3GRDA

Crystal structure of ntf2-superfamily protein with unknown function (np_977240.1) from bacillus cereus atcc 10987 at 1.25 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
MPKANLEIIRSTYEGSASSNAKHLAEALSEKVEWTEAEGFPYGGTYIGVEAIMENVFSRLGSEWNDYKASVNMYHEVSGKDVIIAEGMYSGVYKDTGKSFEAEFVHVWQLENGKIVKFKQYVDSHLVREAMKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized NTF2-superfamily protein
publication title Crystal structure of NTF2-superfamily protein with unknown function (NP_977240.1) from BACILLUS CEREUS ATCC 10987 at 1.25 A resolution
rcsb
source organism Bacillus cereus atcc 10987
total genus 44
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3grdA00
1ZX2A 3GRDA 3JUQA 3UNLA 4J9AA 1S5AA 3G8ZA 4XBXA 1ASKA 3JUMA 4GB5A 1E3RA 5KP4A 1O7MB 5HGRA 4WWUC 3MYTA 3HK4A 1STDA 2B1XB 3SOAA 5AIIA 1NU3A 2CHCA 1OGXA 2F98A 2HMJB 3MG3A 1JKGA 4K1UA 1OH0A 1O7PB 4HVNA 1OUNA 1TP6A 3FH1A 5JPUA 4H3UA 1DMQA 2GBXB 3A76A 1UUVB 3F14A 1JB2A 2CKFB 3DZLA 3FZWA 3MHEA 3MG1A 3F40A 3DUKA 4HJLB 2XSOB 3K7CA 4HM2B 2HMMB 5FW5A 3EBTA 3WMDA 1W01A 2RGQA 1OHOA 5G2GA 3CPOA 1JKGB 2B24B 4HM4B 5CF1A 2PZVA 3OWYA 4XB5A 5DREA 5D82A 1EG9B 6STDA 4J8TA 3GZYB 1Q42A 3G0KA 3F8XA 4X2OA 4X2HA 3T8NA 3B8LA 2OWPA 3EN8A 7STDA 3MG2A 5IF6A 3I0YA 4WYKA 4Q53A 4MJDA 1GY5A 4U13A 2UX0A 2F86B 5AIHA 2BMQB 4OUQA 4HM0B 3EQQB 3K0ZA 1E97A 2JQ5A 1ULJB 1OCVA 1C7HA 1VZZA 4WYKB 3KZTA 1ZO2A 5BXQA 3FLJA 2QGUA 3OXAA 3EHCA 4R1KA 4KVHA 1E3VA 3FF0A 2YFJB 5IERA 2QIYA 3KSPA 5CF2A 3KE7A 3NM2A 3FF2A 2XSHB 5KP3A 3EJVA 2GEYA 2GEXA 3NXJA 5AEWB 3ROBA 1HKXA 3FGYA 3B4PA 5AIGA 1A2KA 1NWWA 3JUOA 4L8PA 4LGQA 1AR0A 3IPTA 3DM8A 1OPYA 3FKAA 4HZ9B 1SJWA 3S5CA 3OWUA 4HM7B 4N3VA 2GXFA 3CNMA 3HZPA 1GS3A 2Z7AA 2A15A 4R9KA 4STDA 2HMNB 1O7HB 3B7CA 4R9LA 2XR8B 4HZBB 5D81A 3F7SA 1O7GB 3F7XA 5KP1A 1JB4A 4HM8B 3EX9A 1QJGA 4LMIA 2IMJA 2RCDA 1U5OA 3GZBA 4HM1B 3VSYA 2YFLB 1OGZA 3F9SA 3DXOA 3H51A 3NV0A 8CHOA 1OHSA 5TGNA 1W6YA 1O7NB 5IG4A 4HM3B 3EC9A 3B4OA 1EA2A 2HMKB 3LYGA 2Z77A 3OX9A 4IIAA 5IENA 1JB5A 3NHXA 3VGNA 3MSOA 1NDOB 3GWRA 1Q40A 1W02A 1QMAA 3UJMA 5IG3A 1K41A 4XM4A 2HMLB 2K54A 3NV0B 3RGRA 3MKIA 5AEUB 3ER7A 3FSDA 4HKVB 2BMOB 4I4KA 3RGAA 3JUPA 5STDA 3F8HA 3EF8A 1TUHA 4XBTA 5CK6A 5IEOA 5EVHA 4FCJA 4L8OA 3D9RA 4XDVA 4K1VA 4LEHA 3DMCA 1Q40B 3OV4A 3SEDA 1GY6A 3HX8A 2I9WA 3NBRA 2INXA 3Q90A 3BB9A 1DMMA 3SOYA 5IEPA 1Z1SA 5D83A 5CXOA 1OF5A 5DRVA 2YFIB 3GZRA 1JN5A 1WQLB 3E99A 2F99A 5AI1A 3JUNA 1BUQA 4OVMA 1ULIB 2STDA 4HM6B 1ISKA 3EN1B 3BLZA 4FCMA 4XDWA 1GYBA 3CNXA 3KKGA 1W00A 2BNGA 1CQSA 3ECFA 3OWSA 5AIFA 5CLKA 2XRXB 4RZMA 3NUVA 2Z76A 1OF5B 1JN5B 5IG0A 4XBYA 2R4IA 4PEJA 2GBWB 3M8CA 3GZXB 3LZAA 2BMRB 2W2CA 3T8UA 1GY7A 4WP5A 5JPPA 2HMOB 3CU3A 3EBYA 3G16A 4L7KA 1UUWB 1DMNA 2RFRA 1IDPA 3STDA 1OHPA 1O7WB 3H3HA 5BVBA 4HM5B 5IG5A 4ORLA 4CDLA
chains in the Genus database with same CATH superfamily
3SLUA 1A2PA 1ZX2A 3GRDA 3JUQA 2J8XB 3UNLA 4J9AA 1S5AA 3BNCA 1BRJA 4QWTA 1YHQ3 3G8ZA 4XBXA 9RNTA 1ASKA 1W4NA 3JUMA 1RGFA 4GB5A 1FGTA 1MOLA 1E3RA 3X3XA 5KP4A 1O7MB 5HGRA 1FYSA 1IK3A 1YJN3 4WWUC 3MYTA 1BGSA 2C4BA 2CX0A 1ROVA 3VF1A 3HK4A 1PFPA 1STDA 2B1XB 2H0IA 3QRDA 4HBRA 3SOAA 5AIIA 2Y73A 1NU3A 1US1A 2CHCA 4KFFA 1B2UA 1Y4KA 1FZUA 1OGXA 1SQWA 4K61A 2P38A 3LTBA 2F98A 1FUSA 1X1WA 3UL5A 2HMJB 1STFI 1LOXA 3MG3A 1TRPA 1S723 1RNTA 1NJI4 2RBIA 4OK0A 4ORLA 1VQM3 3EB8A 2HOHA 3KFQC 1BNEA 1JKGA 5EQLA 2CX1A 4K1UA 1OH0A 2IUJA 2L4VA 2W9QA 3S28A 1O7PB 1MWUA 4HVNA 1OUNA 1TP6A 1RGKA 1RGHA 1RTUA 1CYVA 3FH1A 1T2HA 1I3IA 2AADA 5M1AA 5JPUA 3SVAA 4H3UA 5HOHA 3FG1A 1DMQA 2GBXB 1RN1A 3A76A 3LT9A 3N9HA 3O8YA 3LOYA 2D42A 1UUVB 1BOXA 2C11A 2H0HA 3BIRA 1LXEA 1GOVA 3F14A 1JB2A 2BU4A 1D6UA 1RHLA 2P09A 3WA2X 1YIT3 2CKFB 1W7CA 4J5KA 1N5HA 3DZLA 3FZWA 3MHEA 1JBTA 3MG1A 1RDSA 1JBRA 3F40A 3DUKA 4HJLB 2XSOB 3K7CA 4HM2B 2HMMB 2OCTA 4ILFA 5ELJA 3DGLA 5FW5A 3EBTA 3WMDA 1W01A 1IVVA 4EBGA 2OTJ3 2CFLA 2XH9A 4DKIA 2RGQA 1OHOA 1GOUA 1PU4A 5G2GA 3CPOA 1HZ1A 1G02A 1JKGB 2B24B 1TU5A 2M7OA 4HM4B 5CF1A 2KF6A 1T5YA 2PZVA 3OWYA 3PZWA 4XB5A 5DREA 1JZDA 1JRQA 5D82A 2LYXA 4G1MB 3DGMA 1EG9B 4O8SA 6STDA 4J8TA 3GZYB 3WDGB 1UDII 1BNIA 1Q42A 3ZFZA 4O3VA 3CXC2 3G0KA 3S27A 2XEPA 3F8XA 1UUGB 2KRTA 2W9PA 4EV5A 4MMXB 2CFDA 3PGBA 4X2OA 2XGLA 2CWTA 1UCIA 4BTYA 1FW7A 4X2HA 1AV4A 2FGTA 1FGOA 2ML6A 3T8NA 3B8LA 2OWPA 3EN8A 3G713 2W03A 2W04A 1AQZA 7STDA 1MGWA 1NNVA 3LXUX 6GSPA 1GSPA 1RCLA 3MG2A 3DY5A 5IF6A 1I0VA 4AKZA 1PYLA 3FCSB 2CG1A 5M18A 1R4CA 1A67A 3CCU3 3I0YA 3LMLA 4WYKA 2CK3H 2FXTA 4KZ1A 4RNTA 1YGWA 1YVBI 3HIGA 4Q53A 4MJDA 1KD14 1Q9EA 1N9EA 1RN7A 5LC6A 1GY5A 2CW9A 4U13A 2BHMA 3URPA 1RRLA 1LVNA 3GSPA 2IY2A 1G0TA 2UX0A 1BIRA 1AVLA 3V92A 1CYUA 1TRQA 5ELUA 2F86B 5AIHA 4CPKA 1FGMA 1YJ93 1LOWA 1YNVX 2BMQB 4KFDA 4OUQA 4HM0B 1LNHA 1HU9A 2XFSA 3EQQB 3K0ZA 1E97A 1PY3A 2KCDA 1GMQA 2JQ5A 1ULJB 4WFOA 1OCVA 3RDEA 1UCJA 3D4AA 3G6E3 1C7HA 1MNLA 4LYLB 1D6ZA 1LRAA 5LC7A 1IVWA 4AEQA 1BSDA 1RJOA 3CC23 1N5PA 1W5ZA 1VZZA 3ZG5A 3KSED 1T2IA 4WYKB 3KZTA 1ZO2A 2XF3A 1BRKA 3FLJA 3HOHA 1X1XA 4N6OB 5BXQA 2CIUA 3CCV3 3SXXA 1LOVA 2QGUA 5RNTA 1MWSA 4MMYB 1WMOA 2V1LA 3OXAA 3RNTA 2E2UA 3EHCA 4R1KA 4TX4A 4KVHA 4RBNA 3X3YA 1E3VA 1I2FA 1MGRA 1MWRA 3FF0A 4I5QA 1KWIA 3CMA3 2YFJB 5IERA 1Q7Y4 2QIYA 1WNHA 1RGCA 3KSPA 3PCRA 3WODG 3I563 2BO9B 4EXRA 1SARA 1UW1A 5CF2A 3KE7A 1EKMA 3NM2A 1WMNA 4N6NB 3FF2A 4FMCA 2XSHB 3X42A 5KP3A 1QVF2 3EJVA 2GEYA 2Q07A 1X1UA 2GEXA 1GD4A 3NXJA 1M9GA 3PS8A 3WHOA 5AEWB 4R80A 1ZGXA 3ROBA 1W6GA 3UL6A 1BRSA 1HKXA 3LH4A 1JBSA 3FGYA 3B4PA 4EV2A 5AIGA 1U8CB 2Z6BA 2F5MA 5FGOA 3WOEB 4WHAA 1TJDA 1GOYA 1SPUA 5BIRA 3BU4A 1LQMB 1A2KA 1UCLA 1VQ73 1NWWA 3JUOA 1L5GB 4L8PA 1KQS2 2C10A 4EC6A 1BNSA 3SX1A 3CCR3 2KF5A 6RNTA 2SARA 4LGQA 1AVKA 1AR0A 3IPTA 1K8A4 1TIJA 1OPYA 3DM8A 3FKAA 1SJWA 4HZ9B 2O3OA 3OWUA 3S5CA 1K28A 1YIJ3 4N6MA 2IA7A 2KF3A 3DH2A 4HAAA 4HM7B 1UI7A 1I8VA 1BRIA 4N3VA 1N8R4 4FMAA 3Q2PA 4BTXA 2GXFA 3NQYA 2IYJA 3AGOA 4JRFA 3D79A 3SYUA 3A5EA 3CNMA 3HZPA 3N54B 4CJNA 1GS3A 3NBJA 1A90A 3CC73 2Z7AA 1IQ8A 1GMRA 2A15A 3L0RA 1RSNA 4R9KA 1FGRA 3LTCA 3X40A 4MMZB 4STDA 2HMNB 1O7HB 3LTAA 1BSAA 2QEX3 1BVIA 3B7CA 1RGGA 2XR8B 4HZBB 4O2HA 4R9LA 4BL3A 5D81A 1NB3I 3F7SA 1O7GB 3F7XA 4FR9A 3WOFB 3Q1CA 5KP1A 1JB4A 2MF7A 3K63A 4HM8B 2CFGA 1B27A 2RNTA 3S67A 3EX9A 2JDIH 2XFTA 3CD63 3FG3A 3EE1A 7GSPA 3FG4A 1V74A 4CCVA 4J5GA 1TFOA 1QJGA 3K9MC 1ROAA 2IMJA 4LMIA 1RCKA 2F4YA 2RCDA 1NB5I 1U5OA 1X1YA 3GZBA 2GU3A 3DGYA 4HM1B 3LTDA 1VQN3 1JZOA 4EW5A 1R4YA 3VSYA 2R41A 1UI8A 1RGAA 1RLSA 5A0OB 3D3LA 2YFLB 3D5GA 1OGZA 1RMSA 3F9SA 4HYZA 4NPBA 2D1WA 2K0MA 3DXOA 3LT8A 4RNZA 3UB1A 2CH9A 3CCJ3 2KXGA 3H51A 2WGQA 2W6JH 1HYFA 3NV0A 8CHOA 1I3FA 1OHSA 5TGNA 2WGOA 1W6YA 1OACA 4BL2A 1BANA 1O7NB 2WOFA 5IG4A 1FA3A 3BNDA 3AGNA 2O9UX 4HM3B 1EEJA 3EC9A 4GSPA 2PNCA 1I70A 1TTOA 3B4OA 5G1LA 3TDGA 5AYRB 1EA2A 2HMKB 3LYGA 2Z77A 1RGEA 3DGOA 3OX9A 1N8QA 3CCE3 1VQ63 4IIAA 2CG0A 5IENA 1JB5A 1DE3A 3NHXA 3VGNA 4H61A 4EYCA 1YI23 1IT8A 1F8NA 3MSOA 3AMOA 2CFKA 1NDOB 1Q864 1QVG2 2H0GA 2YX9A 3GWRA 1MWTA 1Q40A 3WR2A 1W02A 1QMAA 1BSBA 3NBBA 1QALA 3KN4A 3UJMA 5IG3A 2OOVC 1K41A 4XM4A 3AHWA 2HMLB 1EUIC 1BU4A 2CWUA 3DGNA 1VQ93 1C54A 2K54A 3NV0B 3RGRA 3MKIA 5AEUB 7RNTA 5I97A 3ER7A 2P05A 3FSDA 4HKVB 2BMOB 4I4KA 1SIHA 4KT3B 2GSPA 3RGAA 1BNGA 1DYUA 2W0QA 3JUPA 1JV2B 3JVCA 1BNJA 5STDA 3X3ZA 1TFKA 3F8HA 1T3BA 3EF8A 1TUHA 4XBTA 3GAXA 5CK6A 5IEOA 3BNBA 5EVHA 3G4S3 4N6TA 1D6YA 4FCJA 2BT3A 1IVUA 4L8OA 3D9RA 3CME3 3CCM3 1B2MA 8RNTA 1KSIA 3AMOB 4MEIA 4XDVA 1M1K4 1W2ZA 4K1VA 1VQQA 2W56A 3NX0A 2OQEC 1Q40B 3AHSA 3DMCA 4LEHA 3OV4A 4N6UA 3PXMA 1B2ZA 1BSCA 5BU4A 3SEDA 1YGEA 1YJW3 1GY6A 4GL6A 1LQGC 2IUKA 2GU1A 2CWVA 3HX8A 3U1WA 4BTWA 2FNQA 3KCHA 4FMBA 1K9M4 1DVCA 2I9WA 1VQO3 3HIIA 1CH0A 3NBRA 1BRNL 2INXA 3Q90A 1GD3A 1FUWA 1B2XA 1IQXA 2SBLA 3BB9A 1M1XB 3HI7A 4O02B 1DMMA 3SOYA 2WO0A 4BIRA 2QA43 5IEPA 1Q824 3CC43 4N6LA 1I0XA 1Z1SA 5D83A 1QAKA 2OTL3 4FCZA 5CXOA 5IW9A 5M19A 1DVDA 1OF5A 2P0XA 2YFIB 3GZRA 1JN5A 1WQLB 4NHFA 5DRVA 5EEOA 1A2VA 1FGQA 1CEWI 2F99A 3E99A 3IJEB 4NREA 5AI1A 3JUNA 2OOVA 1SIIA 1FUTA 3MWZA 4AKYA 2UGIA 1BUQA 1VQP3 2RSXA 4OVMA 1RKYA 1ULIB 2STDA 4HM6B 2W56B 1Q7HA 4RNYA 1ISKA 1I2GA 4R4KA 1VQK3 1VQL3 1UCKA 3EN1B 3U97A 1BNFA 3BLZA 1BRGA 4FCMA 1IU7A 1IYYA 4XDWA 1GYBA 1B3SA 3CNXA 3N8BA 4IPBA 1B2SA 3KKGA 4LSOA 1BAOA 2P0MA 1V57A 2F56A 1LNIA 2XGNA 2LQVA 1W00A 2BNGA 3K5TA 3V99A 2F5WA 1VQ53 3KIIA 1CQSA 3ECFA 1M904 1IT7A 1NO3A 3QK9A 3OWSA 1W2B2 5AIFA 5CLKA 3PYJA 1KC84 2MC8A 2WOHA 2XRXB 2K3DA 1IQYA 4K90B 3IMAB 3NUVA 3ALAA 4LZIA 4RZMA 3X41A 1N9JA 2Z76A 1I2EA 1BRHA 1OF5B 1UGIA 3T0UA 1JN5B 3MPHA 5IG0A 4XBYA 3Q3FA 1LOYA 2E2VA 2OQEA 2CFWA 5AYSC 2R4IA 4KFEA 1BNRA 4PEJA 1RNBA 1G96A 3J7Yd 1VQ43 1K734 4IT7A 2GBWB 3M8CA 3GZXB 3WA3A 2ML5A 3CCQ3 2ZDJA 2L1SA 3ZG0A 3LZAA 3PCSA 2BMRB 2W2CA 3T8UA 1GY7A 4ZM8A 1IV9A 4WP5A 1DETA 5JPPA 2HMOB 5G1KA 1JJ22 3D5IA 5GSPA 1B21A 2Y74A 1JNQA 1GMPA 3CU3A 1Q814 1W6CA 1V58A 2AAEA 3NQZA 3EBYA 1WMPA 3G16A 1EQKA 1J2BA 1IVXA 1ZS7A 3V98A 2ZL8A 3I553 3OW22 4L7KA 1BSEA 3S29A 3CCS3 1UUWB 1AY7A 1DMNA 1B20A 2RFRA 1UGHI 4HOHA 2KF4A 1RGLA 1YVSA 1IDPA 1RN4A 1WTHA 1IV7A 2KAAA 1QAFA 3STDA 2ZHXB 2UUGC 1RRHA 1OHPA 2E2TA 4BU4A 1O7WB 3CPW2 3H3HA 5BVBA 4JF8A 5JBSA 3CCL3 4HM5B 5IG5A 2BIRA 1BUJA 4FMDA 3BNEA 2CC3A 4N6V0 1VQ83 2ZA4A 3NM7A 4GHOA 4CDLA
chains in the Genus database with same CATH topology
3SLUA 1ZX2A 3GRDA 3JUQA 3UNLA 4J9AA 1S5AA 3BNCA 4QWTA 1YHQ3 3G8ZA 4XBXA 1ASKA 1W4NA 3JUMA 4GB5A 1FGTA 1MOLA 1E3RA 3X3XA 5KP4A 1O7MB 5HGRA 1IK3A 1YJN3 4WWUC 3MYTA 1ROVA 3VF1A 3HK4A 1PFPA 1STDA 2B1XB 3QRDA 4HBRA 3SOAA 5AIIA 2Y73A 1NU3A 1US1A 2CHCA 4KFFA 1Y4KA 1OGXA 1SQWA 4K61A 2P38A 3LTBA 2F98A 3UL5A 2HMJB 1STFI 1LOXA 3MG3A 1S723 1NJI4 1VQM3 4OK0A 4ORLA 3EB8A 3KFQC 1JKGA 5EQLA 4K1UA 1OH0A 2IUJA 2L4VA 2W9QA 3S28A 1O7PB 4HVNA 1OUNA 1TP6A 1CYVA 3FH1A 5JPUA 3SVAA 4H3UA 3FG1A 1DMQA 2GBXB 3A76A 3LT9A 3N9HA 3O8YA 3LOYA 2D42A 1UUVB 2C11A 1LXEA 3F14A 1JB2A 1D6UA 2P09A 3WA2X 1YIT3 2CKFB 1W7CA 1N5HA 3DZLA 3FZWA 3MHEA 3MG1A 3F40A 3DUKA 4HJLB 2XSOB 3K7CA 4HM2B 2HMMB 2OCTA 5ELJA 5FW5A 3DGLA 3EBTA 3WMDA 1W01A 1IVVA 4EBGA 2OTJ3 2CFLA 2XH9A 2RGQA 1OHOA 1PU4A 5G2GA 3CPOA 1JKGB 2B24B 1TU5A 2M7OA 4HM4B 5CF1A 1T5YA 2PZVA 3OWYA 3PZWA 4XB5A 5DREA 1JRQA 5D82A 2LYXA 4G1MB 3DGMA 1EG9B 6STDA 4J8TA 3GZYB 3WDGB 1Q42A 4O3VA 3CXC2 3G0KA 3S27A 2XEPA 3F8XA 2KRTA 2W9PA 4EV5A 4MMXB 2CFDA 3PGBA 4X2OA 2XGLA 2CWTA 4BTYA 4X2HA 1AV4A 2FGTA 1FGOA 2ML6A 3T8NA 3B8LA 2OWPA 3EN8A 3G713 2W03A 2W04A 7STDA 3LXUX 3MG2A 3DY5A 5IF6A 4AKZA 3FCSB 2CG1A 1R4CA 1A67A 3CCU3 3I0YA 3LMLA 4WYKA 2CK3H 2FXTA 4KZ1A 1YVBI 3HIGA 4Q53A 4MJDA 1KD14 1N9EA 1RN7A 5LC6A 1GY5A 2CW9A 4U13A 2BHMA 1RRLA 1LVNA 2UX0A 1AVLA 3V92A 1CYUA 5ELUA 2F86B 5AIHA 1FGMA 1YJ93 2BMQB 4KFDA 4OUQA 4HM0B 1LNHA 1HU9A 2XFSA 3EQQB 3K0ZA 1E97A 2KCDA 2JQ5A 1ULJB 4WFOA 1OCVA 3RDEA 3G6E3 1C7HA 1MNLA 5LC7A 1D6ZA 1IVWA 4AEQA 1RJOA 3CC23 1N5PA 1W5ZA 1VZZA 3KSED 4WYKB 3KZTA 1ZO2A 2XF3A 5BXQA 3FLJA 4N6OB 2CIUA 3CCV3 3SXXA 2QGUA 4MMYB 1WMOA 2V1LA 3OXAA 2E2UA 3EHCA 4R1KA 4TX4A 4KVHA 4RBNA 3X3YA 1E3VA 3FF0A 1KWIA 3CMA3 2YFJB 5IERA 1Q7Y4 2QIYA 1WNHA 3KSPA 3PCRA 3WODG 3I563 2BO9B 4EXRA 1UW1A 5CF2A 3KE7A 1EKMA 3NM2A 1WMNA 4N6NB 3FF2A 4FMCA 2XSHB 3X42A 5KP3A 1QVF2 3EJVA 2GEYA 2Q07A 2GEXA 1GD4A 3NXJA 1M9GA 3PS8A 5AEWB 4R80A 3ROBA 3UL6A 1W6GA 1HKXA 3LH4A 3FGYA 3B4PA 4EV2A 5AIGA 1U8CB 2Z6BA 5FGOA 3WOEB 4WHAA 1SPUA 1VQ73 1A2KA 1NWWA 3JUOA 1L5GB 4L8PA 1KQS2 2C10A 4EC6A 3SX1A 3CCR3 4LGQA 1AVKA 1AR0A 3IPTA 1K8A4 1TIJA 1OPYA 3DM8A 3FKAA 1SJWA 4HZ9B 2O3OA 3OWUA 3S5CA 1K28A 1YIJ3 4N6MA 2IA7A 1N8R4 4HM7B 4N3VA 1UI7A 4FMAA 3Q2PA 4BTXA 2GXFA 3NQYA 4JRFA 3CNMA 3HZPA 3N54B 1GS3A 3NBJA 1A90A 3CC73 2Z7AA 1IQ8A 2A15A 3L0RA 4R9KA 1FGRA 3LTCA 3X40A 4MMZB 4STDA 2HMNB 1O7HB 3LTAA 2QEX3 3B7CA 4O2HA 2XR8B 4HZBB 4R9LA 5D81A 1NB3I 3F7SA 1O7GB 3F7XA 4FR9A 3WOFB 3Q1CA 5KP1A 1JB4A 2MF7A 3K63A 4HM8B 2CFGA 3S67A 3EX9A 2JDIH 2XFTA 3CD63 3FG3A 3EE1A 3FG4A 1V74A 4CCVA 1TFOA 1QJGA 3K9MC 1ROAA 2IMJA 4LMIA 1NB5I 2RCDA 1U5OA 3GZBA 2GU3A 4HM1B 3LTDA 1VQN3 3VSYA 1UI8A 5A0OB 3D3LA 2YFLB 1OGZA 3F9SA 4HYZA 4RNZA 3UB1A 2D1WA 2K0MA 3DXOA 3LT8A 2CH9A 3CCJ3 2KXGA 3H51A 2WGQA 2W6JH 3NV0A 8CHOA 1OHSA 5TGNA 2WGOA 1W6YA 1OACA 1O7NB 2WOFA 5IG4A 1FA3A 3BNDA 2O9UX 4HM3B 3EC9A 2PNCA 3B4OA 3TDGA 5AYRB 1EA2A 2HMKB 3LYGA 2Z77A 3DGOA 3OX9A 3CCE3 1N8QA 1VQ63 4IIAA 2CG0A 5IENA 1JB5A 3NHXA 3VGNA 4H61A 4EYCA 1YI23 1IT8A 1F8NA 3MSOA 3AMOA 2CFKA 1NDOB 1Q864 1QVG2 2YX9A 3GWRA 1Q40A 1W02A 1QMAA 3NBBA 1QALA 3KN4A 3UJMA 5IG3A 2OOVC 1K41A 4XM4A 2HMLB 3DGNA 2CWUA 1VQ93 2K54A 3NV0B 3RGRA 3MKIA 5AEUB 5I97A 3ER7A 2P05A 3FSDA 4HKVB 2BMOB 4I4KA 1SIHA 3RGAA 1DYUA 2W0QA 3JUPA 1JV2B 3JVCA 5STDA 3X3ZA 1TFKA 3F8HA 3EF8A 1TUHA 4XBTA 3GAXA 5CK6A 5IEOA 3BNBA 5EVHA 3G4S3 4N6TA 1D6YA 4FCJA 2BT3A 1IVUA 4L8OA 3D9RA 3CME3 3CCM3 1KSIA 3AMOB 4MEIA 4XDVA 1M1K4 1W2ZA 4K1VA 4N6UA 2W56A 3NX0A 2OQEC 1Q40B 3DMCA 4LEHA 4O8SA 3OV4A 3PXMA 3SEDA 1YGEA 1YJW3 1GY6A 4GL6A 2IUKA 2GU1A 2CWVA 3HX8A 3U1WA 4BTWA 2FNQA 4FMBA 1K9M4 1DVCA 2I9WA 1VQO3 3HIIA 3NBRA 2INXA 3Q90A 1GD3A 1FUWA 1IQXA 2SBLA 3BB9A 1M1XB 3HI7A 4O02B 1DMMA 3SOYA 2WO0A 2QA43 5IEPA 1Q824 3CC43 4N6LA 1Z1SA 5D83A 1QAKA 2OTL3 4FCZA 5CXOA 5IW9A 1DVDA 1OF5A 2P0XA 2YFIB 3GZRA 1JN5A 1WQLB 4NHFA 5DRVA 5EEOA 1A2VA 1FGQA 1CEWI 2F99A 3E99A 3IJEB 4NREA 5AI1A 3JUNA 2OOVA 1SIIA 3MWZA 4AKYA 1BUQA 1VQP3 2RSXA 4OVMA 1RKYA 1ULIB 2STDA 4HM6B 2W56B 4RNYA 1ISKA 1VQK3 4R4KA 1VQL3 3EN1B 3U97A 3BLZA 4FCMA 1IU7A 4XDWA 1GYBA 3N8BA 3CNXA 4IPBA 3KKGA 4LSOA 2P0MA 2XGNA 2LQVA 1W00A 2BNGA 3K5TA 3V99A 1VQ53 3KIIA 1CQSA 3ECFA 1M904 1IT7A 1NO3A 3QK9A 3OWSA 1W2B2 5AIFA 5CLKA 3PYJA 1KC84 2MC8A 2WOHA 2XRXB 1IQYA 4K90B 3IMAB 3NUVA 3ALAA 4LZIA 4RZMA 3X41A 1N9JA 2Z76A 1OF5B 3T0UA 1JN5B 3MPHA 5IG0A 4XBYA 2E2VA 2OQEA 2CFWA 5AYSC 2R4IA 4KFEA 4PEJA 1G96A 3J7Yd 1VQ43 1K734 4IT7A 2GBWB 3M8CA 3GZXB 3WA3A 2ML5A 3CCQ3 2ZDJA 3LZAA 3PCSA 2BMRB 2W2CA 3T8UA 1GY7A 4ZM8A 1IV9A 4WP5A 5JPPA 2HMOB 1JJ22 2Y74A 1JNQA 3CU3A 1Q814 1W6CA 3NQZA 3EBYA 1WMPA 3G16A 1EQKA 1J2BA 1IVXA 3V98A 2ZL8A 3I553 3OW22 4L7KA 3S29A 3CCS3 1UUWB 1DMNA 2RFRA 1IDPA 1WTHA 1IV7A 1QAFA 3STDA 1RRHA 1OHPA 2E2TA 1O7WB 3CPW2 3H3HA 5BVBA 4JF8A 5JBSA 3CCL3 4HM5B 5IG5A 4FMDA 3BNEA 2CC3A 4N6V0 1VQ83 3NM7A 4CDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZX2 A;  3GRD A;  3JUQ A;  3UNL A;  4J9A A;  1S5A A;  3G8Z A;  4XBX A;  1ASK A;  3JUM A;  4GB5 A;  1E3R A;  5KP4 A;  1O7M B;  5HGR A;  4WWU C;  3MYT A;  3HK4 A;  1STD A;  2B1X B;  3SOA A;  5AII A;  1NU3 A;  2CHC A;  1OGX A;  2F98 A;  2HMJ B;  3MG3 A;  1JKG A;  4K1U A;  1OH0 A;  1O7P B;  4HVN A;  1OUN A;  1TP6 A;  3FH1 A;  5JPU A;  4H3U A;  1DMQ A;  2GBX B;  3A76 A;  1UUV B;  3F14 A;  1JB2 A;  2CKF B;  3DZL A;  3FZW A;  3MHE A;  3MG1 A;  3F40 A;  3DUK A;  4HJL B;  2XSO B;  3K7C A;  4HM2 B;  2HMM B;  5FW5 A;  3EBT A;  3WMD A;  1W01 A;  2RGQ A;  1OHO A;  5G2G A;  3CPO A;  1JKG B;  2B24 B;  4HM4 B;  5CF1 A;  2PZV A;  3OWY A;  4XB5 A;  5DRE A;  5D82 A;  1EG9 B;  6STD A;  4J8T A;  3GZY B;  1Q42 A;  3G0K A;  3F8X A;  4X2O A;  4X2H A;  3T8N A;  3B8L A;  2OWP A;  3EN8 A;  7STD A;  3MG2 A;  5IF6 A;  3I0Y A;  4WYK A;  4Q53 A;  4MJD A;  1GY5 A;  4U13 A;  2UX0 A;  2F86 B;  5AIH A;  2BMQ B;  4OUQ A;  4HM0 B;  3EQQ B;  3K0Z A;  1E97 A;  2JQ5 A;  1ULJ B;  1OCV A;  1C7H A;  1VZZ A;  4WYK B;  3KZT A;  1ZO2 A;  5BXQ A;  3FLJ A;  2QGU A;  3OXA A;  3EHC A;  4R1K A;  4KVH A;  1E3V A;  3FF0 A;  2YFJ B;  5IER A;  2QIY A;  3KSP A;  5CF2 A;  3KE7 A;  3NM2 A;  3FF2 A;  2XSH B;  5KP3 A;  3EJV A;  2GEY A;  2GEX A;  3NXJ A;  5AEW B;  3ROB A;  1HKX A;  3FGY A;  3B4P A;  5AIG A;  1A2K A;  1NWW A;  3JUO A;  4L8P A;  4LGQ A;  1AR0 A;  3IPT A;  3DM8 A;  1OPY A;  3FKA A;  4HZ9 B;  1SJW A;  3S5C A;  3OWU A;  4HM7 B;  4N3V A;  2GXF A;  3CNM A;  3HZP A;  1GS3 A;  2Z7A A;  2A15 A;  4R9K A;  4STD A;  2HMN B;  1O7H B;  3B7C A;  4R9L A;  2XR8 B;  4HZB B;  5D81 A;  3F7S A;  1O7G B;  3F7X A;  5KP1 A;  1JB4 A;  4HM8 B;  3EX9 A;  1QJG A;  4LMI A;  2IMJ A;  2RCD A;  1U5O A;  3GZB A;  4HM1 B;  3VSY A;  2YFL B;  1OGZ A;  3F9S A;  3DXO A;  3H51 A;  3NV0 A;  8CHO A;  1OHS A;  5TGN A;  1W6Y A;  1O7N B;  5IG4 A;  4HM3 B;  3EC9 A;  3B4O A;  1EA2 A;  2HMK B;  3LYG A;  2Z77 A;  3OX9 A;  4IIA A;  5IEN A;  1JB5 A;  3NHX A;  3VGN A;  3MSO A;  1NDO B;  3GWR A;  1Q40 A;  1W02 A;  1QMA A;  3UJM A;  5IG3 A;  1K41 A;  4XM4 A;  2HML B;  2K54 A;  3NV0 B;  3RGR A;  3MKI A;  5AEU B;  3ER7 A;  3FSD A;  4HKV B;  2BMO B;  4I4K A;  3RGA A;  3JUP A;  5STD A;  3F8H A;  3EF8 A;  1TUH A;  4XBT A;  5CK6 A;  5IEO A;  5EVH A;  4FCJ A;  4L8O A;  3D9R A;  4XDV A;  4K1V A;  4LEH A;  3DMC A;  1Q40 B;  3OV4 A;  3SED A;  1GY6 A;  3HX8 A;  2I9W A;  3NBR A;  2INX A;  3Q90 A;  3BB9 A;  1DMM A;  3SOY A;  5IEP A;  1Z1S A;  5D83 A;  5CXO A;  1OF5 A;  5DRV A;  2YFI B;  3GZR A;  1JN5 A;  1WQL B;  3E99 A;  2F99 A;  5AI1 A;  3JUN A;  1BUQ A;  4OVM A;  1ULI B;  2STD A;  4HM6 B;  1ISK A;  3EN1 B;  3BLZ A;  4FCM A;  4XDW A;  1GYB A;  3CNX A;  3KKG A;  1W00 A;  2BNG A;  1CQS A;  3ECF A;  3OWS A;  5AIF A;  5CLK A;  2XRX B;  4RZM A;  3NUV A;  2Z76 A;  1OF5 B;  1JN5 B;  5IG0 A;  4XBY A;  2R4I A;  4PEJ A;  2GBW B;  3M8C A;  3GZX B;  3LZA A;  2BMR B;  2W2C A;  3T8U A;  1GY7 A;  4WP5 A;  5JPP A;  2HMO B;  3CU3 A;  3EBY A;  3G16 A;  4L7K A;  1UUW B;  1DMN A;  2RFR A;  1IDP A;  3STD A;  1OHP A;  1O7W B;  3H3H A;  5BVB A;  4HM5 B;  5IG5 A;  4ORL A;  4CDL A; 
#chains in the Genus database with same CATH topology
 3SLU A;  1A2P A;  1ZX2 A;  3GRD A;  3JUQ A;  2J8X B;  3UNL A;  4J9A A;  1S5A A;  3BNC A;  1BRJ A;  4QWT A;  1YHQ 3;  3G8Z A;  4XBX A;  9RNT A;  1ASK A;  1W4N A;  3JUM A;  1RGF A;  4GB5 A;  1FGT A;  1MOL A;  1E3R A;  3X3X A;  5KP4 A;  1O7M B;  5HGR A;  1FYS A;  1IK3 A;  1YJN 3;  4WWU C;  3MYT A;  1BGS A;  2C4B A;  2CX0 A;  1ROV A;  3VF1 A;  3HK4 A;  1PFP A;  1STD A;  2B1X B;  2H0I A;  3QRD A;  4HBR A;  3SOA A;  5AII A;  2Y73 A;  1NU3 A;  1US1 A;  2CHC A;  4KFF A;  1B2U A;  1Y4K A;  1FZU A;  1OGX A;  1SQW A;  4K61 A;  2P38 A;  3LTB A;  2F98 A;  1FUS A;  1X1W A;  3UL5 A;  2HMJ B;  1STF I;  1LOX A;  3MG3 A;  1TRP A;  1S72 3;  1RNT A;  1NJI 4;  2RBI A;  4OK0 A;  4ORL A;  1VQM 3;  3EB8 A;  2HOH A;  3KFQ C;  1BNE A;  1JKG A;  5EQL A;  2CX1 A;  4K1U A;  1OH0 A;  2IUJ A;  2L4V A;  2W9Q A;  3S28 A;  1O7P B;  1MWU A;  4HVN A;  1OUN A;  1TP6 A;  1RGK A;  1RGH A;  1RTU A;  1CYV A;  3FH1 A;  1T2H A;  1I3I A;  2AAD A;  5M1A A;  5JPU A;  3SVA A;  4H3U A;  5HOH A;  3FG1 A;  1DMQ A;  2GBX B;  1RN1 A;  3A76 A;  3LT9 A;  3N9H A;  3O8Y A;  3LOY A;  2D42 A;  1UUV B;  1BOX A;  2C11 A;  2H0H A;  3BIR A;  1LXE A;  1GOV A;  3F14 A;  1JB2 A;  2BU4 A;  1D6U A;  1RHL A;  2P09 A;  3WA2 X;  1YIT 3;  2CKF B;  1W7C A;  4J5K A;  1N5H A;  3DZL A;  3FZW A;  3MHE A;  1JBT A;  3MG1 A;  1RDS A;  1JBR A;  3F40 A;  3DUK A;  4HJL B;  2XSO B;  3K7C A;  4HM2 B;  2HMM B;  2OCT A;  4ILF A;  5ELJ A;  3DGL A;  5FW5 A;  3EBT A;  3WMD A;  1W01 A;  1IVV A;  4EBG A;  2OTJ 3;  2CFL A;  2XH9 A;  4DKI A;  2RGQ A;  1OHO A;  1GOU A;  1PU4 A;  5G2G A;  3CPO A;  1HZ1 A;  1G02 A;  1JKG B;  2B24 B;  1TU5 A;  2M7O A;  4HM4 B;  5CF1 A;  2KF6 A;  1T5Y A;  2PZV A;  3OWY A;  3PZW A;  4XB5 A;  5DRE A;  1JZD A;  1JRQ A;  5D82 A;  2LYX A;  4G1M B;  3DGM A;  1EG9 B;  4O8S A;  6STD A;  4J8T A;  3GZY B;  3WDG B;  1UDI I;  1BNI A;  1Q42 A;  3ZFZ A;  4O3V A;  3CXC 2;  3G0K A;  3S27 A;  2XEP A;  3F8X A;  1UUG B;  2KRT A;  2W9P A;  4EV5 A;  4MMX B;  2CFD A;  3PGB A;  4X2O A;  2XGL A;  2CWT A;  1UCI A;  4BTY A;  1FW7 A;  4X2H A;  1AV4 A;  2FGT A;  1FGO A;  2ML6 A;  3T8N A;  3B8L A;  2OWP A;  3EN8 A;  3G71 3;  2W03 A;  2W04 A;  1AQZ A;  7STD A;  1MGW A;  1NNV A;  3LXU X;  6GSP A;  1GSP A;  1RCL A;  3MG2 A;  3DY5 A;  5IF6 A;  1I0V A;  4AKZ A;  1PYL A;  3FCS B;  2CG1 A;  5M18 A;  1R4C A;  1A67 A;  3CCU 3;  3I0Y A;  3LML A;  4WYK A;  2CK3 H;  2FXT A;  4KZ1 A;  4RNT A;  1YGW A;  1YVB I;  3HIG A;  4Q53 A;  4MJD A;  1KD1 4;  1Q9E A;  1N9E A;  1RN7 A;  5LC6 A;  1GY5 A;  2CW9 A;  4U13 A;  2BHM A;  3URP A;  1RRL A;  1LVN A;  3GSP A;  2IY2 A;  1G0T A;  2UX0 A;  1BIR A;  1AVL A;  3V92 A;  1CYU A;  1TRQ A;  5ELU A;  2F86 B;  5AIH A;  4CPK A;  1FGM A;  1YJ9 3;  1LOW A;  1YNV X;  2BMQ B;  4KFD A;  4OUQ A;  4HM0 B;  1LNH A;  1HU9 A;  2XFS A;  3EQQ B;  3K0Z A;  1E97 A;  1PY3 A;  2KCD A;  1GMQ A;  2JQ5 A;  1ULJ B;  4WFO A;  1OCV A;  3RDE A;  1UCJ A;  3D4A A;  3G6E 3;  1C7H A;  1MNL A;  4LYL B;  1D6Z A;  1LRA A;  5LC7 A;  1IVW A;  4AEQ A;  1BSD A;  1RJO A;  3CC2 3;  1N5P A;  1W5Z A;  1VZZ A;  3ZG5 A;  3KSE D;  1T2I A;  4WYK B;  3KZT A;  1ZO2 A;  2XF3 A;  1BRK A;  3FLJ A;  3HOH A;  1X1X A;  4N6O B;  5BXQ A;  2CIU A;  3CCV 3;  3SXX A;  1LOV A;  2QGU A;  5RNT A;  1MWS A;  4MMY B;  1WMO A;  2V1L A;  3OXA A;  3RNT A;  2E2U A;  3EHC A;  4R1K A;  4TX4 A;  4KVH A;  4RBN A;  3X3Y A;  1E3V A;  1I2F A;  1MGR A;  1MWR A;  3FF0 A;  4I5Q A;  1KWI A;  3CMA 3;  2YFJ B;  5IER A;  1Q7Y 4;  2QIY A;  1WNH A;  1RGC A;  3KSP A;  3PCR A;  3WOD G;  3I56 3;  2BO9 B;  4EXR A;  1SAR A;  1UW1 A;  5CF2 A;  3KE7 A;  1EKM A;  3NM2 A;  1WMN A;  4N6N B;  3FF2 A;  4FMC A;  2XSH B;  3X42 A;  5KP3 A;  1QVF 2;  3EJV A;  2GEY A;  2Q07 A;  1X1U A;  2GEX A;  1GD4 A;  3NXJ A;  1M9G A;  3PS8 A;  3WHO A;  5AEW B;  4R80 A;  1ZGX A;  3ROB A;  1W6G A;  3UL6 A;  1BRS A;  1HKX A;  3LH4 A;  1JBS A;  3FGY A;  3B4P A;  4EV2 A;  5AIG A;  1U8C B;  2Z6B A;  2F5M A;  5FGO A;  3WOE B;  4WHA A;  1TJD A;  1GOY A;  1SPU A;  5BIR A;  3BU4 A;  1LQM B;  1A2K A;  1UCL A;  1VQ7 3;  1NWW A;  3JUO A;  1L5G B;  4L8P A;  1KQS 2;  2C10 A;  4EC6 A;  1BNS A;  3SX1 A;  3CCR 3;  2KF5 A;  6RNT A;  2SAR A;  4LGQ A;  1AVK A;  1AR0 A;  3IPT A;  1K8A 4;  1TIJ A;  1OPY A;  3DM8 A;  3FKA A;  1SJW A;  4HZ9 B;  2O3O A;  3OWU A;  3S5C A;  1K28 A;  1YIJ 3;  4N6M A;  2IA7 A;  2KF3 A;  3DH2 A;  4HAA A;  4HM7 B;  1UI7 A;  1I8V A;  1BRI A;  4N3V A;  1N8R 4;  4FMA A;  3Q2P A;  4BTX A;  2GXF A;  3NQY A;  2IYJ A;  3AGO A;  4JRF A;  3D79 A;  3SYU A;  3A5E A;  3CNM A;  3HZP A;  3N54 B;  4CJN A;  1GS3 A;  3NBJ A;  1A90 A;  3CC7 3;  2Z7A A;  1IQ8 A;  1GMR A;  2A15 A;  3L0R A;  1RSN A;  4R9K A;  1FGR A;  3LTC A;  3X40 A;  4MMZ B;  4STD A;  2HMN B;  1O7H B;  3LTA A;  1BSA A;  2QEX 3;  1BVI A;  3B7C A;  1RGG A;  2XR8 B;  4HZB B;  4O2H A;  4R9L A;  4BL3 A;  5D81 A;  1NB3 I;  3F7S A;  1O7G B;  3F7X A;  4FR9 A;  3WOF B;  3Q1C A;  5KP1 A;  1JB4 A;  2MF7 A;  3K63 A;  4HM8 B;  2CFG A;  1B27 A;  2RNT A;  3S67 A;  3EX9 A;  2JDI H;  2XFT A;  3CD6 3;  3FG3 A;  3EE1 A;  7GSP A;  3FG4 A;  1V74 A;  4CCV A;  4J5G A;  1TFO A;  1QJG A;  3K9M C;  1ROA A;  2IMJ A;  4LMI A;  1RCK A;  2F4Y A;  2RCD A;  1NB5 I;  1U5O A;  1X1Y A;  3GZB A;  2GU3 A;  3DGY A;  4HM1 B;  3LTD A;  1VQN 3;  1JZO A;  4EW5 A;  1R4Y A;  3VSY A;  2R41 A;  1UI8 A;  1RGA A;  1RLS A;  5A0O B;  3D3L A;  2YFL B;  3D5G A;  1OGZ A;  1RMS A;  3F9S A;  4HYZ A;  4NPB A;  2D1W A;  2K0M A;  3DXO A;  3LT8 A;  4RNZ A;  3UB1 A;  2CH9 A;  3CCJ 3;  2KXG A;  3H51 A;  2WGQ A;  2W6J H;  1HYF A;  3NV0 A;  8CHO A;  1I3F A;  1OHS A;  5TGN A;  2WGO A;  1W6Y A;  1OAC A;  4BL2 A;  1BAN A;  1O7N B;  2WOF A;  5IG4 A;  1FA3 A;  3BND A;  3AGN A;  2O9U X;  4HM3 B;  1EEJ A;  3EC9 A;  4GSP A;  2PNC A;  1I70 A;  1TTO A;  3B4O A;  5G1L A;  3TDG A;  5AYR B;  1EA2 A;  2HMK B;  3LYG A;  2Z77 A;  1RGE A;  3DGO A;  3OX9 A;  1N8Q A;  3CCE 3;  1VQ6 3;  4IIA A;  2CG0 A;  5IEN A;  1JB5 A;  1DE3 A;  3NHX A;  3VGN A;  4H61 A;  4EYC A;  1YI2 3;  1IT8 A;  1F8N A;  3MSO A;  3AMO A;  2CFK A;  1NDO B;  1Q86 4;  1QVG 2;  2H0G A;  2YX9 A;  3GWR A;  1MWT A;  1Q40 A;  3WR2 A;  1W02 A;  1QMA A;  1BSB A;  3NBB A;  1QAL A;  3KN4 A;  3UJM A;  5IG3 A;  2OOV C;  1K41 A;  4XM4 A;  3AHW A;  2HML B;  1EUI C;  1BU4 A;  2CWU A;  3DGN A;  1VQ9 3;  1C54 A;  2K54 A;  3NV0 B;  3RGR A;  3MKI A;  5AEU B;  7RNT A;  5I97 A;  3ER7 A;  2P05 A;  3FSD A;  4HKV B;  2BMO B;  4I4K A;  1SIH A;  4KT3 B;  2GSP A;  3RGA A;  1BNG A;  1DYU A;  2W0Q A;  3JUP A;  1JV2 B;  3JVC A;  1BNJ A;  5STD A;  3X3Z A;  1TFK A;  3F8H A;  1T3B A;  3EF8 A;  1TUH A;  4XBT A;  3GAX A;  5CK6 A;  5IEO A;  3BNB A;  5EVH A;  3G4S 3;  4N6T A;  1D6Y A;  4FCJ A;  2BT3 A;  1IVU A;  4L8O A;  3D9R A;  3CME 3;  3CCM 3;  1B2M A;  8RNT A;  1KSI A;  3AMO B;  4MEI A;  4XDV A;  1M1K 4;  1W2Z A;  4K1V A;  1VQQ A;  2W56 A;  3NX0 A;  2OQE C;  1Q40 B;  3AHS A;  3DMC A;  4LEH A;  3OV4 A;  4N6U A;  3PXM A;  1B2Z A;  1BSC A;  5BU4 A;  3SED A;  1YGE A;  1YJW 3;  1GY6 A;  4GL6 A;  1LQG C;  2IUK A;  2GU1 A;  2CWV A;  3HX8 A;  3U1W A;  4BTW A;  2FNQ A;  3KCH A;  4FMB A;  1K9M 4;  1DVC A;  2I9W A;  1VQO 3;  3HII A;  1CH0 A;  3NBR A;  1BRN L;  2INX A;  3Q90 A;  1GD3 A;  1FUW A;  1B2X A;  1IQX A;  2SBL A;  3BB9 A;  1M1X B;  3HI7 A;  4O02 B;  1DMM A;  3SOY A;  2WO0 A;  4BIR A;  2QA4 3;  5IEP A;  1Q82 4;  3CC4 3;  4N6L A;  1I0X A;  1Z1S A;  5D83 A;  1QAK A;  2OTL 3;  4FCZ A;  5CXO A;  5IW9 A;  5M19 A;  1DVD A;  1OF5 A;  2P0X A;  2YFI B;  3GZR A;  1JN5 A;  1WQL B;  4NHF A;  5DRV A;  5EEO A;  1A2V A;  1FGQ A;  1CEW I;  2F99 A;  3E99 A;  3IJE B;  4NRE A;  5AI1 A;  3JUN A;  2OOV A;  1SII A;  1FUT A;  3MWZ A;  4AKY A;  2UGI A;  1BUQ A;  1VQP 3;  2RSX A;  4OVM A;  1RKY A;  1ULI B;  2STD A;  4HM6 B;  2W56 B;  1Q7H A;  4RNY A;  1ISK A;  1I2G A;  4R4K A;  1VQK 3;  1VQL 3;  1UCK A;  3EN1 B;  3U97 A;  1BNF A;  3BLZ A;  1BRG A;  4FCM A;  1IU7 A;  1IYY A;  4XDW A;  1GYB A;  1B3S A;  3CNX A;  3N8B A;  4IPB A;  1B2S A;  3KKG A;  4LSO A;  1BAO A;  2P0M A;  1V57 A;  2F56 A;  1LNI A;  2XGN A;  2LQV A;  1W00 A;  2BNG A;  3K5T A;  3V99 A;  2F5W A;  1VQ5 3;  3KII A;  1CQS A;  3ECF A;  1M90 4;  1IT7 A;  1NO3 A;  3QK9 A;  3OWS A;  1W2B 2;  5AIF A;  5CLK A;  3PYJ A;  1KC8 4;  2MC8 A;  2WOH A;  2XRX B;  2K3D A;  1IQY A;  4K90 B;  3IMA B;  3NUV A;  3ALA A;  4LZI A;  4RZM A;  3X41 A;  1N9J A;  2Z76 A;  1I2E A;  1BRH A;  1OF5 B;  1UGI A;  3T0U A;  1JN5 B;  3MPH A;  5IG0 A;  4XBY A;  3Q3F A;  1LOY A;  2E2V A;  2OQE A;  2CFW A;  5AYS C;  2R4I A;  4KFE A;  1BNR A;  4PEJ A;  1RNB A;  1G96 A;  3J7Y d;  1VQ4 3;  1K73 4;  4IT7 A;  2GBW B;  3M8C A;  3GZX B;  3WA3 A;  2ML5 A;  3CCQ 3;  2ZDJ A;  2L1S A;  3ZG0 A;  3LZA A;  3PCS A;  2BMR B;  2W2C A;  3T8U A;  1GY7 A;  4ZM8 A;  1IV9 A;  4WP5 A;  1DET A;  5JPP A;  2HMO B;  5G1K A;  1JJ2 2;  3D5I A;  5GSP A;  1B21 A;  2Y74 A;  1JNQ A;  1GMP A;  3CU3 A;  1Q81 4;  1W6C A;  1V58 A;  2AAE A;  3NQZ A;  3EBY A;  1WMP A;  3G16 A;  1EQK A;  1J2B A;  1IVX A;  1ZS7 A;  3V98 A;  2ZL8 A;  3I55 3;  3OW2 2;  4L7K A;  1BSE A;  3S29 A;  3CCS 3;  1UUW B;  1AY7 A;  1DMN A;  1B20 A;  2RFR A;  1UGH I;  4HOH A;  2KF4 A;  1RGL A;  1YVS A;  1IDP A;  1RN4 A;  1WTH A;  1IV7 A;  2KAA A;  1QAF A;  3STD A;  2ZHX B;  2UUG C;  1RRH A;  1OHP A;  2E2T A;  4BU4 A;  1O7W B;  3CPW 2;  3H3H A;  5BVB A;  4JF8 A;  5JBS A;  3CCL 3;  4HM5 B;  5IG5 A;  2BIR A;  1BUJ A;  4FMD A;  3BNE A;  2CC3 A;  4N6V 0;  1VQ8 3;  2ZA4 A;  3NM7 A;  4GHO A;  4CDL A; 
#chains in the Genus database with same CATH homology
 3SLU A;  1ZX2 A;  3GRD A;  3JUQ A;  3UNL A;  4J9A A;  1S5A A;  3BNC A;  4QWT A;  1YHQ 3;  3G8Z A;  4XBX A;  1ASK A;  1W4N A;  3JUM A;  4GB5 A;  1FGT A;  1MOL A;  1E3R A;  3X3X A;  5KP4 A;  1O7M B;  5HGR A;  1IK3 A;  1YJN 3;  4WWU C;  3MYT A;  1ROV A;  3VF1 A;  3HK4 A;  1PFP A;  1STD A;  2B1X B;  3QRD A;  4HBR A;  3SOA A;  5AII A;  2Y73 A;  1NU3 A;  1US1 A;  2CHC A;  4KFF A;  1Y4K A;  1OGX A;  1SQW A;  4K61 A;  2P38 A;  3LTB A;  2F98 A;  3UL5 A;  2HMJ B;  1STF I;  1LOX A;  3MG3 A;  1S72 3;  1NJI 4;  1VQM 3;  4OK0 A;  4ORL A;  3EB8 A;  3KFQ C;  1JKG A;  5EQL A;  4K1U A;  1OH0 A;  2IUJ A;  2L4V A;  2W9Q A;  3S28 A;  1O7P B;  4HVN A;  1OUN A;  1TP6 A;  1CYV A;  3FH1 A;  5JPU A;  3SVA A;  4H3U A;  3FG1 A;  1DMQ A;  2GBX B;  3A76 A;  3LT9 A;  3N9H A;  3O8Y A;  3LOY A;  2D42 A;  1UUV B;  2C11 A;  1LXE A;  3F14 A;  1JB2 A;  1D6U A;  2P09 A;  3WA2 X;  1YIT 3;  2CKF B;  1W7C A;  1N5H A;  3DZL A;  3FZW A;  3MHE A;  3MG1 A;  3F40 A;  3DUK A;  4HJL B;  2XSO B;  3K7C A;  4HM2 B;  2HMM B;  2OCT A;  5ELJ A;  5FW5 A;  3DGL A;  3EBT A;  3WMD A;  1W01 A;  1IVV A;  4EBG A;  2OTJ 3;  2CFL A;  2XH9 A;  2RGQ A;  1OHO A;  1PU4 A;  5G2G A;  3CPO A;  1JKG B;  2B24 B;  1TU5 A;  2M7O A;  4HM4 B;  5CF1 A;  1T5Y A;  2PZV A;  3OWY A;  3PZW A;  4XB5 A;  5DRE A;  1JRQ A;  5D82 A;  2LYX A;  4G1M B;  3DGM A;  1EG9 B;  6STD A;  4J8T A;  3GZY B;  3WDG B;  1Q42 A;  4O3V A;  3CXC 2;  3G0K A;  3S27 A;  2XEP A;  3F8X A;  2KRT A;  2W9P A;  4EV5 A;  4MMX B;  2CFD A;  3PGB A;  4X2O A;  2XGL A;  2CWT A;  4BTY A;  4X2H A;  1AV4 A;  2FGT A;  1FGO A;  2ML6 A;  3T8N A;  3B8L A;  2OWP A;  3EN8 A;  3G71 3;  2W03 A;  2W04 A;  7STD A;  3LXU X;  3MG2 A;  3DY5 A;  5IF6 A;  4AKZ A;  3FCS B;  2CG1 A;  1R4C A;  1A67 A;  3CCU 3;  3I0Y A;  3LML A;  4WYK A;  2CK3 H;  2FXT A;  4KZ1 A;  1YVB I;  3HIG A;  4Q53 A;  4MJD A;  1KD1 4;  1N9E A;  1RN7 A;  5LC6 A;  1GY5 A;  2CW9 A;  4U13 A;  2BHM A;  1RRL A;  1LVN A;  2UX0 A;  1AVL A;  3V92 A;  1CYU A;  5ELU A;  2F86 B;  5AIH A;  1FGM A;  1YJ9 3;  2BMQ B;  4KFD A;  4OUQ A;  4HM0 B;  1LNH A;  1HU9 A;  2XFS A;  3EQQ B;  3K0Z A;  1E97 A;  2KCD A;  2JQ5 A;  1ULJ B;  4WFO A;  1OCV A;  3RDE A;  3G6E 3;  1C7H A;  1MNL A;  5LC7 A;  1D6Z A;  1IVW A;  4AEQ A;  1RJO A;  3CC2 3;  1N5P A;  1W5Z A;  1VZZ A;  3KSE D;  4WYK B;  3KZT A;  1ZO2 A;  2XF3 A;  5BXQ A;  3FLJ A;  4N6O B;  2CIU A;  3CCV 3;  3SXX A;  2QGU A;  4MMY B;  1WMO A;  2V1L A;  3OXA A;  2E2U A;  3EHC A;  4R1K A;  4TX4 A;  4KVH A;  4RBN A;  3X3Y A;  1E3V A;  3FF0 A;  1KWI A;  3CMA 3;  2YFJ B;  5IER A;  1Q7Y 4;  2QIY A;  1WNH A;  3KSP A;  3PCR A;  3WOD G;  3I56 3;  2BO9 B;  4EXR A;  1UW1 A;  5CF2 A;  3KE7 A;  1EKM A;  3NM2 A;  1WMN A;  4N6N B;  3FF2 A;  4FMC A;  2XSH B;  3X42 A;  5KP3 A;  1QVF 2;  3EJV A;  2GEY A;  2Q07 A;  2GEX A;  1GD4 A;  3NXJ A;  1M9G A;  3PS8 A;  5AEW B;  4R80 A;  3ROB A;  3UL6 A;  1W6G A;  1HKX A;  3LH4 A;  3FGY A;  3B4P A;  4EV2 A;  5AIG A;  1U8C B;  2Z6B A;  5FGO A;  3WOE B;  4WHA A;  1SPU A;  1VQ7 3;  1A2K A;  1NWW A;  3JUO A;  1L5G B;  4L8P A;  1KQS 2;  2C10 A;  4EC6 A;  3SX1 A;  3CCR 3;  4LGQ A;  1AVK A;  1AR0 A;  3IPT A;  1K8A 4;  1TIJ A;  1OPY A;  3DM8 A;  3FKA A;  1SJW A;  4HZ9 B;  2O3O A;  3OWU A;  3S5C A;  1K28 A;  1YIJ 3;  4N6M A;  2IA7 A;  1N8R 4;  4HM7 B;  4N3V A;  1UI7 A;  4FMA A;  3Q2P A;  4BTX A;  2GXF A;  3NQY A;  4JRF A;  3CNM A;  3HZP A;  3N54 B;  1GS3 A;  3NBJ A;  1A90 A;  3CC7 3;  2Z7A A;  1IQ8 A;  2A15 A;  3L0R A;  4R9K A;  1FGR A;  3LTC A;  3X40 A;  4MMZ B;  4STD A;  2HMN B;  1O7H B;  3LTA A;  2QEX 3;  3B7C A;  4O2H A;  2XR8 B;  4HZB B;  4R9L A;  5D81 A;  1NB3 I;  3F7S A;  1O7G B;  3F7X A;  4FR9 A;  3WOF B;  3Q1C A;  5KP1 A;  1JB4 A;  2MF7 A;  3K63 A;  4HM8 B;  2CFG A;  3S67 A;  3EX9 A;  2JDI H;  2XFT A;  3CD6 3;  3FG3 A;  3EE1 A;  3FG4 A;  1V74 A;  4CCV A;  1TFO A;  1QJG A;  3K9M C;  1ROA A;  2IMJ A;  4LMI A;  1NB5 I;  2RCD A;  1U5O A;  3GZB A;  2GU3 A;  4HM1 B;  3LTD A;  1VQN 3;  3VSY A;  1UI8 A;  5A0O B;  3D3L A;  2YFL B;  1OGZ A;  3F9S A;  4HYZ A;  4RNZ A;  3UB1 A;  2D1W A;  2K0M A;  3DXO A;  3LT8 A;  2CH9 A;  3CCJ 3;  2KXG A;  3H51 A;  2WGQ A;  2W6J H;  3NV0 A;  8CHO A;  1OHS A;  5TGN A;  2WGO A;  1W6Y A;  1OAC A;  1O7N B;  2WOF A;  5IG4 A;  1FA3 A;  3BND A;  2O9U X;  4HM3 B;  3EC9 A;  2PNC A;  3B4O A;  3TDG A;  5AYR B;  1EA2 A;  2HMK B;  3LYG A;  2Z77 A;  3DGO A;  3OX9 A;  3CCE 3;  1N8Q A;  1VQ6 3;  4IIA A;  2CG0 A;  5IEN A;  1JB5 A;  3NHX A;  3VGN A;  4H61 A;  4EYC A;  1YI2 3;  1IT8 A;  1F8N A;  3MSO A;  3AMO A;  2CFK A;  1NDO B;  1Q86 4;  1QVG 2;  2YX9 A;  3GWR A;  1Q40 A;  1W02 A;  1QMA A;  3NBB A;  1QAL A;  3KN4 A;  3UJM A;  5IG3 A;  2OOV C;  1K41 A;  4XM4 A;  2HML B;  3DGN A;  2CWU A;  1VQ9 3;  2K54 A;  3NV0 B;  3RGR A;  3MKI A;  5AEU B;  5I97 A;  3ER7 A;  2P05 A;  3FSD A;  4HKV B;  2BMO B;  4I4K A;  1SIH A;  3RGA A;  1DYU A;  2W0Q A;  3JUP A;  1JV2 B;  3JVC A;  5STD A;  3X3Z A;  1TFK A;  3F8H A;  3EF8 A;  1TUH A;  4XBT A;  3GAX A;  5CK6 A;  5IEO A;  3BNB A;  5EVH A;  3G4S 3;  4N6T A;  1D6Y A;  4FCJ A;  2BT3 A;  1IVU A;  4L8O A;  3D9R A;  3CME 3;  3CCM 3;  1KSI A;  3AMO B;  4MEI A;  4XDV A;  1M1K 4;  1W2Z A;  4K1V A;  4N6U A;  2W56 A;  3NX0 A;  2OQE C;  1Q40 B;  3DMC A;  4LEH A;  4O8S A;  3OV4 A;  3PXM A;  3SED A;  1YGE A;  1YJW 3;  1GY6 A;  4GL6 A;  2IUK A;  2GU1 A;  2CWV A;  3HX8 A;  3U1W A;  4BTW A;  2FNQ A;  4FMB A;  1K9M 4;  1DVC A;  2I9W A;  1VQO 3;  3HII A;  3NBR A;  2INX A;  3Q90 A;  1GD3 A;  1FUW A;  1IQX A;  2SBL A;  3BB9 A;  1M1X B;  3HI7 A;  4O02 B;  1DMM A;  3SOY A;  2WO0 A;  2QA4 3;  5IEP A;  1Q82 4;  3CC4 3;  4N6L A;  1Z1S A;  5D83 A;  1QAK A;  2OTL 3;  4FCZ A;  5CXO A;  5IW9 A;  1DVD A;  1OF5 A;  2P0X A;  2YFI B;  3GZR A;  1JN5 A;  1WQL B;  4NHF A;  5DRV A;  5EEO A;  1A2V A;  1FGQ A;  1CEW I;  2F99 A;  3E99 A;  3IJE B;  4NRE A;  5AI1 A;  3JUN A;  2OOV A;  1SII A;  3MWZ A;  4AKY A;  1BUQ A;  1VQP 3;  2RSX A;  4OVM A;  1RKY A;  1ULI B;  2STD A;  4HM6 B;  2W56 B;  4RNY A;  1ISK A;  1VQK 3;  4R4K A;  1VQL 3;  3EN1 B;  3U97 A;  3BLZ A;  4FCM A;  1IU7 A;  4XDW A;  1GYB A;  3N8B A;  3CNX A;  4IPB A;  3KKG A;  4LSO A;  2P0M A;  2XGN A;  2LQV A;  1W00 A;  2BNG A;  3K5T A;  3V99 A;  1VQ5 3;  3KII A;  1CQS A;  3ECF A;  1M90 4;  1IT7 A;  1NO3 A;  3QK9 A;  3OWS A;  1W2B 2;  5AIF A;  5CLK A;  3PYJ A;  1KC8 4;  2MC8 A;  2WOH A;  2XRX B;  1IQY A;  4K90 B;  3IMA B;  3NUV A;  3ALA A;  4LZI A;  4RZM A;  3X41 A;  1N9J A;  2Z76 A;  1OF5 B;  3T0U A;  1JN5 B;  3MPH A;  5IG0 A;  4XBY A;  2E2V A;  2OQE A;  2CFW A;  5AYS C;  2R4I A;  4KFE A;  4PEJ A;  1G96 A;  3J7Y d;  1VQ4 3;  1K73 4;  4IT7 A;  2GBW B;  3M8C A;  3GZX B;  3WA3 A;  2ML5 A;  3CCQ 3;  2ZDJ A;  3LZA A;  3PCS A;  2BMR B;  2W2C A;  3T8U A;  1GY7 A;  4ZM8 A;  1IV9 A;  4WP5 A;  5JPP A;  2HMO B;  1JJ2 2;  2Y74 A;  1JNQ A;  3CU3 A;  1Q81 4;  1W6C A;  3NQZ A;  3EBY A;  1WMP A;  3G16 A;  1EQK A;  1J2B A;  1IVX A;  3V98 A;  2ZL8 A;  3I55 3;  3OW2 2;  4L7K A;  3S29 A;  3CCS 3;  1UUW B;  1DMN A;  2RFR A;  1IDP A;  1WTH A;  1IV7 A;  1QAF A;  3STD A;  1RRH A;  1OHP A;  2E2T A;  1O7W B;  3CPW 2;  3H3H A;  5BVB A;  4JF8 A;  5JBS A;  3CCL 3;  4HM5 B;  5IG5 A;  4FMD A;  3BNE A;  2CC3 A;  4N6V 0;  1VQ8 3;  3NM7 A;  4CDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...