1GMRA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmrA00
1FUSA 1RSNA 1I0XA 2F5WA 4HAAA 1BSBA 1I2FA 1B2SA 1GOUA 1BRHA 3D4AA 1BRGA 1UCKA 1YVSA 1BNIA 1RGHA 1RHLA 3GSPA 5HOHA 1GOYA 3HOHA 1BU4A 4J5GA 1RGFA 2KF6A 1YNVX 1CH0A 1RDSA 1RCKA 1ZGXA 1X1XA 1X1YA 4GSPA 2F5MA 3SYUA 3BU4A 1DE3A 1RTUA 1PY3A 1T2IA 4BU4A 3KCHA 1RN4A 6GSPA 1BRSA 1BRNL 1PYLA 1BSEA 2HOHA 1BGSA 4J5KA 1B2ZA 3URPA 1BUJA 1AQZA 1T2HA 2GSPA 3Q3FA 1FUTA 1BNEA 1I8VA 1G02A 8RNTA 1BNRA 1GMRA 6RNTA 1BIRA 7RNTA 1JBRA 1SARA 3WHOA 2RNTA 3AGNA 1BRKA 1UCLA 1B2XA 1X1UA 2F4YA 1I0VA 4HOHA 1LOVA 2F56A 1BAOA 4BIRA 1GOVA 2KF5A 1JBTA 1RLSA 3WR2A 1LOWA 1LNIA 1A2PA 2AADA 5BIRA 1JBSA 1RGCA 3D5GA 3A5EA 2RBIA 1B2UA 1MGRA 1B2MA 1BSDA 2ZA4A 1I2GA 1R4YA 3D5IA 1BSCA 1I3FA 1I2EA 1TRQA 1TRPA 1BNJA 1RNBA 1RNTA 1RN1A 1I70A 1RGLA 1LOYA 2KF4A 5BU4A 1I3IA 4RNTA 1UCJA 1BRJA 2BU4A 1RMSA 1B21A 1GMPA 1LRAA 1BNFA 1RGEA 2KF3A 7GSPA 5RNTA 1X1WA 1UCIA 1RCLA 1AY7A 1DETA 1TTOA 3DGYA 3RNTA 1HZ1A 1FYSA 1RGAA 1YGWA 3AGOA 1BVIA 2C4BA 3AHWA 2SARA 3AHSA 1HYFA 2KAAA 1BANA 1GSPA 2AAEA 1RGGA 1FW7A 1BSAA 1B20A 1Q9EA 3BIRA 1B27A 1BOXA 1BNGA 1MGWA 2BIRA 1B3SA 1BNSA 9RNTA 3DH2A 4GHOA 1GMQA 1IYYA 1RGKA 1FZUA 5GSPA 1BRIA 1C54A
chains in the Genus database with same CATH superfamily
1RSNA 2BO9B 2SBLA 2R4IA 1JRQA 1I2FA 1B2SA 1GOUA 1W6YA 4OK0A 1UCKA 2E2VA 4U13A 1QMAA 2WO0A 1BNIA 3T0UA 1Q40A 1WMOA 2P05A 3LOYA 2GBXB 4HM3B 2XF3A 1YI23 4G1MB 1YNVX 4IT7A 4K90B 3WOEB 3MPHA 1K9M4 4R80A 2YFIB 1JB2A 3T8NA 1VQ53 1UUVB 1GYBA 3K63A 1DE3A 2OQEC 4HM7B 5A0OB 5DREA 3KFQC 6GSPA 1M1XB 3NV0A 4HZBB 1BRNL 1PYLA 5AIFA 4HM0B 4J5KA 1GY6A 3LMLA 1EUIC 3LTBA 1MWSA 1N9EA 2IMJA 2FGTA 5JBSA 1UI7A 3HI7A 2ZHXB 1T2HA 3NBBA 3Q3FA 1RJOA 3X42A 1IVUA 3EN1B 1I8VA 3SOYA 8RNTA 2Z76A 3RGRA 5M18A 4WFOA 2RSXA 2ZL8A 5IG4A 1SARA 3H51A 4MMXB 1SPUA 1UGIA 2F86B 3WHOA 1NWWA 4GL6A 3F9SA 3PXMA 1JB4A 3CC23 3S67A 1IU7A 1OH0A 2BT3A 5D81A 1I0VA 2A15A 1LOVA 1BAOA 4H61A 3IMAB 3OWUA 1DMMA 2D1WA 2MC8A 5AEUB 1ASKA 3EQQB 1S5AA 3GRDA 3KN4A 1JBSA 4N6UA 3A5EA 2RBIA 1Q7Y4 4CCVA 3CCV3 1MWRA 1B2MA 1N8R4 3A76A 3NX0A 1R4YA 2GBWB 3GZXB 3T8UA 2CKFB 2F98A 2W9QA 3VGNA 2JQ5A 3K0ZA 3PCSA 4AKYA 1EQKA 1FUWA 1YHQ3 3Q90A 1BNJA 1WMNA 2B24B 3CCJ3 1DYUA 4HKVB 4NREA 1K41A 3LTAA 1SIIA 1W5ZA 3WOFB 1QAKA 1VQO3 1E3RA 1BRJA 1UCJA 3Q1CA 4HBRA 1B21A 2CH9A 2KCDA 3DGMA 4FCZA 4FR9A 1IVVA 5AYRB 1L5GB 1PFPA 5RNTA 2CX1A 1UCIA 1LQMB 4I4KA 2XRXB 1VQL3 5M19A 1V57A 3DGNA 1UUGB 4EYCA 3FG4A 1J2BA 1LVNA 4R9LA 1YGWA 2W04A 4CDLA 1ROVA 2SARA 3AHSA 4ZM8A 1O7GB 2CX0A 1HYFA 2INXA 3MKIA 4RZMA 7STDA 1W00A 3OW22 1DMNA 1TU5A 1W6CA 3I563 2Y74A 3JVCA 2P0XA 3CXC2 4HVNA 4IIAA 3VSYA 3KE7A 3BNCA 1BNGA 1STFI 1D6ZA 1ZO2A 2Z6BA 1OACA 2RGQA 3DH2A 3EC9A 4K1VA 1GMQA 1WTHA 1T3BA 3MG2A 2RFRA 1D6YA 2W9PA 4L8OA 1Q824 3CD63 3ZG5A 1FZUA 4RNYA 4OVMA 5G2GA 1N5HA 2WGQA 3UNLA 1O7NB 3D4AA 2XFSA 1BRGA 1YVSA 1N9JA 3V99A 4XB5A 4LMIA 2ML5A 3MWZA 4LSOA 1OUNA 2BMQB 1WNHA 1GOYA 1W6GA 1YGEA 3HOHA 1BU4A 3KZTA 3BNBA 4K1UA 1RGFA 4XBTA 2E2UA 5HGRA 4CJNA 2V1LA 4NPBA 5G1LA 3S29A 4WHAA 5KP3A 4GSPA 1OHSA 1TUHA 4N6NB 1OHOA 5AIIA 3TDGA 2B1XB 1V74A 2BHMA 2CC3A 1T2IA 2GU1A 1OGZA 4WYKB 2IUJA 2J8XB 4PEJA 1BSEA 1RKYA 5D82A 4O3VA 1NJI4 1Q42A 3K5TA 1QVG2 5CXOA 1R4CA 2GSPA 3FLJA 4IPBA 3MG3A 3QRDA 4NHFA 1FUTA 1FA3A 1BNEA 1W02A 2K0MA 3SXXA 4BTXA 4HM6B 3JUOA 1GMRA 1ROAA 3CPOA 1E3VA 2Y73A 4FCMA 4KVHA 1KWIA 5EVHA 2PNCA 5ELUA 7RNTA 1JBRA 2WOFA 1STDA 1IQ8A 4LEHA 3RGAA 4KZ1A 1HKXA 2HMMB 1BRKA 3AGNA 1LNHA 1GS3A 5FW5A 2XEPA 4XBYA 3SX1A 2CFGA 3OV4A 1UW1A 2FXTA 3IPTA 2QA43 3FF0A 1JBTA 3S27A 3WR2A 2CIUA 3HIIA 3NUVA 1A2KA 1LNIA 1YIJ3 2AADA 2C10A 1RGCA 4HJLB 3FZWA 3Q2PA 1MGRA 2CFDA 3ZFZA 1YJW3 2ZA4A 1I2GA 3S28A 3NQZA 1I3FA 3G4S3 1YIT3 1PU4A 1TRQA 3FCSB 2ML6A 1RNBA 1VQ83 2XGLA 2XSOB 1UGHI 1UI8A 3UJMA 1U8CB 2XH9A 5STDA 2BNGA 1RNTA 1RGLA 3DZLA 4HM8B 3CPW2 2IYJA 1UDII 3B8LA 4RNTA 1ZX2A 2BU4A 1C7HA 3MG1A 1GMPA 1RMSA 3GZRA 1LRAA 3K9MC 4RBNA 5IW9A 1RCLA 1AY7A 1A67A 1DETA 4JRFA 2UX0A 4JF8A 5IF6A 1VQP3 1MNLA 1HZ1A 2CG0A 1BVIA 3LT9A 4LZIA 2XGNA 2W6JH 1GSPA 2AAEA 2OTJ3 2YFJB 2FNQA 1TP6A 3WMDA 4O2HA 1KD14 3FG3A 1BSAA 1B20A 1O7MB 5LC7A 3FGYA 1Q9EA 4KFFA 1DVCA 1RN7A 3B7CA 3F8XA 4N6MA 1DVDA 5IG5A 1MGWA 2BIRA 1B3SA 4QWTA 3LH4A 4LGQA 2CWTA 4X2OA 2HMOB 5M1AA 1JN5A 3V92A 1W2B2 4R4KA 3LT8A 2OQEA 1RGKA 2H0IA 4FMCA 3NV0B 2P0MA 1U5OA 2W56B 1BRIA 2UUGC 5GSPA 1M1K4 1WQLB 2F5WA 1C54A 1S723 3F40A 1SQWA 3NBRA 1ISKA 4AKZA 3F8HA 1OF5B 1QAFA 1RGHA 4LYLB 5JPPA 1RHLA 2Z77A 5HOHA 3O8YA 5DRVA 4J5GA 3GZBA 3LTCA 1MWUA 3HIGA 5TGNA 1RDSA 1LXEA 4R1KA 4XDWA 3X40A 4HM4B 1A2VA 1ZGXA 1X1XA 4L8PA 1NU3A 2F99A 1VQ73 2F5MA 3SYUA 4Q53A 3EBTA 3GZYB 3BB9A 2KXGA 4WWUC 1QALA 5IEOA 1VQM3 5AIHA 2YX9A 2XSHB 5AYSC 4DKIA 4GB5A 3UB1A 1CEWI 3CU3A 3OWYA 1D6UA 2P38A 3EX9A 6STDA 3OXAA 2Z7AA 4XBXA 3FKAA 4TX4A 1AR0A 1B2ZA 1EG9B 3NXJA 1W4NA 2LQVA 4ORLA 2OOVA 3URPA 1IT8A 1BUJA 4H3UA 1EKMA 1GD4A 1RRHA 1NO3A 3SOAA 1CQSA 1BNRA 4KFDA 3LTDA 2IA7A 1BIRA 1JKGA 3PYJA 2H0GA 5EQLA 1O7PB 5ELJA 2RNTA 2W2CA 3HZPA 4MEIA 1NDOB 1LQGC 1IT7A 1EEJA 1NNVA 1X1UA 4EV2A 2CFKA 2F4YA 2HMJB 2K3DA 1Q7HA 4O8SA 3CCS3 4BIRA 3D79A 3OWSA 1RLSA 3JUNA 4N6LA 4HM5B 3N54B 5IG3A 1VQ93 4R9KA 1T5YA 2CG1A 1AVKA 5BIRA 3MHEA 1O7HB 3GAXA 1IV7A 3D5GA 4N3VA 2CHCA 3BLZA 4HYZA 3FF2A 1BSDA 2W0QA 3DGLA 3M8CA 2M7OA 5G1KA 3WODG 3CC43 1IVWA 2CW9A 3JUQA 3KIIA 3CCE3 3SEDA 1I2EA 3SLUA 1JNQA 1V58A 1M904 2RCDA 1W2ZA 3B4PA 4BTYA 3G0KA 4CPKA 3HK4A 2KF4A 3NM2A 5BU4A 3F7SA 5CLKA 1I3IA 2QIYA 3WA2X 3F7XA 5IENA 5IERA 3CCM3 1RGEA 3OX9A 5AI1A 3F14A 5I97A 2QEX3 4EC6A 2CK3H 1Q864 1EA2A 3L0RA 3NBJA 5IG0A 3DGYA 2CWUA 3DUKA 3JUPA 3RNTA 3ER7A 1UUWB 2HMNB 1GD3A 1RGAA 2CWVA 3AGOA 3AHWA 2C4BA 4RNZA 5IEPA 4WYKA 2KAAA 3EF8A 1FGRA 2PZVA 1G0TA 2WGOA 3J7Yd 3G16A 3FSDA 4HM2B 4EBGA 3AMOB 2LYXA 1ULIB 3ZG0A 5BVBA 1FW7A 1JKGB 3ROBA 1A90A 1B27A 1K734 4FMAA 1OGXA 3CCR3 1IV9A 3FH1A 4HM1B 1JZDA 2HMLB 1MOLA 1IQYA 4MJDA 5CF1A 4GHOA 4L7KA 2W56A 1IYYA 4EV5A 2STDA 4MMYB 3CNMA 1JN5B 4EW5A 1FGTA 1FUSA 1I0XA 4HAAA 1BSBA 2K54A 1YJ93 1CYUA 1BRHA 1HU9A 2GXFA 3U97A 5BXQA 1VQK3 2XR8B 3KSED 3U1WA 3NM7A 2JDIH 3LXUX 1SIHA 1VZZA 3E99A 1NB5I 3GSPA 4J8TA 4XM4A 3HX8A 3X3ZA 3CCU3 2D42A 3ECFA 3EE1A 2KF6A 1CYVA 3MYTA 1CH0A 2R41A 1RCKA 3CME3 1X1YA 4N6TA 2OTL3 3MSOA 3QK9A 1OCVA 5AEWB 1G96A 2C11A 3BU4A 1RTUA 4KFEA 1VQN3 3UL5A 2Q07A 1LOXA 1W7CA 1PY3A 4BU4A 3KCHA 1RN4A 1DMQA 3CNXA 1BRSA 2IY2A 2OWPA 1K8A4 2HOHA 1GY5A 1BGSA 1RRLA 1Q814 8CHOA 3WA3A 2ZDJA 1AQZA 4O02B 2CFLA 5D83A 2L1SA 1G02A 2O9UX 3EBYA 1K28A 2BMOB 3EJVA 6RNTA 1YVBI 3KSPA 5JPUA 1N8QA 4AEQA 2E2TA 1FGQA 1KSIA 3X41A 3CMA3 3DMCA 4N6V0 2OOVC 1NB3I 2L4VA 3DGOA 3DY5A 4OUQA 1IQXA 2GEXA 1UCLA 1TFOA 1B2XA 3LZAA 3S5CA 3PCRA 3JUMA 1US1A 2P09A 4HOHA 4WP5A 2F56A 2GEYA 3IJEB 3SVAA 1GOVA 2KF5A 2XFTA 2OCTA 3STDA 3DXOA 1LOWA 4ILFA 1A2PA 4BTWA 4FCJA 5CF2A 1FGOA 2IUKA 2QGUA 3EHCA 3N9HA 1KQS2 1B2UA 3KKGA 2W03A 1OPYA 3K7CA 1IVXA 4EXRA 3I0YA 2GU3A 4BL2A 1SJWA 5KP4A 5EEOA 3ALAA 3D5IA 1BSCA 5AIGA 1MWTA 1TRPA 4I5QA 1TFKA 1TJDA 1QJGA 4J9AA 3NQYA 1AV4A 3NHXA 1E97A 4BL3A 3CCQ3 1Q40B 1RN1A 1Z1SA 1I70A 2H0HA 1FGMA 1LOYA 4FMBA 1VQ63 3G6E3 1JZOA 4KT3B 1OHPA 3EB8A 3RDEA 3X3YA 2WOHA 5LC6A 1WMPA 1ZS7A 4XDVA 1BNFA 2KF3A 3LYGA 7GSPA 2YFLB 3X3XA 1X1WA 1TIJA 3B4OA 3AMOA 3BNDA 3DM8A 1BUQA 1JV2B 3PZWA 1TTOA 4K61A 3H3HA 4HZ9B 1W01A 2O3OA 3I553 1FYSA 3VF1A 3EN8A 3N8BA 2KRTA 3WDGB 3GWRA 2HMKB 1VQQA 4FMDA 1JB5A 1BANA 4MMZB 4N6OB 4STDA 3PGBA 3CC73 1QVF2 1RGGA 1OF5A 2UGIA 1IDPA 1VQ43 3CCL3 3UL6A 3PS8A 2CFWA 3BIRA 4X2HA 3FG1A 1GY7A 2MF7A 5FGOA 1JJ22 1BOXA 1O7WB 1ULJB 1YJN3 3G8ZA 1M9GA 3D3LA 3D9RA 1BNSA 5KP1A 9RNTA 2I9WA 1KC84 3BNEA 1AVLA 2BMRB 1F8NA 1Y4KA 1IK3A 3V98A 5CK6A 3G713 1N5PA
chains in the Genus database with same CATH topology
1FUSA 1RSNA 1I0XA 2F5WA 4HAAA 1BSBA 1I2FA 1B2SA 1GOUA 1BRHA 3D4AA 1BRGA 1UCKA 1YVSA 1BNIA 1RGHA 1RHLA 3GSPA 5HOHA 1GOYA 3HOHA 1BU4A 4J5GA 1RGFA 2KF6A 1YNVX 1CH0A 1RDSA 1RCKA 1ZGXA 1X1XA 1X1YA 4GSPA 2F5MA 3SYUA 3BU4A 1DE3A 1RTUA 1PY3A 1T2IA 4BU4A 3KCHA 1RN4A 6GSPA 1BRSA 1BRNL 1PYLA 1BSEA 2HOHA 1BGSA 4J5KA 1B2ZA 3URPA 1BUJA 1AQZA 1T2HA 2GSPA 3Q3FA 1FUTA 1BNEA 1I8VA 1G02A 8RNTA 1BNRA 1GMRA 6RNTA 1BIRA 7RNTA 1JBRA 1SARA 3WHOA 2RNTA 3AGNA 1BRKA 1UCLA 1B2XA 1X1UA 2F4YA 1I0VA 4HOHA 1LOVA 2F56A 1BAOA 4BIRA 1GOVA 2KF5A 1JBTA 1RLSA 3WR2A 1LOWA 1LNIA 1A2PA 2AADA 5BIRA 1JBSA 1RGCA 3D5GA 3A5EA 2RBIA 1B2UA 1MGRA 1B2MA 1BSDA 2ZA4A 1I2GA 1R4YA 3D5IA 1BSCA 1I3FA 1I2EA 1TRQA 1TRPA 1BNJA 1RNBA 1RNTA 1RN1A 1I70A 1RGLA 1LOYA 2KF4A 5BU4A 1I3IA 4RNTA 1UCJA 1BRJA 2BU4A 1RMSA 1B21A 1GMPA 1LRAA 1BNFA 1RGEA 2KF3A 7GSPA 5RNTA 1X1WA 1UCIA 1RCLA 1AY7A 1DETA 1TTOA 3DGYA 3RNTA 1HZ1A 1FYSA 1RGAA 1YGWA 3AGOA 1BVIA 2C4BA 3AHWA 2SARA 3AHSA 1HYFA 2KAAA 1BANA 1GSPA 2AAEA 1RGGA 1FW7A 1BSAA 1B20A 1Q9EA 3BIRA 1B27A 1BOXA 1BNGA 1MGWA 2BIRA 1B3SA 1BNSA 9RNTA 3DH2A 4GHOA 1GMQA 1IYYA 1RGKA 1FZUA 5GSPA 1BRIA 1C54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUS A;  1RSN A;  1I0X A;  2F5W A;  4HAA A;  1BSB A;  1I2F A;  1B2S A;  1GOU A;  1BRH A;  3D4A A;  1BRG A;  1UCK A;  1YVS A;  1BNI A;  1RGH A;  1RHL A;  3GSP A;  5HOH A;  1GOY A;  3HOH A;  1BU4 A;  4J5G A;  1RGF A;  2KF6 A;  1YNV X;  1CH0 A;  1RDS A;  1RCK A;  1ZGX A;  1X1X A;  1X1Y A;  4GSP A;  2F5M A;  3SYU A;  3BU4 A;  1DE3 A;  1RTU A;  1PY3 A;  1T2I A;  4BU4 A;  3KCH A;  1RN4 A;  6GSP A;  1BRS A;  1BRN L;  1PYL A;  1BSE A;  2HOH A;  1BGS A;  4J5K A;  1B2Z A;  3URP A;  1BUJ A;  1AQZ A;  1T2H A;  2GSP A;  3Q3F A;  1FUT A;  1BNE A;  1I8V A;  1G02 A;  8RNT A;  1BNR A;  1GMR A;  6RNT A;  1BIR A;  7RNT A;  1JBR A;  1SAR A;  3WHO A;  2RNT A;  3AGN A;  1BRK A;  1UCL A;  1B2X A;  1X1U A;  2F4Y A;  1I0V A;  4HOH A;  1LOV A;  2F56 A;  1BAO A;  4BIR A;  1GOV A;  2KF5 A;  1JBT A;  1RLS A;  3WR2 A;  1LOW A;  1LNI A;  1A2P A;  2AAD A;  5BIR A;  1JBS A;  1RGC A;  3D5G A;  3A5E A;  2RBI A;  1B2U A;  1MGR A;  1B2M A;  1BSD A;  2ZA4 A;  1I2G A;  1R4Y A;  3D5I A;  1BSC A;  1I3F A;  1I2E A;  1TRQ A;  1TRP A;  1BNJ A;  1RNB A;  1RNT A;  1RN1 A;  1I70 A;  1RGL A;  1LOY A;  2KF4 A;  5BU4 A;  1I3I A;  4RNT A;  1UCJ A;  1BRJ A;  2BU4 A;  1RMS A;  1B21 A;  1GMP A;  1LRA A;  1BNF A;  1RGE A;  2KF3 A;  7GSP A;  5RNT A;  1X1W A;  1UCI A;  1RCL A;  1AY7 A;  1DET A;  1TTO A;  3DGY A;  3RNT A;  1HZ1 A;  1FYS A;  1RGA A;  1YGW A;  3AGO A;  1BVI A;  2C4B A;  3AHW A;  2SAR A;  3AHS A;  1HYF A;  2KAA A;  1BAN A;  1GSP A;  2AAE A;  1RGG A;  1FW7 A;  1BSA A;  1B20 A;  1Q9E A;  3BIR A;  1B27 A;  1BOX A;  1BNG A;  1MGW A;  2BIR A;  1B3S A;  1BNS A;  9RNT A;  3DH2 A;  4GHO A;  1GMQ A;  1IYY A;  1RGK A;  1FZU A;  5GSP A;  1BRI A;  1C54 A; 
#chains in the Genus database with same CATH topology
 1RSN A;  2BO9 B;  2SBL A;  2R4I A;  1JRQ A;  1I2F A;  1B2S A;  1GOU A;  1W6Y A;  4OK0 A;  1UCK A;  2E2V A;  4U13 A;  1QMA A;  2WO0 A;  1BNI A;  3T0U A;  1Q40 A;  1WMO A;  2P05 A;  3LOY A;  2GBX B;  4HM3 B;  2XF3 A;  1YI2 3;  4G1M B;  1YNV X;  4IT7 A;  4K90 B;  3WOE B;  3MPH A;  1K9M 4;  4R80 A;  2YFI B;  1JB2 A;  3T8N A;  1VQ5 3;  1UUV B;  1GYB A;  3K63 A;  1DE3 A;  2OQE C;  4HM7 B;  5A0O B;  5DRE A;  3KFQ C;  6GSP A;  1M1X B;  3NV0 A;  4HZB B;  1BRN L;  1PYL A;  5AIF A;  4HM0 B;  4J5K A;  1GY6 A;  3LML A;  1EUI C;  3LTB A;  1MWS A;  1N9E A;  2IMJ A;  2FGT A;  5JBS A;  1UI7 A;  3HI7 A;  2ZHX B;  1T2H A;  3NBB A;  3Q3F A;  1RJO A;  3X42 A;  1IVU A;  3EN1 B;  1I8V A;  3SOY A;  8RNT A;  2Z76 A;  3RGR A;  5M18 A;  4WFO A;  2RSX A;  2ZL8 A;  5IG4 A;  1SAR A;  3H51 A;  4MMX B;  1SPU A;  1UGI A;  2F86 B;  3WHO A;  1NWW A;  4GL6 A;  3F9S A;  3PXM A;  1JB4 A;  3CC2 3;  3S67 A;  1IU7 A;  1OH0 A;  2BT3 A;  5D81 A;  1I0V A;  2A15 A;  1LOV A;  1BAO A;  4H61 A;  3IMA B;  3OWU A;  1DMM A;  2D1W A;  2MC8 A;  5AEU B;  1ASK A;  3EQQ B;  1S5A A;  3GRD A;  3KN4 A;  1JBS A;  4N6U A;  3A5E A;  2RBI A;  1Q7Y 4;  4CCV A;  3CCV 3;  1MWR A;  1B2M A;  1N8R 4;  3A76 A;  3NX0 A;  1R4Y A;  2GBW B;  3GZX B;  3T8U A;  2CKF B;  2F98 A;  2W9Q A;  3VGN A;  2JQ5 A;  3K0Z A;  3PCS A;  4AKY A;  1EQK A;  1FUW A;  1YHQ 3;  3Q90 A;  1BNJ A;  1WMN A;  2B24 B;  3CCJ 3;  1DYU A;  4HKV B;  4NRE A;  1K41 A;  3LTA A;  1SII A;  1W5Z A;  3WOF B;  1QAK A;  1VQO 3;  1E3R A;  1BRJ A;  1UCJ A;  3Q1C A;  4HBR A;  1B21 A;  2CH9 A;  2KCD A;  3DGM A;  4FCZ A;  4FR9 A;  1IVV A;  5AYR B;  1L5G B;  1PFP A;  5RNT A;  2CX1 A;  1UCI A;  1LQM B;  4I4K A;  2XRX B;  1VQL 3;  5M19 A;  1V57 A;  3DGN A;  1UUG B;  4EYC A;  3FG4 A;  1J2B A;  1LVN A;  4R9L A;  1YGW A;  2W04 A;  4CDL A;  1ROV A;  2SAR A;  3AHS A;  4ZM8 A;  1O7G B;  2CX0 A;  1HYF A;  2INX A;  3MKI A;  4RZM A;  7STD A;  1W00 A;  3OW2 2;  1DMN A;  1TU5 A;  1W6C A;  3I56 3;  2Y74 A;  3JVC A;  2P0X A;  3CXC 2;  4HVN A;  4IIA A;  3VSY A;  3KE7 A;  3BNC A;  1BNG A;  1STF I;  1D6Z A;  1ZO2 A;  2Z6B A;  1OAC A;  2RGQ A;  3DH2 A;  3EC9 A;  4K1V A;  1GMQ A;  1WTH A;  1T3B A;  3MG2 A;  2RFR A;  1D6Y A;  2W9P A;  4L8O A;  1Q82 4;  3CD6 3;  3ZG5 A;  1FZU A;  4RNY A;  4OVM A;  5G2G A;  1N5H A;  2WGQ A;  3UNL A;  1O7N B;  3D4A A;  2XFS A;  1BRG A;  1YVS A;  1N9J A;  3V99 A;  4XB5 A;  4LMI A;  2ML5 A;  3MWZ A;  4LSO A;  1OUN A;  2BMQ B;  1WNH A;  1GOY A;  1W6G A;  1YGE A;  3HOH A;  1BU4 A;  3KZT A;  3BNB A;  4K1U A;  1RGF A;  4XBT A;  2E2U A;  5HGR A;  4CJN A;  2V1L A;  4NPB A;  5G1L A;  3S29 A;  4WHA A;  5KP3 A;  4GSP A;  1OHS A;  1TUH A;  4N6N B;  1OHO A;  5AII A;  3TDG A;  2B1X B;  1V74 A;  2BHM A;  2CC3 A;  1T2I A;  2GU1 A;  1OGZ A;  4WYK B;  2IUJ A;  2J8X B;  4PEJ A;  1BSE A;  1RKY A;  5D82 A;  4O3V A;  1NJI 4;  1Q42 A;  3K5T A;  1QVG 2;  5CXO A;  1R4C A;  2GSP A;  3FLJ A;  4IPB A;  3MG3 A;  3QRD A;  4NHF A;  1FUT A;  1FA3 A;  1BNE A;  1W02 A;  2K0M A;  3SXX A;  4BTX A;  4HM6 B;  3JUO A;  1GMR A;  1ROA A;  3CPO A;  1E3V A;  2Y73 A;  4FCM A;  4KVH A;  1KWI A;  5EVH A;  2PNC A;  5ELU A;  7RNT A;  1JBR A;  2WOF A;  1STD A;  1IQ8 A;  4LEH A;  3RGA A;  4KZ1 A;  1HKX A;  2HMM B;  1BRK A;  3AGN A;  1LNH A;  1GS3 A;  5FW5 A;  2XEP A;  4XBY A;  3SX1 A;  2CFG A;  3OV4 A;  1UW1 A;  2FXT A;  3IPT A;  2QA4 3;  3FF0 A;  1JBT A;  3S27 A;  3WR2 A;  2CIU A;  3HII A;  3NUV A;  1A2K A;  1LNI A;  1YIJ 3;  2AAD A;  2C10 A;  1RGC A;  4HJL B;  3FZW A;  3Q2P A;  1MGR A;  2CFD A;  3ZFZ A;  1YJW 3;  2ZA4 A;  1I2G A;  3S28 A;  3NQZ A;  1I3F A;  3G4S 3;  1YIT 3;  1PU4 A;  1TRQ A;  3FCS B;  2ML6 A;  1RNB A;  1VQ8 3;  2XGL A;  2XSO B;  1UGH I;  1UI8 A;  3UJM A;  1U8C B;  2XH9 A;  5STD A;  2BNG A;  1RNT A;  1RGL A;  3DZL A;  4HM8 B;  3CPW 2;  2IYJ A;  1UDI I;  3B8L A;  4RNT A;  1ZX2 A;  2BU4 A;  1C7H A;  3MG1 A;  1GMP A;  1RMS A;  3GZR A;  1LRA A;  3K9M C;  4RBN A;  5IW9 A;  1RCL A;  1AY7 A;  1A67 A;  1DET A;  4JRF A;  2UX0 A;  4JF8 A;  5IF6 A;  1VQP 3;  1MNL A;  1HZ1 A;  2CG0 A;  1BVI A;  3LT9 A;  4LZI A;  2XGN A;  2W6J H;  1GSP A;  2AAE A;  2OTJ 3;  2YFJ B;  2FNQ A;  1TP6 A;  3WMD A;  4O2H A;  1KD1 4;  3FG3 A;  1BSA A;  1B20 A;  1O7M B;  5LC7 A;  3FGY A;  1Q9E A;  4KFF A;  1DVC A;  1RN7 A;  3B7C A;  3F8X A;  4N6M A;  1DVD A;  5IG5 A;  1MGW A;  2BIR A;  1B3S A;  4QWT A;  3LH4 A;  4LGQ A;  2CWT A;  4X2O A;  2HMO B;  5M1A A;  1JN5 A;  3V92 A;  1W2B 2;  4R4K A;  3LT8 A;  2OQE A;  1RGK A;  2H0I A;  4FMC A;  3NV0 B;  2P0M A;  1U5O A;  2W56 B;  1BRI A;  2UUG C;  5GSP A;  1M1K 4;  1WQL B;  2F5W A;  1C54 A;  1S72 3;  3F40 A;  1SQW A;  3NBR A;  1ISK A;  4AKZ A;  3F8H A;  1OF5 B;  1QAF A;  1RGH A;  4LYL B;  5JPP A;  1RHL A;  2Z77 A;  5HOH A;  3O8Y A;  5DRV A;  4J5G A;  3GZB A;  3LTC A;  1MWU A;  3HIG A;  5TGN A;  1RDS A;  1LXE A;  4R1K A;  4XDW A;  3X40 A;  4HM4 B;  1A2V A;  1ZGX A;  1X1X A;  4L8P A;  1NU3 A;  2F99 A;  1VQ7 3;  2F5M A;  3SYU A;  4Q53 A;  3EBT A;  3GZY B;  3BB9 A;  2KXG A;  4WWU C;  1QAL A;  5IEO A;  1VQM 3;  5AIH A;  2YX9 A;  2XSH B;  5AYS C;  4DKI A;  4GB5 A;  3UB1 A;  1CEW I;  3CU3 A;  3OWY A;  1D6U A;  2P38 A;  3EX9 A;  6STD A;  3OXA A;  2Z7A A;  4XBX A;  3FKA A;  4TX4 A;  1AR0 A;  1B2Z A;  1EG9 B;  3NXJ A;  1W4N A;  2LQV A;  4ORL A;  2OOV A;  3URP A;  1IT8 A;  1BUJ A;  4H3U A;  1EKM A;  1GD4 A;  1RRH A;  1NO3 A;  3SOA A;  1CQS A;  1BNR A;  4KFD A;  3LTD A;  2IA7 A;  1BIR A;  1JKG A;  3PYJ A;  2H0G A;  5EQL A;  1O7P B;  5ELJ A;  2RNT A;  2W2C A;  3HZP A;  4MEI A;  1NDO B;  1LQG C;  1IT7 A;  1EEJ A;  1NNV A;  1X1U A;  4EV2 A;  2CFK A;  2F4Y A;  2HMJ B;  2K3D A;  1Q7H A;  4O8S A;  3CCS 3;  4BIR A;  3D79 A;  3OWS A;  1RLS A;  3JUN A;  4N6L A;  4HM5 B;  3N54 B;  5IG3 A;  1VQ9 3;  4R9K A;  1T5Y A;  2CG1 A;  1AVK A;  5BIR A;  3MHE A;  1O7H B;  3GAX A;  1IV7 A;  3D5G A;  4N3V A;  2CHC A;  3BLZ A;  4HYZ A;  3FF2 A;  1BSD A;  2W0Q A;  3DGL A;  3M8C A;  2M7O A;  5G1K A;  3WOD G;  3CC4 3;  1IVW A;  2CW9 A;  3JUQ A;  3KII A;  3CCE 3;  3SED A;  1I2E A;  3SLU A;  1JNQ A;  1V58 A;  1M90 4;  2RCD A;  1W2Z A;  3B4P A;  4BTY A;  3G0K A;  4CPK A;  3HK4 A;  2KF4 A;  3NM2 A;  5BU4 A;  3F7S A;  5CLK A;  1I3I A;  2QIY A;  3WA2 X;  3F7X A;  5IEN A;  5IER A;  3CCM 3;  1RGE A;  3OX9 A;  5AI1 A;  3F14 A;  5I97 A;  2QEX 3;  4EC6 A;  2CK3 H;  1Q86 4;  1EA2 A;  3L0R A;  3NBJ A;  5IG0 A;  3DGY A;  2CWU A;  3DUK A;  3JUP A;  3RNT A;  3ER7 A;  1UUW B;  2HMN B;  1GD3 A;  1RGA A;  2CWV A;  3AGO A;  3AHW A;  2C4B A;  4RNZ A;  5IEP A;  4WYK A;  2KAA A;  3EF8 A;  1FGR A;  2PZV A;  1G0T A;  2WGO A;  3J7Y d;  3G16 A;  3FSD A;  4HM2 B;  4EBG A;  3AMO B;  2LYX A;  1ULI B;  3ZG0 A;  5BVB A;  1FW7 A;  1JKG B;  3ROB A;  1A90 A;  1B27 A;  1K73 4;  4FMA A;  1OGX A;  3CCR 3;  1IV9 A;  3FH1 A;  4HM1 B;  1JZD A;  2HML B;  1MOL A;  1IQY A;  4MJD A;  5CF1 A;  4GHO A;  4L7K A;  2W56 A;  1IYY A;  4EV5 A;  2STD A;  4MMY B;  3CNM A;  1JN5 B;  4EW5 A;  1FGT A;  1FUS A;  1I0X A;  4HAA A;  1BSB A;  2K54 A;  1YJ9 3;  1CYU A;  1BRH A;  1HU9 A;  2GXF A;  3U97 A;  5BXQ A;  1VQK 3;  2XR8 B;  3KSE D;  3U1W A;  3NM7 A;  2JDI H;  3LXU X;  1SIH A;  1VZZ A;  3E99 A;  1NB5 I;  3GSP A;  4J8T A;  4XM4 A;  3HX8 A;  3X3Z A;  3CCU 3;  2D42 A;  3ECF A;  3EE1 A;  2KF6 A;  1CYV A;  3MYT A;  1CH0 A;  2R41 A;  1RCK A;  3CME 3;  1X1Y A;  4N6T A;  2OTL 3;  3MSO A;  3QK9 A;  1OCV A;  5AEW B;  1G96 A;  2C11 A;  3BU4 A;  1RTU A;  4KFE A;  1VQN 3;  3UL5 A;  2Q07 A;  1LOX A;  1W7C A;  1PY3 A;  4BU4 A;  3KCH A;  1RN4 A;  1DMQ A;  3CNX A;  1BRS A;  2IY2 A;  2OWP A;  1K8A 4;  2HOH A;  1GY5 A;  1BGS A;  1RRL A;  1Q81 4;  8CHO A;  3WA3 A;  2ZDJ A;  1AQZ A;  4O02 B;  2CFL A;  5D83 A;  2L1S A;  1G02 A;  2O9U X;  3EBY A;  1K28 A;  2BMO B;  3EJV A;  6RNT A;  1YVB I;  3KSP A;  5JPU A;  1N8Q A;  4AEQ A;  2E2T A;  1FGQ A;  1KSI A;  3X41 A;  3CMA 3;  3DMC A;  4N6V 0;  2OOV C;  1NB3 I;  2L4V A;  3DGO A;  3DY5 A;  4OUQ A;  1IQX A;  2GEX A;  1UCL A;  1TFO A;  1B2X A;  3LZA A;  3S5C A;  3PCR A;  3JUM A;  1US1 A;  2P09 A;  4HOH A;  4WP5 A;  2F56 A;  2GEY A;  3IJE B;  3SVA A;  1GOV A;  2KF5 A;  2XFT A;  2OCT A;  3STD A;  3DXO A;  1LOW A;  4ILF A;  1A2P A;  4BTW A;  4FCJ A;  5CF2 A;  1FGO A;  2IUK A;  2QGU A;  3EHC A;  3N9H A;  1KQS 2;  1B2U A;  3KKG A;  2W03 A;  1OPY A;  3K7C A;  1IVX A;  4EXR A;  3I0Y A;  2GU3 A;  4BL2 A;  1SJW A;  5KP4 A;  5EEO A;  3ALA A;  3D5I A;  1BSC A;  5AIG A;  1MWT A;  1TRP A;  4I5Q A;  1TFK A;  1TJD A;  1QJG A;  4J9A A;  3NQY A;  1AV4 A;  3NHX A;  1E97 A;  4BL3 A;  3CCQ 3;  1Q40 B;  1RN1 A;  1Z1S A;  1I70 A;  2H0H A;  1FGM A;  1LOY A;  4FMB A;  1VQ6 3;  3G6E 3;  1JZO A;  4KT3 B;  1OHP A;  3EB8 A;  3RDE A;  3X3Y A;  2WOH A;  5LC6 A;  1WMP A;  1ZS7 A;  4XDV A;  1BNF A;  2KF3 A;  3LYG A;  7GSP A;  2YFL B;  3X3X A;  1X1W A;  1TIJ A;  3B4O A;  3AMO A;  3BND A;  3DM8 A;  1BUQ A;  1JV2 B;  3PZW A;  1TTO A;  4K61 A;  3H3H A;  4HZ9 B;  1W01 A;  2O3O A;  3I55 3;  1FYS A;  3VF1 A;  3EN8 A;  3N8B A;  2KRT A;  3WDG B;  3GWR A;  2HMK B;  1VQQ A;  4FMD A;  1JB5 A;  1BAN A;  4MMZ B;  4N6O B;  4STD A;  3PGB A;  3CC7 3;  1QVF 2;  1RGG A;  1OF5 A;  2UGI A;  1IDP A;  1VQ4 3;  3CCL 3;  3UL6 A;  3PS8 A;  2CFW A;  3BIR A;  4X2H A;  3FG1 A;  1GY7 A;  2MF7 A;  5FGO A;  1JJ2 2;  1BOX A;  1O7W B;  1ULJ B;  1YJN 3;  3G8Z A;  1M9G A;  3D3L A;  3D9R A;  1BNS A;  5KP1 A;  9RNT A;  2I9W A;  1KC8 4;  3BNE A;  1AVL A;  2BMR B;  1F8N A;  1Y4K A;  1IK3 A;  3V98 A;  5CK6 A;  3G71 3;  1N5P A; 
#chains in the Genus database with same CATH homology
 1FUS A;  1RSN A;  1I0X A;  2F5W A;  4HAA A;  1BSB A;  1I2F A;  1B2S A;  1GOU A;  1BRH A;  3D4A A;  1BRG A;  1UCK A;  1YVS A;  1BNI A;  1RGH A;  1RHL A;  3GSP A;  5HOH A;  1GOY A;  3HOH A;  1BU4 A;  4J5G A;  1RGF A;  2KF6 A;  1YNV X;  1CH0 A;  1RDS A;  1RCK A;  1ZGX A;  1X1X A;  1X1Y A;  4GSP A;  2F5M A;  3SYU A;  3BU4 A;  1DE3 A;  1RTU A;  1PY3 A;  1T2I A;  4BU4 A;  3KCH A;  1RN4 A;  6GSP A;  1BRS A;  1BRN L;  1PYL A;  1BSE A;  2HOH A;  1BGS A;  4J5K A;  1B2Z A;  3URP A;  1BUJ A;  1AQZ A;  1T2H A;  2GSP A;  3Q3F A;  1FUT A;  1BNE A;  1I8V A;  1G02 A;  8RNT A;  1BNR A;  1GMR A;  6RNT A;  1BIR A;  7RNT A;  1JBR A;  1SAR A;  3WHO A;  2RNT A;  3AGN A;  1BRK A;  1UCL A;  1B2X A;  1X1U A;  2F4Y A;  1I0V A;  4HOH A;  1LOV A;  2F56 A;  1BAO A;  4BIR A;  1GOV A;  2KF5 A;  1JBT A;  1RLS A;  3WR2 A;  1LOW A;  1LNI A;  1A2P A;  2AAD A;  5BIR A;  1JBS A;  1RGC A;  3D5G A;  3A5E A;  2RBI A;  1B2U A;  1MGR A;  1B2M A;  1BSD A;  2ZA4 A;  1I2G A;  1R4Y A;  3D5I A;  1BSC A;  1I3F A;  1I2E A;  1TRQ A;  1TRP A;  1BNJ A;  1RNB A;  1RNT A;  1RN1 A;  1I70 A;  1RGL A;  1LOY A;  2KF4 A;  5BU4 A;  1I3I A;  4RNT A;  1UCJ A;  1BRJ A;  2BU4 A;  1RMS A;  1B21 A;  1GMP A;  1LRA A;  1BNF A;  1RGE A;  2KF3 A;  7GSP A;  5RNT A;  1X1W A;  1UCI A;  1RCL A;  1AY7 A;  1DET A;  1TTO A;  3DGY A;  3RNT A;  1HZ1 A;  1FYS A;  1RGA A;  1YGW A;  3AGO A;  1BVI A;  2C4B A;  3AHW A;  2SAR A;  3AHS A;  1HYF A;  2KAA A;  1BAN A;  1GSP A;  2AAE A;  1RGG A;  1FW7 A;  1BSA A;  1B20 A;  1Q9E A;  3BIR A;  1B27 A;  1BOX A;  1BNG A;  1MGW A;  2BIR A;  1B3S A;  1BNS A;  9RNT A;  3DH2 A;  4GHO A;  1GMQ A;  1IYY A;  1RGK A;  1FZU A;  5GSP A;  1BRI A;  1C54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...