3NV0B

Crystal structure and mutational analysis of the nxf2/nxt1 heterodimeric complex from caenorhabditis elegans at 1.84 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
SMKTTQEINKEDEELCNESKKFMDVYYDVMDRKREKIGFLYTQVSNAVWNGNPINGYDSICEFMKALPSTQHDIQSLDAQRLPEGVTGDMSGGMLLNVAGAVTVDGDSKRAFTQTLLLGVEDGKYKVKSDRFRYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding/protein transport
molecule keywords Nuclear RNA export factor 2
publication title The structure of the NXF2/NXT1 heterodimeric complex reveals the combined specificity and versatility of the NTF2-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 48
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nv0B00
3F8HA 3WMDA 1DMQA 1S5AA 2PZVA 3GZYB 3F14A 3FLJA 3EHCA 5BXQA 5CF1A 3OXAA 3RGRA 1O7MB 3EBTA 3ROBA 1ZX2A 1K41A 4HVNA 4XDVA 1OF5B 3G8ZA 4KVHA 1Z1SA 3KKGA 1STDA 2HMLB 1QMAA 2UX0A 3DXOA 1TUHA 3VSYA 5AIHA 5STDA 3BB9A 3E99A 2R4IA 2GXFA 3CNMA 4HM2B 5IG4A 2YFIB 2B24B 4N3VA 2I9WA 3MSOA 3DMCA 1ZO2A 5IG5A 1JKGB 4L8PA 3JUMA 5AIGA 3ECFA 4Q53A 3F8XA 3BLZA 4CDLA 2Z7AA 1OHPA 3OX9A 1BUQA 5CK6A 3IPTA 1Q40A 1GY6A 3H3HA 1AR0A 3ER7A 1W02A 3STDA 3SOYA 5JPPA 3GZBA 1WQLB 4OUQA 1DMNA 4H3UA 2XRXB 3MG2A 4WWUC 2BMOB 1DMMA 1OPYA 2YFLB 3HK4A 3NXJA 3OWSA 1OH0A 1SJWA 4HM6B 3LYGA 3OV4A 2RFRA 4GB5A 4HM5B 1W01A 3EX9A 3VGNA 2GEYA 3F40A 1HKXA 1O7HB 3HZPA 3KE7A 1OGXA 3JUNA 3JUPA 1OHSA 3SOAA 3K7CA 5HGRA 3RGAA 3LZAA 3NBRA 2HMJB 5IEPA 3A76A 4HM8B 3F7SA 1GY5A 2GBXB 5G2GA 4LMIA 1E97A 3OWUA 1Q40B 4ORLA 4XBTA 3UJMA 3KZTA 3Q90A 4HKVB 2F98A 3SEDA 5IF6A 3GZRA 4LEHA 1O7WB 2HMNB 8CHOA 3HX8A 2STDA 3EJVA 1E3RA 3MG1A 3FF0A 3FGYA 1O7GB 4XB5A 2W2CA 5AIIA 3G16A 3T8UA 1JB2A 4X2HA 5CLKA 3EQQB 2GBWB 3FH1A 3JUQA 2QGUA 3FF2A 2YFJB 4WYKA 3CNXA 5D83A 3EN8A 1CQSA 3GZXB 5BVBA 2K54A 4HM1B 4XDWA 7STDA 5D81A 3MHEA 3F9SA 2INXA 1IDPA 3GRDA 2XR8B 4LGQA 4K1UA 5AEUB 3EF8A 4PEJA 4XM4A 2F86B 3S5CA 3B4PA 4L7KA 2JQ5A 3NM2A 2XSOB 1GY7A 3I0YA 4WP5A 4HM3B 1EA2A 4HM0B 4R9KA 1QJGA 5IERA 2IMJA 4I4KA 2XSHB 2Z76A 2BMQB 1VZZA 3NV0A 3NHXA 5FW5A 1C7HA 5IENA 5DRVA 3EBYA 3CU3A 3B8LA 1OUNA 4HZ9B 3FSDA 3JUOA 2OWPA 1ASKA 3G0KA 1U5OA 2A15A 1OGZA 2Z77A 3FZWA 4WYKB 3H51A 3DZLA 3B4OA 3MYTA 5IG0A 1JB4A 3DM8A 4J8TA 1Q42A 1JB5A 5CF2A 4XBYA 2BMRB 4R9LA 1OHOA 3DUKA 4OVMA 4FCJA 1W00A 1OCVA 5CXOA 4STDA 5D82A 3D9RA 5TGNA 1ISKA 5JPUA 3UNLA 1UUWB 4HM4B 4MJDA 3NUVA 5IEOA 5AI1A 4FCMA 2HMMB 4L8OA 6STDA 5KP3A 4J9AA 3K0ZA 3FKAA 2B1XB 3EN1B 3NV0B 5DREA 5KP1A 4X2OA 1UUVB 1JN5A 3EC9A 2BNGA 4IIAA 1EG9B 3T8NA 1GS3A 3OWYA 3KSPA 3MKIA 1TP6A 3M8CA 1A2KA 5KP4A 1E3VA 4HZBB 5IG3A 4R1KA 1O7PB 2QIYA 2CHCA 1OF5A 1ULJB 1NDOB 5AIFA 2HMOB 4K1VA 3CPOA 3MG3A 3F7XA 2RGQA 1O7NB 2RCDA 4XBXA 4U13A 1GYBA 2F99A 3GWRA 1W6YA 5AEWB 1ULIB 4HM7B 2GEXA 2HMKB 4RZMA 1JKGA 1JN5B 2CKFB 1NU3A 4HJLB 3B7CA 5EVHA 1NWWA
chains in the Genus database with same CATH superfamily
1QAKA 2R41A 3PCSA 2CG1A 1GD3A 1AVLA 1UDII 3F8HA 1GOYA 4LSOA 3WMDA 2H0HA 1DMQA 3KFQC 4FMAA 1S5AA 1TU5A 1RTUA 4FCZA 2PZVA 1KD14 3SVAA 4CCVA 3GZYB 4O2HA 3FG3A 1NNVA 3UB1A 1FGRA 2RSXA 1RNBA 3F14A 3FLJA 3NBBA 3S67A 1VQ73 3EHCA 1RGKA 4N6NB 1DVDA 2WOHA 1NO3A 3O8YA 4FMDA 2KRTA 4LYLB 5BXQA 1CYUA 5CF1A 3OXAA 2AAEA 2SARA 2P05A 4N6OB 3G6E3 3RGRA 3L0RA 4MEIA 1O7MB 3EBTA 3ROBA 2E2VA 1ZX2A 1K41A 4HVNA 3QRDA 3BNEA 4XDVA 1SARA 1OF5B 3G8ZA 1OACA 1JZOA 3EE1A 3LTDA 4KVHA 1Z1SA 2RNTA 1HYFA 2BU4A 3KKGA 2MC8A 4N6V0 1MOLA 1STDA 3K5TA 1QVF2 2HMLB 4O8SA 5JBSA 1QMAA 2UX0A 3DXOA 3X42A 1TUHA 1BNFA 4ILFA 3VSYA 1BANA 1K9M4 1F8NA 2KF5A 5AIHA 5M18A 1KSIA 1YIJ3 3D3LA 5STDA 1JV2B 1TFOA 1YVSA 4LZIA 3PGBA 3CME3 3X40A 1FGMA 1HU9A 3BB9A 1B27A 1RMSA 1AVKA 1STFI 2R4IA 1YNVX 3E99A 2GXFA 1T5YA 1MGWA 2UGIA 3CNMA 5ELJA 4HM2B 5IG4A 4EW5A 2GU3A 2ZDJA 2YFIB 3PS8A 2B24B 4N3VA 1JJ22 1BRGA 2I9WA 2MF7A 3SYUA 3MSOA 1YJ93 3CC43 1I0XA 1MWRA 3DMCA 1ZO2A 3CCQ3 3CCE3 2XFSA 5IG5A 7GSPA 3VF1A 1JKGB 4MMYB 3NM7A 4L8PA 3JUMA 3CPW2 5AIGA 3ECFA 4Q53A 1I3IA 3F8XA 1X1WA 1AY7A 2PNCA 3BLZA 3WA2X 1CEWI 1FUWA 3KN4A 1X1YA 2Z7AA 4CDLA 1CH0A 2CFLA 1BSDA 1OHPA 3FCSB 3JVCA 3OX9A 3WOFB 1BUQA 5CK6A 1RGHA 3IPTA 3FG4A 2W6JH 4WHAA 1A2PA 1Q40A 1LVNA 1VQK3 1DETA 1PY3A 1V74A 2XEPA 3DGLA 3ZG0A 1FGQA 2QA43 1GY6A 3H3HA 1MGRA 5FGOA 4DKIA 4JF8A 3LXUX 1AR0A 1RN7A 1EQKA 1LNIA 1YGWA 4EYCA 2RBIA 2OQEC 3Q1CA 2XFTA 1FGOA 1IVVA 1RGLA 3ER7A 4G1MB 2GSPA 4QWTA 1W02A 3HIIA 3STDA 3SOYA 1MWSA 3D4AA 1BSBA 2K3DA 1UUGB 5JPPA 2XF3A 3MWZA 4O3VA 1D6ZA 3GZBA 1WQLB 1VQ83 5RNTA 4OUQA 4IT7A 1DMNA 4H3UA 3AGNA 1QALA 3GAXA 2FXTA 2XRXB 3MG2A 2BMOB 1FGTA 1W4NA 3QK9A 4WWUC 1SQWA 5GSPA 4BTWA 1S723 1W6GA 1DMMA 1BNJA 1BIRA 1BNRA 4HOHA 1OPYA 3RDEA 8RNTA 2OCTA 3V92A 3N8BA 1TRPA 2YFLB 1VQO3 1PFPA 3HK4A 3NXJA 3OWSA 3CC73 2CFWA 1IV7A 3Q2PA 1TTOA 4OK0A 3D5IA 2F5WA 1VQM3 1JBRA 2P38A 1BRHA 1IT8A 1B2ZA 3URPA 1OH0A 1SJWA 2KF4A 4HM6B 3LYGA 1RGEA 2D42A 1IVUA 3OV4A 1VQ93 4KFDA 2RFRA 4GB5A 1UI7A 1BNIA 1WTHA 1W01A 1YGEA 4HM5B 5BIRA 2LYXA 4KFFA 3EX9A 3VGNA 1VQ43 2GEYA 3F40A 1BRKA 2CIUA 1HKXA 2CWTA 1QVG2 1O7HB 3HZPA 1RRHA 1NJI4 1RKYA 3KE7A 1OGXA 3D79A 3JUNA 1BRJA 3WA3A 1W5ZA 1Q7Y4 1LNHA 3CCU3 1SIIA 3EB8A 3JUPA 1OHSA 3SOAA 3SXXA 3K7CA 1IU7A 5HGRA 1IVXA 1GD4A 1UCIA 3RGAA 3LZAA 2W9QA 3NBRA 4FR9A 1HZ1A 2KCDA 2HMJB 4BTXA 5BU4A 1RDSA 5IEPA 4BL3A 2ZL8A 1ROVA 1RN1A 2AADA 3A76A 3F7SA 2GU1A 1GY5A 4HM8B 2IUJA 1BGSA 2GBXB 5G2GA 4LMIA 2IA7A 1E97A 1GSPA 2LQVA 2C11A 3OWUA 4J5KA 3ZFZA 2XH9A 1Q40B 1PU4A 3I563 4NPBA 1B2UA 4ORLA 1YJN3 4XBTA 3BIRA 1RLSA 1B2MA 3UJMA 1I2GA 3KZTA 1J2BA 1MWTA 3LT9A 2Y74A 2FNQA 3Q90A 2F98A 1Q9EA 4HKVB 4O02B 1K734 1RGAA 3SEDA 5IF6A 3GZRA 4LEHA 1O7WB 2HMNB 2WO0A 2SBLA 4CJNA 2CK3H 8CHOA 1Q7HA 3HX8A 2STDA 3EJVA 1ZGXA 1IQ8A 1E3RA 1TJDA 3MG1A 3FF0A 2CFDA 3FGYA 4KZ1A 1KQS2 1VQ53 3WHOA 3LH4A 5M19A 3G713 2XGNA 1O7GB 4XB5A 2W2CA 5AIIA 2FGTA 3G16A 3T8UA 1JB2A 4X2HA 4NHFA 1BU4A 5CLKA 4N6MA 2L4VA 3LMLA 1N5HA 2CX0A 3EQQB 2GBWB 3CC23 3FH1A 1I70A 2QGUA 3FF2A 2W56A 3JUQA 2YFJB 4WYKA 3CNXA 5LC6A 2V1LA 1X1XA 5D83A 3EN8A 2OOVC 3CCV3 1W2B2 2IUKA 1CQSA 3GZXB 3X41A 3NQYA 5BVBA 2K54A 3DGOA 4HM1B 1RNTA 3KSED 4XDWA 4RNYA 3CD63 4I5QA 1TIJA 1ZS7A 7STDA 5D81A 3SLUA 2QEX3 3MHEA 1UCLA 5G1KA 3F9SA 2ZHXB 3DGMA 2INXA 2F56A 1YIT3 1IDPA 2CFKA 1VQ63 2O3OA 1D6YA 1VQP3 1BRSA 1GOVA 3GRDA 5IW9A 1I3FA 1KWIA 2XR8B 2CW9A 3G4S3 1MNLA 4N6UA 4LGQA 4K1UA 5AEUB 4N6LA 1LXEA 3EF8A 4PEJA 4XM4A 5A0OB 1TRQA 2F86B 1UCJA 3BNDA 1UI8A 3S5CA 3B4PA 4L7KA 2JQ5A 3NM2A 1RSNA 1GY7A 2XSOB 2ML6A 3I0YA 4WP5A 1WNHA 4HM3B 1T2IA 4GL6A 1DE3A 2O9UX 2W04A 1EA2A 1UGHI 3GSPA 4KFEA 4HM0B 4R9KA 4EXRA 3MPHA 1QJGA 1N8R4 5IERA 1NB5I 2IMJA 3PZWA 4JRFA 1MWUA 2CWVA 1NB3I 4BL2A 1N9EA 1Y4KA 3IMAB 4I4KA 2XSHB 1D6UA 5M1AA 3CCR3 1SPUA 2IY2A 1RCLA 2Z76A 3CMA3 2BMQB 4TX4A 1VZZA 3N54B 3NV0A 1IT7A 3NHXA 1IK3A 2CG0A 3J7Yd 5FW5A 1C7HA 1BVIA 1LOYA 5IENA 3WR2A 5DRVA 1SIHA 1WMPA 2CWUA 3EBYA 3CU3A 1W2ZA 2CX1A 2M7OA 1RGGA 2KAAA 3B8LA 4MMZB 1OUNA 1BNGA 1BNEA 4HZ9B 2JDIH 3LTCA 3FSDA 3JUOA 4BIRA 3T0UA 3D5GA 2OWPA 2P0XA 2CFGA 2WGOA 1Q824 1TFKA 1AV4A 2IYJA 2WOFA 3A5EA 3CCM3 1ASKA 2OTJ3 3PXMA 3G0KA 1LOWA 4H61A 1YJW3 3BU4A 3AHSA 1U5OA 1I8VA 4WFOA 2KF3A 2A15A 1OGZA 2C4BA 2WGQA 2Z77A 2OOVA 2W56B 1US1A 3FG1A 3FZWA 4WYKB 4AKYA 1RCKA 2CC3A 1BAOA 3H51A 3DZLA 4AEQA 2Z6BA 1YI23 2BT3A 4RNZA 1LQGC 1FUTA 3B4OA 3MYTA 5IG0A 2C10A 4EC6A 1JB4A 3KIIA 3DM8A 4J8TA 1Q42A 2P09A 1BOXA 1T2HA 1JB5A 5CF2A 4XBYA 2BMRB 3BNCA 4R9LA 3RNTA 3S27A 1UGIA 1OHOA 1VQN3 1V57A 3DUKA 1I2FA 3LTBA 4OVMA 3X3YA 4CPKA 2W0QA 3KCHA 1W00A 4FCJA 4HAAA 4NREA 1OCVA 1GOUA 1QAFA 1V58A 1BSEA 5CXOA 4STDA 5D82A 3U1WA 3V99A 3I553 1Q864 1B21A 3D9RA 3PCRA 1VQQA 3DGNA 1B2XA 5TGNA 3CXC2 1ISKA 2OQEA 5JPUA 3UNLA 6RNTA 1RRLA 1UUWB 4HM4B 3LOYA 4MJDA 5G1LA 3Q3FA 3N9HA 1M904 3NUVA 5IEOA 1IV9A 5AYSC 5AYRB 1A2VA 4EV2A 4BU4A 5AI1A 4FCMA 3HI7A 2HMMB 4L8OA 6STDA 1GMRA 1X1UA 1EEJA 5HOHA 1YHQ3 1WMNA 2BHMA 5KP3A 6GSPA 4J9AA 1RGCA 4KT3B 3K0ZA 1IYYA 2W9PA 2OTL3 4K90B 1FUSA 1BNSA 2B1XB 1EUIC 3EN1B 2H0IA 3FKAA 3NV0B 5DREA 2KF6A 5KP1A 4X2OA 1W7CA 1R4YA 1UUVB 1U8CB 2F4YA 2HOHA 4EBGA 1L5GB 5I97A 2XGLA 3TDGA 3S29A 1R4CA 1RJOA 1IQYA 1FW7A 1N8QA 3NBJA 1JN5A 3EC9A 3CCJ3 4K61A 1M9GA 2H0GA 4N6TA 1N5PA 3AMOA 1A67A 1VQL3 1G02A 2BNGA 2L1SA 4IIAA 1K8A4 1CYVA 1GMPA 1BSAA 1DYUA 1EG9B 3T8NA 3CCL3 1JBTA 1GS3A 3WOEB 3S28A 1G0TA 1I0VA 2ML5A 3OWYA 1JNQA 3KSPA 3MKIA 3ZG5A 3X3XA 4R80A 2UUGC 3IJEB 1RGFA 2W03A 5ELUA 1TP6A 4EV5A 1RHLA 1B20A 4FMBA 3M8CA 4AKZA 2CH9A 1ROAA 1A2KA 1B3SA 1E3VA 3AHWA 1DVCA 5KP4A 4HZBB 2E2TA 1M1K4 3V98A 4RBNA 2P0MA 5IG3A 1BRIA 1BSCA 3K63A 1IQXA 2D1WA 3NQZA 4FMCA 4R1KA 1O7PB 3CCS3 2QIYA 5EQLA 4GHOA 1B2SA 2CHCA 1FA3A 1M1XB 4IPBA 1Q814 1G96A 1EKMA 3DGYA 1OF5A 2J8XB 7RNTA 1LOVA 1ULJB 5EEOA 3DH2A 1NDOB 3OW22 5AIFA 3LT8A 1WMOA 2HMOB 1JRQA 4K1VA 3CPOA 3MG3A 3U97A 3WDGB 3F7XA 2F5MA 2Q07A 1JBSA 1KC84 2RGQA 4HBRA 3HOHA 9RNTA 1GMQA 1PYLA 3K9MC 1T3BA 1O7NB 1UW1A 3AGOA 4RNTA 2RCDA 4XBXA 2BO9B 1W6CA 1LOXA 1AQZA 4U13A 1GYBA 2YX9A 2F99A 1FYSA 1I2EA 1UCKA 3GWRA 1W6YA 4J5GA 2ZA4A 3SX1A 3UL5A 5AEWB 3PYJA 4GSPA 3DY5A 1JZDA 3X3ZA 4ZM8A 2K0MA 1ULIB 2Y73A 4HM7B 2GEXA 1BUJA 1N9JA 1IVWA 5LC7A 4BTYA 1FZUA 4R4KA 3HIGA 1K28A 3BNBA 2HMKB 4MMXB 1LQMB 1RN4A 1JKGA 1LRAA 4RZMA 3LTAA 2E2UA 1JN5B 2CKFB 1NU3A 2BIRA 2KXGA 3WODG 4HYZA 1YVBI 4HJLB 3B7CA 3ALAA 3AMOB 3NX0A 5EVHA 1NWWA 1A90A 1C54A 3UL6A 1BRNL
chains in the Genus database with same CATH topology
1QAKA 3PCSA 2CG1A 1GD3A 1AVLA 3F8HA 4LSOA 3WMDA 1DMQA 3KFQC 4FMAA 1S5AA 1TU5A 4FCZA 2PZVA 1KD14 3SVAA 4CCVA 3GZYB 4O2HA 3FG3A 3UB1A 1FGRA 2RSXA 3F14A 3FLJA 3NBBA 3S67A 1VQ73 3EHCA 4N6NB 1DVDA 2WOHA 1NO3A 3O8YA 4FMDA 2KRTA 5BXQA 1CYUA 5CF1A 3OXAA 3G6E3 4N6OB 2P05A 3RGRA 3L0RA 4MEIA 1O7MB 3EBTA 3ROBA 2E2VA 1ZX2A 1K41A 4HVNA 3QRDA 3BNEA 4XDVA 1OF5B 3G8ZA 1OACA 3EE1A 3LTDA 4KVHA 1Z1SA 2MC8A 3KKGA 4N6V0 1MOLA 1STDA 3K5TA 1QVF2 2HMLB 4O8SA 5JBSA 1QMAA 2UX0A 3DXOA 3X42A 1TUHA 3VSYA 1K9M4 1F8NA 5AIHA 1KSIA 1YIJ3 3D3LA 5STDA 1JV2B 1TFOA 4LZIA 3PGBA 3CME3 3X40A 1FGMA 1HU9A 3BB9A 1STFI 3E99A 1AVKA 2R4IA 2GXFA 1T5YA 3CNMA 5ELJA 4HM2B 5IG4A 2GU3A 2ZDJA 2YFIB 3PS8A 2B24B 4N3VA 1JJ22 2I9WA 2MF7A 3MSOA 1YJ93 3CC43 3DMCA 1ZO2A 3CCQ3 3CCE3 2XFSA 5IG5A 3VF1A 1JKGB 4MMYB 3NM7A 4L8PA 3JUMA 3CPW2 5AIGA 3ECFA 4Q53A 3F8XA 2PNCA 3BLZA 3WA2X 1CEWI 1FUWA 3KN4A 2Z7AA 4CDLA 2CFLA 1OHPA 3FCSB 3JVCA 3OX9A 3WOFB 1BUQA 5CK6A 3IPTA 3FG4A 2W6JH 4WHAA 1Q40A 1LVNA 1VQK3 1V74A 2XEPA 3DGLA 1FGQA 2QA43 1GY6A 3H3HA 5FGOA 4JF8A 3LXUX 1AR0A 1RN7A 1EQKA 4EYCA 2OQEC 3Q1CA 2XFTA 1FGOA 1IVVA 3ER7A 4G1MB 4QWTA 1W02A 3HIIA 3STDA 3SOYA 5JPPA 2XF3A 3MWZA 4O3VA 1D6ZA 3GZBA 1WQLB 1VQ83 4OUQA 4IT7A 1DMNA 4H3UA 1QALA 3GAXA 2FXTA 2XRXB 3MG2A 2BMOB 1FGTA 1W4NA 3QK9A 4WWUC 1SQWA 1S723 4BTWA 1W6GA 1DMMA 1OPYA 3RDEA 2OCTA 3V92A 3N8BA 1VQO3 2YFLB 1PFPA 3HK4A 3NXJA 3OWSA 3CC73 2CFWA 1IV7A 3Q2PA 4OK0A 1VQM3 2P38A 1IT8A 1OH0A 1SJWA 4HM6B 3LYGA 2D42A 1IVUA 3OV4A 1VQ93 4KFDA 2RFRA 4GB5A 1UI7A 1WTHA 4HM5B 1W01A 1YGEA 2LYXA 4KFFA 3EX9A 3VGNA 1VQ43 2GEYA 3F40A 2CIUA 1HKXA 2CWTA 1QVG2 1O7HB 3HZPA 1RRHA 1NJI4 1RKYA 3KE7A 1OGXA 3JUNA 3WA3A 1W5ZA 1Q7Y4 1LNHA 3CCU3 1SIIA 3EB8A 3JUPA 1OHSA 3SOAA 3SXXA 3K7CA 1IU7A 5HGRA 1IVXA 1GD4A 3RGAA 3LZAA 2W9QA 3NBRA 4FR9A 2KCDA 2HMJB 4BTXA 5IEPA 2ZL8A 1ROVA 3A76A 3F7SA 4HM8B 2GU1A 1GY5A 2IUJA 2GBXB 5G2GA 4LMIA 2IA7A 1E97A 2LQVA 2C11A 3OWUA 2XH9A 1Q40B 1PU4A 3I563 4ORLA 1YJN3 4XBTA 3UJMA 3KZTA 1J2BA 3LT9A 2Y74A 2FNQA 3Q90A 2F98A 4HKVB 4O02B 1K734 3SEDA 5IF6A 3GZRA 4LEHA 1O7WB 2HMNB 2WO0A 2SBLA 2CK3H 8CHOA 3HX8A 2STDA 3EJVA 1IQ8A 1E3RA 3MG1A 3FF0A 2CFDA 3FGYA 4KZ1A 1KQS2 1VQ53 3LH4A 3G713 2XGNA 1O7GB 4XB5A 2W2CA 5AIIA 2FGTA 3G16A 3T8UA 1JB2A 4X2HA 4NHFA 5CLKA 4N6MA 2L4VA 3LMLA 1N5HA 3CC23 3EQQB 2GBWB 3FH1A 3JUQA 2QGUA 3FF2A 2W56A 2YFJB 4WYKA 3CNXA 5LC6A 2V1LA 5D83A 3EN8A 2OOVC 3CCV3 1W2B2 2IUKA 1CQSA 3GZXB 3X41A 3NQYA 5BVBA 2K54A 3DGOA 4HM1B 3KSED 4XDWA 4RNYA 3CD63 1TIJA 7STDA 5D81A 3SLUA 2QEX3 3MHEA 3F9SA 3DGMA 2INXA 1YIT3 1IDPA 2CFKA 1VQ63 2O3OA 1D6YA 1VQP3 3GRDA 5IW9A 1KWIA 2XR8B 2CW9A 3G4S3 1MNLA 4N6UA 4LGQA 4K1UA 5AEUB 4N6LA 1LXEA 3EF8A 4PEJA 4XM4A 5A0OB 2F86B 3BNDA 1UI8A 3S5CA 3B4PA 4L7KA 2JQ5A 3NM2A 2XSOB 1GY7A 3I0YA 2ML6A 4WP5A 1WNHA 4HM3B 4GL6A 2O9UX 2W04A 1EA2A 4KFEA 4HM0B 4R9KA 4EXRA 3MPHA 1QJGA 1N8R4 5IERA 1NB5I 2IMJA 3PZWA 4JRFA 2CWVA 1NB3I 1N9EA 1Y4KA 3IMAB 4I4KA 2XSHB 1D6UA 3CCR3 1SPUA 2Z76A 3CMA3 2BMQB 4TX4A 1VZZA 3N54B 3NV0A 1IT7A 3NHXA 1IK3A 2CG0A 3J7Yd 5FW5A 1C7HA 5IENA 5DRVA 1SIHA 1WMPA 2CWUA 3EBYA 3CU3A 1W2ZA 2M7OA 3B8LA 4MMZB 1OUNA 4HZ9B 2JDIH 3LTCA 3FSDA 3JUOA 3T0UA 2OWPA 2P0XA 2CFGA 2WGOA 1Q824 1TFKA 1AV4A 2WOFA 3CCM3 2OTJ3 1ASKA 3PXMA 3G0KA 4H61A 1YJW3 1U5OA 4WFOA 2A15A 1OGZA 2WGQA 2Z77A 4AKYA 2OOVA 2W56B 1US1A 3FG1A 3FZWA 4WYKB 3H51A 2CC3A 3DZLA 4AEQA 2Z6BA 1YI23 2BT3A 4RNZA 3B4OA 3MYTA 5IG0A 2C10A 4EC6A 1JB4A 3KIIA 3DM8A 4J8TA 1Q42A 2P09A 1JB5A 5CF2A 4XBYA 2BMRB 3BNCA 4R9LA 3S27A 1OHOA 1VQN3 3DUKA 3LTBA 4OVMA 3X3YA 2W0QA 4FCJA 1W00A 4NREA 1OCVA 1QAFA 3I553 5CXOA 4STDA 5D82A 3U1WA 3V99A 1Q864 3D9RA 3PCRA 3DGNA 3CXC2 5TGNA 1ISKA 2OQEA 5JPUA 3UNLA 1RRLA 1UUWB 4HM4B 3LOYA 4MJDA 1M904 3N9HA 3NUVA 5IEOA 1IV9A 5AYSC 5AYRB 1A2VA 4EV2A 5AI1A 4FCMA 3HI7A 2HMMB 4L8OA 6STDA 1YHQ3 1WMNA 2BHMA 5KP3A 4J9AA 3K0ZA 2W9PA 2OTL3 4K90B 3FKAA 2B1XB 3EN1B 3NV0B 5DREA 5KP1A 4X2OA 1W7CA 1UUVB 1U8CB 5I97A 4EBGA 1L5GB 2XGLA 3TDGA 3S29A 1R4CA 1RJOA 1IQYA 1N8QA 3NBJA 1JN5A 3EC9A 3CCJ3 4K61A 1M9GA 4N6TA 1N5PA 3AMOA 1A67A 1VQL3 2BNGA 4IIAA 1K8A4 1CYVA 1DYUA 1EG9B 3T8NA 3CCL3 1GS3A 3WOEB 3S28A 2ML5A 3OWYA 1JNQA 3KSPA 3MKIA 3X3XA 4R80A 3IJEB 5ELUA 2W03A 1TP6A 4EV5A 4FMBA 3M8CA 4AKZA 2CH9A 1ROAA 1A2KA 5KP4A 1E3VA 1DVCA 4HZBB 2E2TA 1M1K4 3V98A 4RBNA 2P0MA 5IG3A 3K63A 4R1KA 3NQZA 1IQXA 2D1WA 4FMCA 3CCS3 1O7PB 2QIYA 5EQLA 2CHCA 1FA3A 1M1XB 4IPBA 1Q814 1G96A 1EKMA 1OF5A 1ULJB 5EEOA 1NDOB 3OW22 5AIFA 3LT8A 1WMOA 2HMOB 1JRQA 4K1VA 3CPOA 3MG3A 3U97A 3WDGB 3F7XA 2Q07A 1KC84 2RGQA 4HBRA 3K9MC 1UW1A 1O7NB 2RCDA 4XBXA 2BO9B 1W6CA 1LOXA 4U13A 1GYBA 2YX9A 2F99A 3GWRA 1W6YA 3SX1A 3UL5A 5AEWB 3PYJA 3X3ZA 3DY5A 4ZM8A 2K0MA 1ULIB 2Y73A 4HM7B 2GEXA 1N9JA 1IVWA 5LC7A 4BTYA 4R4KA 3HIGA 1K28A 3BNBA 2HMKB 4MMXB 4RZMA 1JKGA 3LTAA 2E2UA 1JN5B 2CKFB 1NU3A 2KXGA 3WODG 4HYZA 1YVBI 4HJLB 3B7CA 3ALAA 3AMOB 3NX0A 5EVHA 1NWWA 1A90A 3UL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8H A;  3WMD A;  1DMQ A;  1S5A A;  2PZV A;  3GZY B;  3F14 A;  3FLJ A;  3EHC A;  5BXQ A;  5CF1 A;  3OXA A;  3RGR A;  1O7M B;  3EBT A;  3ROB A;  1ZX2 A;  1K41 A;  4HVN A;  4XDV A;  1OF5 B;  3G8Z A;  4KVH A;  1Z1S A;  3KKG A;  1STD A;  2HML B;  1QMA A;  2UX0 A;  3DXO A;  1TUH A;  3VSY A;  5AIH A;  5STD A;  3BB9 A;  3E99 A;  2R4I A;  2GXF A;  3CNM A;  4HM2 B;  5IG4 A;  2YFI B;  2B24 B;  4N3V A;  2I9W A;  3MSO A;  3DMC A;  1ZO2 A;  5IG5 A;  1JKG B;  4L8P A;  3JUM A;  5AIG A;  3ECF A;  4Q53 A;  3F8X A;  3BLZ A;  4CDL A;  2Z7A A;  1OHP A;  3OX9 A;  1BUQ A;  5CK6 A;  3IPT A;  1Q40 A;  1GY6 A;  3H3H A;  1AR0 A;  3ER7 A;  1W02 A;  3STD A;  3SOY A;  5JPP A;  3GZB A;  1WQL B;  4OUQ A;  1DMN A;  4H3U A;  2XRX B;  3MG2 A;  4WWU C;  2BMO B;  1DMM A;  1OPY A;  2YFL B;  3HK4 A;  3NXJ A;  3OWS A;  1OH0 A;  1SJW A;  4HM6 B;  3LYG A;  3OV4 A;  2RFR A;  4GB5 A;  4HM5 B;  1W01 A;  3EX9 A;  3VGN A;  2GEY A;  3F40 A;  1HKX A;  1O7H B;  3HZP A;  3KE7 A;  1OGX A;  3JUN A;  3JUP A;  1OHS A;  3SOA A;  3K7C A;  5HGR A;  3RGA A;  3LZA A;  3NBR A;  2HMJ B;  5IEP A;  3A76 A;  4HM8 B;  3F7S A;  1GY5 A;  2GBX B;  5G2G A;  4LMI A;  1E97 A;  3OWU A;  1Q40 B;  4ORL A;  4XBT A;  3UJM A;  3KZT A;  3Q90 A;  4HKV B;  2F98 A;  3SED A;  5IF6 A;  3GZR A;  4LEH A;  1O7W B;  2HMN B;  8CHO A;  3HX8 A;  2STD A;  3EJV A;  1E3R A;  3MG1 A;  3FF0 A;  3FGY A;  1O7G B;  4XB5 A;  2W2C A;  5AII A;  3G16 A;  3T8U A;  1JB2 A;  4X2H A;  5CLK A;  3EQQ B;  2GBW B;  3FH1 A;  3JUQ A;  2QGU A;  3FF2 A;  2YFJ B;  4WYK A;  3CNX A;  5D83 A;  3EN8 A;  1CQS A;  3GZX B;  5BVB A;  2K54 A;  4HM1 B;  4XDW A;  7STD A;  5D81 A;  3MHE A;  3F9S A;  2INX A;  1IDP A;  3GRD A;  2XR8 B;  4LGQ A;  4K1U A;  5AEU B;  3EF8 A;  4PEJ A;  4XM4 A;  2F86 B;  3S5C A;  3B4P A;  4L7K A;  2JQ5 A;  3NM2 A;  2XSO B;  1GY7 A;  3I0Y A;  4WP5 A;  4HM3 B;  1EA2 A;  4HM0 B;  4R9K A;  1QJG A;  5IER A;  2IMJ A;  4I4K A;  2XSH B;  2Z76 A;  2BMQ B;  1VZZ A;  3NV0 A;  3NHX A;  5FW5 A;  1C7H A;  5IEN A;  5DRV A;  3EBY A;  3CU3 A;  3B8L A;  1OUN A;  4HZ9 B;  3FSD A;  3JUO A;  2OWP A;  1ASK A;  3G0K A;  1U5O A;  2A15 A;  1OGZ A;  2Z77 A;  3FZW A;  4WYK B;  3H51 A;  3DZL A;  3B4O A;  3MYT A;  5IG0 A;  1JB4 A;  3DM8 A;  4J8T A;  1Q42 A;  1JB5 A;  5CF2 A;  4XBY A;  2BMR B;  4R9L A;  1OHO A;  3DUK A;  4OVM A;  4FCJ A;  1W00 A;  1OCV A;  5CXO A;  4STD A;  5D82 A;  3D9R A;  5TGN A;  1ISK A;  5JPU A;  3UNL A;  1UUW B;  4HM4 B;  4MJD A;  3NUV A;  5IEO A;  5AI1 A;  4FCM A;  2HMM B;  4L8O A;  6STD A;  5KP3 A;  4J9A A;  3K0Z A;  3FKA A;  2B1X B;  3EN1 B;  3NV0 B;  5DRE A;  5KP1 A;  4X2O A;  1UUV B;  1JN5 A;  3EC9 A;  2BNG A;  4IIA A;  1EG9 B;  3T8N A;  1GS3 A;  3OWY A;  3KSP A;  3MKI A;  1TP6 A;  3M8C A;  1A2K A;  5KP4 A;  1E3V A;  4HZB B;  5IG3 A;  4R1K A;  1O7P B;  2QIY A;  2CHC A;  1OF5 A;  1ULJ B;  1NDO B;  5AIF A;  2HMO B;  4K1V A;  3CPO A;  3MG3 A;  3F7X A;  2RGQ A;  1O7N B;  2RCD A;  4XBX A;  4U13 A;  1GYB A;  2F99 A;  3GWR A;  1W6Y A;  5AEW B;  1ULI B;  4HM7 B;  2GEX A;  2HMK B;  4RZM A;  1JKG A;  1JN5 B;  2CKF B;  1NU3 A;  4HJL B;  3B7C A;  5EVH A;  1NWW A; 
#chains in the Genus database with same CATH topology
 1QAK A;  2R41 A;  3PCS A;  2CG1 A;  1GD3 A;  1AVL A;  1UDI I;  3F8H A;  1GOY A;  4LSO A;  3WMD A;  2H0H A;  1DMQ A;  3KFQ C;  4FMA A;  1S5A A;  1TU5 A;  1RTU A;  4FCZ A;  2PZV A;  1KD1 4;  3SVA A;  4CCV A;  3GZY B;  4O2H A;  3FG3 A;  1NNV A;  3UB1 A;  1FGR A;  2RSX A;  1RNB A;  3F14 A;  3FLJ A;  3NBB A;  3S67 A;  1VQ7 3;  3EHC A;  1RGK A;  4N6N B;  1DVD A;  2WOH A;  1NO3 A;  3O8Y A;  4FMD A;  2KRT A;  4LYL B;  5BXQ A;  1CYU A;  5CF1 A;  3OXA A;  2AAE A;  2SAR A;  2P05 A;  4N6O B;  3G6E 3;  3RGR A;  3L0R A;  4MEI A;  1O7M B;  3EBT A;  3ROB A;  2E2V A;  1ZX2 A;  1K41 A;  4HVN A;  3QRD A;  3BNE A;  4XDV A;  1SAR A;  1OF5 B;  3G8Z A;  1OAC A;  1JZO A;  3EE1 A;  3LTD A;  4KVH A;  1Z1S A;  2RNT A;  1HYF A;  2BU4 A;  3KKG A;  2MC8 A;  4N6V 0;  1MOL A;  1STD A;  3K5T A;  1QVF 2;  2HML B;  4O8S A;  5JBS A;  1QMA A;  2UX0 A;  3DXO A;  3X42 A;  1TUH A;  1BNF A;  4ILF A;  3VSY A;  1BAN A;  1K9M 4;  1F8N A;  2KF5 A;  5AIH A;  5M18 A;  1KSI A;  1YIJ 3;  3D3L A;  5STD A;  1JV2 B;  1TFO A;  1YVS A;  4LZI A;  3PGB A;  3CME 3;  3X40 A;  1FGM A;  1HU9 A;  3BB9 A;  1B27 A;  1RMS A;  1AVK A;  1STF I;  2R4I A;  1YNV X;  3E99 A;  2GXF A;  1T5Y A;  1MGW A;  2UGI A;  3CNM A;  5ELJ A;  4HM2 B;  5IG4 A;  4EW5 A;  2GU3 A;  2ZDJ A;  2YFI B;  3PS8 A;  2B24 B;  4N3V A;  1JJ2 2;  1BRG A;  2I9W A;  2MF7 A;  3SYU A;  3MSO A;  1YJ9 3;  3CC4 3;  1I0X A;  1MWR A;  3DMC A;  1ZO2 A;  3CCQ 3;  3CCE 3;  2XFS A;  5IG5 A;  7GSP A;  3VF1 A;  1JKG B;  4MMY B;  3NM7 A;  4L8P A;  3JUM A;  3CPW 2;  5AIG A;  3ECF A;  4Q53 A;  1I3I A;  3F8X A;  1X1W A;  1AY7 A;  2PNC A;  3BLZ A;  3WA2 X;  1CEW I;  1FUW A;  3KN4 A;  1X1Y A;  2Z7A A;  4CDL A;  1CH0 A;  2CFL A;  1BSD A;  1OHP A;  3FCS B;  3JVC A;  3OX9 A;  3WOF B;  1BUQ A;  5CK6 A;  1RGH A;  3IPT A;  3FG4 A;  2W6J H;  4WHA A;  1A2P A;  1Q40 A;  1LVN A;  1VQK 3;  1DET A;  1PY3 A;  1V74 A;  2XEP A;  3DGL A;  3ZG0 A;  1FGQ A;  2QA4 3;  1GY6 A;  3H3H A;  1MGR A;  5FGO A;  4DKI A;  4JF8 A;  3LXU X;  1AR0 A;  1RN7 A;  1EQK A;  1LNI A;  1YGW A;  4EYC A;  2RBI A;  2OQE C;  3Q1C A;  2XFT A;  1FGO A;  1IVV A;  1RGL A;  3ER7 A;  4G1M B;  2GSP A;  4QWT A;  1W02 A;  3HII A;  3STD A;  3SOY A;  1MWS A;  3D4A A;  1BSB A;  2K3D A;  1UUG B;  5JPP A;  2XF3 A;  3MWZ A;  4O3V A;  1D6Z A;  3GZB A;  1WQL B;  1VQ8 3;  5RNT A;  4OUQ A;  4IT7 A;  1DMN A;  4H3U A;  3AGN A;  1QAL A;  3GAX A;  2FXT A;  2XRX B;  3MG2 A;  2BMO B;  1FGT A;  1W4N A;  3QK9 A;  4WWU C;  1SQW A;  5GSP A;  4BTW A;  1S72 3;  1W6G A;  1DMM A;  1BNJ A;  1BIR A;  1BNR A;  4HOH A;  1OPY A;  3RDE A;  8RNT A;  2OCT A;  3V92 A;  3N8B A;  1TRP A;  2YFL B;  1VQO 3;  1PFP A;  3HK4 A;  3NXJ A;  3OWS A;  3CC7 3;  2CFW A;  1IV7 A;  3Q2P A;  1TTO A;  4OK0 A;  3D5I A;  2F5W A;  1VQM 3;  1JBR A;  2P38 A;  1BRH A;  1IT8 A;  1B2Z A;  3URP A;  1OH0 A;  1SJW A;  2KF4 A;  4HM6 B;  3LYG A;  1RGE A;  2D42 A;  1IVU A;  3OV4 A;  1VQ9 3;  4KFD A;  2RFR A;  4GB5 A;  1UI7 A;  1BNI A;  1WTH A;  1W01 A;  1YGE A;  4HM5 B;  5BIR A;  2LYX A;  4KFF A;  3EX9 A;  3VGN A;  1VQ4 3;  2GEY A;  3F40 A;  1BRK A;  2CIU A;  1HKX A;  2CWT A;  1QVG 2;  1O7H B;  3HZP A;  1RRH A;  1NJI 4;  1RKY A;  3KE7 A;  1OGX A;  3D79 A;  3JUN A;  1BRJ A;  3WA3 A;  1W5Z A;  1Q7Y 4;  1LNH A;  3CCU 3;  1SII A;  3EB8 A;  3JUP A;  1OHS A;  3SOA A;  3SXX A;  3K7C A;  1IU7 A;  5HGR A;  1IVX A;  1GD4 A;  1UCI A;  3RGA A;  3LZA A;  2W9Q A;  3NBR A;  4FR9 A;  1HZ1 A;  2KCD A;  2HMJ B;  4BTX A;  5BU4 A;  1RDS A;  5IEP A;  4BL3 A;  2ZL8 A;  1ROV A;  1RN1 A;  2AAD A;  3A76 A;  3F7S A;  2GU1 A;  1GY5 A;  4HM8 B;  2IUJ A;  1BGS A;  2GBX B;  5G2G A;  4LMI A;  2IA7 A;  1E97 A;  1GSP A;  2LQV A;  2C11 A;  3OWU A;  4J5K A;  3ZFZ A;  2XH9 A;  1Q40 B;  1PU4 A;  3I56 3;  4NPB A;  1B2U A;  4ORL A;  1YJN 3;  4XBT A;  3BIR A;  1RLS A;  1B2M A;  3UJM A;  1I2G A;  3KZT A;  1J2B A;  1MWT A;  3LT9 A;  2Y74 A;  2FNQ A;  3Q90 A;  2F98 A;  1Q9E A;  4HKV B;  4O02 B;  1K73 4;  1RGA A;  3SED A;  5IF6 A;  3GZR A;  4LEH A;  1O7W B;  2HMN B;  2WO0 A;  2SBL A;  4CJN A;  2CK3 H;  8CHO A;  1Q7H A;  3HX8 A;  2STD A;  3EJV A;  1ZGX A;  1IQ8 A;  1E3R A;  1TJD A;  3MG1 A;  3FF0 A;  2CFD A;  3FGY A;  4KZ1 A;  1KQS 2;  1VQ5 3;  3WHO A;  3LH4 A;  5M19 A;  3G71 3;  2XGN A;  1O7G B;  4XB5 A;  2W2C A;  5AII A;  2FGT A;  3G16 A;  3T8U A;  1JB2 A;  4X2H A;  4NHF A;  1BU4 A;  5CLK A;  4N6M A;  2L4V A;  3LML A;  1N5H A;  2CX0 A;  3EQQ B;  2GBW B;  3CC2 3;  3FH1 A;  1I70 A;  2QGU A;  3FF2 A;  2W56 A;  3JUQ A;  2YFJ B;  4WYK A;  3CNX A;  5LC6 A;  2V1L A;  1X1X A;  5D83 A;  3EN8 A;  2OOV C;  3CCV 3;  1W2B 2;  2IUK A;  1CQS A;  3GZX B;  3X41 A;  3NQY A;  5BVB A;  2K54 A;  3DGO A;  4HM1 B;  1RNT A;  3KSE D;  4XDW A;  4RNY A;  3CD6 3;  4I5Q A;  1TIJ A;  1ZS7 A;  7STD A;  5D81 A;  3SLU A;  2QEX 3;  3MHE A;  1UCL A;  5G1K A;  3F9S A;  2ZHX B;  3DGM A;  2INX A;  2F56 A;  1YIT 3;  1IDP A;  2CFK A;  1VQ6 3;  2O3O A;  1D6Y A;  1VQP 3;  1BRS A;  1GOV A;  3GRD A;  5IW9 A;  1I3F A;  1KWI A;  2XR8 B;  2CW9 A;  3G4S 3;  1MNL A;  4N6U A;  4LGQ A;  4K1U A;  5AEU B;  4N6L A;  1LXE A;  3EF8 A;  4PEJ A;  4XM4 A;  5A0O B;  1TRQ A;  2F86 B;  1UCJ A;  3BND A;  1UI8 A;  3S5C A;  3B4P A;  4L7K A;  2JQ5 A;  3NM2 A;  1RSN A;  1GY7 A;  2XSO B;  2ML6 A;  3I0Y A;  4WP5 A;  1WNH A;  4HM3 B;  1T2I A;  4GL6 A;  1DE3 A;  2O9U X;  2W04 A;  1EA2 A;  1UGH I;  3GSP A;  4KFE A;  4HM0 B;  4R9K A;  4EXR A;  3MPH A;  1QJG A;  1N8R 4;  5IER A;  1NB5 I;  2IMJ A;  3PZW A;  4JRF A;  1MWU A;  2CWV A;  1NB3 I;  4BL2 A;  1N9E A;  1Y4K A;  3IMA B;  4I4K A;  2XSH B;  1D6U A;  5M1A A;  3CCR 3;  1SPU A;  2IY2 A;  1RCL A;  2Z76 A;  3CMA 3;  2BMQ B;  4TX4 A;  1VZZ A;  3N54 B;  3NV0 A;  1IT7 A;  3NHX A;  1IK3 A;  2CG0 A;  3J7Y d;  5FW5 A;  1C7H A;  1BVI A;  1LOY A;  5IEN A;  3WR2 A;  5DRV A;  1SIH A;  1WMP A;  2CWU A;  3EBY A;  3CU3 A;  1W2Z A;  2CX1 A;  2M7O A;  1RGG A;  2KAA A;  3B8L A;  4MMZ B;  1OUN A;  1BNG A;  1BNE A;  4HZ9 B;  2JDI H;  3LTC A;  3FSD A;  3JUO A;  4BIR A;  3T0U A;  3D5G A;  2OWP A;  2P0X A;  2CFG A;  2WGO A;  1Q82 4;  1TFK A;  1AV4 A;  2IYJ A;  2WOF A;  3A5E A;  3CCM 3;  1ASK A;  2OTJ 3;  3PXM A;  3G0K A;  1LOW A;  4H61 A;  1YJW 3;  3BU4 A;  3AHS A;  1U5O A;  1I8V A;  4WFO A;  2KF3 A;  2A15 A;  1OGZ A;  2C4B A;  2WGQ A;  2Z77 A;  2OOV A;  2W56 B;  1US1 A;  3FG1 A;  3FZW A;  4WYK B;  4AKY A;  1RCK A;  2CC3 A;  1BAO A;  3H51 A;  3DZL A;  4AEQ A;  2Z6B A;  1YI2 3;  2BT3 A;  4RNZ A;  1LQG C;  1FUT A;  3B4O A;  3MYT A;  5IG0 A;  2C10 A;  4EC6 A;  1JB4 A;  3KII A;  3DM8 A;  4J8T A;  1Q42 A;  2P09 A;  1BOX A;  1T2H A;  1JB5 A;  5CF2 A;  4XBY A;  2BMR B;  3BNC A;  4R9L A;  3RNT A;  3S27 A;  1UGI A;  1OHO A;  1VQN 3;  1V57 A;  3DUK A;  1I2F A;  3LTB A;  4OVM A;  3X3Y A;  4CPK A;  2W0Q A;  3KCH A;  1W00 A;  4FCJ A;  4HAA A;  4NRE A;  1OCV A;  1GOU A;  1QAF A;  1V58 A;  1BSE A;  5CXO A;  4STD A;  5D82 A;  3U1W A;  3V99 A;  3I55 3;  1Q86 4;  1B21 A;  3D9R A;  3PCR A;  1VQQ A;  3DGN A;  1B2X A;  5TGN A;  3CXC 2;  1ISK A;  2OQE A;  5JPU A;  3UNL A;  6RNT A;  1RRL A;  1UUW B;  4HM4 B;  3LOY A;  4MJD A;  5G1L A;  3Q3F A;  3N9H A;  1M90 4;  3NUV A;  5IEO A;  1IV9 A;  5AYS C;  5AYR B;  1A2V A;  4EV2 A;  4BU4 A;  5AI1 A;  4FCM A;  3HI7 A;  2HMM B;  4L8O A;  6STD A;  1GMR A;  1X1U A;  1EEJ A;  5HOH A;  1YHQ 3;  1WMN A;  2BHM A;  5KP3 A;  6GSP A;  4J9A A;  1RGC A;  4KT3 B;  3K0Z A;  1IYY A;  2W9P A;  2OTL 3;  4K90 B;  1FUS A;  1BNS A;  2B1X B;  1EUI C;  3EN1 B;  2H0I A;  3FKA A;  3NV0 B;  5DRE A;  2KF6 A;  5KP1 A;  4X2O A;  1W7C A;  1R4Y A;  1UUV B;  1U8C B;  2F4Y A;  2HOH A;  4EBG A;  1L5G B;  5I97 A;  2XGL A;  3TDG A;  3S29 A;  1R4C A;  1RJO A;  1IQY A;  1FW7 A;  1N8Q A;  3NBJ A;  1JN5 A;  3EC9 A;  3CCJ 3;  4K61 A;  1M9G A;  2H0G A;  4N6T A;  1N5P A;  3AMO A;  1A67 A;  1VQL 3;  1G02 A;  2BNG A;  2L1S A;  4IIA A;  1K8A 4;  1CYV A;  1GMP A;  1BSA A;  1DYU A;  1EG9 B;  3T8N A;  3CCL 3;  1JBT A;  1GS3 A;  3WOE B;  3S28 A;  1G0T A;  1I0V A;  2ML5 A;  3OWY A;  1JNQ A;  3KSP A;  3MKI A;  3ZG5 A;  3X3X A;  4R80 A;  2UUG C;  3IJE B;  1RGF A;  2W03 A;  5ELU A;  1TP6 A;  4EV5 A;  1RHL A;  1B20 A;  4FMB A;  3M8C A;  4AKZ A;  2CH9 A;  1ROA A;  1A2K A;  1B3S A;  1E3V A;  3AHW A;  1DVC A;  5KP4 A;  4HZB B;  2E2T A;  1M1K 4;  3V98 A;  4RBN A;  2P0M A;  5IG3 A;  1BRI A;  1BSC A;  3K63 A;  1IQX A;  2D1W A;  3NQZ A;  4FMC A;  4R1K A;  1O7P B;  3CCS 3;  2QIY A;  5EQL A;  4GHO A;  1B2S A;  2CHC A;  1FA3 A;  1M1X B;  4IPB A;  1Q81 4;  1G96 A;  1EKM A;  3DGY A;  1OF5 A;  2J8X B;  7RNT A;  1LOV A;  1ULJ B;  5EEO A;  3DH2 A;  1NDO B;  3OW2 2;  5AIF A;  3LT8 A;  1WMO A;  2HMO B;  1JRQ A;  4K1V A;  3CPO A;  3MG3 A;  3U97 A;  3WDG B;  3F7X A;  2F5M A;  2Q07 A;  1JBS A;  1KC8 4;  2RGQ A;  4HBR A;  3HOH A;  9RNT A;  1GMQ A;  1PYL A;  3K9M C;  1T3B A;  1O7N B;  1UW1 A;  3AGO A;  4RNT A;  2RCD A;  4XBX A;  2BO9 B;  1W6C A;  1LOX A;  1AQZ A;  4U13 A;  1GYB A;  2YX9 A;  2F99 A;  1FYS A;  1I2E A;  1UCK A;  3GWR A;  1W6Y A;  4J5G A;  2ZA4 A;  3SX1 A;  3UL5 A;  5AEW B;  3PYJ A;  4GSP A;  3DY5 A;  1JZD A;  3X3Z A;  4ZM8 A;  2K0M A;  1ULI B;  2Y73 A;  4HM7 B;  2GEX A;  1BUJ A;  1N9J A;  1IVW A;  5LC7 A;  4BTY A;  1FZU A;  4R4K A;  3HIG A;  1K28 A;  3BNB A;  2HMK B;  4MMX B;  1LQM B;  1RN4 A;  1JKG A;  1LRA A;  4RZM A;  3LTA A;  2E2U A;  1JN5 B;  2CKF B;  1NU3 A;  2BIR A;  2KXG A;  3WOD G;  4HYZ A;  1YVB I;  4HJL B;  3B7C A;  3ALA A;  3AMO B;  3NX0 A;  5EVH A;  1NWW A;  1A90 A;  1C54 A;  3UL6 A;  1BRN L; 
#chains in the Genus database with same CATH homology
 1QAK A;  3PCS A;  2CG1 A;  1GD3 A;  1AVL A;  3F8H A;  4LSO A;  3WMD A;  1DMQ A;  3KFQ C;  4FMA A;  1S5A A;  1TU5 A;  4FCZ A;  2PZV A;  1KD1 4;  3SVA A;  4CCV A;  3GZY B;  4O2H A;  3FG3 A;  3UB1 A;  1FGR A;  2RSX A;  3F14 A;  3FLJ A;  3NBB A;  3S67 A;  1VQ7 3;  3EHC A;  4N6N B;  1DVD A;  2WOH A;  1NO3 A;  3O8Y A;  4FMD A;  2KRT A;  5BXQ A;  1CYU A;  5CF1 A;  3OXA A;  3G6E 3;  4N6O B;  2P05 A;  3RGR A;  3L0R A;  4MEI A;  1O7M B;  3EBT A;  3ROB A;  2E2V A;  1ZX2 A;  1K41 A;  4HVN A;  3QRD A;  3BNE A;  4XDV A;  1OF5 B;  3G8Z A;  1OAC A;  3EE1 A;  3LTD A;  4KVH A;  1Z1S A;  2MC8 A;  3KKG A;  4N6V 0;  1MOL A;  1STD A;  3K5T A;  1QVF 2;  2HML B;  4O8S A;  5JBS A;  1QMA A;  2UX0 A;  3DXO A;  3X42 A;  1TUH A;  3VSY A;  1K9M 4;  1F8N A;  5AIH A;  1KSI A;  1YIJ 3;  3D3L A;  5STD A;  1JV2 B;  1TFO A;  4LZI A;  3PGB A;  3CME 3;  3X40 A;  1FGM A;  1HU9 A;  3BB9 A;  1STF I;  3E99 A;  1AVK A;  2R4I A;  2GXF A;  1T5Y A;  3CNM A;  5ELJ A;  4HM2 B;  5IG4 A;  2GU3 A;  2ZDJ A;  2YFI B;  3PS8 A;  2B24 B;  4N3V A;  1JJ2 2;  2I9W A;  2MF7 A;  3MSO A;  1YJ9 3;  3CC4 3;  3DMC A;  1ZO2 A;  3CCQ 3;  3CCE 3;  2XFS A;  5IG5 A;  3VF1 A;  1JKG B;  4MMY B;  3NM7 A;  4L8P A;  3JUM A;  3CPW 2;  5AIG A;  3ECF A;  4Q53 A;  3F8X A;  2PNC A;  3BLZ A;  3WA2 X;  1CEW I;  1FUW A;  3KN4 A;  2Z7A A;  4CDL A;  2CFL A;  1OHP A;  3FCS B;  3JVC A;  3OX9 A;  3WOF B;  1BUQ A;  5CK6 A;  3IPT A;  3FG4 A;  2W6J H;  4WHA A;  1Q40 A;  1LVN A;  1VQK 3;  1V74 A;  2XEP A;  3DGL A;  1FGQ A;  2QA4 3;  1GY6 A;  3H3H A;  5FGO A;  4JF8 A;  3LXU X;  1AR0 A;  1RN7 A;  1EQK A;  4EYC A;  2OQE C;  3Q1C A;  2XFT A;  1FGO A;  1IVV A;  3ER7 A;  4G1M B;  4QWT A;  1W02 A;  3HII A;  3STD A;  3SOY A;  5JPP A;  2XF3 A;  3MWZ A;  4O3V A;  1D6Z A;  3GZB A;  1WQL B;  1VQ8 3;  4OUQ A;  4IT7 A;  1DMN A;  4H3U A;  1QAL A;  3GAX A;  2FXT A;  2XRX B;  3MG2 A;  2BMO B;  1FGT A;  1W4N A;  3QK9 A;  4WWU C;  1SQW A;  1S72 3;  4BTW A;  1W6G A;  1DMM A;  1OPY A;  3RDE A;  2OCT A;  3V92 A;  3N8B A;  1VQO 3;  2YFL B;  1PFP A;  3HK4 A;  3NXJ A;  3OWS A;  3CC7 3;  2CFW A;  1IV7 A;  3Q2P A;  4OK0 A;  1VQM 3;  2P38 A;  1IT8 A;  1OH0 A;  1SJW A;  4HM6 B;  3LYG A;  2D42 A;  1IVU A;  3OV4 A;  1VQ9 3;  4KFD A;  2RFR A;  4GB5 A;  1UI7 A;  1WTH A;  4HM5 B;  1W01 A;  1YGE A;  2LYX A;  4KFF A;  3EX9 A;  3VGN A;  1VQ4 3;  2GEY A;  3F40 A;  2CIU A;  1HKX A;  2CWT A;  1QVG 2;  1O7H B;  3HZP A;  1RRH A;  1NJI 4;  1RKY A;  3KE7 A;  1OGX A;  3JUN A;  3WA3 A;  1W5Z A;  1Q7Y 4;  1LNH A;  3CCU 3;  1SII A;  3EB8 A;  3JUP A;  1OHS A;  3SOA A;  3SXX A;  3K7C A;  1IU7 A;  5HGR A;  1IVX A;  1GD4 A;  3RGA A;  3LZA A;  2W9Q A;  3NBR A;  4FR9 A;  2KCD A;  2HMJ B;  4BTX A;  5IEP A;  2ZL8 A;  1ROV A;  3A76 A;  3F7S A;  4HM8 B;  2GU1 A;  1GY5 A;  2IUJ A;  2GBX B;  5G2G A;  4LMI A;  2IA7 A;  1E97 A;  2LQV A;  2C11 A;  3OWU A;  2XH9 A;  1Q40 B;  1PU4 A;  3I56 3;  4ORL A;  1YJN 3;  4XBT A;  3UJM A;  3KZT A;  1J2B A;  3LT9 A;  2Y74 A;  2FNQ A;  3Q90 A;  2F98 A;  4HKV B;  4O02 B;  1K73 4;  3SED A;  5IF6 A;  3GZR A;  4LEH A;  1O7W B;  2HMN B;  2WO0 A;  2SBL A;  2CK3 H;  8CHO A;  3HX8 A;  2STD A;  3EJV A;  1IQ8 A;  1E3R A;  3MG1 A;  3FF0 A;  2CFD A;  3FGY A;  4KZ1 A;  1KQS 2;  1VQ5 3;  3LH4 A;  3G71 3;  2XGN A;  1O7G B;  4XB5 A;  2W2C A;  5AII A;  2FGT A;  3G16 A;  3T8U A;  1JB2 A;  4X2H A;  4NHF A;  5CLK A;  4N6M A;  2L4V A;  3LML A;  1N5H A;  3CC2 3;  3EQQ B;  2GBW B;  3FH1 A;  3JUQ A;  2QGU A;  3FF2 A;  2W56 A;  2YFJ B;  4WYK A;  3CNX A;  5LC6 A;  2V1L A;  5D83 A;  3EN8 A;  2OOV C;  3CCV 3;  1W2B 2;  2IUK A;  1CQS A;  3GZX B;  3X41 A;  3NQY A;  5BVB A;  2K54 A;  3DGO A;  4HM1 B;  3KSE D;  4XDW A;  4RNY A;  3CD6 3;  1TIJ A;  7STD A;  5D81 A;  3SLU A;  2QEX 3;  3MHE A;  3F9S A;  3DGM A;  2INX A;  1YIT 3;  1IDP A;  2CFK A;  1VQ6 3;  2O3O A;  1D6Y A;  1VQP 3;  3GRD A;  5IW9 A;  1KWI A;  2XR8 B;  2CW9 A;  3G4S 3;  1MNL A;  4N6U A;  4LGQ A;  4K1U A;  5AEU B;  4N6L A;  1LXE A;  3EF8 A;  4PEJ A;  4XM4 A;  5A0O B;  2F86 B;  3BND A;  1UI8 A;  3S5C A;  3B4P A;  4L7K A;  2JQ5 A;  3NM2 A;  2XSO B;  1GY7 A;  3I0Y A;  2ML6 A;  4WP5 A;  1WNH A;  4HM3 B;  4GL6 A;  2O9U X;  2W04 A;  1EA2 A;  4KFE A;  4HM0 B;  4R9K A;  4EXR A;  3MPH A;  1QJG A;  1N8R 4;  5IER A;  1NB5 I;  2IMJ A;  3PZW A;  4JRF A;  2CWV A;  1NB3 I;  1N9E A;  1Y4K A;  3IMA B;  4I4K A;  2XSH B;  1D6U A;  3CCR 3;  1SPU A;  2Z76 A;  3CMA 3;  2BMQ B;  4TX4 A;  1VZZ A;  3N54 B;  3NV0 A;  1IT7 A;  3NHX A;  1IK3 A;  2CG0 A;  3J7Y d;  5FW5 A;  1C7H A;  5IEN A;  5DRV A;  1SIH A;  1WMP A;  2CWU A;  3EBY A;  3CU3 A;  1W2Z A;  2M7O A;  3B8L A;  4MMZ B;  1OUN A;  4HZ9 B;  2JDI H;  3LTC A;  3FSD A;  3JUO A;  3T0U A;  2OWP A;  2P0X A;  2CFG A;  2WGO A;  1Q82 4;  1TFK A;  1AV4 A;  2WOF A;  3CCM 3;  2OTJ 3;  1ASK A;  3PXM A;  3G0K A;  4H61 A;  1YJW 3;  1U5O A;  4WFO A;  2A15 A;  1OGZ A;  2WGQ A;  2Z77 A;  4AKY A;  2OOV A;  2W56 B;  1US1 A;  3FG1 A;  3FZW A;  4WYK B;  3H51 A;  2CC3 A;  3DZL A;  4AEQ A;  2Z6B A;  1YI2 3;  2BT3 A;  4RNZ A;  3B4O A;  3MYT A;  5IG0 A;  2C10 A;  4EC6 A;  1JB4 A;  3KII A;  3DM8 A;  4J8T A;  1Q42 A;  2P09 A;  1JB5 A;  5CF2 A;  4XBY A;  2BMR B;  3BNC A;  4R9L A;  3S27 A;  1OHO A;  1VQN 3;  3DUK A;  3LTB A;  4OVM A;  3X3Y A;  2W0Q A;  4FCJ A;  1W00 A;  4NRE A;  1OCV A;  1QAF A;  3I55 3;  5CXO A;  4STD A;  5D82 A;  3U1W A;  3V99 A;  1Q86 4;  3D9R A;  3PCR A;  3DGN A;  3CXC 2;  5TGN A;  1ISK A;  2OQE A;  5JPU A;  3UNL A;  1RRL A;  1UUW B;  4HM4 B;  3LOY A;  4MJD A;  1M90 4;  3N9H A;  3NUV A;  5IEO A;  1IV9 A;  5AYS C;  5AYR B;  1A2V A;  4EV2 A;  5AI1 A;  4FCM A;  3HI7 A;  2HMM B;  4L8O A;  6STD A;  1YHQ 3;  1WMN A;  2BHM A;  5KP3 A;  4J9A A;  3K0Z A;  2W9P A;  2OTL 3;  4K90 B;  3FKA A;  2B1X B;  3EN1 B;  3NV0 B;  5DRE A;  5KP1 A;  4X2O A;  1W7C A;  1UUV B;  1U8C B;  5I97 A;  4EBG A;  1L5G B;  2XGL A;  3TDG A;  3S29 A;  1R4C A;  1RJO A;  1IQY A;  1N8Q A;  3NBJ A;  1JN5 A;  3EC9 A;  3CCJ 3;  4K61 A;  1M9G A;  4N6T A;  1N5P A;  3AMO A;  1A67 A;  1VQL 3;  2BNG A;  4IIA A;  1K8A 4;  1CYV A;  1DYU A;  1EG9 B;  3T8N A;  3CCL 3;  1GS3 A;  3WOE B;  3S28 A;  2ML5 A;  3OWY A;  1JNQ A;  3KSP A;  3MKI A;  3X3X A;  4R80 A;  3IJE B;  5ELU A;  2W03 A;  1TP6 A;  4EV5 A;  4FMB A;  3M8C A;  4AKZ A;  2CH9 A;  1ROA A;  1A2K A;  5KP4 A;  1E3V A;  1DVC A;  4HZB B;  2E2T A;  1M1K 4;  3V98 A;  4RBN A;  2P0M A;  5IG3 A;  3K63 A;  4R1K A;  3NQZ A;  1IQX A;  2D1W A;  4FMC A;  3CCS 3;  1O7P B;  2QIY A;  5EQL A;  2CHC A;  1FA3 A;  1M1X B;  4IPB A;  1Q81 4;  1G96 A;  1EKM A;  1OF5 A;  1ULJ B;  5EEO A;  1NDO B;  3OW2 2;  5AIF A;  3LT8 A;  1WMO A;  2HMO B;  1JRQ A;  4K1V A;  3CPO A;  3MG3 A;  3U97 A;  3WDG B;  3F7X A;  2Q07 A;  1KC8 4;  2RGQ A;  4HBR A;  3K9M C;  1UW1 A;  1O7N B;  2RCD A;  4XBX A;  2BO9 B;  1W6C A;  1LOX A;  4U13 A;  1GYB A;  2YX9 A;  2F99 A;  3GWR A;  1W6Y A;  3SX1 A;  3UL5 A;  5AEW B;  3PYJ A;  3X3Z A;  3DY5 A;  4ZM8 A;  2K0M A;  1ULI B;  2Y73 A;  4HM7 B;  2GEX A;  1N9J A;  1IVW A;  5LC7 A;  4BTY A;  4R4K A;  3HIG A;  1K28 A;  3BNB A;  2HMK B;  4MMX B;  4RZM A;  1JKG A;  3LTA A;  2E2U A;  1JN5 B;  2CKF B;  1NU3 A;  2KXG A;  3WOD G;  4HYZ A;  1YVB I;  4HJL B;  3B7C A;  3ALA A;  3AMO B;  3NX0 A;  5EVH A;  1NWW A;  1A90 A;  3UL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...