3GRDA

Crystal structure of ntf2-superfamily protein with unknown function (np_977240.1) from bacillus cereus atcc 10987 at 1.25 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
MPKANLEIIRSTYEGSASSNAKHLAEALSEKVEWTEAEGFPYGGTYIGVEAIMENVFSRLGSEWNDYKASVNMYHEVSGKDVIIAEGMYSGVYKDTGKSFEAEFVHVWQLENGKIVKFKQYVDSHLVREAMKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized NTF2-superfamily protein
publication title Crystal structure of NTF2-superfamily protein with unknown function (NP_977240.1) from BACILLUS CEREUS ATCC 10987 at 1.25 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Structural genomics, unknown function
total genus 44
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3grdA00
2BMRB 3LYGA 5AEUB 3FSDA 5JPPA 2F86B 2A15A 5AIGA 2GBXB 1NWWA 1OCVA 3CNXA 3G8ZA 5IENA 3MYTA 3DUKA 2YFLB 5TGNA 2XSOB 1JB5A 5IG4A 3EQQB 4X2OA 1JB2A 3DXOA 4J8TA 2HMLB 4XB5A 2W2CA 3B8LA 3VGNA 4HKVB 4HM1B 1DMNA 2XRXB 5G2GA 3CPOA 3FF0A 4MJDA 1W01A 3EC9A 2STDA 5AEWB 6STDA 5DRVA 4STDA 2B24B 3JUPA 5AI1A 1EG9B 3JUNA 3DZLA 1OF5A 3G16A 3HK4A 1ULJB 5CK6A 4CDLA 2HMMB 2I9WA 4HJLB 4PEJA 3ROBA 4N3VA 2R4IA 3KE7A 3F8XA 1JN5B 3ER7A 5D83A 2OWPA 4HM8B 3CU3A 2QIYA 5CF2A 4WP5A 2YFIB 3FZWA 3NBRA 3NXJA 3FF2A 3OWUA 1E97A 8CHOA 3MG1A 1ZX2A 4HM2B 1OHPA 3FKAA 3OWYA 5IG0A 4H3UA 3EF8A 1OGXA 4R1KA 1JB4A 1JKGA 1E3RA 3F9SA 1OGZA 1IDPA 1QMAA 2Z7AA 3H51A 3GZYB 2K54A 4L8PA 3I0YA 1GY6A 5CXOA 4OVMA 1WQLB 4KVHA 1TUHA 5BXQA 4OUQA 4IIAA 2GBWB 5IG5A 3T8NA 5KP3A 1O7HB 4HZBB 3B7CA 3MKIA 4HM6B 3NM2A 1W00A 1ISKA 1Q40B 3D9RA 1W6YA 3NUVA 3H3HA 4I4KA 1OF5B 3B4OA 3F40A 3EBTA 3KSPA 3F14A 3LZAA 4ORLA 1BUQA 4LEHA 5D82A 3B4PA 3NV0B 1Q40A 1QJGA 3EBYA 3GRDA 3RGRA 5BVBA 4HM0B 2INXA 4XBYA 2RGQA 3MG3A 4GB5A 2QGUA 3T8UA 3F8HA 1K41A 2XR8B 1W02A 3EN8A 3NV0A 4U13A 4FCMA 1GS3A 3FGYA 1JKGB 5DREA 5CF1A 1STDA 2BNGA 7STDA 1C7HA 3A76A 2Z77A 1ASKA 3HX8A 5AIHA 4K1VA 3IPTA 1HKXA 4HM5B 4XBXA 4K1UA 2HMNB 2PZVA 3JUMA 4R9KA 1DMMA 3F7SA 1E3VA 3OXAA 3JUOA 4LGQA 2HMJB 4HM3B 2B1XB 3FLJA 2GXFA 1O7GB 3DMCA 1GY5A 1A2KA 3E99A 1O7MB 3Q90A 2JQ5A 4WYKA 1TP6A 3CNMA 3GZRA 5FW5A 3RGAA 2UX0A 3M8CA 2HMKB 1S5AA 3S5CA 4HM7B 3KZTA 1NU3A 3SEDA 5KP1A 4J9AA 3KKGA 3K7CA 2XSHB 1EA2A 2CHCA 2BMQB 3OWSA 4LMIA 4Q53A 2GEXA 3FH1A 1DMQA 5IEPA 3ECFA 2F99A 5STDA 3UJMA 4XM4A 1U5OA 3BB9A 1SJWA 2RCDA 5IERA 1GY7A 2RFRA 4XBTA 3BLZA 4L8OA 4RZMA 1CQSA 3STDA 4FCJA 3EJVA 1OPYA 2CKFB 4HZ9B 1NDOB 4XDVA 3EN1B 3K0ZA 1VZZA 1OHSA 3WMDA 1UUWB 3OX9A 1O7NB 1OH0A 4HVNA 1OUNA 5IF6A 3DM8A 5D81A 5JPUA 3GZXB 3HZPA 1AR0A 4WYKB 3OV4A 5IEOA 3MG2A 3F7XA 4R9LA 2IMJA 1Z1SA 1Q42A 1O7PB 1ULIB 3EX9A 2Z76A 2F98A 3GZBA 3SOAA 4XDWA 1ZO2A 1GYBA 5CLKA 3GWRA 1JN5A 5KP4A 3NHXA 2HMOB 1O7WB 3VSYA 5EVHA 5AIFA 3JUQA 4X2HA 3G0KA 2BMOB 3MSOA 1UUVB 4L7KA 5AIIA 1OHOA 2YFJB 3UNLA 3EHCA 5HGRA 2GEYA 5IG3A 3MHEA 4HM4B 3SOYA 4WWUC
chains in the Genus database with same CATH superfamily
3G6E3 4BTWA 2BMRB 4HBRA 1TU5A 2KCDA 3LYGA 4KFFA 5AEUB 1BNGA 4K61A 3FSDA 1ROAA 5JPPA 2HOHA 1BRKA 2F86B 2A15A 5AIGA 3L0RA 1KWIA 2GBXB 4FMAA 1NWWA 1OCVA 1I0XA 3CNXA 1K8A4 3G8ZA 2OTJ3 5IENA 1ZGXA 3MYTA 3DUKA 1BSEA 1BVIA 2YFLB 3AGOA 4ZM8A 5IW9A 5TGNA 3CPW2 2KRTA 2XSOB 1NB5I 1JB5A 3S27A 5IG4A 2OTL3 1RCKA 3EQQB 4X2OA 1GOYA 2KAAA 1JB2A 1TFOA 3Q1CA 3CCM3 3DXOA 4J8TA 2CK3H 1UI7A 2HMLB 2OOVA 4XB5A 2CWUA 1BU4A 2WOFA 4IPBA 1MWUA 4O8SA 2CFKA 2W2CA 3B8LA 1RGLA 3VGNA 2K3DA 2D42A 4HKVB 4HM1B 1DMNA 2XRXB 5G2GA 4HYZA 3BU4A 1N5HA 1UCJA 1Q7HA 1HYFA 2W9QA 3CPOA 4ILFA 4IT7A 4JRFA 3N54B 1W5ZA 3FF0A 4MJDA 1W01A 2CFLA 1LOXA 3SX1A 1US1A 4EBGA 1IT8A 3EC9A 2STDA 5AEWB 6STDA 4EV2A 2W04A 1LRAA 1VQM3 1RN4A 2P05A 5DRVA 3G4S3 2W9PA 1I3IA 4STDA 3FG3A 3X3XA 2B24B 4EXRA 2F5WA 4GSPA 1JBSA 4BTYA 1VQN3 3JUPA 5AI1A 1EG9B 3JUNA 1N5PA 1RGFA 5M1AA 3DZLA 1Q824 1BOXA 1OF5A 3G16A 1MGWA 3HK4A 3X40A 3AHSA 3RNTA 1ULJB 3SXXA 5CK6A 4CDLA 4H61A 4NPBA 2HMMB 1U8CB 2I9WA 2SARA 1AV4A 1LQGC 4HJLB 4PEJA 3U97A 4AKZA 1QVF2 1JZOA 4NHFA 3LXUX 3ROBA 5HOHA 1YHQ3 4N3VA 2M7OA 2FXTA 2R4IA 3KE7A 4EC6A 3F8XA 1LQMB 3FG4A 2WGQA 8RNTA 1T3BA 1YGEA 1GOVA 1MNLA 2KXGA 1JN5B 3ER7A 1BNIA 1DVDA 1BIRA 2OWPA 4HM8B 5D83A 3CU3A 1IYYA 2QIYA 3FG1A 5CF2A 4WP5A 5EQLA 1UW1A 2YFIB 3FZWA 1Y4KA 4MMXB 3NBRA 3K5TA 4FMDA 3NXJA 3FF2A 3OWUA 3LT8A 3CCR3 1E97A 3NBJA 1W7CA 2FGTA 3X42A 8CHOA 3MG1A 1ZX2A 4HM2B 1OHPA 1FYSA 3FKAA 1RGKA 3LTBA 3X41A 1I70A 2P09A 1SPUA 1W2ZA 1WMNA 3OWYA 5IG0A 1X1XA 1JBRA 3CC23 4H3UA 3UB1A 1T2HA 2C4BA 3X3YA 4AEQA 1GMRA 3EF8A 1OGXA 1QAFA 1RCLA 1FGRA 4R1KA 1VQO3 1JZDA 4O02B 3PXMA 1JB4A 1JKGA 2MF7A 3CCU3 1E3RA 1F8NA 2IUKA 5M18A 1T5YA 3F9SA 9RNTA 1LOWA 1GD4A 1OGZA 1Q864 2AAEA 3PYJA 3OW22 1IDPA 4RBNA 3NBBA 2BO9B 3CCL3 2R41A 3BIRA 1UUGB 1K9M4 1N9EA 1QMAA 3DY5A 1VQL3 1PYLA 2GU1A 1L5GB 1BRIA 1RNTA 2Z7AA 1FW7A 3H51A 1DETA 3HIIA 2XFTA 5ELUA 3URPA 4CCVA 3GZYB 4LYLB 5RNTA 2BHMA 2CW9A 1KQS2 2K54A 4L8PA 1BRHA 3I0YA 1UGIA 1V74A 2P0MA 3K63A 4KT3B 3K9MC 2KF5A 3EB8A 1IVWA 1GY6A 5CXOA 1CH0A 4OVMA 1V58A 1IVVA 1AY7A 1WQLB 5G1KA 1CYVA 2W56A 4KVHA 4HOHA 1BSAA 1NNVA 4RNYA 4CJNA 1B2MA 1SIHA 1TUHA 1RRHA 1RGEA 1UGHI 1IV7A 5BXQA 1A2VA 1JRQA 2CFGA 4OUQA 2KF4A 2GBWB 4IIAA 4NREA 5IG5A 4KFDA 1EEJA 2KF6A 1B2SA 3LH4A 3QRDA 3I553 3T8NA 5KP3A 2E2VA 1BNEA 1RN1A 2RSXA 1MOLA 1BUJA 1YI23 4JF8A 1O7HB 2IUJA 1KSIA 1BNSA 4MEIA 4HZBB 2ML6A 4FMBA 2F5MA 1LOVA 1I2FA 1YVSA 3B7CA 3UL6A 3X3ZA 3MKIA 4N6LA 4QWTA 1QVG2 1MWSA 3IMAB 4HM6B 2W6JH 1M904 1DE3A 3N8BA 1RLSA 3NM2A 1W00A 1WMOA 1YJW3 1ISKA 1Q40B 2H0HA 3D9RA 4O2HA 3TDGA 3WOFB 1W6YA 1MWTA 1RDSA 3CME3 1TRPA 3NUVA 1LXEA 2O3OA 3DH2A 3H3HA 4I4KA 2F56A 1OF5B 4N6NB 1CEWI 3B4OA 1RTUA 2K0MA 3F40A 1EUIC 1LNIA 1X1UA 3EBTA 2CG1A 1HZ1A 4OK0A 2QA43 3KSPA 2JDIH 3F14A 2AADA 3CCV3 2ZL8A 3SYUA 3LZAA 4ORLA 4I5QA 4LEHA 1BUQA 3BNEA 3HIGA 2CFWA 5D82A 3B4PA 1FGTA 1B2ZA 3NV0B 1Q40A 2UUGC 1QJGA 1R4CA 1YJN3 3EBYA 3GRDA 1RGCA 3RGRA 3CCE3 1VQ73 5BVBA 4HM0B 5BU4A 2D1WA 4BTXA 1BANA 3DGLA 3LOYA 2XGLA 1OACA 2INXA 4XBYA 2RGQA 2XGNA 3MG3A 2C11A 2E2UA 3V92A 1LNHA 3WHOA 4GB5A 2QGUA 3T8UA 1MGRA 1JJ22 1KC84 5LC7A 1IQXA 3F8HA 1RHLA 1K41A 1YNVX 4AKYA 1AVLA 1VQ63 1W02A 1BGSA 2XR8B 3EN8A 1JNQA 3NV0A 4U13A 5EEOA 1IK3A 4FCMA 5GSPA 2Y74A 1N8R4 4RNTA 1GS3A 1EQKA 2GU3A 4BL3A 2XF3A 3D4AA 3FGYA 1K28A 5M19A 1JKGB 5DREA 3A5EA 1W6GA 2J8XB 2C10A 1RRLA 4BL2A 1BNJA 1STDA 3DGOA 1Q9EA 3NQYA 3PZWA 4J5GA 5CF1A 3D5IA 2BNGA 1JBTA 2IA7A 1I0VA 3KIIA 7STDA 1C7HA 1D6UA 4O3VA 1Q7Y4 3A76A 3JVCA 4R80A 1UI8A 2Z77A 4HAAA 4WHAA 1ASKA 3HX8A 5AIHA 4K1VA 1K734 4EW5A 3IPTA 6GSPA 4GL6A 2H0GA 1G0TA 1HKXA 4HM5B 4XBXA 5I97A 4K1UA 2ZDJA 2HMNB 2PZVA 3JUMA 1NJI4 4J5KA 1DMMA 1PFPA 1LOYA 1N9JA 4R9KA 3PCRA 3F7SA 1E3VA 2W56B 1IQ8A 3S29A 3OXAA 2BIRA 1TJDA 5BIRA 3JUOA 1PY3A 4LGQA 4N6V0 2HMJB 2WOHA 4HM3B 3LTCA 1V57A 1W4NA 1WTHA 1RJOA 1BRGA 2B1XB 3EE1A 3FLJA 3G713 1VQ53 2GXFA 2V1LA 2BU4A 1O7GB 3DMCA 1GY5A 1NB3I 2ML5A 1GOUA 1BRNL 1M9GA 3DGYA 1A2KA 3BNBA 1RGHA 2GSPA 3E99A 4KZ1A 3NQZA 1O7MB 3Q90A 7RNTA 4DKIA 2JQ5A 4WYKA 3U1WA 1TP6A 3CNMA 3GZRA 3WOEB 1UCLA 4BIRA 1I2EA 5FW5A 4CPKA 1PU4A 1VQK3 2WGOA 2RBIA 3RGAA 1AVKA 2UX0A 3Q3FA 2IYJA 1BRJA 4GHOA 3M8CA 2HMKB 3CC43 1S5AA 2OCTA 3S5CA 4HM7B 1WMPA 5AYRB 1GSPA 1ROVA 1ZS7A 1QALA 1MWRA 2CIUA 1VQP3 3IJEB 1I3FA 3KZTA 3PGBA 1NU3A 1BSBA 1D6YA 3LTDA 3MWZA 3SEDA 2MC8A 1UCIA 5KP1A 4J9AA 3GSPA 1X1WA 4RNZA 3KKGA 5LC6A 2CX1A 1D6ZA 2BT3A 4N6OB 2RNTA 4N6MA 3K7CA 3FCSB 5ELJA 4LZIA 3WA2X 3WA3A 4EV5A 1FGMA 2XSHB 1EA2A 1A67A 3LT9A 3V99A 2CG0A 2CHCA 1DVCA 1IVXA 1EKMA 2BMQB 3OWSA 3KSED 4LMIA 2OQEA 4Q53A 2GEXA 1M1XB 4R4KA 3FH1A 1DMQA 1IVUA 1RGAA 2L1SA 2P0XA 4FMCA 3VF1A 3CD63 3ALAA 1FUTA 2CWVA 5IEPA 1BSCA 1NO3A 4K90B 1GD3A 2F99A 3ECFA 5STDA 2Q07A 1B2UA 3UJMA 4XM4A 4FR9A 1B3SA 3BNCA 3HOHA 3CXC2 1X1YA 2WO0A 1HU9A 1U5OA 1RGGA 3V98A 3DGMA 3WR2A 2XH9A 3BB9A 1FUWA 5JBSA 1SJWA 1A2PA 2Z6BA 2RCDA 1C54A 5IERA 4WFOA 2FNQA 1B20A 1GMPA 1SIIA 2UGIA 1GY7A 1TTOA 2RFRA 4XBTA 1IT7A 1FGQA 1W2B2 2IY2A 1YJ93 1FA3A 1Q814 1YIT3 2F4YA 3BLZA 4L8OA 1TIJA 3AGNA 2P38A 1CYUA 3D3LA 3I563 3S67A 3QK9A 3LMLA 4N6TA 5G1LA 1BSDA 4RZMA 3CCJ3 1VQ83 1BAOA 1CQSA 2SBLA 1SQWA 3STDA 2KF3A 4FCJA 3T0UA 3CMA3 3EJVA 1AQZA 3LTAA 1OPYA 1LVNA 2CKFB 1FZUA 1G02A 1I2GA 3SVAA 3WDGB 2W03A 4HZ9B 3AHWA 2E2TA 1NDOB 3AMOB 4MMYB 4N6UA 4XDVA 1J2BA 1KD14 1UDII 2CX0A 3ZG5A 1BRSA 3CCS3 1RNBA 3EN1B 1IQYA 3K0ZA 5AYSC 1SARA 1VZZA 2CC3A 1OHSA 3WMDA 2ZA4A 3WODG 1UUWB 3OX9A 1QAKA 3KFQC 1O7NB 1B21A 1YIJ3 2LQVA 4BU4A 1GMQA 1N8QA 1OH0A 4HVNA 1OUNA 1VQ43 3J7Yd 5IF6A 1RKYA 1FUSA 2CWTA 5A0OB 1B2XA 3DM8A 5D81A 5JPUA 3AMOA 3BNDA 3GZXB 3HZPA 2QEX3 3CCQ3 1AR0A 1RSNA 1R4YA 3CC73 4WYKB 3D5GA 3O8YA 3OV4A 5IEOA 3RDEA 1G96A 6RNTA 1S723 3MG2A 4LSOA 3F7XA 4R9LA 2IMJA 3S28A 1Z1SA 1Q42A 2XEPA 3PS8A 1A90A 3HI7A 2CH9A 3ZG0A 5FGOA 1RMSA 1T2IA 3Q2PA 1O7PB 3ZFZA 1ULIB 2W0QA 3EX9A 1UCKA 1IU7A 2F98A 2Z76A 1VQ93 3GZBA 3SOAA 1DYUA 4XDWA 1ZO2A 2ZHXB 1GYBA 2LYXA 5CLKA 3GWRA 1YGWA 1JN5A 1TFKA 1YVBI 3DGNA 7GSPA 5KP4A 3NHXA 1WNHA 1VQQA 1O7WB 2HMOB 3VSYA 1W6CA 1I8VA 5EVHA 1B27A 4KFEA 5AIFA 1TRQA 3JUQA 1RN7A 3GAXA 1M1K4 1BNRA 2OQEC 3G0KA 4TX4A 4X2HA 2BMOB 3MSOA 1UUVB 1BNFA 2H0IA 3NM7A 4L7KA 1FGOA 2XFSA 5AIIA 3KCHA 1OHOA 3PCSA 1IV9A 2PNCA 2YFJB 3UNLA 1STFI 4FCZA 3KN4A 3EHCA 5HGRA 2GEYA 4G1MB 5IG3A 3D79A 4EYCA 3MHEA 2Y73A 3N9HA 2CFDA 4MMZB 2L4VA 4HM4B 3SOYA 3UL5A 3NX0A 3SLUA 2O9UX 3MPHA 4WWUC 2YX9A 1JV2B 2OOVC
chains in the Genus database with same CATH topology
3G6E3 4BTWA 2BMRB 4HBRA 1TU5A 2KCDA 3LYGA 4KFFA 5AEUB 4K61A 3FSDA 1ROAA 5JPPA 2F86B 2A15A 5AIGA 3L0RA 1KWIA 2GBXB 4FMAA 1NWWA 1OCVA 3CNXA 3G8ZA 2OTJ3 5IENA 3MYTA 3DUKA 2YFLB 4ZM8A 5IW9A 5TGNA 3CPW2 2KRTA 2XSOB 1NB5I 1JB5A 3S27A 5IG4A 2OTL3 3EQQB 4X2OA 1JB2A 1TFOA 3Q1CA 3CCM3 3DXOA 4J8TA 2CK3H 1UI7A 2HMLB 2OOVA 4XB5A 2CWUA 2WOFA 4IPBA 4O8SA 2CFKA 2W2CA 3B8LA 3VGNA 2D42A 4HKVB 4HM1B 1DMNA 2XRXB 5G2GA 4HYZA 1N5HA 2W9QA 3CPOA 4IT7A 4JRFA 3N54B 1W5ZA 3FF0A 4MJDA 1W01A 2CFLA 1LOXA 3SX1A 1US1A 4EBGA 1IT8A 3EC9A 2STDA 5AEWB 6STDA 4EV2A 2W04A 1VQM3 2P05A 5DRVA 3G4S3 2W9PA 4STDA 3FG3A 3X3XA 2B24B 4EXRA 4BTYA 1VQN3 3JUPA 5AI1A 1EG9B 3JUNA 1N5PA 3DZLA 1Q824 1OF5A 3G16A 3HK4A 3X40A 1ULJB 3SXXA 5CK6A 4CDLA 4H61A 2HMMB 1U8CB 2I9WA 4HJLB 1AV4A 4PEJA 3U97A 4AKZA 1QVF2 4NHFA 3LXUX 3ROBA 1YHQ3 4N3VA 2M7OA 2FXTA 2R4IA 3KE7A 4EC6A 3F8XA 3FG4A 2WGQA 1YGEA 1MNLA 2KXGA 1JN5B 3ER7A 1DVDA 5D83A 2OWPA 4HM8B 3CU3A 2QIYA 3FG1A 5CF2A 4WP5A 5EQLA 1UW1A 2YFIB 3FZWA 1Y4KA 4MMXB 3NBRA 3K5TA 4FMDA 3NXJA 3FF2A 3OWUA 3LT8A 3CCR3 1E97A 3NBJA 1W7CA 2FGTA 3X42A 8CHOA 3MG1A 1ZX2A 4HM2B 1OHPA 3FKAA 3X41A 3LTBA 2P09A 1SPUA 1W2ZA 1WMNA 3OWYA 5IG0A 3CC23 4H3UA 3UB1A 3X3YA 4AEQA 3EF8A 1OGXA 1QAFA 4R1KA 1FGRA 1VQO3 4O02B 3PXMA 1JB4A 1JKGA 2MF7A 3CCU3 1E3RA 1F8NA 2IUKA 1Q864 1T5YA 3F9SA 1K8A4 1GD4A 1OGZA 3PYJA 3OW22 1IDPA 4RBNA 3NBBA 2BO9B 3CCL3 1K9M4 1N9EA 1QMAA 3DY5A 1VQL3 2GU1A 1L5GB 2Z7AA 3H51A 3HIIA 2XFTA 5ELUA 4CCVA 3GZYB 2BHMA 2CW9A 1KQS2 2K54A 4L8PA 3I0YA 1V74A 2P0MA 3K63A 3K9MC 3EB8A 1IVWA 1GY6A 5CXOA 4OVMA 1IVVA 1WQLB 1CYVA 2W56A 4KVHA 4RNYA 1SIHA 1TUHA 1RRHA 1IV7A 5BXQA 1A2VA 1JRQA 2CFGA 4OUQA 4IIAA 2GBWB 4NREA 5IG5A 4KFDA 3LH4A 3QRDA 3I553 3T8NA 5KP3A 2E2VA 2RSXA 1MOLA 1YI23 4JF8A 1O7HB 2IUJA 1KSIA 4MEIA 4HZBB 2ML6A 4FMBA 3UL6A 3B7CA 3X3ZA 3MKIA 4N6LA 4QWTA 1QVG2 4HM6B 3IMAB 1M904 2W6JH 3N8BA 3NM2A 1W00A 1WMOA 1YJW3 1ISKA 1Q40B 3D9RA 4O2HA 3TDGA 3WOFB 1W6YA 3CME3 3NUVA 1LXEA 2O3OA 3H3HA 4I4KA 1OF5B 4N6NB 1CEWI 3B4OA 2K0MA 3F40A 3EBTA 2CG1A 4OK0A 2QA43 3KSPA 2JDIH 3F14A 3CCV3 2ZL8A 3LZAA 4ORLA 1BUQA 4LEHA 3BNEA 3HIGA 2CFWA 5D82A 3B4PA 1FGTA 3NV0B 1Q40A 1QJGA 1R4CA 1YJN3 3EBYA 3GRDA 3RGRA 3CCE3 1VQ73 5BVBA 4HM0B 2D1WA 4BTXA 3LOYA 3DGLA 2XGLA 1OACA 2INXA 4XBYA 2RGQA 2XGNA 3MG3A 2C11A 2E2UA 3V92A 1LNHA 4GB5A 2QGUA 3T8UA 1JJ22 1KC84 5LC7A 1IQXA 3F8HA 1K41A 4AKYA 1AVLA 1VQ63 2XR8B 1W02A 3EN8A 1JNQA 3NV0A 4U13A 5EEOA 1IK3A 4FCMA 2Y74A 1N8R4 1EQKA 1GS3A 2GU3A 2XF3A 3FGYA 1K28A 1JKGB 5DREA 1W6GA 2C10A 1RRLA 3DGOA 1STDA 5CF1A 3NQYA 3PZWA 2BNGA 2IA7A 7STDA 3KIIA 1C7HA 1D6UA 4O3VA 1Q7Y4 3A76A 3JVCA 4R80A 1UI8A 2Z77A 4WHAA 1ASKA 3HX8A 5AIHA 4K1VA 1K734 3IPTA 4GL6A 1HKXA 4HM5B 4XBXA 5I97A 4K1UA 2ZDJA 2HMNB 2PZVA 3JUMA 1NJI4 4R9KA 1DMMA 1PFPA 1N9JA 3PCRA 3F7SA 1E3VA 2W56B 1IQ8A 3S29A 3OXAA 3JUOA 4LGQA 4N6V0 2HMJB 2WOHA 4HM3B 3LTCA 1W4NA 1WTHA 1RJOA 2B1XB 3EE1A 3FLJA 3G713 1VQ53 2GXFA 2V1LA 1O7GB 3DMCA 1GY5A 1NB3I 2ML5A 1M9GA 1A2KA 3BNBA 3E99A 4KZ1A 3NQZA 1O7MB 3Q90A 2JQ5A 4WYKA 3U1WA 1TP6A 3CNMA 3GZRA 3WOEB 5FW5A 1PU4A 1VQK3 2WGOA 3RGAA 1AVKA 2UX0A 3M8CA 2HMKB 3CC43 1S5AA 2OCTA 3S5CA 4HM7B 1WMPA 5AYRB 1ROVA 1QALA 1VQP3 2CIUA 3IJEB 3KZTA 3PGBA 1NU3A 1D6YA 3LTDA 3MWZA 3SEDA 2MC8A 5KP1A 4J9AA 4RNZA 3KKGA 5LC6A 1D6ZA 2BT3A 4N6OB 4N6MA 3K7CA 3FCSB 5ELJA 4LZIA 3WA2X 3WA3A 4EV5A 1FGMA 2XSHB 1EA2A 1A67A 3LT9A 3V99A 2CG0A 2CHCA 1DVCA 1IVXA 1EKMA 2BMQB 3OWSA 3KSED 4LMIA 2OQEA 4Q53A 2GEXA 1M1XB 4R4KA 3FH1A 1DMQA 1IVUA 4FMCA 2P0XA 3VF1A 3CD63 3ALAA 2CWVA 5IEPA 1NO3A 4K90B 1GD3A 2F99A 3ECFA 5STDA 2Q07A 3UJMA 4XM4A 4FR9A 3BNCA 3CXC2 2WO0A 1HU9A 1U5OA 3V98A 3DGMA 2XH9A 3BB9A 1FUWA 5JBSA 1SJWA 2Z6BA 2RCDA 5IERA 4WFOA 2FNQA 1SIIA 1GY7A 2RFRA 4XBTA 1IT7A 1FGQA 1W2B2 1YJ93 1FA3A 1Q814 1YIT3 3BLZA 4L8OA 1TIJA 2P38A 1CYUA 3D3LA 3I563 3S67A 3QK9A 3LMLA 4N6TA 1VQ83 3CCJ3 4RZMA 2SBLA 1CQSA 1SQWA 3STDA 4FCJA 3T0UA 3CMA3 3EJVA 3LTAA 1OPYA 1LVNA 2CKFB 3SVAA 3WDGB 2W03A 4HZ9B 2E2TA 1NDOB 3AMOB 4MMYB 4N6UA 4XDVA 1J2BA 1KD14 3CCS3 3EN1B 1IQYA 3K0ZA 5AYSC 1VZZA 2CC3A 1OHSA 3WMDA 3WODG 1UUWB 3OX9A 1QAKA 3KFQC 1O7NB 1YIJ3 2LQVA 1N8QA 1OH0A 4HVNA 1OUNA 1VQ43 3J7Yd 5IF6A 1RKYA 2CWTA 5A0OB 3DM8A 5D81A 5JPUA 3AMOA 3BNDA 3GZXB 3HZPA 2QEX3 3CCQ3 1AR0A 3CC73 4WYKB 3O8YA 3OV4A 5IEOA 3RDEA 1G96A 1S723 3MG2A 4LSOA 3F7XA 4R9LA 2IMJA 3S28A 1Z1SA 1Q42A 2XEPA 3PS8A 1A90A 3HI7A 2CH9A 5FGOA 3Q2PA 1O7PB 1ULIB 2W0QA 3EX9A 1IU7A 2F98A 2Z76A 1VQ93 3GZBA 3SOAA 1DYUA 4XDWA 1ZO2A 1GYBA 2LYXA 5CLKA 3GWRA 1JN5A 1TFKA 1YVBI 3DGNA 5KP4A 3NHXA 1WNHA 2HMOB 1O7WB 3VSYA 1W6CA 5EVHA 4KFEA 5AIFA 3JUQA 1RN7A 3GAXA 1M1K4 2OQEC 3G0KA 4TX4A 4X2HA 2BMOB 3MSOA 1UUVB 3NM7A 4L7KA 1FGOA 2XFSA 5AIIA 1OHOA 3PCSA 1IV9A 2PNCA 2YFJB 3UNLA 1STFI 4FCZA 3KN4A 3EHCA 5HGRA 2GEYA 4G1MB 5IG3A 4EYCA 3MHEA 2Y73A 3N9HA 2CFDA 4MMZB 2L4VA 4HM4B 3SOYA 3UL5A 3NX0A 3SLUA 2O9UX 3MPHA 4WWUC 2YX9A 1JV2B 2OOVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMR B;  3LYG A;  5AEU B;  3FSD A;  5JPP A;  2F86 B;  2A15 A;  5AIG A;  2GBX B;  1NWW A;  1OCV A;  3CNX A;  3G8Z A;  5IEN A;  3MYT A;  3DUK A;  2YFL B;  5TGN A;  2XSO B;  1JB5 A;  5IG4 A;  3EQQ B;  4X2O A;  1JB2 A;  3DXO A;  4J8T A;  2HML B;  4XB5 A;  2W2C A;  3B8L A;  3VGN A;  4HKV B;  4HM1 B;  1DMN A;  2XRX B;  5G2G A;  3CPO A;  3FF0 A;  4MJD A;  1W01 A;  3EC9 A;  2STD A;  5AEW B;  6STD A;  5DRV A;  4STD A;  2B24 B;  3JUP A;  5AI1 A;  1EG9 B;  3JUN A;  3DZL A;  1OF5 A;  3G16 A;  3HK4 A;  1ULJ B;  5CK6 A;  4CDL A;  2HMM B;  2I9W A;  4HJL B;  4PEJ A;  3ROB A;  4N3V A;  2R4I A;  3KE7 A;  3F8X A;  1JN5 B;  3ER7 A;  5D83 A;  2OWP A;  4HM8 B;  3CU3 A;  2QIY A;  5CF2 A;  4WP5 A;  2YFI B;  3FZW A;  3NBR A;  3NXJ A;  3FF2 A;  3OWU A;  1E97 A;  8CHO A;  3MG1 A;  1ZX2 A;  4HM2 B;  1OHP A;  3FKA A;  3OWY A;  5IG0 A;  4H3U A;  3EF8 A;  1OGX A;  4R1K A;  1JB4 A;  1JKG A;  1E3R A;  3F9S A;  1OGZ A;  1IDP A;  1QMA A;  2Z7A A;  3H51 A;  3GZY B;  2K54 A;  4L8P A;  3I0Y A;  1GY6 A;  5CXO A;  4OVM A;  1WQL B;  4KVH A;  1TUH A;  5BXQ A;  4OUQ A;  4IIA A;  2GBW B;  5IG5 A;  3T8N A;  5KP3 A;  1O7H B;  4HZB B;  3B7C A;  3MKI A;  4HM6 B;  3NM2 A;  1W00 A;  1ISK A;  1Q40 B;  3D9R A;  1W6Y A;  3NUV A;  3H3H A;  4I4K A;  1OF5 B;  3B4O A;  3F40 A;  3EBT A;  3KSP A;  3F14 A;  3LZA A;  4ORL A;  1BUQ A;  4LEH A;  5D82 A;  3B4P A;  3NV0 B;  1Q40 A;  1QJG A;  3EBY A;  3GRD A;  3RGR A;  5BVB A;  4HM0 B;  2INX A;  4XBY A;  2RGQ A;  3MG3 A;  4GB5 A;  2QGU A;  3T8U A;  3F8H A;  1K41 A;  2XR8 B;  1W02 A;  3EN8 A;  3NV0 A;  4U13 A;  4FCM A;  1GS3 A;  3FGY A;  1JKG B;  5DRE A;  5CF1 A;  1STD A;  2BNG A;  7STD A;  1C7H A;  3A76 A;  2Z77 A;  1ASK A;  3HX8 A;  5AIH A;  4K1V A;  3IPT A;  1HKX A;  4HM5 B;  4XBX A;  4K1U A;  2HMN B;  2PZV A;  3JUM A;  4R9K A;  1DMM A;  3F7S A;  1E3V A;  3OXA A;  3JUO A;  4LGQ A;  2HMJ B;  4HM3 B;  2B1X B;  3FLJ A;  2GXF A;  1O7G B;  3DMC A;  1GY5 A;  1A2K A;  3E99 A;  1O7M B;  3Q90 A;  2JQ5 A;  4WYK A;  1TP6 A;  3CNM A;  3GZR A;  5FW5 A;  3RGA A;  2UX0 A;  3M8C A;  2HMK B;  1S5A A;  3S5C A;  4HM7 B;  3KZT A;  1NU3 A;  3SED A;  5KP1 A;  4J9A A;  3KKG A;  3K7C A;  2XSH B;  1EA2 A;  2CHC A;  2BMQ B;  3OWS A;  4LMI A;  4Q53 A;  2GEX A;  3FH1 A;  1DMQ A;  5IEP A;  3ECF A;  2F99 A;  5STD A;  3UJM A;  4XM4 A;  1U5O A;  3BB9 A;  1SJW A;  2RCD A;  5IER A;  1GY7 A;  2RFR A;  4XBT A;  3BLZ A;  4L8O A;  4RZM A;  1CQS A;  3STD A;  4FCJ A;  3EJV A;  1OPY A;  2CKF B;  4HZ9 B;  1NDO B;  4XDV A;  3EN1 B;  3K0Z A;  1VZZ A;  1OHS A;  3WMD A;  1UUW B;  3OX9 A;  1O7N B;  1OH0 A;  4HVN A;  1OUN A;  5IF6 A;  3DM8 A;  5D81 A;  5JPU A;  3GZX B;  3HZP A;  1AR0 A;  4WYK B;  3OV4 A;  5IEO A;  3MG2 A;  3F7X A;  4R9L A;  2IMJ A;  1Z1S A;  1Q42 A;  1O7P B;  1ULI B;  3EX9 A;  2Z76 A;  2F98 A;  3GZB A;  3SOA A;  4XDW A;  1ZO2 A;  1GYB A;  5CLK A;  3GWR A;  1JN5 A;  5KP4 A;  3NHX A;  2HMO B;  1O7W B;  3VSY A;  5EVH A;  5AIF A;  3JUQ A;  4X2H A;  3G0K A;  2BMO B;  3MSO A;  1UUV B;  4L7K A;  5AII A;  1OHO A;  2YFJ B;  3UNL A;  3EHC A;  5HGR A;  2GEY A;  5IG3 A;  3MHE A;  4HM4 B;  3SOY A;  4WWU C; 
#chains in the Genus database with same CATH topology
 3G6E 3;  4BTW A;  2BMR B;  4HBR A;  1TU5 A;  2KCD A;  3LYG A;  4KFF A;  5AEU B;  1BNG A;  4K61 A;  3FSD A;  1ROA A;  5JPP A;  2HOH A;  1BRK A;  2F86 B;  2A15 A;  5AIG A;  3L0R A;  1KWI A;  2GBX B;  4FMA A;  1NWW A;  1OCV A;  1I0X A;  3CNX A;  1K8A 4;  3G8Z A;  2OTJ 3;  5IEN A;  1ZGX A;  3MYT A;  3DUK A;  1BSE A;  1BVI A;  2YFL B;  3AGO A;  4ZM8 A;  5IW9 A;  5TGN A;  3CPW 2;  2KRT A;  2XSO B;  1NB5 I;  1JB5 A;  3S27 A;  5IG4 A;  2OTL 3;  1RCK A;  3EQQ B;  4X2O A;  1GOY A;  2KAA A;  1JB2 A;  1TFO A;  3Q1C A;  3CCM 3;  3DXO A;  4J8T A;  2CK3 H;  1UI7 A;  2HML B;  2OOV A;  4XB5 A;  2CWU A;  1BU4 A;  2WOF A;  4IPB A;  1MWU A;  4O8S A;  2CFK A;  2W2C A;  3B8L A;  1RGL A;  3VGN A;  2K3D A;  2D42 A;  4HKV B;  4HM1 B;  1DMN A;  2XRX B;  5G2G A;  4HYZ A;  3BU4 A;  1N5H A;  1UCJ A;  1Q7H A;  1HYF A;  2W9Q A;  3CPO A;  4ILF A;  4IT7 A;  4JRF A;  3N54 B;  1W5Z A;  3FF0 A;  4MJD A;  1W01 A;  2CFL A;  1LOX A;  3SX1 A;  1US1 A;  4EBG A;  1IT8 A;  3EC9 A;  2STD A;  5AEW B;  6STD A;  4EV2 A;  2W04 A;  1LRA A;  1VQM 3;  1RN4 A;  2P05 A;  5DRV A;  3G4S 3;  2W9P A;  1I3I A;  4STD A;  3FG3 A;  3X3X A;  2B24 B;  4EXR A;  2F5W A;  4GSP A;  1JBS A;  4BTY A;  1VQN 3;  3JUP A;  5AI1 A;  1EG9 B;  3JUN A;  1N5P A;  1RGF A;  5M1A A;  3DZL A;  1Q82 4;  1BOX A;  1OF5 A;  3G16 A;  1MGW A;  3HK4 A;  3X40 A;  3AHS A;  3RNT A;  1ULJ B;  3SXX A;  5CK6 A;  4CDL A;  4H61 A;  4NPB A;  2HMM B;  1U8C B;  2I9W A;  2SAR A;  1AV4 A;  1LQG C;  4HJL B;  4PEJ A;  3U97 A;  4AKZ A;  1QVF 2;  1JZO A;  4NHF A;  3LXU X;  3ROB A;  5HOH A;  1YHQ 3;  4N3V A;  2M7O A;  2FXT A;  2R4I A;  3KE7 A;  4EC6 A;  3F8X A;  1LQM B;  3FG4 A;  2WGQ A;  8RNT A;  1T3B A;  1YGE A;  1GOV A;  1MNL A;  2KXG A;  1JN5 B;  3ER7 A;  1BNI A;  1DVD A;  1BIR A;  2OWP A;  4HM8 B;  5D83 A;  3CU3 A;  1IYY A;  2QIY A;  3FG1 A;  5CF2 A;  4WP5 A;  5EQL A;  1UW1 A;  2YFI B;  3FZW A;  1Y4K A;  4MMX B;  3NBR A;  3K5T A;  4FMD A;  3NXJ A;  3FF2 A;  3OWU A;  3LT8 A;  3CCR 3;  1E97 A;  3NBJ A;  1W7C A;  2FGT A;  3X42 A;  8CHO A;  3MG1 A;  1ZX2 A;  4HM2 B;  1OHP A;  1FYS A;  3FKA A;  1RGK A;  3LTB A;  3X41 A;  1I70 A;  2P09 A;  1SPU A;  1W2Z A;  1WMN A;  3OWY A;  5IG0 A;  1X1X A;  1JBR A;  3CC2 3;  4H3U A;  3UB1 A;  1T2H A;  2C4B A;  3X3Y A;  4AEQ A;  1GMR A;  3EF8 A;  1OGX A;  1QAF A;  1RCL A;  1FGR A;  4R1K A;  1VQO 3;  1JZD A;  4O02 B;  3PXM A;  1JB4 A;  1JKG A;  2MF7 A;  3CCU 3;  1E3R A;  1F8N A;  2IUK A;  5M18 A;  1T5Y A;  3F9S A;  9RNT A;  1LOW A;  1GD4 A;  1OGZ A;  1Q86 4;  2AAE A;  3PYJ A;  3OW2 2;  1IDP A;  4RBN A;  3NBB A;  2BO9 B;  3CCL 3;  2R41 A;  3BIR A;  1UUG B;  1K9M 4;  1N9E A;  1QMA A;  3DY5 A;  1VQL 3;  1PYL A;  2GU1 A;  1L5G B;  1BRI A;  1RNT A;  2Z7A A;  1FW7 A;  3H51 A;  1DET A;  3HII A;  2XFT A;  5ELU A;  3URP A;  4CCV A;  3GZY B;  4LYL B;  5RNT A;  2BHM A;  2CW9 A;  1KQS 2;  2K54 A;  4L8P A;  1BRH A;  3I0Y A;  1UGI A;  1V74 A;  2P0M A;  3K63 A;  4KT3 B;  3K9M C;  2KF5 A;  3EB8 A;  1IVW A;  1GY6 A;  5CXO A;  1CH0 A;  4OVM A;  1V58 A;  1IVV A;  1AY7 A;  1WQL B;  5G1K A;  1CYV A;  2W56 A;  4KVH A;  4HOH A;  1BSA A;  1NNV A;  4RNY A;  4CJN A;  1B2M A;  1SIH A;  1TUH A;  1RRH A;  1RGE A;  1UGH I;  1IV7 A;  5BXQ A;  1A2V A;  1JRQ A;  2CFG A;  4OUQ A;  2KF4 A;  2GBW B;  4IIA A;  4NRE A;  5IG5 A;  4KFD A;  1EEJ A;  2KF6 A;  1B2S A;  3LH4 A;  3QRD A;  3I55 3;  3T8N A;  5KP3 A;  2E2V A;  1BNE A;  1RN1 A;  2RSX A;  1MOL A;  1BUJ A;  1YI2 3;  4JF8 A;  1O7H B;  2IUJ A;  1KSI A;  1BNS A;  4MEI A;  4HZB B;  2ML6 A;  4FMB A;  2F5M A;  1LOV A;  1I2F A;  1YVS A;  3B7C A;  3UL6 A;  3X3Z A;  3MKI A;  4N6L A;  4QWT A;  1QVG 2;  1MWS A;  3IMA B;  4HM6 B;  2W6J H;  1M90 4;  1DE3 A;  3N8B A;  1RLS A;  3NM2 A;  1W00 A;  1WMO A;  1YJW 3;  1ISK A;  1Q40 B;  2H0H A;  3D9R A;  4O2H A;  3TDG A;  3WOF B;  1W6Y A;  1MWT A;  1RDS A;  3CME 3;  1TRP A;  3NUV A;  1LXE A;  2O3O A;  3DH2 A;  3H3H A;  4I4K A;  2F56 A;  1OF5 B;  4N6N B;  1CEW I;  3B4O A;  1RTU A;  2K0M A;  3F40 A;  1EUI C;  1LNI A;  1X1U A;  3EBT A;  2CG1 A;  1HZ1 A;  4OK0 A;  2QA4 3;  3KSP A;  2JDI H;  3F14 A;  2AAD A;  3CCV 3;  2ZL8 A;  3SYU A;  3LZA A;  4ORL A;  4I5Q A;  4LEH A;  1BUQ A;  3BNE A;  3HIG A;  2CFW A;  5D82 A;  3B4P A;  1FGT A;  1B2Z A;  3NV0 B;  1Q40 A;  2UUG C;  1QJG A;  1R4C A;  1YJN 3;  3EBY A;  3GRD A;  1RGC A;  3RGR A;  3CCE 3;  1VQ7 3;  5BVB A;  4HM0 B;  5BU4 A;  2D1W A;  4BTX A;  1BAN A;  3DGL A;  3LOY A;  2XGL A;  1OAC A;  2INX A;  4XBY A;  2RGQ A;  2XGN A;  3MG3 A;  2C11 A;  2E2U A;  3V92 A;  1LNH A;  3WHO A;  4GB5 A;  2QGU A;  3T8U A;  1MGR A;  1JJ2 2;  1KC8 4;  5LC7 A;  1IQX A;  3F8H A;  1RHL A;  1K41 A;  1YNV X;  4AKY A;  1AVL A;  1VQ6 3;  1W02 A;  1BGS A;  2XR8 B;  3EN8 A;  1JNQ A;  3NV0 A;  4U13 A;  5EEO A;  1IK3 A;  4FCM A;  5GSP A;  2Y74 A;  1N8R 4;  4RNT A;  1GS3 A;  1EQK A;  2GU3 A;  4BL3 A;  2XF3 A;  3D4A A;  3FGY A;  1K28 A;  5M19 A;  1JKG B;  5DRE A;  3A5E A;  1W6G A;  2J8X B;  2C10 A;  1RRL A;  4BL2 A;  1BNJ A;  1STD A;  3DGO A;  1Q9E A;  3NQY A;  3PZW A;  4J5G A;  5CF1 A;  3D5I A;  2BNG A;  1JBT A;  2IA7 A;  1I0V A;  3KII A;  7STD A;  1C7H A;  1D6U A;  4O3V A;  1Q7Y 4;  3A76 A;  3JVC A;  4R80 A;  1UI8 A;  2Z77 A;  4HAA A;  4WHA A;  1ASK A;  3HX8 A;  5AIH A;  4K1V A;  1K73 4;  4EW5 A;  3IPT A;  6GSP A;  4GL6 A;  2H0G A;  1G0T A;  1HKX A;  4HM5 B;  4XBX A;  5I97 A;  4K1U A;  2ZDJ A;  2HMN B;  2PZV A;  3JUM A;  1NJI 4;  4J5K A;  1DMM A;  1PFP A;  1LOY A;  1N9J A;  4R9K A;  3PCR A;  3F7S A;  1E3V A;  2W56 B;  1IQ8 A;  3S29 A;  3OXA A;  2BIR A;  1TJD A;  5BIR A;  3JUO A;  1PY3 A;  4LGQ A;  4N6V 0;  2HMJ B;  2WOH A;  4HM3 B;  3LTC A;  1V57 A;  1W4N A;  1WTH A;  1RJO A;  1BRG A;  2B1X B;  3EE1 A;  3FLJ A;  3G71 3;  1VQ5 3;  2GXF A;  2V1L A;  2BU4 A;  1O7G B;  3DMC A;  1GY5 A;  1NB3 I;  2ML5 A;  1GOU A;  1BRN L;  1M9G A;  3DGY A;  1A2K A;  3BNB A;  1RGH A;  2GSP A;  3E99 A;  4KZ1 A;  3NQZ A;  1O7M B;  3Q90 A;  7RNT A;  4DKI A;  2JQ5 A;  4WYK A;  3U1W A;  1TP6 A;  3CNM A;  3GZR A;  3WOE B;  1UCL A;  4BIR A;  1I2E A;  5FW5 A;  4CPK A;  1PU4 A;  1VQK 3;  2WGO A;  2RBI A;  3RGA A;  1AVK A;  2UX0 A;  3Q3F A;  2IYJ A;  1BRJ A;  4GHO A;  3M8C A;  2HMK B;  3CC4 3;  1S5A A;  2OCT A;  3S5C A;  4HM7 B;  1WMP A;  5AYR B;  1GSP A;  1ROV A;  1ZS7 A;  1QAL A;  1MWR A;  2CIU A;  1VQP 3;  3IJE B;  1I3F A;  3KZT A;  3PGB A;  1NU3 A;  1BSB A;  1D6Y A;  3LTD A;  3MWZ A;  3SED A;  2MC8 A;  1UCI A;  5KP1 A;  4J9A A;  3GSP A;  1X1W A;  4RNZ A;  3KKG A;  5LC6 A;  2CX1 A;  1D6Z A;  2BT3 A;  4N6O B;  2RNT A;  4N6M A;  3K7C A;  3FCS B;  5ELJ A;  4LZI A;  3WA2 X;  3WA3 A;  4EV5 A;  1FGM A;  2XSH B;  1EA2 A;  1A67 A;  3LT9 A;  3V99 A;  2CG0 A;  2CHC A;  1DVC A;  1IVX A;  1EKM A;  2BMQ B;  3OWS A;  3KSE D;  4LMI A;  2OQE A;  4Q53 A;  2GEX A;  1M1X B;  4R4K A;  3FH1 A;  1DMQ A;  1IVU A;  1RGA A;  2L1S A;  2P0X A;  4FMC A;  3VF1 A;  3CD6 3;  3ALA A;  1FUT A;  2CWV A;  5IEP A;  1BSC A;  1NO3 A;  4K90 B;  1GD3 A;  2F99 A;  3ECF A;  5STD A;  2Q07 A;  1B2U A;  3UJM A;  4XM4 A;  4FR9 A;  1B3S A;  3BNC A;  3HOH A;  3CXC 2;  1X1Y A;  2WO0 A;  1HU9 A;  1U5O A;  1RGG A;  3V98 A;  3DGM A;  3WR2 A;  2XH9 A;  3BB9 A;  1FUW A;  5JBS A;  1SJW A;  1A2P A;  2Z6B A;  2RCD A;  1C54 A;  5IER A;  4WFO A;  2FNQ A;  1B20 A;  1GMP A;  1SII A;  2UGI A;  1GY7 A;  1TTO A;  2RFR A;  4XBT A;  1IT7 A;  1FGQ A;  1W2B 2;  2IY2 A;  1YJ9 3;  1FA3 A;  1Q81 4;  1YIT 3;  2F4Y A;  3BLZ A;  4L8O A;  1TIJ A;  3AGN A;  2P38 A;  1CYU A;  3D3L A;  3I56 3;  3S67 A;  3QK9 A;  3LML A;  4N6T A;  5G1L A;  1BSD A;  4RZM A;  3CCJ 3;  1VQ8 3;  1BAO A;  1CQS A;  2SBL A;  1SQW A;  3STD A;  2KF3 A;  4FCJ A;  3T0U A;  3CMA 3;  3EJV A;  1AQZ A;  3LTA A;  1OPY A;  1LVN A;  2CKF B;  1FZU A;  1G02 A;  1I2G A;  3SVA A;  3WDG B;  2W03 A;  4HZ9 B;  3AHW A;  2E2T A;  1NDO B;  3AMO B;  4MMY B;  4N6U A;  4XDV A;  1J2B A;  1KD1 4;  1UDI I;  2CX0 A;  3ZG5 A;  1BRS A;  3CCS 3;  1RNB A;  3EN1 B;  1IQY A;  3K0Z A;  5AYS C;  1SAR A;  1VZZ A;  2CC3 A;  1OHS A;  3WMD A;  2ZA4 A;  3WOD G;  1UUW B;  3OX9 A;  1QAK A;  3KFQ C;  1O7N B;  1B21 A;  1YIJ 3;  2LQV A;  4BU4 A;  1GMQ A;  1N8Q A;  1OH0 A;  4HVN A;  1OUN A;  1VQ4 3;  3J7Y d;  5IF6 A;  1RKY A;  1FUS A;  2CWT A;  5A0O B;  1B2X A;  3DM8 A;  5D81 A;  5JPU A;  3AMO A;  3BND A;  3GZX B;  3HZP A;  2QEX 3;  3CCQ 3;  1AR0 A;  1RSN A;  1R4Y A;  3CC7 3;  4WYK B;  3D5G A;  3O8Y A;  3OV4 A;  5IEO A;  3RDE A;  1G96 A;  6RNT A;  1S72 3;  3MG2 A;  4LSO A;  3F7X A;  4R9L A;  2IMJ A;  3S28 A;  1Z1S A;  1Q42 A;  2XEP A;  3PS8 A;  1A90 A;  3HI7 A;  2CH9 A;  3ZG0 A;  5FGO A;  1RMS A;  1T2I A;  3Q2P A;  1O7P B;  3ZFZ A;  1ULI B;  2W0Q A;  3EX9 A;  1UCK A;  1IU7 A;  2F98 A;  2Z76 A;  1VQ9 3;  3GZB A;  3SOA A;  1DYU A;  4XDW A;  1ZO2 A;  2ZHX B;  1GYB A;  2LYX A;  5CLK A;  3GWR A;  1YGW A;  1JN5 A;  1TFK A;  1YVB I;  3DGN A;  7GSP A;  5KP4 A;  3NHX A;  1WNH A;  1VQQ A;  1O7W B;  2HMO B;  3VSY A;  1W6C A;  1I8V A;  5EVH A;  1B27 A;  4KFE A;  5AIF A;  1TRQ A;  3JUQ A;  1RN7 A;  3GAX A;  1M1K 4;  1BNR A;  2OQE C;  3G0K A;  4TX4 A;  4X2H A;  2BMO B;  3MSO A;  1UUV B;  1BNF A;  2H0I A;  3NM7 A;  4L7K A;  1FGO A;  2XFS A;  5AII A;  3KCH A;  1OHO A;  3PCS A;  1IV9 A;  2PNC A;  2YFJ B;  3UNL A;  1STF I;  4FCZ A;  3KN4 A;  3EHC A;  5HGR A;  2GEY A;  4G1M B;  5IG3 A;  3D79 A;  4EYC A;  3MHE A;  2Y73 A;  3N9H A;  2CFD A;  4MMZ B;  2L4V A;  4HM4 B;  3SOY A;  3UL5 A;  3NX0 A;  3SLU A;  2O9U X;  3MPH A;  4WWU C;  2YX9 A;  1JV2 B;  2OOV C; 
#chains in the Genus database with same CATH homology
 3G6E 3;  4BTW A;  2BMR B;  4HBR A;  1TU5 A;  2KCD A;  3LYG A;  4KFF A;  5AEU B;  4K61 A;  3FSD A;  1ROA A;  5JPP A;  2F86 B;  2A15 A;  5AIG A;  3L0R A;  1KWI A;  2GBX B;  4FMA A;  1NWW A;  1OCV A;  3CNX A;  3G8Z A;  2OTJ 3;  5IEN A;  3MYT A;  3DUK A;  2YFL B;  4ZM8 A;  5IW9 A;  5TGN A;  3CPW 2;  2KRT A;  2XSO B;  1NB5 I;  1JB5 A;  3S27 A;  5IG4 A;  2OTL 3;  3EQQ B;  4X2O A;  1JB2 A;  1TFO A;  3Q1C A;  3CCM 3;  3DXO A;  4J8T A;  2CK3 H;  1UI7 A;  2HML B;  2OOV A;  4XB5 A;  2CWU A;  2WOF A;  4IPB A;  4O8S A;  2CFK A;  2W2C A;  3B8L A;  3VGN A;  2D42 A;  4HKV B;  4HM1 B;  1DMN A;  2XRX B;  5G2G A;  4HYZ A;  1N5H A;  2W9Q A;  3CPO A;  4IT7 A;  4JRF A;  3N54 B;  1W5Z A;  3FF0 A;  4MJD A;  1W01 A;  2CFL A;  1LOX A;  3SX1 A;  1US1 A;  4EBG A;  1IT8 A;  3EC9 A;  2STD A;  5AEW B;  6STD A;  4EV2 A;  2W04 A;  1VQM 3;  2P05 A;  5DRV A;  3G4S 3;  2W9P A;  4STD A;  3FG3 A;  3X3X A;  2B24 B;  4EXR A;  4BTY A;  1VQN 3;  3JUP A;  5AI1 A;  1EG9 B;  3JUN A;  1N5P A;  3DZL A;  1Q82 4;  1OF5 A;  3G16 A;  3HK4 A;  3X40 A;  1ULJ B;  3SXX A;  5CK6 A;  4CDL A;  4H61 A;  2HMM B;  1U8C B;  2I9W A;  4HJL B;  1AV4 A;  4PEJ A;  3U97 A;  4AKZ A;  1QVF 2;  4NHF A;  3LXU X;  3ROB A;  1YHQ 3;  4N3V A;  2M7O A;  2FXT A;  2R4I A;  3KE7 A;  4EC6 A;  3F8X A;  3FG4 A;  2WGQ A;  1YGE A;  1MNL A;  2KXG A;  1JN5 B;  3ER7 A;  1DVD A;  5D83 A;  2OWP A;  4HM8 B;  3CU3 A;  2QIY A;  3FG1 A;  5CF2 A;  4WP5 A;  5EQL A;  1UW1 A;  2YFI B;  3FZW A;  1Y4K A;  4MMX B;  3NBR A;  3K5T A;  4FMD A;  3NXJ A;  3FF2 A;  3OWU A;  3LT8 A;  3CCR 3;  1E97 A;  3NBJ A;  1W7C A;  2FGT A;  3X42 A;  8CHO A;  3MG1 A;  1ZX2 A;  4HM2 B;  1OHP A;  3FKA A;  3X41 A;  3LTB A;  2P09 A;  1SPU A;  1W2Z A;  1WMN A;  3OWY A;  5IG0 A;  3CC2 3;  4H3U A;  3UB1 A;  3X3Y A;  4AEQ A;  3EF8 A;  1OGX A;  1QAF A;  4R1K A;  1FGR A;  1VQO 3;  4O02 B;  3PXM A;  1JB4 A;  1JKG A;  2MF7 A;  3CCU 3;  1E3R A;  1F8N A;  2IUK A;  1Q86 4;  1T5Y A;  3F9S A;  1K8A 4;  1GD4 A;  1OGZ A;  3PYJ A;  3OW2 2;  1IDP A;  4RBN A;  3NBB A;  2BO9 B;  3CCL 3;  1K9M 4;  1N9E A;  1QMA A;  3DY5 A;  1VQL 3;  2GU1 A;  1L5G B;  2Z7A A;  3H51 A;  3HII A;  2XFT A;  5ELU A;  4CCV A;  3GZY B;  2BHM A;  2CW9 A;  1KQS 2;  2K54 A;  4L8P A;  3I0Y A;  1V74 A;  2P0M A;  3K63 A;  3K9M C;  3EB8 A;  1IVW A;  1GY6 A;  5CXO A;  4OVM A;  1IVV A;  1WQL B;  1CYV A;  2W56 A;  4KVH A;  4RNY A;  1SIH A;  1TUH A;  1RRH A;  1IV7 A;  5BXQ A;  1A2V A;  1JRQ A;  2CFG A;  4OUQ A;  4IIA A;  2GBW B;  4NRE A;  5IG5 A;  4KFD A;  3LH4 A;  3QRD A;  3I55 3;  3T8N A;  5KP3 A;  2E2V A;  2RSX A;  1MOL A;  1YI2 3;  4JF8 A;  1O7H B;  2IUJ A;  1KSI A;  4MEI A;  4HZB B;  2ML6 A;  4FMB A;  3UL6 A;  3B7C A;  3X3Z A;  3MKI A;  4N6L A;  4QWT A;  1QVG 2;  4HM6 B;  3IMA B;  1M90 4;  2W6J H;  3N8B A;  3NM2 A;  1W00 A;  1WMO A;  1YJW 3;  1ISK A;  1Q40 B;  3D9R A;  4O2H A;  3TDG A;  3WOF B;  1W6Y A;  3CME 3;  3NUV A;  1LXE A;  2O3O A;  3H3H A;  4I4K A;  1OF5 B;  4N6N B;  1CEW I;  3B4O A;  2K0M A;  3F40 A;  3EBT A;  2CG1 A;  4OK0 A;  2QA4 3;  3KSP A;  2JDI H;  3F14 A;  3CCV 3;  2ZL8 A;  3LZA A;  4ORL A;  1BUQ A;  4LEH A;  3BNE A;  3HIG A;  2CFW A;  5D82 A;  3B4P A;  1FGT A;  3NV0 B;  1Q40 A;  1QJG A;  1R4C A;  1YJN 3;  3EBY A;  3GRD A;  3RGR A;  3CCE 3;  1VQ7 3;  5BVB A;  4HM0 B;  2D1W A;  4BTX A;  3LOY A;  3DGL A;  2XGL A;  1OAC A;  2INX A;  4XBY A;  2RGQ A;  2XGN A;  3MG3 A;  2C11 A;  2E2U A;  3V92 A;  1LNH A;  4GB5 A;  2QGU A;  3T8U A;  1JJ2 2;  1KC8 4;  5LC7 A;  1IQX A;  3F8H A;  1K41 A;  4AKY A;  1AVL A;  1VQ6 3;  2XR8 B;  1W02 A;  3EN8 A;  1JNQ A;  3NV0 A;  4U13 A;  5EEO A;  1IK3 A;  4FCM A;  2Y74 A;  1N8R 4;  1EQK A;  1GS3 A;  2GU3 A;  2XF3 A;  3FGY A;  1K28 A;  1JKG B;  5DRE A;  1W6G A;  2C10 A;  1RRL A;  3DGO A;  1STD A;  5CF1 A;  3NQY A;  3PZW A;  2BNG A;  2IA7 A;  7STD A;  3KII A;  1C7H A;  1D6U A;  4O3V A;  1Q7Y 4;  3A76 A;  3JVC A;  4R80 A;  1UI8 A;  2Z77 A;  4WHA A;  1ASK A;  3HX8 A;  5AIH A;  4K1V A;  1K73 4;  3IPT A;  4GL6 A;  1HKX A;  4HM5 B;  4XBX A;  5I97 A;  4K1U A;  2ZDJ A;  2HMN B;  2PZV A;  3JUM A;  1NJI 4;  4R9K A;  1DMM A;  1PFP A;  1N9J A;  3PCR A;  3F7S A;  1E3V A;  2W56 B;  1IQ8 A;  3S29 A;  3OXA A;  3JUO A;  4LGQ A;  4N6V 0;  2HMJ B;  2WOH A;  4HM3 B;  3LTC A;  1W4N A;  1WTH A;  1RJO A;  2B1X B;  3EE1 A;  3FLJ A;  3G71 3;  1VQ5 3;  2GXF A;  2V1L A;  1O7G B;  3DMC A;  1GY5 A;  1NB3 I;  2ML5 A;  1M9G A;  1A2K A;  3BNB A;  3E99 A;  4KZ1 A;  3NQZ A;  1O7M B;  3Q90 A;  2JQ5 A;  4WYK A;  3U1W A;  1TP6 A;  3CNM A;  3GZR A;  3WOE B;  5FW5 A;  1PU4 A;  1VQK 3;  2WGO A;  3RGA A;  1AVK A;  2UX0 A;  3M8C A;  2HMK B;  3CC4 3;  1S5A A;  2OCT A;  3S5C A;  4HM7 B;  1WMP A;  5AYR B;  1ROV A;  1QAL A;  1VQP 3;  2CIU A;  3IJE B;  3KZT A;  3PGB A;  1NU3 A;  1D6Y A;  3LTD A;  3MWZ A;  3SED A;  2MC8 A;  5KP1 A;  4J9A A;  4RNZ A;  3KKG A;  5LC6 A;  1D6Z A;  2BT3 A;  4N6O B;  4N6M A;  3K7C A;  3FCS B;  5ELJ A;  4LZI A;  3WA2 X;  3WA3 A;  4EV5 A;  1FGM A;  2XSH B;  1EA2 A;  1A67 A;  3LT9 A;  3V99 A;  2CG0 A;  2CHC A;  1DVC A;  1IVX A;  1EKM A;  2BMQ B;  3OWS A;  3KSE D;  4LMI A;  2OQE A;  4Q53 A;  2GEX A;  1M1X B;  4R4K A;  3FH1 A;  1DMQ A;  1IVU A;  4FMC A;  2P0X A;  3VF1 A;  3CD6 3;  3ALA A;  2CWV A;  5IEP A;  1NO3 A;  4K90 B;  1GD3 A;  2F99 A;  3ECF A;  5STD A;  2Q07 A;  3UJM A;  4XM4 A;  4FR9 A;  3BNC A;  3CXC 2;  2WO0 A;  1HU9 A;  1U5O A;  3V98 A;  3DGM A;  2XH9 A;  3BB9 A;  1FUW A;  5JBS A;  1SJW A;  2Z6B A;  2RCD A;  5IER A;  4WFO A;  2FNQ A;  1SII A;  1GY7 A;  2RFR A;  4XBT A;  1IT7 A;  1FGQ A;  1W2B 2;  1YJ9 3;  1FA3 A;  1Q81 4;  1YIT 3;  3BLZ A;  4L8O A;  1TIJ A;  2P38 A;  1CYU A;  3D3L A;  3I56 3;  3S67 A;  3QK9 A;  3LML A;  4N6T A;  1VQ8 3;  3CCJ 3;  4RZM A;  2SBL A;  1CQS A;  1SQW A;  3STD A;  4FCJ A;  3T0U A;  3CMA 3;  3EJV A;  3LTA A;  1OPY A;  1LVN A;  2CKF B;  3SVA A;  3WDG B;  2W03 A;  4HZ9 B;  2E2T A;  1NDO B;  3AMO B;  4MMY B;  4N6U A;  4XDV A;  1J2B A;  1KD1 4;  3CCS 3;  3EN1 B;  1IQY A;  3K0Z A;  5AYS C;  1VZZ A;  2CC3 A;  1OHS A;  3WMD A;  3WOD G;  1UUW B;  3OX9 A;  1QAK A;  3KFQ C;  1O7N B;  1YIJ 3;  2LQV A;  1N8Q A;  1OH0 A;  4HVN A;  1OUN A;  1VQ4 3;  3J7Y d;  5IF6 A;  1RKY A;  2CWT A;  5A0O B;  3DM8 A;  5D81 A;  5JPU A;  3AMO A;  3BND A;  3GZX B;  3HZP A;  2QEX 3;  3CCQ 3;  1AR0 A;  3CC7 3;  4WYK B;  3O8Y A;  3OV4 A;  5IEO A;  3RDE A;  1G96 A;  1S72 3;  3MG2 A;  4LSO A;  3F7X A;  4R9L A;  2IMJ A;  3S28 A;  1Z1S A;  1Q42 A;  2XEP A;  3PS8 A;  1A90 A;  3HI7 A;  2CH9 A;  5FGO A;  3Q2P A;  1O7P B;  1ULI B;  2W0Q A;  3EX9 A;  1IU7 A;  2F98 A;  2Z76 A;  1VQ9 3;  3GZB A;  3SOA A;  1DYU A;  4XDW A;  1ZO2 A;  1GYB A;  2LYX A;  5CLK A;  3GWR A;  1JN5 A;  1TFK A;  1YVB I;  3DGN A;  5KP4 A;  3NHX A;  1WNH A;  2HMO B;  1O7W B;  3VSY A;  1W6C A;  5EVH A;  4KFE A;  5AIF A;  3JUQ A;  1RN7 A;  3GAX A;  1M1K 4;  2OQE C;  3G0K A;  4TX4 A;  4X2H A;  2BMO B;  3MSO A;  1UUV B;  3NM7 A;  4L7K A;  1FGO A;  2XFS A;  5AII A;  1OHO A;  3PCS A;  1IV9 A;  2PNC A;  2YFJ B;  3UNL A;  1STF I;  4FCZ A;  3KN4 A;  3EHC A;  5HGR A;  2GEY A;  4G1M B;  5IG3 A;  4EYC A;  3MHE A;  2Y73 A;  3N9H A;  2CFD A;  4MMZ B;  2L4V A;  4HM4 B;  3SOY A;  3UL5 A;  3NX0 A;  3SLU A;  2O9U X;  3MPH A;  4WWU C;  2YX9 A;  1JV2 B;  2OOV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...