3NV0B

Crystal structure and mutational analysis of the nxf2/nxt1 heterodimeric complex from caenorhabditis elegans at 1.84 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
SMKTTQEINKEDEELCNESKKFMDVYYDVMDRKREKIGFLYTQVSNAVWNGNPINGYDSICEFMKALPSTQHDIQSLDAQRLPEGVTGDMSGGMLLNVAGAVTVDGDSKRAFTQTLLLGVEDGKYKVKSDRFRYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the NXF2/NXT1 heterodimeric complex reveals the combined specificity and versatility of the NTF2-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding/protein transport
molecule keywords Nuclear RNA export factor 2
total genus 48
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nv0B00
4HZ9B 3RGAA 1A2KA 3EC9A 3EX9A 1JKGB 3EJVA 1ISKA 1JKGA 2Z76A 3F40A 3DM8A 3FZWA 5CF2A 1IDPA 3CNXA 3F8HA 3OX9A 3F7SA 5DREA 1W02A 3GZBA 5HGRA 5JPPA 3UJMA 1GS3A 5D81A 3HZPA 3E99A 3JUMA 4X2OA 3EBYA 5KP4A 3CNMA 4HM4B 5EVHA 3DMCA 3OWYA 5KP1A 1HKXA 3ECFA 3H51A 3ER7A 2GEYA 3EN8A 3MKIA 2I9WA 2RFRA 2YFJB 5IERA 1DMQA 2XR8B 2BMRB 4HM2B 2R4IA 5DRVA 1OHPA 1OF5B 2GEXA 1NWWA 5AIGA 5TGNA 3FH1A 3LZAA 1TP6A 4KVHA 1ULJB 2XSHB 3T8NA 4LEHA 3EBTA 3D9RA 3RGRA 1K41A 1O7PB 1OHSA 6STDA 3F8XA 5AEWB 2HMJB 3HX8A 1OCVA 4HM3B 4XDVA 1SJWA 2GBWB 3DZLA 1GY5A 4RZMA 1OH0A 2RGQA 1C7HA 4IIAA 5BXQA 2HMKB 1O7HB 1GY7A 1W00A 2HMNB 4Q53A 4R9LA 1Q40B 2F86B 4WYKB 2GXFA 3STDA 4CDLA 5G2GA 1E3VA 4U13A 5D83A 4MJDA 1QMAA 2B1XB 3FKAA 3GRDA 3GZYB 2QGUA 3JUOA 4FCJA 1ZO2A 2YFIB 3MHEA 3NV0B 4HM0B 5AI1A 3KKGA 4L8PA 3BB9A 2BMQB 5AIIA 2QIYA 1JN5A 2STDA 2YFLB 5FW5A 3M8CA 5IEOA 4WP5A 5IG4A 1NDOB 4PEJA 1S5AA 1VZZA 5STDA 4HM6B 5IG3A 3T8UA 4K1VA 3GZRA 3DXOA 1Q42A 2Z7AA 5KP3A 3SEDA 4WWUC 4XBYA 3S5CA 3B4OA 3MG3A 5CLKA 3CPOA 3CU3A 3IPTA 1E3RA 1GYBA 4HVNA 1OHOA 3SOAA 3GWRA 3MG1A 4R1KA 4XBTA 4XDWA 2GBXB 3HK4A 4XBXA 4XM4A 1ULIB 3EQQB 3G16A 3VSYA 5AIFA 1CQSA 3SOYA 5IF6A 1AR0A 3NHXA 2BMOB 2PZVA 2HMMB 2A15A 3NBRA 1O7NB 3BLZA 1O7MB 1QJGA 1JN5B 2JQ5A 2B24B 3A76A 4N3VA 4XB5A 1ASKA 4FCMA 4J9AA 5AEUB 1OGXA 3Q90A 3OWSA 1ZX2A 1BUQA 2XRXB 3FGYA 1Z1SA 2F98A 1GY6A 3FF2A 4OUQA 3VGNA 5BVBA 3MYTA 1UUWB 3JUNA 4GB5A 4L8OA 3DUKA 3G0KA 2HMOB 1DMMA 3WMDA 3NUVA 3OWUA 1JB5A 4HZBB 3G8ZA 5IG0A 5IEPA 1OF5A 1EA2A 1OGZA 2F99A 4HJLB 4LMIA 2INXA 3EF8A 1EG9B 3F7XA 3KSPA 4R9KA 4STDA 4LGQA 5AIHA 3B4PA 1OPYA 3GZXB 4WYKA 3FSDA 1W01A 3F9SA 5CXOA 3B7CA 2BNGA 2IMJA 3I0YA 3OXAA 4H3UA 1O7WB 3MSOA 5IENA 1NU3A 3NM2A 2Z77A 3OV4A 4OVMA 3NXJA 5CF1A 8CHOA 5IG5A 2UX0A 3NV0A 3ROBA 4X2HA 1UUVB 3B8LA 2XSOB 1JB2A 1DMNA 2HMLB 3EN1B 4J8TA 4ORLA 1U5OA 3H3HA 3UNLA 1STDA 3JUPA 4HM8B 4K1UA 4HKVB 1JB4A 7STDA 1WQLB 3FLJA 3KE7A 2W2CA 1Q40A 4I4KA 1OUNA 5JPUA 3KZTA 2RCDA 3K0ZA 3F14A 4HM5B 3FF0A 4L7KA 5D82A 2OWPA 5CK6A 1TUHA 3LYGA 2CHCA 4HM7B 3EHCA 1O7GB 3JUQA 2K54A 1W6YA 3MG2A 4HM1B 2CKFB 3K7CA 1E97A
chains in the Genus database with same CATH superfamily
3AMOA 1WNHA 2FGTA 4HBRA 4HZ9B 1VQK3 1A2KA 2P09A 4MEIA 1ISKA 3I553 3CCS3 1BRHA 2WO0A 3DM8A 1GD4A 1IDPA 1YJ93 4BU4A 1I3FA 5JPPA 1B2XA 1N9JA 1FZUA 4KZ1A 2W04A 1US1A 4X2OA 1D6ZA 4FMAA 1BU4A 1N5HA 3ZFZA 1EEJA 1BVIA 2XFSA 4HYZA 5KP1A 1B27A 4J5GA 4LSOA 1VQM3 1ROVA 5IERA 3CCL3 5BIRA 4O2HA 3OW22 3URPA 3IJEB 4EW5A 2C4BA 3LZAA 1TP6A 3SLUA 4KVHA 2W56A 1D6UA 3D9RA 3HIGA 1X1WA 1T2HA 2ZL8A 6STDA 1X1XA 1RNTA 1D6YA 3HX8A 1BNGA 1OCVA 4FMBA 4XDVA 1RSNA 5ELJA 4EYCA 2BIRA 1NO3A 1VQ43 3SVAA 1GSPA 1UI8A 1C7HA 1LNHA 3CC73 1STFI 1T3BA 1O7HB 1RRLA 2HMKB 3STDA 1TJDA 3DGLA 1Q40B 4R9LA 4WYKB 2Y74A 1FW7A 1MWSA 2CWTA 2WOHA 4IPBA 1LRAA 4ILFA 1IQYA 1M1XB 3FKAA 4U13A 1W4NA 5AI1A 4HM0B 1NJI4 2YFIB 3MHEA 1W5ZA 3CC43 2H0GA 3BB9A 2BMQB 5AIIA 1RN4A 2AADA 1JN5A 1V74A 1W6GA 2C10A 2YFLB 4KT3B 3KIIA 2W6JH 1LOVA 4CCVA 5AYSC 1Q9EA 1IVVA 3T8UA 5M1AA 5KP3A 3LTAA 1BNEA 4WWUC 1RLSA 2JDIH 3CPOA 1E3RA 1BSCA 5EEOA 1GYBA 2K54A 1OHOA 1T5YA 2W0QA 3LMLA 1I0VA 4R1KA 4XDWA 4XBXA 3BNCA 4QWTA 2D42A 4LZIA 1IVUA 5AIFA 5IF6A 1WMOA 1AR0A 3D3LA 2PZVA 2A15A 3K5TA 1BNJA 2F4YA 1JN5B 4FCMA 5AEUB 2SBLA 3Q90A 3CPW2 1ZX2A 1ZS7A 2O3OA 2F98A 1AY7A 2KF6A 3FF2A 1GOVA 3O8YA 1K9M4 1FGRA 4WHAA 2CH9A 4L8OA 1FGOA 1BANA 4CJNA 4EXRA 1DMMA 3NUVA 1G96A 4HZBB 2ML5A 1EA2A 1HYFA 1W2ZA 3AGOA 3WOEB 2F5MA 5G1KA 4J5KA 3EF8A 1VQ73 4G1MB 4R9KA 5AIHA 3FG3A 3B4PA 4FMCA 1UCIA 4TX4A 3F9SA 2UGIA 1RJOA 4H3UA 2BNGA 3I0YA 2WOFA 3Q2PA 1R4CA 1V57A 2Z77A 3OV4A 3NXJA 2UX0A 5JBSA 4HAAA 1JV2B 1LOWA 1MGRA 7RNTA 1U5OA 3UNLA 3JUPA 4HM8B 1SIHA 3X3XA 1DETA 2KCDA 1QAKA 2W2CA 3D5GA 1OUNA 3D4AA 3DGOA 3IMAB 4I4KA 2RCDA 2W03A 3K0ZA 2OQEA 2CFKA 3FF0A 1BIRA 4KFFA 3DY5A 5CK6A 1SARA 1YGEA 2K0MA 1O7GB 3MYTA 2OWPA 1BNRA 2CKFB 2D1WA 3CCE3 2CC3A 1BRNL 2FXTA 4AKYA 4AEQA 2Z76A 3F40A 2ZA4A 3FZWA 3KCHA 5CF2A 3CNXA 3OX9A 3DGMA 1WTHA 1IK3A 3JVCA 1I3IA 1UCKA 1PYLA 2IA7A 5BU4A 3JUMA 3WODG 1EUIC 8RNTA 2CK3H 2E2UA 3DMCA 3OWYA 3ECFA 2OQEC 3ER7A 3V99A 3EN8A 3MKIA 3CCQ3 1Q7Y4 2CX0A 4N6V0 1SIIA 2R4IA 3CD63 1OHPA 2GU3A 3NQYA 1NWWA 1YHQ3 1AQZA 1BSDA 3FH1A 2QEX3 2XEPA 4BIRA 1BSAA 3EBTA 3D79A 3RGRA 3UL6A 5AEWB 3KFQC 2XH9A 1UGHI 4NHFA 2XGNA 4N6LA 3SXXA 5AYRB 4RNTA 1N8R4 3MPHA 4IIAA 2P05A 5BXQA 4Q53A 1SQWA 5G2GA 1WMNA 1I8VA 5GSPA 2WGOA 5D83A 4KFDA 3GZYB 1AVLA 2KAAA 2O9UX 1VQ93 2W56B 1RGAA 4L8PA 2W9QA 1A2VA 2CWUA 3M8CA 4R80A 1NDOB 1PY3A 5STDA 3V98A 2R41A 1TRPA 3GZRA 1Q42A 2Z7AA 1RDSA 4XBYA 1UW1A 3S5CA 1UCLA 2GU1A 5CLKA 1FUSA 3CU3A 1BNFA 4HVNA 4BTYA 3CCV3 1BRSA 1GOUA 1U8CB 3L0RA 4XBTA 4XM4A 1MGWA 3EQQB 1IT7A 3G16A 2CIUA 3LT9A 2H0IA 1A90A 1JBRA 3HOHA 3SOYA 3BNEA 3NHXA 4OUQA 1NNVA 2OTJ3 3NBRA 3BLZA 1RGEA 1PU4A 3DGNA 4XB5A 1ASKA 1TFKA 1RGKA 1OGXA 3OWSA 3I563 1EQKA 2BT3A 1BUQA 2XRXB 1CH0A 4O3VA 3G713 3FG1A 1BAOA 3U97A 3VGNA 1YVSA 6RNTA 3JUNA 4WFOA 5ELUA 3DUKA 3RDEA 3CCU3 3DGYA 3WA2X 1TIJA 2UUGC 1JB5A 3Q1CA 3G8ZA 2FNQA 3X3YA 3LTDA 1YIJ3 1M904 1MWTA 1VQP3 1SPUA 2INXA 3UJMA 3F7XA 1QVG2 2L4VA 4LGQA 1OPYA 1FUWA 1BRGA 5CXOA 2KRTA 1BUJA 3AGNA 2IMJA 1NB5I 3OXAA 5IENA 1HU9A 1BRJA 3MSOA 5LC7A 4EBGA 5CF1A 3NQZA 3QRDA 1IQXA 1YIT3 1KD14 2OOVC 4X2HA 1VQQA 3PCRA 3WR2A 3U1WA 1WQLB 3CME3 2C11A 1Q40A 3X41A 1PFPA 3KZTA 1CYVA 1IT8A 2P0MA 4JRFA 3X3ZA 4L7KA 5D82A 4N6NB 3CCM3 1RGGA 1TUHA 3LYGA 4HM7B 1TRQA 3EHCA 4NREA 1GOYA 1BNSA 2CW9A 3JUQA 2W9PA 2ZHXB 3MG2A 1RNBA 1CEWI 3N54B 1IV7A 1JBTA 2K3DA 5EQLA 3EC9A 4HOHA 3EJVA 2OOVA 1M1K4 1JKGA 5DREA 4O02B 1BRIA 3F7SA 3LTCA 3GZBA 5HGRA 3WOFB 3CXC2 3CCR3 4RNZA 1ROAA 3VF1A 3MWZA 1GS3A 3HZPA 3E99A 1S723 3LOYA 3EBYA 3CNMA 4HM4B 5EVHA 3N9HA 4EV5A 1B2ZA 2LYXA 4KFEA 2GEYA 3PS8A 1K734 1JBSA 2RFRA 2Q07A 3GAXA 2CFGA 2XR8B 1GMPA 2HOHA 5DRVA 1DE3A 1LQMB 2GEXA 5AIGA 5TGNA 1BGSA 1VQ63 1TTOA 1A2PA 3ZG5A 3GSPA 3S28A 4AKZA 1ULJB 2XF3A 1RMSA 1JZOA 1UI7A 1LNIA 1K41A 1O7PB 2J8XB 4MMXB 1FGTA 1RGFA 1V58A 3F8XA 1BSEA 1SJWA 1I70A 2GBWB 1J2BA 1I2GA 1RTUA 1GY5A 1DVDA 3TDGA 1FGQA 1IVXA 2P0XA 1B3SA 4FR9A 1CYUA 3Q3FA 2HMNB 3AHWA 3AHSA 4I5QA 1RCLA 1UDII 1E3VA 1LQGC 3T0UA 1N5PA 4MJDA 1FUTA 4FCJA 1F8NA 3NV0B 1W7CA 3NX0A 2E2VA 1VQ53 1G0TA 3KKGA 1YI23 1VQL3 2Y73A 2L1SA 4N6TA 2QIYA 4RBNA 9RNTA 2E2TA 5IG4A 1MWUA 4WP5A 4PEJA 1VZZA 3UB1A 4EC6A 5A0OB 5IG3A 2BU4A 3WDGB 3DXOA 5LC6A 3SEDA 1IU7A 1OACA 1X1UA 3MG3A 3IPTA 1Q814 3S67A 3GWRA 3AMOB 3HK4A 5FGOA 1KSIA 1C54A 3G6E3 3BNBA 2Z6BA 5I97A 1RN7A 2M7OA 3RNTA 4BL2A 2BMOB 1BOXA 2WGQA 2OTL3 4FCZA 1O7NB 1O7MB 3A76A 1NB3I 4N3VA 2B24B 3S27A 3LTBA 4J9AA 3ALAA 4GL6A 4R4KA 4MMZB 4OK0A 4LYLB 3SX1A 3FGYA 1GMQA 1N9EA 3DH2A 1GY6A 3LXUX 3NBJA 4GB5A 3NBBA 1QALA 2HMOB 3WMDA 1ZGXA 2OCTA 1WMPA 5IEPA 1OF5A 1Q864 1OGZA 1UCJA 2F99A 4LMIA 1Y4KA 4K61A 1IYYA 1GMRA 2SARA 4MMYB 3FSDA 3X40A 4BTWA 2RNTA 1YJN3 1BSBA 4OVMA 3K9MC 4N6OB 3PCSA 3ROBA 1UUVB 4O8SA 1BRKA 1JB2A 3KSED 1W2B2 3HIIA 1JB4A 7STDA 5M19A 1Q824 3PXMA 3CC23 2F56A 3F14A 4HM5B 7GSPA 4RNYA 2CHCA 3HI7A 4HM1B 3A5EA 1Q7HA 1E97A 4N6UA 2BO9B 3RGAA 3BU4A 3EX9A 1JKGB 5IW9A 1VQN3 2QA43 4BL3A 3FCSB 5HOHA 3F8HA 3SYUA 3CMA3 1MNLA 1DVCA 1I2EA 1W02A 2KXGA 3FG4A 1I0XA 2ZDJA 6GSPA 5RNTA 2MF7A 1JRQA 5D81A 4CPKA 2YX9A 5KP4A 1LXEA 2XFTA 1B2UA 1HKXA 3CCJ3 1TFOA 3H51A 2H0HA 2I9WA 2YFJB 1L5GB 4ZM8A 3J7Yd 1DMQA 2BMRB 1RCKA 4HM2B 3PYJA 1IVWA 4GSPA 1GD3A 1OF5B 4N6MA 2KF5A 2RSXA 5G1LA 1AV4A 2XSHB 4FMDA 4LEHA 3T8NA 3G4S3 1OHSA 2XGLA 1VQO3 1KQS2 2HMJB 1UUGB 4IT7A 3X42A 4HM3B 3DZLA 1RGLA 1FYSA 4BTXA 2CFLA 2V1LA 4RZMA 1OH0A 1YVBI 2CFWA 3PZWA 1YNVX 2CX1A 2RGQA 2CG1A 1YGWA 1GY7A 1RHLA 1W00A 1MOLA 1B2MA 4CDLA 2F86B 2GXFA 4GHOA 1KC84 1R4YA 1B2SA 1LOYA 1QMAA 2B1XB 3GRDA 5IG5A 2QGUA 2LQVA 3JUOA 1DYUA 1ZO2A 1EKMA 3S29A 3V92A 3UL5A 2IUJA 2IYJA 2CFDA 3KN4A 2STDA 5FW5A 5IEOA 1LVNA 1N8QA 1S5AA 2MC8A 1RGCA 4HM6B 1HZ1A 4K1VA 1RGHA 1K28A 1JJ22 3B4OA 3WHOA 5M18A 3EB8A 3EE1A 3MG1A 3QK9A 2AAEA 2GBXB 2CWVA 1ULIB 1JNQA 3D5IA 3VSYA 2IY2A 1IV9A 1CQSA 1JZDA 4DKIA 2JQ5A 1QJGA 2RBIA 1K8A4 4K90B 1TU5A 1Z1SA 1AVKA 3LT8A 2PNCA 3N8BA 1G02A 1RN1A 1UUWB 5BVBA 2F5WA 1W6CA 4NPBA 1QVF2 3G0KA 1UGIA 1LOXA 3OWUA 3LH4A 5IG0A 3WA3A 2KF3A 2ML6A 1FGMA 4HJLB 4STDA 2KF4A 3ZG0A 1EG9B 3KSPA 3PGBA 1FA3A 3GZXB 4WYKA 1IQ8A 1W01A 1T2IA 1MWRA 3B7CA 1O7WB 3K63A 1NU3A 3NM2A 1I2FA 8CHOA 1B20A 3NV0A 3SOAA 3B8LA 2P38A 2XSOB 1DMNA 1X1YA 2HMLB 3EN1B 4H61A 4J8TA 4ORLA 3H3HA 1STDA 4K1UA 4HKVB 3BIRA 3FLJA 2BHMA 3KE7A 4EV2A 2IUKA 5JPUA 1YJW3 1VQ83 1RRHA 1M9GA 4JF8A 1A67A 2CG0A 3NM7A 1QAFA 1BNIA 2GSPA 1RKYA 1KWIA 1W6YA 1B21A 3BNDA 3K7CA 2HMMB
chains in the Genus database with same CATH topology
3AMOA 1WNHA 2FGTA 4HBRA 4HZ9B 1VQK3 1A2KA 2P09A 4MEIA 1ISKA 3I553 3CCS3 2WO0A 3DM8A 1GD4A 1IDPA 1YJ93 5JPPA 1N9JA 4KZ1A 2W04A 1US1A 4X2OA 1D6ZA 4FMAA 1N5HA 2XFSA 4HYZA 5KP1A 4LSOA 1VQM3 1ROVA 5IERA 3CCL3 4O2HA 3OW22 3IJEB 3LZAA 1TP6A 3SLUA 4KVHA 2W56A 1D6UA 3D9RA 3HIGA 2ZL8A 6STDA 1D6YA 3HX8A 1OCVA 4FMBA 4XDVA 5ELJA 4EYCA 1NO3A 1VQ43 3SVAA 1UI8A 1C7HA 1LNHA 3CC73 1STFI 2HMKB 1O7HB 1RRLA 2OTJ3 3STDA 4R9LA 3DGLA 1Q40B 4WYKB 2Y74A 2CWTA 2WOHA 4IPBA 4U13A 1IQYA 1M1XB 3FKAA 1W4NA 5AI1A 4HM0B 1NJI4 2YFIB 3MHEA 1W5ZA 3CC43 3BB9A 2BMQB 5AIIA 4AEQA 1JN5A 1V74A 1W6GA 2C10A 2YFLB 3KIIA 2W6JH 4CCVA 5AYSC 3T8UA 1IVVA 5KP3A 3LTAA 4WWUC 2JDIH 3CPOA 1E3RA 5EEOA 1GYBA 2W0QA 1OHOA 1T5YA 3LMLA 4R1KA 4XDWA 4XBXA 3BNCA 4QWTA 2D42A 4LZIA 1IVUA 5AIFA 5IF6A 1WMOA 1AR0A 3D3LA 2PZVA 2A15A 3K5TA 1JN5B 4FCMA 5AEUB 2SBLA 3Q90A 3CPW2 1ZX2A 2O3OA 2F98A 3FF2A 3O8YA 1K9M4 1FGRA 4WHAA 2CH9A 4L8OA 1FGOA 4EXRA 1DMMA 3NUVA 1G96A 4HZBB 2ML5A 1EA2A 1W2ZA 3WOEB 3EF8A 1VQ73 4G1MB 4R9KA 5AIHA 3FG3A 3B4PA 4FMCA 4TX4A 3F9SA 1RJOA 4H3UA 2BNGA 3I0YA 2WOFA 3Q2PA 1R4CA 2Z77A 3OV4A 3NXJA 2UX0A 5JBSA 1JV2B 1U5OA 3UNLA 3JUPA 4HM8B 1SIHA 3X3XA 2KCDA 1QAKA 2W2CA 3IMAB 1OUNA 3DGOA 4I4KA 2RCDA 2W03A 3K0ZA 2OQEA 2CFKA 3FF0A 4KFFA 3DY5A 5CK6A 1YGEA 2K0MA 1O7GB 3MYTA 2OWPA 2CKFB 2D1WA 3CCE3 2CC3A 2FXTA 4AKYA 2Z76A 3F40A 3FZWA 5CF2A 1IK3A 3CNXA 3OX9A 3DGMA 1WTHA 3JVCA 2IA7A 3JUMA 3WODG 2CK3H 2E2UA 3DMCA 3OWYA 3ECFA 2OQEC 3ER7A 3V99A 3EN8A 3MKIA 3CCQ3 1Q7Y4 4N6V0 1SIIA 2R4IA 3CD63 1OHPA 2GU3A 3NQYA 1NWWA 1YHQ3 3FH1A 2QEX3 2XEPA 3EBTA 3RGRA 3UL6A 5AEWB 3KFQC 2XH9A 4NHFA 2XGNA 4N6LA 3SXXA 5AYRB 1N8R4 3MPHA 4IIAA 2P05A 5BXQA 4Q53A 1SQWA 5G2GA 1WMNA 2WGOA 5D83A 4KFDA 3GZYB 1AVLA 2O9UX 1VQ93 2W56B 4L8PA 2W9QA 1A2VA 2CWUA 3M8CA 4R80A 1NDOB 5STDA 3V98A 3GZRA 1Q42A 2Z7AA 4XBYA 1UW1A 3S5CA 2GU1A 5CLKA 3CU3A 1KWIA 4HVNA 4BTYA 3CCV3 1U8CB 3L0RA 4XBTA 4XM4A 3EQQB 1IT7A 3G16A 2CIUA 3LT9A 1A90A 3SOYA 3BNEA 3NHXA 4OUQA 3NBRA 3BLZA 1PU4A 3DGNA 4XB5A 1ASKA 1TFKA 1OGXA 3OWSA 3I563 1EQKA 2BT3A 1BUQA 2XRXB 4O3VA 3G713 3FG1A 3U97A 3VGNA 3JUNA 4WFOA 5ELUA 3DUKA 3RDEA 3CCU3 3WA2X 1TIJA 1JB5A 3Q1CA 3G8ZA 2FNQA 3X3YA 3LTDA 1YIJ3 1M904 1VQP3 1SPUA 2INXA 3UJMA 3F7XA 1QVG2 2L4VA 4LGQA 1OPYA 1FUWA 5CXOA 2KRTA 2IMJA 1NB5I 3OXAA 5IENA 1HU9A 3MSOA 5LC7A 4EBGA 5CF1A 3NQZA 3QRDA 1IQXA 1YIT3 1KD14 2OOVC 4X2HA 3PCRA 3U1WA 1WQLB 3CME3 2C11A 1Q40A 3X41A 1PFPA 3KZTA 1CYVA 1IT8A 2P0MA 4JRFA 3X3ZA 4L7KA 5D82A 4N6NB 3CCM3 1TUHA 3LYGA 4HM7B 4NREA 3EHCA 2CW9A 3JUQA 2W9PA 3MG2A 1CEWI 3N54B 1IV7A 5EQLA 3EC9A 2OOVA 3EJVA 1M1K4 1JKGA 5DREA 4O02B 3F7SA 3LTCA 3GZBA 5HGRA 3WOFB 3CXC2 3CCR3 4RNZA 1ROAA 3VF1A 3MWZA 1GS3A 3HZPA 3E99A 1S723 3LOYA 3EBYA 3CNMA 4HM4B 5EVHA 3N9HA 4EV5A 2LYXA 4KFEA 2GEYA 3PS8A 1K734 2RFRA 2Q07A 3GAXA 2CFGA 2XR8B 5DRVA 2GEXA 5AIGA 5TGNA 1VQ63 4AKZA 3S28A 1ULJB 2XF3A 1UI7A 1K41A 1O7PB 4MMXB 1FGTA 3F8XA 1SJWA 2GBWB 1J2BA 1GY5A 1DVDA 3TDGA 1FGQA 1IVXA 2P0XA 4FR9A 1CYUA 2HMNB 1E3VA 3T0UA 1N5PA 4MJDA 4FCJA 1F8NA 3NV0B 1W7CA 3NX0A 2E2VA 1VQ53 3KKGA 1YI23 1VQL3 2Y73A 4N6TA 2QIYA 4RBNA 2E2TA 5IG4A 4WP5A 4PEJA 1VZZA 3UB1A 4EC6A 5A0OB 5IG3A 3WDGB 3DXOA 5LC6A 3SEDA 1IU7A 1OACA 3MG3A 3IPTA 1Q814 3S67A 3GWRA 3AMOB 3HK4A 5FGOA 1KSIA 3G6E3 3BNBA 2Z6BA 5I97A 1RN7A 2M7OA 2BMOB 2OTL3 2WGQA 4FCZA 1O7NB 1O7MB 3A76A 1NB3I 4N3VA 2B24B 3S27A 3LTBA 4J9AA 3ALAA 4GL6A 4R4KA 4MMZB 4OK0A 3SX1A 3FGYA 1N9EA 3LXUX 1GY6A 3NBJA 4GB5A 3NBBA 1QALA 2HMOB 3WMDA 2OCTA 1WMPA 5IEPA 1OF5A 1Q864 1OGZA 2F99A 4LMIA 1Y4KA 4K61A 4MMYB 3FSDA 3X40A 4BTWA 1YJN3 4OVMA 3K9MC 4N6OB 3PCSA 3ROBA 1UUVB 4O8SA 1JB2A 3KSED 1W2B2 3HIIA 1JB4A 7STDA 1Q824 3PXMA 3CC23 3F14A 4HM5B 4RNYA 2CHCA 3HI7A 4HM1B 1E97A 4N6UA 2BO9B 3RGAA 3EX9A 1JKGB 5IW9A 1VQN3 2QA43 3FCSB 3F8HA 3CMA3 1MNLA 1DVCA 1W02A 2KXGA 3FG4A 2ZDJA 2MF7A 1JRQA 5D81A 2YX9A 5KP4A 1LXEA 2XFTA 3CCJ3 1HKXA 1TFOA 3H51A 2I9WA 2YFJB 1L5GB 4ZM8A 3J7Yd 1DMQA 2BMRB 4HM2B 3PYJA 1IVWA 1GD3A 1OF5B 4N6MA 2RSXA 1AV4A 2XSHB 4FMDA 4LEHA 3T8NA 3G4S3 1OHSA 2XGLA 1VQO3 1KQS2 2HMJB 3X42A 4IT7A 4HM3B 3DZLA 4BTXA 2CFLA 2V1LA 4RZMA 1OH0A 1YVBI 2CFWA 3PZWA 2RGQA 2CG1A 1GY7A 1W00A 1MOLA 4CDLA 2F86B 2GXFA 1KC84 1QMAA 2B1XB 3GRDA 5IG5A 2QGUA 2LQVA 3JUOA 1DYUA 1ZO2A 1EKMA 3S29A 3V92A 3UL5A 2IUJA 2CFDA 3KN4A 2STDA 5FW5A 5IEOA 1LVNA 1N8QA 1S5AA 2MC8A 4HM6B 4K1VA 1K28A 1JJ22 3B4OA 3EB8A 3EE1A 3MG1A 3QK9A 2GBXB 2CWVA 1ULIB 1JNQA 3VSYA 1IV9A 1CQSA 2JQ5A 1QJGA 1K8A4 4K90B 1TU5A 1Z1SA 1AVKA 3LT8A 2PNCA 3N8BA 5BVBA 1UUWB 1W6CA 1QVF2 3G0KA 1LOXA 3OWUA 3LH4A 5IG0A 3WA3A 2ML6A 1FGMA 4HJLB 4STDA 1EG9B 3KSPA 3PGBA 1FA3A 3GZXB 4WYKA 1IQ8A 1W01A 3B7CA 1O7WB 3K63A 1NU3A 3NM2A 8CHOA 3NV0A 3SOAA 3B8LA 2P38A 2XSOB 1DMNA 2HMLB 3EN1B 4H61A 4J8TA 4ORLA 3H3HA 1STDA 4K1UA 4HKVB 3FLJA 2BHMA 3KE7A 4EV2A 2IUKA 5JPUA 1YJW3 1VQ83 1RRHA 1M9GA 4JF8A 1A67A 2CG0A 3NM7A 1QAFA 1RKYA 2K54A 1W6YA 3BNDA 3K7CA 2HMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZ9 B;  3RGA A;  1A2K A;  3EC9 A;  3EX9 A;  1JKG B;  3EJV A;  1ISK A;  1JKG A;  2Z76 A;  3F40 A;  3DM8 A;  3FZW A;  5CF2 A;  1IDP A;  3CNX A;  3F8H A;  3OX9 A;  3F7S A;  5DRE A;  1W02 A;  3GZB A;  5HGR A;  5JPP A;  3UJM A;  1GS3 A;  5D81 A;  3HZP A;  3E99 A;  3JUM A;  4X2O A;  3EBY A;  5KP4 A;  3CNM A;  4HM4 B;  5EVH A;  3DMC A;  3OWY A;  5KP1 A;  1HKX A;  3ECF A;  3H51 A;  3ER7 A;  2GEY A;  3EN8 A;  3MKI A;  2I9W A;  2RFR A;  2YFJ B;  5IER A;  1DMQ A;  2XR8 B;  2BMR B;  4HM2 B;  2R4I A;  5DRV A;  1OHP A;  1OF5 B;  2GEX A;  1NWW A;  5AIG A;  5TGN A;  3FH1 A;  3LZA A;  1TP6 A;  4KVH A;  1ULJ B;  2XSH B;  3T8N A;  4LEH A;  3EBT A;  3D9R A;  3RGR A;  1K41 A;  1O7P B;  1OHS A;  6STD A;  3F8X A;  5AEW B;  2HMJ B;  3HX8 A;  1OCV A;  4HM3 B;  4XDV A;  1SJW A;  2GBW B;  3DZL A;  1GY5 A;  4RZM A;  1OH0 A;  2RGQ A;  1C7H A;  4IIA A;  5BXQ A;  2HMK B;  1O7H B;  1GY7 A;  1W00 A;  2HMN B;  4Q53 A;  4R9L A;  1Q40 B;  2F86 B;  4WYK B;  2GXF A;  3STD A;  4CDL A;  5G2G A;  1E3V A;  4U13 A;  5D83 A;  4MJD A;  1QMA A;  2B1X B;  3FKA A;  3GRD A;  3GZY B;  2QGU A;  3JUO A;  4FCJ A;  1ZO2 A;  2YFI B;  3MHE A;  3NV0 B;  4HM0 B;  5AI1 A;  3KKG A;  4L8P A;  3BB9 A;  2BMQ B;  5AII A;  2QIY A;  1JN5 A;  2STD A;  2YFL B;  5FW5 A;  3M8C A;  5IEO A;  4WP5 A;  5IG4 A;  1NDO B;  4PEJ A;  1S5A A;  1VZZ A;  5STD A;  4HM6 B;  5IG3 A;  3T8U A;  4K1V A;  3GZR A;  3DXO A;  1Q42 A;  2Z7A A;  5KP3 A;  3SED A;  4WWU C;  4XBY A;  3S5C A;  3B4O A;  3MG3 A;  5CLK A;  3CPO A;  3CU3 A;  3IPT A;  1E3R A;  1GYB A;  4HVN A;  1OHO A;  3SOA A;  3GWR A;  3MG1 A;  4R1K A;  4XBT A;  4XDW A;  2GBX B;  3HK4 A;  4XBX A;  4XM4 A;  1ULI B;  3EQQ B;  3G16 A;  3VSY A;  5AIF A;  1CQS A;  3SOY A;  5IF6 A;  1AR0 A;  3NHX A;  2BMO B;  2PZV A;  2HMM B;  2A15 A;  3NBR A;  1O7N B;  3BLZ A;  1O7M B;  1QJG A;  1JN5 B;  2JQ5 A;  2B24 B;  3A76 A;  4N3V A;  4XB5 A;  1ASK A;  4FCM A;  4J9A A;  5AEU B;  1OGX A;  3Q90 A;  3OWS A;  1ZX2 A;  1BUQ A;  2XRX B;  3FGY A;  1Z1S A;  2F98 A;  1GY6 A;  3FF2 A;  4OUQ A;  3VGN A;  5BVB A;  3MYT A;  1UUW B;  3JUN A;  4GB5 A;  4L8O A;  3DUK A;  3G0K A;  2HMO B;  1DMM A;  3WMD A;  3NUV A;  3OWU A;  1JB5 A;  4HZB B;  3G8Z A;  5IG0 A;  5IEP A;  1OF5 A;  1EA2 A;  1OGZ A;  2F99 A;  4HJL B;  4LMI A;  2INX A;  3EF8 A;  1EG9 B;  3F7X A;  3KSP A;  4R9K A;  4STD A;  4LGQ A;  5AIH A;  3B4P A;  1OPY A;  3GZX B;  4WYK A;  3FSD A;  1W01 A;  3F9S A;  5CXO A;  3B7C A;  2BNG A;  2IMJ A;  3I0Y A;  3OXA A;  4H3U A;  1O7W B;  3MSO A;  5IEN A;  1NU3 A;  3NM2 A;  2Z77 A;  3OV4 A;  4OVM A;  3NXJ A;  5CF1 A;  8CHO A;  5IG5 A;  2UX0 A;  3NV0 A;  3ROB A;  4X2H A;  1UUV B;  3B8L A;  2XSO B;  1JB2 A;  1DMN A;  2HML B;  3EN1 B;  4J8T A;  4ORL A;  1U5O A;  3H3H A;  3UNL A;  1STD A;  3JUP A;  4HM8 B;  4K1U A;  4HKV B;  1JB4 A;  7STD A;  1WQL B;  3FLJ A;  3KE7 A;  2W2C A;  1Q40 A;  4I4K A;  1OUN A;  5JPU A;  3KZT A;  2RCD A;  3K0Z A;  3F14 A;  4HM5 B;  3FF0 A;  4L7K A;  5D82 A;  2OWP A;  5CK6 A;  1TUH A;  3LYG A;  2CHC A;  4HM7 B;  3EHC A;  1O7G B;  3JUQ A;  2K54 A;  1W6Y A;  3MG2 A;  4HM1 B;  2CKF B;  3K7C A;  1E97 A; 
#chains in the Genus database with same CATH topology
 3AMO A;  1WNH A;  2FGT A;  4HBR A;  4HZ9 B;  1VQK 3;  1A2K A;  2P09 A;  4MEI A;  1ISK A;  3I55 3;  3CCS 3;  1BRH A;  2WO0 A;  3DM8 A;  1GD4 A;  1IDP A;  1YJ9 3;  4BU4 A;  1I3F A;  5JPP A;  1B2X A;  1N9J A;  1FZU A;  4KZ1 A;  2W04 A;  1US1 A;  4X2O A;  1D6Z A;  4FMA A;  1BU4 A;  1N5H A;  3ZFZ A;  1EEJ A;  1BVI A;  2XFS A;  4HYZ A;  5KP1 A;  1B27 A;  4J5G A;  4LSO A;  1VQM 3;  1ROV A;  5IER A;  3CCL 3;  5BIR A;  4O2H A;  3OW2 2;  3URP A;  3IJE B;  4EW5 A;  2C4B A;  3LZA A;  1TP6 A;  3SLU A;  4KVH A;  2W56 A;  1D6U A;  3D9R A;  3HIG A;  1X1W A;  1T2H A;  2ZL8 A;  6STD A;  1X1X A;  1RNT A;  1D6Y A;  3HX8 A;  1BNG A;  1OCV A;  4FMB A;  4XDV A;  1RSN A;  5ELJ A;  4EYC A;  2BIR A;  1NO3 A;  1VQ4 3;  3SVA A;  1GSP A;  1UI8 A;  1C7H A;  1LNH A;  3CC7 3;  1STF I;  1T3B A;  1O7H B;  1RRL A;  2HMK B;  3STD A;  1TJD A;  3DGL A;  1Q40 B;  4R9L A;  4WYK B;  2Y74 A;  1FW7 A;  1MWS A;  2CWT A;  2WOH A;  4IPB A;  1LRA A;  4ILF A;  1IQY A;  1M1X B;  3FKA A;  4U13 A;  1W4N A;  5AI1 A;  4HM0 B;  1NJI 4;  2YFI B;  3MHE A;  1W5Z A;  3CC4 3;  2H0G A;  3BB9 A;  2BMQ B;  5AII A;  1RN4 A;  2AAD A;  1JN5 A;  1V74 A;  1W6G A;  2C10 A;  2YFL B;  4KT3 B;  3KII A;  2W6J H;  1LOV A;  4CCV A;  5AYS C;  1Q9E A;  1IVV A;  3T8U A;  5M1A A;  5KP3 A;  3LTA A;  1BNE A;  4WWU C;  1RLS A;  2JDI H;  3CPO A;  1E3R A;  1BSC A;  5EEO A;  1GYB A;  2K54 A;  1OHO A;  1T5Y A;  2W0Q A;  3LML A;  1I0V A;  4R1K A;  4XDW A;  4XBX A;  3BNC A;  4QWT A;  2D42 A;  4LZI A;  1IVU A;  5AIF A;  5IF6 A;  1WMO A;  1AR0 A;  3D3L A;  2PZV A;  2A15 A;  3K5T A;  1BNJ A;  2F4Y A;  1JN5 B;  4FCM A;  5AEU B;  2SBL A;  3Q90 A;  3CPW 2;  1ZX2 A;  1ZS7 A;  2O3O A;  2F98 A;  1AY7 A;  2KF6 A;  3FF2 A;  1GOV A;  3O8Y A;  1K9M 4;  1FGR A;  4WHA A;  2CH9 A;  4L8O A;  1FGO A;  1BAN A;  4CJN A;  4EXR A;  1DMM A;  3NUV A;  1G96 A;  4HZB B;  2ML5 A;  1EA2 A;  1HYF A;  1W2Z A;  3AGO A;  3WOE B;  2F5M A;  5G1K A;  4J5K A;  3EF8 A;  1VQ7 3;  4G1M B;  4R9K A;  5AIH A;  3FG3 A;  3B4P A;  4FMC A;  1UCI A;  4TX4 A;  3F9S A;  2UGI A;  1RJO A;  4H3U A;  2BNG A;  3I0Y A;  2WOF A;  3Q2P A;  1R4C A;  1V57 A;  2Z77 A;  3OV4 A;  3NXJ A;  2UX0 A;  5JBS A;  4HAA A;  1JV2 B;  1LOW A;  1MGR A;  7RNT A;  1U5O A;  3UNL A;  3JUP A;  4HM8 B;  1SIH A;  3X3X A;  1DET A;  2KCD A;  1QAK A;  2W2C A;  3D5G A;  1OUN A;  3D4A A;  3DGO A;  3IMA B;  4I4K A;  2RCD A;  2W03 A;  3K0Z A;  2OQE A;  2CFK A;  3FF0 A;  1BIR A;  4KFF A;  3DY5 A;  5CK6 A;  1SAR A;  1YGE A;  2K0M A;  1O7G B;  3MYT A;  2OWP A;  1BNR A;  2CKF B;  2D1W A;  3CCE 3;  2CC3 A;  1BRN L;  2FXT A;  4AKY A;  4AEQ A;  2Z76 A;  3F40 A;  2ZA4 A;  3FZW A;  3KCH A;  5CF2 A;  3CNX A;  3OX9 A;  3DGM A;  1WTH A;  1IK3 A;  3JVC A;  1I3I A;  1UCK A;  1PYL A;  2IA7 A;  5BU4 A;  3JUM A;  3WOD G;  1EUI C;  8RNT A;  2CK3 H;  2E2U A;  3DMC A;  3OWY A;  3ECF A;  2OQE C;  3ER7 A;  3V99 A;  3EN8 A;  3MKI A;  3CCQ 3;  1Q7Y 4;  2CX0 A;  4N6V 0;  1SII A;  2R4I A;  3CD6 3;  1OHP A;  2GU3 A;  3NQY A;  1NWW A;  1YHQ 3;  1AQZ A;  1BSD A;  3FH1 A;  2QEX 3;  2XEP A;  4BIR A;  1BSA A;  3EBT A;  3D79 A;  3RGR A;  3UL6 A;  5AEW B;  3KFQ C;  2XH9 A;  1UGH I;  4NHF A;  2XGN A;  4N6L A;  3SXX A;  5AYR B;  4RNT A;  1N8R 4;  3MPH A;  4IIA A;  2P05 A;  5BXQ A;  4Q53 A;  1SQW A;  5G2G A;  1WMN A;  1I8V A;  5GSP A;  2WGO A;  5D83 A;  4KFD A;  3GZY B;  1AVL A;  2KAA A;  2O9U X;  1VQ9 3;  2W56 B;  1RGA A;  4L8P A;  2W9Q A;  1A2V A;  2CWU A;  3M8C A;  4R80 A;  1NDO B;  1PY3 A;  5STD A;  3V98 A;  2R41 A;  1TRP A;  3GZR A;  1Q42 A;  2Z7A A;  1RDS A;  4XBY A;  1UW1 A;  3S5C A;  1UCL A;  2GU1 A;  5CLK A;  1FUS A;  3CU3 A;  1BNF A;  4HVN A;  4BTY A;  3CCV 3;  1BRS A;  1GOU A;  1U8C B;  3L0R A;  4XBT A;  4XM4 A;  1MGW A;  3EQQ B;  1IT7 A;  3G16 A;  2CIU A;  3LT9 A;  2H0I A;  1A90 A;  1JBR A;  3HOH A;  3SOY A;  3BNE A;  3NHX A;  4OUQ A;  1NNV A;  2OTJ 3;  3NBR A;  3BLZ A;  1RGE A;  1PU4 A;  3DGN A;  4XB5 A;  1ASK A;  1TFK A;  1RGK A;  1OGX A;  3OWS A;  3I56 3;  1EQK A;  2BT3 A;  1BUQ A;  2XRX B;  1CH0 A;  4O3V A;  3G71 3;  3FG1 A;  1BAO A;  3U97 A;  3VGN A;  1YVS A;  6RNT A;  3JUN A;  4WFO A;  5ELU A;  3DUK A;  3RDE A;  3CCU 3;  3DGY A;  3WA2 X;  1TIJ A;  2UUG C;  1JB5 A;  3Q1C A;  3G8Z A;  2FNQ A;  3X3Y A;  3LTD A;  1YIJ 3;  1M90 4;  1MWT A;  1VQP 3;  1SPU A;  2INX A;  3UJM A;  3F7X A;  1QVG 2;  2L4V A;  4LGQ A;  1OPY A;  1FUW A;  1BRG A;  5CXO A;  2KRT A;  1BUJ A;  3AGN A;  2IMJ A;  1NB5 I;  3OXA A;  5IEN A;  1HU9 A;  1BRJ A;  3MSO A;  5LC7 A;  4EBG A;  5CF1 A;  3NQZ A;  3QRD A;  1IQX A;  1YIT 3;  1KD1 4;  2OOV C;  4X2H A;  1VQQ A;  3PCR A;  3WR2 A;  3U1W A;  1WQL B;  3CME 3;  2C11 A;  1Q40 A;  3X41 A;  1PFP A;  3KZT A;  1CYV A;  1IT8 A;  2P0M A;  4JRF A;  3X3Z A;  4L7K A;  5D82 A;  4N6N B;  3CCM 3;  1RGG A;  1TUH A;  3LYG A;  4HM7 B;  1TRQ A;  3EHC A;  4NRE A;  1GOY A;  1BNS A;  2CW9 A;  3JUQ A;  2W9P A;  2ZHX B;  3MG2 A;  1RNB A;  1CEW I;  3N54 B;  1IV7 A;  1JBT A;  2K3D A;  5EQL A;  3EC9 A;  4HOH A;  3EJV A;  2OOV A;  1M1K 4;  1JKG A;  5DRE A;  4O02 B;  1BRI A;  3F7S A;  3LTC A;  3GZB A;  5HGR A;  3WOF B;  3CXC 2;  3CCR 3;  4RNZ A;  1ROA A;  3VF1 A;  3MWZ A;  1GS3 A;  3HZP A;  3E99 A;  1S72 3;  3LOY A;  3EBY A;  3CNM A;  4HM4 B;  5EVH A;  3N9H A;  4EV5 A;  1B2Z A;  2LYX A;  4KFE A;  2GEY A;  3PS8 A;  1K73 4;  1JBS A;  2RFR A;  2Q07 A;  3GAX A;  2CFG A;  2XR8 B;  1GMP A;  2HOH A;  5DRV A;  1DE3 A;  1LQM B;  2GEX A;  5AIG A;  5TGN A;  1BGS A;  1VQ6 3;  1TTO A;  1A2P A;  3ZG5 A;  3GSP A;  3S28 A;  4AKZ A;  1ULJ B;  2XF3 A;  1RMS A;  1JZO A;  1UI7 A;  1LNI A;  1K41 A;  1O7P B;  2J8X B;  4MMX B;  1FGT A;  1RGF A;  1V58 A;  3F8X A;  1BSE A;  1SJW A;  1I70 A;  2GBW B;  1J2B A;  1I2G A;  1RTU A;  1GY5 A;  1DVD A;  3TDG A;  1FGQ A;  1IVX A;  2P0X A;  1B3S A;  4FR9 A;  1CYU A;  3Q3F A;  2HMN B;  3AHW A;  3AHS A;  4I5Q A;  1RCL A;  1UDI I;  1E3V A;  1LQG C;  3T0U A;  1N5P A;  4MJD A;  1FUT A;  4FCJ A;  1F8N A;  3NV0 B;  1W7C A;  3NX0 A;  2E2V A;  1VQ5 3;  1G0T A;  3KKG A;  1YI2 3;  1VQL 3;  2Y73 A;  2L1S A;  4N6T A;  2QIY A;  4RBN A;  9RNT A;  2E2T A;  5IG4 A;  1MWU A;  4WP5 A;  4PEJ A;  1VZZ A;  3UB1 A;  4EC6 A;  5A0O B;  5IG3 A;  2BU4 A;  3WDG B;  3DXO A;  5LC6 A;  3SED A;  1IU7 A;  1OAC A;  1X1U A;  3MG3 A;  3IPT A;  1Q81 4;  3S67 A;  3GWR A;  3AMO B;  3HK4 A;  5FGO A;  1KSI A;  1C54 A;  3G6E 3;  3BNB A;  2Z6B A;  5I97 A;  1RN7 A;  2M7O A;  3RNT A;  4BL2 A;  2BMO B;  1BOX A;  2WGQ A;  2OTL 3;  4FCZ A;  1O7N B;  1O7M B;  3A76 A;  1NB3 I;  4N3V A;  2B24 B;  3S27 A;  3LTB A;  4J9A A;  3ALA A;  4GL6 A;  4R4K A;  4MMZ B;  4OK0 A;  4LYL B;  3SX1 A;  3FGY A;  1GMQ A;  1N9E A;  3DH2 A;  1GY6 A;  3LXU X;  3NBJ A;  4GB5 A;  3NBB A;  1QAL A;  2HMO B;  3WMD A;  1ZGX A;  2OCT A;  1WMP A;  5IEP A;  1OF5 A;  1Q86 4;  1OGZ A;  1UCJ A;  2F99 A;  4LMI A;  1Y4K A;  4K61 A;  1IYY A;  1GMR A;  2SAR A;  4MMY B;  3FSD A;  3X40 A;  4BTW A;  2RNT A;  1YJN 3;  1BSB A;  4OVM A;  3K9M C;  4N6O B;  3PCS A;  3ROB A;  1UUV B;  4O8S A;  1BRK A;  1JB2 A;  3KSE D;  1W2B 2;  3HII A;  1JB4 A;  7STD A;  5M19 A;  1Q82 4;  3PXM A;  3CC2 3;  2F56 A;  3F14 A;  4HM5 B;  7GSP A;  4RNY A;  2CHC A;  3HI7 A;  4HM1 B;  3A5E A;  1Q7H A;  1E97 A;  4N6U A;  2BO9 B;  3RGA A;  3BU4 A;  3EX9 A;  1JKG B;  5IW9 A;  1VQN 3;  2QA4 3;  4BL3 A;  3FCS B;  5HOH A;  3F8H A;  3SYU A;  3CMA 3;  1MNL A;  1DVC A;  1I2E A;  1W02 A;  2KXG A;  3FG4 A;  1I0X A;  2ZDJ A;  6GSP A;  5RNT A;  2MF7 A;  1JRQ A;  5D81 A;  4CPK A;  2YX9 A;  5KP4 A;  1LXE A;  2XFT A;  1B2U A;  1HKX A;  3CCJ 3;  1TFO A;  3H51 A;  2H0H A;  2I9W A;  2YFJ B;  1L5G B;  4ZM8 A;  3J7Y d;  1DMQ A;  2BMR B;  1RCK A;  4HM2 B;  3PYJ A;  1IVW A;  4GSP A;  1GD3 A;  1OF5 B;  4N6M A;  2KF5 A;  2RSX A;  5G1L A;  1AV4 A;  2XSH B;  4FMD A;  4LEH A;  3T8N A;  3G4S 3;  1OHS A;  2XGL A;  1VQO 3;  1KQS 2;  2HMJ B;  1UUG B;  4IT7 A;  3X42 A;  4HM3 B;  3DZL A;  1RGL A;  1FYS A;  4BTX A;  2CFL A;  2V1L A;  4RZM A;  1OH0 A;  1YVB I;  2CFW A;  3PZW A;  1YNV X;  2CX1 A;  2RGQ A;  2CG1 A;  1YGW A;  1GY7 A;  1RHL A;  1W00 A;  1MOL A;  1B2M A;  4CDL A;  2F86 B;  2GXF A;  4GHO A;  1KC8 4;  1R4Y A;  1B2S A;  1LOY A;  1QMA A;  2B1X B;  3GRD A;  5IG5 A;  2QGU A;  2LQV A;  3JUO A;  1DYU A;  1ZO2 A;  1EKM A;  3S29 A;  3V92 A;  3UL5 A;  2IUJ A;  2IYJ A;  2CFD A;  3KN4 A;  2STD A;  5FW5 A;  5IEO A;  1LVN A;  1N8Q A;  1S5A A;  2MC8 A;  1RGC A;  4HM6 B;  1HZ1 A;  4K1V A;  1RGH A;  1K28 A;  1JJ2 2;  3B4O A;  3WHO A;  5M18 A;  3EB8 A;  3EE1 A;  3MG1 A;  3QK9 A;  2AAE A;  2GBX B;  2CWV A;  1ULI B;  1JNQ A;  3D5I A;  3VSY A;  2IY2 A;  1IV9 A;  1CQS A;  1JZD A;  4DKI A;  2JQ5 A;  1QJG A;  2RBI A;  1K8A 4;  4K90 B;  1TU5 A;  1Z1S A;  1AVK A;  3LT8 A;  2PNC A;  3N8B A;  1G02 A;  1RN1 A;  1UUW B;  5BVB A;  2F5W A;  1W6C A;  4NPB A;  1QVF 2;  3G0K A;  1UGI A;  1LOX A;  3OWU A;  3LH4 A;  5IG0 A;  3WA3 A;  2KF3 A;  2ML6 A;  1FGM A;  4HJL B;  4STD A;  2KF4 A;  3ZG0 A;  1EG9 B;  3KSP A;  3PGB A;  1FA3 A;  3GZX B;  4WYK A;  1IQ8 A;  1W01 A;  1T2I A;  1MWR A;  3B7C A;  1O7W B;  3K63 A;  1NU3 A;  3NM2 A;  1I2F A;  8CHO A;  1B20 A;  3NV0 A;  3SOA A;  3B8L A;  2P38 A;  2XSO B;  1DMN A;  1X1Y A;  2HML B;  3EN1 B;  4H61 A;  4J8T A;  4ORL A;  3H3H A;  1STD A;  4K1U A;  4HKV B;  3BIR A;  3FLJ A;  2BHM A;  3KE7 A;  4EV2 A;  2IUK A;  5JPU A;  1YJW 3;  1VQ8 3;  1RRH A;  1M9G A;  4JF8 A;  1A67 A;  2CG0 A;  3NM7 A;  1QAF A;  1BNI A;  2GSP A;  1RKY A;  1KWI A;  1W6Y A;  1B21 A;  3BND A;  3K7C A;  2HMM B; 
#chains in the Genus database with same CATH homology
 3AMO A;  1WNH A;  2FGT A;  4HBR A;  4HZ9 B;  1VQK 3;  1A2K A;  2P09 A;  4MEI A;  1ISK A;  3I55 3;  3CCS 3;  2WO0 A;  3DM8 A;  1GD4 A;  1IDP A;  1YJ9 3;  5JPP A;  1N9J A;  4KZ1 A;  2W04 A;  1US1 A;  4X2O A;  1D6Z A;  4FMA A;  1N5H A;  2XFS A;  4HYZ A;  5KP1 A;  4LSO A;  1VQM 3;  1ROV A;  5IER A;  3CCL 3;  4O2H A;  3OW2 2;  3IJE B;  3LZA A;  1TP6 A;  3SLU A;  4KVH A;  2W56 A;  1D6U A;  3D9R A;  3HIG A;  2ZL8 A;  6STD A;  1D6Y A;  3HX8 A;  1OCV A;  4FMB A;  4XDV A;  5ELJ A;  4EYC A;  1NO3 A;  1VQ4 3;  3SVA A;  1UI8 A;  1C7H A;  1LNH A;  3CC7 3;  1STF I;  2HMK B;  1O7H B;  1RRL A;  2OTJ 3;  3STD A;  4R9L A;  3DGL A;  1Q40 B;  4WYK B;  2Y74 A;  2CWT A;  2WOH A;  4IPB A;  4U13 A;  1IQY A;  1M1X B;  3FKA A;  1W4N A;  5AI1 A;  4HM0 B;  1NJI 4;  2YFI B;  3MHE A;  1W5Z A;  3CC4 3;  3BB9 A;  2BMQ B;  5AII A;  4AEQ A;  1JN5 A;  1V74 A;  1W6G A;  2C10 A;  2YFL B;  3KII A;  2W6J H;  4CCV A;  5AYS C;  3T8U A;  1IVV A;  5KP3 A;  3LTA A;  4WWU C;  2JDI H;  3CPO A;  1E3R A;  5EEO A;  1GYB A;  2W0Q A;  1OHO A;  1T5Y A;  3LML A;  4R1K A;  4XDW A;  4XBX A;  3BNC A;  4QWT A;  2D42 A;  4LZI A;  1IVU A;  5AIF A;  5IF6 A;  1WMO A;  1AR0 A;  3D3L A;  2PZV A;  2A15 A;  3K5T A;  1JN5 B;  4FCM A;  5AEU B;  2SBL A;  3Q90 A;  3CPW 2;  1ZX2 A;  2O3O A;  2F98 A;  3FF2 A;  3O8Y A;  1K9M 4;  1FGR A;  4WHA A;  2CH9 A;  4L8O A;  1FGO A;  4EXR A;  1DMM A;  3NUV A;  1G96 A;  4HZB B;  2ML5 A;  1EA2 A;  1W2Z A;  3WOE B;  3EF8 A;  1VQ7 3;  4G1M B;  4R9K A;  5AIH A;  3FG3 A;  3B4P A;  4FMC A;  4TX4 A;  3F9S A;  1RJO A;  4H3U A;  2BNG A;  3I0Y A;  2WOF A;  3Q2P A;  1R4C A;  2Z77 A;  3OV4 A;  3NXJ A;  2UX0 A;  5JBS A;  1JV2 B;  1U5O A;  3UNL A;  3JUP A;  4HM8 B;  1SIH A;  3X3X A;  2KCD A;  1QAK A;  2W2C A;  3IMA B;  1OUN A;  3DGO A;  4I4K A;  2RCD A;  2W03 A;  3K0Z A;  2OQE A;  2CFK A;  3FF0 A;  4KFF A;  3DY5 A;  5CK6 A;  1YGE A;  2K0M A;  1O7G B;  3MYT A;  2OWP A;  2CKF B;  2D1W A;  3CCE 3;  2CC3 A;  2FXT A;  4AKY A;  2Z76 A;  3F40 A;  3FZW A;  5CF2 A;  1IK3 A;  3CNX A;  3OX9 A;  3DGM A;  1WTH A;  3JVC A;  2IA7 A;  3JUM A;  3WOD G;  2CK3 H;  2E2U A;  3DMC A;  3OWY A;  3ECF A;  2OQE C;  3ER7 A;  3V99 A;  3EN8 A;  3MKI A;  3CCQ 3;  1Q7Y 4;  4N6V 0;  1SII A;  2R4I A;  3CD6 3;  1OHP A;  2GU3 A;  3NQY A;  1NWW A;  1YHQ 3;  3FH1 A;  2QEX 3;  2XEP A;  3EBT A;  3RGR A;  3UL6 A;  5AEW B;  3KFQ C;  2XH9 A;  4NHF A;  2XGN A;  4N6L A;  3SXX A;  5AYR B;  1N8R 4;  3MPH A;  4IIA A;  2P05 A;  5BXQ A;  4Q53 A;  1SQW A;  5G2G A;  1WMN A;  2WGO A;  5D83 A;  4KFD A;  3GZY B;  1AVL A;  2O9U X;  1VQ9 3;  2W56 B;  4L8P A;  2W9Q A;  1A2V A;  2CWU A;  3M8C A;  4R80 A;  1NDO B;  5STD A;  3V98 A;  3GZR A;  1Q42 A;  2Z7A A;  4XBY A;  1UW1 A;  3S5C A;  2GU1 A;  5CLK A;  3CU3 A;  1KWI A;  4HVN A;  4BTY A;  3CCV 3;  1U8C B;  3L0R A;  4XBT A;  4XM4 A;  3EQQ B;  1IT7 A;  3G16 A;  2CIU A;  3LT9 A;  1A90 A;  3SOY A;  3BNE A;  3NHX A;  4OUQ A;  3NBR A;  3BLZ A;  1PU4 A;  3DGN A;  4XB5 A;  1ASK A;  1TFK A;  1OGX A;  3OWS A;  3I56 3;  1EQK A;  2BT3 A;  1BUQ A;  2XRX B;  4O3V A;  3G71 3;  3FG1 A;  3U97 A;  3VGN A;  3JUN A;  4WFO A;  5ELU A;  3DUK A;  3RDE A;  3CCU 3;  3WA2 X;  1TIJ A;  1JB5 A;  3Q1C A;  3G8Z A;  2FNQ A;  3X3Y A;  3LTD A;  1YIJ 3;  1M90 4;  1VQP 3;  1SPU A;  2INX A;  3UJM A;  3F7X A;  1QVG 2;  2L4V A;  4LGQ A;  1OPY A;  1FUW A;  5CXO A;  2KRT A;  2IMJ A;  1NB5 I;  3OXA A;  5IEN A;  1HU9 A;  3MSO A;  5LC7 A;  4EBG A;  5CF1 A;  3NQZ A;  3QRD A;  1IQX A;  1YIT 3;  1KD1 4;  2OOV C;  4X2H A;  3PCR A;  3U1W A;  1WQL B;  3CME 3;  2C11 A;  1Q40 A;  3X41 A;  1PFP A;  3KZT A;  1CYV A;  1IT8 A;  2P0M A;  4JRF A;  3X3Z A;  4L7K A;  5D82 A;  4N6N B;  3CCM 3;  1TUH A;  3LYG A;  4HM7 B;  4NRE A;  3EHC A;  2CW9 A;  3JUQ A;  2W9P A;  3MG2 A;  1CEW I;  3N54 B;  1IV7 A;  5EQL A;  3EC9 A;  2OOV A;  3EJV A;  1M1K 4;  1JKG A;  5DRE A;  4O02 B;  3F7S A;  3LTC A;  3GZB A;  5HGR A;  3WOF B;  3CXC 2;  3CCR 3;  4RNZ A;  1ROA A;  3VF1 A;  3MWZ A;  1GS3 A;  3HZP A;  3E99 A;  1S72 3;  3LOY A;  3EBY A;  3CNM A;  4HM4 B;  5EVH A;  3N9H A;  4EV5 A;  2LYX A;  4KFE A;  2GEY A;  3PS8 A;  1K73 4;  2RFR A;  2Q07 A;  3GAX A;  2CFG A;  2XR8 B;  5DRV A;  2GEX A;  5AIG A;  5TGN A;  1VQ6 3;  4AKZ A;  3S28 A;  1ULJ B;  2XF3 A;  1UI7 A;  1K41 A;  1O7P B;  4MMX B;  1FGT A;  3F8X A;  1SJW A;  2GBW B;  1J2B A;  1GY5 A;  1DVD A;  3TDG A;  1FGQ A;  1IVX A;  2P0X A;  4FR9 A;  1CYU A;  2HMN B;  1E3V A;  3T0U A;  1N5P A;  4MJD A;  4FCJ A;  1F8N A;  3NV0 B;  1W7C A;  3NX0 A;  2E2V A;  1VQ5 3;  3KKG A;  1YI2 3;  1VQL 3;  2Y73 A;  4N6T A;  2QIY A;  4RBN A;  2E2T A;  5IG4 A;  4WP5 A;  4PEJ A;  1VZZ A;  3UB1 A;  4EC6 A;  5A0O B;  5IG3 A;  3WDG B;  3DXO A;  5LC6 A;  3SED A;  1IU7 A;  1OAC A;  3MG3 A;  3IPT A;  1Q81 4;  3S67 A;  3GWR A;  3AMO B;  3HK4 A;  5FGO A;  1KSI A;  3G6E 3;  3BNB A;  2Z6B A;  5I97 A;  1RN7 A;  2M7O A;  2BMO B;  2OTL 3;  2WGQ A;  4FCZ A;  1O7N B;  1O7M B;  3A76 A;  1NB3 I;  4N3V A;  2B24 B;  3S27 A;  3LTB A;  4J9A A;  3ALA A;  4GL6 A;  4R4K A;  4MMZ B;  4OK0 A;  3SX1 A;  3FGY A;  1N9E A;  3LXU X;  1GY6 A;  3NBJ A;  4GB5 A;  3NBB A;  1QAL A;  2HMO B;  3WMD A;  2OCT A;  1WMP A;  5IEP A;  1OF5 A;  1Q86 4;  1OGZ A;  2F99 A;  4LMI A;  1Y4K A;  4K61 A;  4MMY B;  3FSD A;  3X40 A;  4BTW A;  1YJN 3;  4OVM A;  3K9M C;  4N6O B;  3PCS A;  3ROB A;  1UUV B;  4O8S A;  1JB2 A;  3KSE D;  1W2B 2;  3HII A;  1JB4 A;  7STD A;  1Q82 4;  3PXM A;  3CC2 3;  3F14 A;  4HM5 B;  4RNY A;  2CHC A;  3HI7 A;  4HM1 B;  1E97 A;  4N6U A;  2BO9 B;  3RGA A;  3EX9 A;  1JKG B;  5IW9 A;  1VQN 3;  2QA4 3;  3FCS B;  3F8H A;  3CMA 3;  1MNL A;  1DVC A;  1W02 A;  2KXG A;  3FG4 A;  2ZDJ A;  2MF7 A;  1JRQ A;  5D81 A;  2YX9 A;  5KP4 A;  1LXE A;  2XFT A;  3CCJ 3;  1HKX A;  1TFO A;  3H51 A;  2I9W A;  2YFJ B;  1L5G B;  4ZM8 A;  3J7Y d;  1DMQ A;  2BMR B;  4HM2 B;  3PYJ A;  1IVW A;  1GD3 A;  1OF5 B;  4N6M A;  2RSX A;  1AV4 A;  2XSH B;  4FMD A;  4LEH A;  3T8N A;  3G4S 3;  1OHS A;  2XGL A;  1VQO 3;  1KQS 2;  2HMJ B;  3X42 A;  4IT7 A;  4HM3 B;  3DZL A;  4BTX A;  2CFL A;  2V1L A;  4RZM A;  1OH0 A;  1YVB I;  2CFW A;  3PZW A;  2RGQ A;  2CG1 A;  1GY7 A;  1W00 A;  1MOL A;  4CDL A;  2F86 B;  2GXF A;  1KC8 4;  1QMA A;  2B1X B;  3GRD A;  5IG5 A;  2QGU A;  2LQV A;  3JUO A;  1DYU A;  1ZO2 A;  1EKM A;  3S29 A;  3V92 A;  3UL5 A;  2IUJ A;  2CFD A;  3KN4 A;  2STD A;  5FW5 A;  5IEO A;  1LVN A;  1N8Q A;  1S5A A;  2MC8 A;  4HM6 B;  4K1V A;  1K28 A;  1JJ2 2;  3B4O A;  3EB8 A;  3EE1 A;  3MG1 A;  3QK9 A;  2GBX B;  2CWV A;  1ULI B;  1JNQ A;  3VSY A;  1IV9 A;  1CQS A;  2JQ5 A;  1QJG A;  1K8A 4;  4K90 B;  1TU5 A;  1Z1S A;  1AVK A;  3LT8 A;  2PNC A;  3N8B A;  5BVB A;  1UUW B;  1W6C A;  1QVF 2;  3G0K A;  1LOX A;  3OWU A;  3LH4 A;  5IG0 A;  3WA3 A;  2ML6 A;  1FGM A;  4HJL B;  4STD A;  1EG9 B;  3KSP A;  3PGB A;  1FA3 A;  3GZX B;  4WYK A;  1IQ8 A;  1W01 A;  3B7C A;  1O7W B;  3K63 A;  1NU3 A;  3NM2 A;  8CHO A;  3NV0 A;  3SOA A;  3B8L A;  2P38 A;  2XSO B;  1DMN A;  2HML B;  3EN1 B;  4H61 A;  4J8T A;  4ORL A;  3H3H A;  1STD A;  4K1U A;  4HKV B;  3FLJ A;  2BHM A;  3KE7 A;  4EV2 A;  2IUK A;  5JPU A;  1YJW 3;  1VQ8 3;  1RRH A;  1M9G A;  4JF8 A;  1A67 A;  2CG0 A;  3NM7 A;  1QAF A;  1RKY A;  2K54 A;  1W6Y A;  3BND A;  3K7C A;  2HMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...