1GMRA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase(guanyloribonuclease)
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmrA00
1RTUA 1T2HA 1AY7A 2BU4A 1RGLA 1LOWA 1RGEA 4HOHA 1R4YA 1BANA 3WR2A 3BU4A 8RNTA 1YNVX 1X1XA 2SARA 1B2MA 1LOYA 2KF5A 2KF3A 1T2IA 1RGAA 1TRPA 4GHOA 4J5GA 2AADA 1RSNA 1B2UA 1RGGA 4BU4A 1JBRA 3A5EA 5BU4A 1FYSA 3DGYA 5RNTA 1UCIA 3D5IA 1BOXA 1BRIA 4J5KA 1RLSA 1FUTA 1MGWA 1I8VA 1B2SA 1X1UA 1TTOA 1RGKA 3RNTA 1B2XA 2F5WA 2KF6A 3DH2A 1BVIA 1DETA 1B27A 1GMRA 1CH0A 5GSPA 1BRSA 1YVSA 1BRJA 7GSPA 1B20A 1AQZA 2GSPA 1RMSA 2BIRA 1UCKA 1FZUA 1RGHA 1BNFA 3HOHA 1GOYA 2F5MA 5HOHA 1RN4A 2KAAA 1UCJA 1BNRA 1LNIA 1I70A 3AGOA 2KF4A 1B2ZA 9RNTA 1RDSA 1B21A 1RNTA 1RGFA 5BIRA 1BSDA 1LOVA 1RCLA 1BSBA 1JBSA 1JBTA 1GSPA 4BIRA 1Q9EA 2RNTA 3D4AA 1BRNL 3GSPA 1RNBA 1GOUA 1BSCA 1BRHA 1DE3A 1BNSA 1LRAA 1BRGA 3AGNA 1C54A 1A2PA 1X1WA 2HOHA 4HAAA 6RNTA 1TRQA 1RHLA 1RGCA 1FUSA 1GOVA 1BAOA 1HZ1A 1PYLA 2F56A 4GSPA 4RNTA 1GMQA 3WHOA 1G02A 1BNJA 1BUJA 1BGSA 7RNTA 6GSPA 1BRKA 1B3SA 1MGRA 1RN1A 1PY3A 1GMPA 1IYYA 2C4BA 1BNGA 1I2GA 1BNIA 2F4YA 1SARA 3Q3FA 1I3FA 1I0XA 1UCLA 1X1YA 1YGWA 3KCHA 1FW7A 1I3IA 1I2FA 3AHWA 3D5GA 3URPA 1BIRA 1BNEA 2ZA4A 1BSAA 3BIRA 1BU4A 2RBIA 1I0VA 1HYFA 1I2EA 1ZGXA 2AAEA 3AHSA 1BSEA 3SYUA 1RCKA
chains in the Genus database with same CATH superfamily
1W2B2 1OGXA 2L4VA 2MC8A 1FGQA 2Z76A 1OACA 1T2HA 2BU4A 3EN1B 3S27A 3MHEA 1WTHA 5JPPA 1E3VA 1RGEA 4HOHA 3JUOA 2Y73A 1DYUA 3HI7A 8RNTA 1YNVX 2CFGA 4XBTA 3T8NA 1DVDA 4XB5A 4L8OA 2SARA 3DGNA 1BUQA 3LT8A 3D79A 3O8YA 1MWTA 2Z77A 1FUWA 2MF7A 1TRPA 5CXOA 5ELJA 2P0MA 1F8NA 3MG3A 3X40A 4BTYA 1FGMA 1RRHA 8CHOA 3G16A 1VQ53 1RJOA 2K54A 4K1UA 2W56B 3IPTA 1Q824 2INXA 3L0RA 5M18A 1NNVA 1B2UA 3K7CA 1Q7Y4 1UUVB 1UDII 3DGYA 5RNTA 1FGOA 3CNMA 2QIYA 1IV9A 4MEIA 3LTAA 5KP3A 2CWVA 3D5IA 5M1AA 1BOXA 4KFDA 1NB3I 1RLSA 5D83A 3WOFB 3I553 3JUPA 3CCR3 3FZWA 4RBNA 1MGWA 2CX0A 1IVXA 3Q90A 2K3DA 2WGOA 3CNXA 3V99A 1B2SA 1AVLA 1TTOA 1RGKA 4R9KA 2RCDA 3WOEB 2P09A 5JBSA 1YJW3 3UB1A 1TFOA 5GSPA 1BRSA 4IIAA 1YVSA 2RSXA 7GSPA 5CK6A 1RKYA 1W6YA 1AVKA 2Y74A 2BIRA 4FMAA 1QALA 1W00A 2D42A 1UI7A 3AMOA 3EX9A 2BHMA 3JUNA 1CYUA 1RGHA 3NM2A 4R9LA 3ZG0A 4L7KA 4N6MA 1L5GB 3D3LA 3KKGA 4JRFA 1Y4KA 2HMMB 3NBJA 4BL2A 1M904 3GAXA 3PZWA 1LNIA 1GY7A 1I70A 2IA7A 3G8ZA 2XGLA 1R4CA 2OQEA 2KF4A 2WOFA 3UL5A 3EBTA 1N9EA 3X3XA 2BMRB 1RGFA 3CC73 1BSDA 1RCLA 3FG3A 1PU4A 1Q7HA 3PCRA 1JBSA 1Q814 1GSPA 4CDLA 3CCL3 4FMCA 3VF1A 1JBTA 2F99A 3LTCA 3EJVA 1VQK3 1FGRA 1YJ93 3GZBA 1VQL3 1STDA 1BRNL 2XFTA 4KFEA 1DE3A 3CC43 3HZPA 3V92A 1ROVA 3F8XA 2GU3A 4K1VA 3STDA 3MSOA 1A2PA 4CPKA 3KIIA 1VQ93 3CPOA 4HM0B 2YFIB 2BMOB 1DMNA 4RNZA 1RGCA 1VQM3 1PYLA 1STFI 3SOAA 4FCMA 1JZDA 2UX0A 2XH9A 4AKYA 1ULIB 2C11A 4N6UA 3X3YA 3CCJ3 4EW5A 3AMOB 3CCM3 2OWPA 1W6CA 2W0QA 1IYYA 4LGQA 2IY2A 3MPHA 4GB5A 5EEOA 2CFDA 2CFKA 2P05A 1YI23 3UJMA 3OWSA 1UCLA 2XEPA 2E2TA 1JN5A 1OF5A 2ZHXB 2GEYA 1G0TA 1I2FA 3AHWA 1E97A 3G0KA 2BMQB 1M1XB 2O9UX 4HBRA 2CIUA 3S28A 1IV7A 3FKAA 3MWZA 4HM3B 3S5CA 1N8R4 1K9M4 4HM8B 1GY6A 5IERA 1BSEA 3ZG5A 4BIRA 3GZXB 4DKIA 1RCKA 3KSPA 1OHSA 3LH4A 3NUVA 1HKXA 2F86B 2WOHA 1AY7A 2D1WA 5IENA 3I563 3PXMA 3CPW2 1ISKA 4NPBA 1BANA 4HJLB 1SQWA 3RGRA 1K8A4 1X1XA 3KZTA 3CC23 4FCJA 2KF5A 3E99A 4JF8A 5D82A 3G4S3 1VQQA 4HZBB 1EQKA 5LC6A 3EHCA 2YFJB 1DVCA 2BO9B 2OOVC 2B24B 2FNQA 2K0MA 2E2VA 1EKMA 4ZM8A 1OF5B 2OCTA 1US1A 4RZMA 1UGHI 2WGQA 4NHFA 2IUJA 1IT7A 4HVNA 3K63A 3SVAA 3FSDA 3BNEA 3T0UA 5BU4A 1FYSA 4WFOA 1JZOA 3CU3A 3PGBA 5IG3A 5IG4A 5BVBA 1Q864 1A90A 2GU1A 4J9AA 3DZLA 3OV4A 1IVUA 2GBXB 3HK4A 4J5KA 5AYRB 3Q2PA 4EV5A 3NBBA 1DMQA 1IQYA 1Z1SA 1I8VA 5IEOA 1OGZA 1OUNA 1QAFA 2KF6A 1BVIA 2R41A 3ECFA 1EUIC 3FG4A 1GMRA 2CG1A 3LXUX 1EG9B 5FGOA 5AYSC 3LZAA 4G1MB 3X41A 1BRJA 3FH1A 1JKGA 1AQZA 4NREA 1RMSA 1V74A 3PCSA 5AI1A 3CCS3 1TUHA 4XM4A 2J8XB 3F40A 3CCU3 1VQP3 1RN7A 2CWUA 1NJI4 1AV4A 1UCJA 1FA3A 4CCVA 2W9QA 4KZ1A 4N6LA 4BL3A 3CD63 2JQ5A 1YJN3 2CKFB 1KC84 1RNTA 1UW1A 1GYBA 1T5YA 4LZIA 4K90B 1YVBI 2M7OA 1ROAA 2P38A 4L8PA 3LTDA 4MMXB 1Q9EA 1K734 5LC7A 2CG0A 2W03A 5EQLA 1LRAA 3G713 2C10A 5CLKA 3MG2A 1G96A 4XDWA 1EA2A 1RHLA 3NV0A 4Q53A 1FUSA 1GOVA 2W04A 4RNTA 2CFLA 3BLZA 1BNJA 1BGSA 1UUGB 1GD4A 1YGEA 1JKGB 3N9HA 4HM1B 5AEUB 5AEWB 5DREA 2ZL8A 3KFQC 6GSPA 1RN1A 4O8SA 5EVHA 2XRXB 1LNHA 1M9GA 3DUKA 2QGUA 3K0ZA 2C4BA 2IMJA 4XBYA 3GZRA 2CC3A 1I2GA 2XF3A 3Q3FA 3M8CA 1I0XA 1O7PB 1X1YA 1FGTA 1OCVA 1YGWA 2R4IA 2STDA 2W6JH 1TP6A 3B4OA 4LSOA 5DRVA 1SIHA 1LQGC 4N6NB 1WMNA 2ZA4A 1BSAA 3BIRA 1BU4A 1MWSA 1O7HB 1I0VA 2O3OA 3ROBA 1IQ8A 2OTL3 2AAEA 3RDEA 1JJ22 1NWWA 3DMCA 3EC9A 1E3RA 2FXTA 3N54B 4WYKA 3SX1A 1GS3A 3NV0B 3WODG 3I0YA 1LOWA 3K9MC 3F9SA 4KFFA 4N6OB 5IG0A 3GZYB 1R4YA 4HKVB 2ML6A 2KRTA 4FMDA 1IVVA 3BU4A 1EEJA 4BTWA 5M19A 2OOVA 2H0IA 1B2MA 2KF3A 4PEJA 4KT3B 1U8CB 3BB9A 3HIIA 4GHOA 1KD14 1WMPA 4RNYA 1A2VA 1NU3A 2QEX3 2AADA 4H3UA 1U5OA 2HMKB 1VQ73 1RSNA 2W9PA 3DGMA 3A5EA 3LMLA 3WDGB 3WMDA 3X3ZA 1WNHA 1IQXA 1ZO2A 1M1K4 1UGIA 2P0XA 3S29A 5IF6A 2RFRA 1BRIA 2Q07A 1D6ZA 3D9RA 3LTBA 4I4KA 5G2GA 2B1XB 1YIT3 1N8QA 3CME3 1V57A 4WYKB 2CHCA 3B8LA 3EN8A 3NHXA 3IJEB 4IT7A 4ORLA 3VSYA 2GEXA 1UUWB 1B2XA 1JV2B 1K41A 2F5WA 2RGQA 2XFSA 4HZ9B 3F14A 3OX9A 1B27A 1MOLA 1CH0A 4TX4A 1GD3A 3H51A 3G6E3 4I5QA 2WO0A 1LVNA 2GSPA 3ER7A 1SJWA 3F7XA 3CXC2 3PYJA 2ML5A 4IPBA 1GOYA 4AEQA 5HOHA 1RN4A 3H3HA 4N3VA 3V98A 1QMAA 5HGRA 5CF1A 3AGOA 1DMMA 3QK9A 3ALAA 5G1LA 1VZZA 5D81A 4FCZA 1VQO3 1HU9A 1V58A 1W01A 2H0HA 9RNTA 1RDSA 4R1KA 3KSED 1LOXA 3T8UA 3MYTA 5BIRA 3EBYA 3OW22 3GWRA 2UGIA 2A15A 4OVMA 1MWUA 2RNTA 3FF2A 1NDOB 5AIFA 1BSCA 1BRHA 3AGNA 1C7HA 2CX1A 4EBGA 1A67A 1NB5I 1MNLA 2E2UA 3UL6A 1LXEA 6RNTA 1TRQA 3PS8A 1HZ1A 1QVG2 3NBRA 2CWTA 4CJNA 2F56A 4GSPA 1VQ63 1GMQA 4X2HA 3SXXA 1G02A 3FLJA 1CYVA 1WQLB 1QVF2 1ZS7A 3ZFZA 5AIHA 1YIJ3 1BRKA 1MGRA 1S5AA 1KQS2 2HMLB 4N6V0 1GMPA 3UNLA 3JVCA 2LQVA 1O7WB 1BNGA 2OTJ3 1BNIA 5FW5A 2F4YA 1SARA 4EC6A 1I3FA 3CCV3 2GXFA 1CEWI 1D6YA 1T3BA 3KCHA 3FF0A 3D5GA 1BIRA 5ELUA 1A2KA 2RBIA 6STDA 3N8BA 1HYFA 1PFPA 3B4PA 2XGNA 3RGAA 2YX9A 3KE7A 1ZX2A 1IU7A 3NQYA 3SYUA 1W5ZA 3EB8A 3F8HA 4N6TA 1RTUA 3DGLA 4EXRA 1RGLA 1UI8A 3DXOA 1J2BA 3MKIA 3EQQB 1W02A 3WR2A 1S723 3JUMA 3OWUA 1IDPA 2SBLA 3VGNA 1N5HA 1KWIA 1OH0A 3FGYA 4O2HA 4HM5B 4STDA 4EYCA 1LOYA 2IYJA 1VQN3 1O7MB 4KVHA 1O7GB 1MWRA 1T2IA 3TDGA 5IEPA 3KN4A 1RGAA 4LEHA 1NO3A 7STDA 3IMAB 3U1WA 3SOYA 3LOYA 4J5GA 1CQSA 2ZDJA 4LMIA 2Z6BA 5STDA 1O7NB 4XDVA 2CK3H 4MJDA 4WHAA 5CF2A 1TU5A 4BU4A 1RGGA 3NX0A 1ULJB 4HYZA 1JRQA 3CMA3 1JBRA 1SPUA 1TIJA 3CCQ3 1Q40A 1UCIA 4WP5A 5KP4A 1LQMB 4OUQA 3K5TA 1FUTA 4MMZB 4OK0A 1AR0A 3F7SA 3J7Yd 2LYXA 5AIIA 3HIGA 3B7CA 3S67A 2V1LA 1X1UA 3RNTA 1JB4A 1D6UA 1TJDA 3DH2A 2PZVA 3OWYA 1DETA 4H61A 1W2ZA 3X42A 5KP1A 1JB5A 2CW9A 2HMJB 3BNCA 3EF8A 2IUKA 5AIGA 3SEDA 4U13A 4EV2A 2HMOB 1B20A 5G1KA 1IT8A 1UCKA 3NM7A 1FZUA 3HOHA 1BNFA 3GRDA 4BTXA 2F5MA 2UUGC 2QA43 4O3VA 2KAAA 4K61A 1BNRA 3BNDA 1VQ83 1N9JA 1W4NA 2L1SA 3DY5A 4HM7B 1B2ZA 1B21A 4AKZA 1K28A 1VQ43 1LOVA 2OQEC 5IW9A 1BSBA 1Q42A 1TFKA 3Q1CA 3NXJA 1Q40B 4HM2B 3D4AA 5A0OB 2JDIH 3GSPA 1W6GA 1GOUA 4FMBA 1RNBA 2I9WA 1BNSA 5JPUA 4WWUC 1BRGA 4J8TA 1C54A 1X1WA 3WA3A 2HOHA 3LT9A 4HAAA 3MG1A 4ILFA 4QWTA 1SIIA 3FCSB 4HM6B 1IK3A 5TGNA 1N5PA 1RRLA 3CCE3 1KSIA 1BAOA 1QAKA 2W2CA 3A76A 4X2OA 3WHOA 2Z7AA 1BUJA 4R80A 3FG1A 2XSHB 7RNTA 1JNQA 1B3SA 2XR8B 5BXQA 4MMYB 1PY3A 1IVWA 2GBWB 3BNBA 3DGOA 3OXAA 5I97A 5IG5A 2KXGA 3WA2X 1ASKA 4GL6A 4FR9A 3LYGA 3JUQA 1GY5A 1YHQ3 2KCDA 4XBXA 4LYLB 2W56A 2PNCA 1FW7A 1I3IA 3HX8A 2BNGA 2CFWA 3NQZA 1JB2A 3SLUA 3URPA 1BNEA 3EE1A 1WMOA 2XSOB 4O02B 4HM4B 1JN5B 3DM8A 1W7CA 4R4KA 1QJGA 3U97A 2F98A 2BT3A 2HMNB 3QRDA 1I2EA 1OHPA 1ZGXA 2YFLB 2H0GA 3AHSA 1OPYA 2CH9A 2FGTA 1OHOA
chains in the Genus database with same CATH topology
1RTUA 1T2HA 1AY7A 2BU4A 1RGLA 1LOWA 1RGEA 4HOHA 1R4YA 1BANA 3WR2A 3BU4A 8RNTA 1YNVX 1X1XA 2SARA 1B2MA 1LOYA 2KF5A 2KF3A 1T2IA 1RGAA 1TRPA 4GHOA 4J5GA 2AADA 1RSNA 1B2UA 1RGGA 4BU4A 1JBRA 3A5EA 5BU4A 1FYSA 3DGYA 5RNTA 1UCIA 3D5IA 1BOXA 1BRIA 4J5KA 1RLSA 1FUTA 1MGWA 1I8VA 1B2SA 1X1UA 1TTOA 1RGKA 3RNTA 1B2XA 2F5WA 2KF6A 3DH2A 1BVIA 1DETA 1B27A 1GMRA 1CH0A 5GSPA 1BRSA 1YVSA 1BRJA 7GSPA 1B20A 1AQZA 2GSPA 1RMSA 2BIRA 1UCKA 1FZUA 1RGHA 1BNFA 3HOHA 1GOYA 2F5MA 5HOHA 1RN4A 2KAAA 1UCJA 1BNRA 1LNIA 1I70A 3AGOA 2KF4A 1B2ZA 9RNTA 1RDSA 1B21A 1RNTA 1RGFA 5BIRA 1BSDA 1LOVA 1RCLA 1BSBA 1JBSA 1JBTA 1GSPA 4BIRA 1Q9EA 2RNTA 3D4AA 1BRNL 3GSPA 1RNBA 1GOUA 1BSCA 1BRHA 1DE3A 1BNSA 1LRAA 1BRGA 3AGNA 1C54A 1A2PA 1X1WA 2HOHA 4HAAA 6RNTA 1TRQA 1RHLA 1RGCA 1FUSA 1GOVA 1BAOA 1HZ1A 1PYLA 2F56A 4GSPA 4RNTA 1GMQA 3WHOA 1G02A 1BNJA 1BUJA 1BGSA 7RNTA 6GSPA 1BRKA 1B3SA 1MGRA 1RN1A 1PY3A 1GMPA 1IYYA 2C4BA 1BNGA 1I2GA 1BNIA 2F4YA 1SARA 3Q3FA 1I3FA 1I0XA 1UCLA 1X1YA 1YGWA 3KCHA 1FW7A 1I3IA 1I2FA 3AHWA 3D5GA 3URPA 1BIRA 1BNEA 2ZA4A 1BSAA 3BIRA 1BU4A 2RBIA 1I0VA 1HYFA 1I2EA 1ZGXA 2AAEA 3AHSA 1BSEA 3SYUA 1RCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTU A;  1T2H A;  1AY7 A;  2BU4 A;  1RGL A;  1LOW A;  1RGE A;  4HOH A;  1R4Y A;  1BAN A;  3WR2 A;  3BU4 A;  8RNT A;  1YNV X;  1X1X A;  2SAR A;  1B2M A;  1LOY A;  2KF5 A;  2KF3 A;  1T2I A;  1RGA A;  1TRP A;  4GHO A;  4J5G A;  2AAD A;  1RSN A;  1B2U A;  1RGG A;  4BU4 A;  1JBR A;  3A5E A;  5BU4 A;  1FYS A;  3DGY A;  5RNT A;  1UCI A;  3D5I A;  1BOX A;  1BRI A;  4J5K A;  1RLS A;  1FUT A;  1MGW A;  1I8V A;  1B2S A;  1X1U A;  1TTO A;  1RGK A;  3RNT A;  1B2X A;  2F5W A;  2KF6 A;  3DH2 A;  1BVI A;  1DET A;  1B27 A;  1GMR A;  1CH0 A;  5GSP A;  1BRS A;  1YVS A;  1BRJ A;  7GSP A;  1B20 A;  1AQZ A;  2GSP A;  1RMS A;  2BIR A;  1UCK A;  1FZU A;  1RGH A;  1BNF A;  3HOH A;  1GOY A;  2F5M A;  5HOH A;  1RN4 A;  2KAA A;  1UCJ A;  1BNR A;  1LNI A;  1I70 A;  3AGO A;  2KF4 A;  1B2Z A;  9RNT A;  1RDS A;  1B21 A;  1RNT A;  1RGF A;  5BIR A;  1BSD A;  1LOV A;  1RCL A;  1BSB A;  1JBS A;  1JBT A;  1GSP A;  4BIR A;  1Q9E A;  2RNT A;  3D4A A;  1BRN L;  3GSP A;  1RNB A;  1GOU A;  1BSC A;  1BRH A;  1DE3 A;  1BNS A;  1LRA A;  1BRG A;  3AGN A;  1C54 A;  1A2P A;  1X1W A;  2HOH A;  4HAA A;  6RNT A;  1TRQ A;  1RHL A;  1RGC A;  1FUS A;  1GOV A;  1BAO A;  1HZ1 A;  1PYL A;  2F56 A;  4GSP A;  4RNT A;  1GMQ A;  3WHO A;  1G02 A;  1BNJ A;  1BUJ A;  1BGS A;  7RNT A;  6GSP A;  1BRK A;  1B3S A;  1MGR A;  1RN1 A;  1PY3 A;  1GMP A;  1IYY A;  2C4B A;  1BNG A;  1I2G A;  1BNI A;  2F4Y A;  1SAR A;  3Q3F A;  1I3F A;  1I0X A;  1UCL A;  1X1Y A;  1YGW A;  3KCH A;  1FW7 A;  1I3I A;  1I2F A;  3AHW A;  3D5G A;  3URP A;  1BIR A;  1BNE A;  2ZA4 A;  1BSA A;  3BIR A;  1BU4 A;  2RBI A;  1I0V A;  1HYF A;  1I2E A;  1ZGX A;  2AAE A;  3AHS A;  1BSE A;  3SYU A;  1RCK A; 
#chains in the Genus database with same CATH topology
 1W2B 2;  1OGX A;  2L4V A;  2MC8 A;  1FGQ A;  2Z76 A;  1OAC A;  1T2H A;  2BU4 A;  3EN1 B;  3S27 A;  3MHE A;  1WTH A;  5JPP A;  1E3V A;  1RGE A;  4HOH A;  3JUO A;  2Y73 A;  1DYU A;  3HI7 A;  8RNT A;  1YNV X;  2CFG A;  4XBT A;  3T8N A;  1DVD A;  4XB5 A;  4L8O A;  2SAR A;  3DGN A;  1BUQ A;  3LT8 A;  3D79 A;  3O8Y A;  1MWT A;  2Z77 A;  1FUW A;  2MF7 A;  1TRP A;  5CXO A;  5ELJ A;  2P0M A;  1F8N A;  3MG3 A;  3X40 A;  4BTY A;  1FGM A;  1RRH A;  8CHO A;  3G16 A;  1VQ5 3;  1RJO A;  2K54 A;  4K1U A;  2W56 B;  3IPT A;  1Q82 4;  2INX A;  3L0R A;  5M18 A;  1NNV A;  1B2U A;  3K7C A;  1Q7Y 4;  1UUV B;  1UDI I;  3DGY A;  5RNT A;  1FGO A;  3CNM A;  2QIY A;  1IV9 A;  4MEI A;  3LTA A;  5KP3 A;  2CWV A;  3D5I A;  5M1A A;  1BOX A;  4KFD A;  1NB3 I;  1RLS A;  5D83 A;  3WOF B;  3I55 3;  3JUP A;  3CCR 3;  3FZW A;  4RBN A;  1MGW A;  2CX0 A;  1IVX A;  3Q90 A;  2K3D A;  2WGO A;  3CNX A;  3V99 A;  1B2S A;  1AVL A;  1TTO A;  1RGK A;  4R9K A;  2RCD A;  3WOE B;  2P09 A;  5JBS A;  1YJW 3;  3UB1 A;  1TFO A;  5GSP A;  1BRS A;  4IIA A;  1YVS A;  2RSX A;  7GSP A;  5CK6 A;  1RKY A;  1W6Y A;  1AVK A;  2Y74 A;  2BIR A;  4FMA A;  1QAL A;  1W00 A;  2D42 A;  1UI7 A;  3AMO A;  3EX9 A;  2BHM A;  3JUN A;  1CYU A;  1RGH A;  3NM2 A;  4R9L A;  3ZG0 A;  4L7K A;  4N6M A;  1L5G B;  3D3L A;  3KKG A;  4JRF A;  1Y4K A;  2HMM B;  3NBJ A;  4BL2 A;  1M90 4;  3GAX A;  3PZW A;  1LNI A;  1GY7 A;  1I70 A;  2IA7 A;  3G8Z A;  2XGL A;  1R4C A;  2OQE A;  2KF4 A;  2WOF A;  3UL5 A;  3EBT A;  1N9E A;  3X3X A;  2BMR B;  1RGF A;  3CC7 3;  1BSD A;  1RCL A;  3FG3 A;  1PU4 A;  1Q7H A;  3PCR A;  1JBS A;  1Q81 4;  1GSP A;  4CDL A;  3CCL 3;  4FMC A;  3VF1 A;  1JBT A;  2F99 A;  3LTC A;  3EJV A;  1VQK 3;  1FGR A;  1YJ9 3;  3GZB A;  1VQL 3;  1STD A;  1BRN L;  2XFT A;  4KFE A;  1DE3 A;  3CC4 3;  3HZP A;  3V92 A;  1ROV A;  3F8X A;  2GU3 A;  4K1V A;  3STD A;  3MSO A;  1A2P A;  4CPK A;  3KII A;  1VQ9 3;  3CPO A;  4HM0 B;  2YFI B;  2BMO B;  1DMN A;  4RNZ A;  1RGC A;  1VQM 3;  1PYL A;  1STF I;  3SOA A;  4FCM A;  1JZD A;  2UX0 A;  2XH9 A;  4AKY A;  1ULI B;  2C11 A;  4N6U A;  3X3Y A;  3CCJ 3;  4EW5 A;  3AMO B;  3CCM 3;  2OWP A;  1W6C A;  2W0Q A;  1IYY A;  4LGQ A;  2IY2 A;  3MPH A;  4GB5 A;  5EEO A;  2CFD A;  2CFK A;  2P05 A;  1YI2 3;  3UJM A;  3OWS A;  1UCL A;  2XEP A;  2E2T A;  1JN5 A;  1OF5 A;  2ZHX B;  2GEY A;  1G0T A;  1I2F A;  3AHW A;  1E97 A;  3G0K A;  2BMQ B;  1M1X B;  2O9U X;  4HBR A;  2CIU A;  3S28 A;  1IV7 A;  3FKA A;  3MWZ A;  4HM3 B;  3S5C A;  1N8R 4;  1K9M 4;  4HM8 B;  1GY6 A;  5IER A;  1BSE A;  3ZG5 A;  4BIR A;  3GZX B;  4DKI A;  1RCK A;  3KSP A;  1OHS A;  3LH4 A;  3NUV A;  1HKX A;  2F86 B;  2WOH A;  1AY7 A;  2D1W A;  5IEN A;  3I56 3;  3PXM A;  3CPW 2;  1ISK A;  4NPB A;  1BAN A;  4HJL B;  1SQW A;  3RGR A;  1K8A 4;  1X1X A;  3KZT A;  3CC2 3;  4FCJ A;  2KF5 A;  3E99 A;  4JF8 A;  5D82 A;  3G4S 3;  1VQQ A;  4HZB B;  1EQK A;  5LC6 A;  3EHC A;  2YFJ B;  1DVC A;  2BO9 B;  2OOV C;  2B24 B;  2FNQ A;  2K0M A;  2E2V A;  1EKM A;  4ZM8 A;  1OF5 B;  2OCT A;  1US1 A;  4RZM A;  1UGH I;  2WGQ A;  4NHF A;  2IUJ A;  1IT7 A;  4HVN A;  3K63 A;  3SVA A;  3FSD A;  3BNE A;  3T0U A;  5BU4 A;  1FYS A;  4WFO A;  1JZO A;  3CU3 A;  3PGB A;  5IG3 A;  5IG4 A;  5BVB A;  1Q86 4;  1A90 A;  2GU1 A;  4J9A A;  3DZL A;  3OV4 A;  1IVU A;  2GBX B;  3HK4 A;  4J5K A;  5AYR B;  3Q2P A;  4EV5 A;  3NBB A;  1DMQ A;  1IQY A;  1Z1S A;  1I8V A;  5IEO A;  1OGZ A;  1OUN A;  1QAF A;  2KF6 A;  1BVI A;  2R41 A;  3ECF A;  1EUI C;  3FG4 A;  1GMR A;  2CG1 A;  3LXU X;  1EG9 B;  5FGO A;  5AYS C;  3LZA A;  4G1M B;  3X41 A;  1BRJ A;  3FH1 A;  1JKG A;  1AQZ A;  4NRE A;  1RMS A;  1V74 A;  3PCS A;  5AI1 A;  3CCS 3;  1TUH A;  4XM4 A;  2J8X B;  3F40 A;  3CCU 3;  1VQP 3;  1RN7 A;  2CWU A;  1NJI 4;  1AV4 A;  1UCJ A;  1FA3 A;  4CCV A;  2W9Q A;  4KZ1 A;  4N6L A;  4BL3 A;  3CD6 3;  2JQ5 A;  1YJN 3;  2CKF B;  1KC8 4;  1RNT A;  1UW1 A;  1GYB A;  1T5Y A;  4LZI A;  4K90 B;  1YVB I;  2M7O A;  1ROA A;  2P38 A;  4L8P A;  3LTD A;  4MMX B;  1Q9E A;  1K73 4;  5LC7 A;  2CG0 A;  2W03 A;  5EQL A;  1LRA A;  3G71 3;  2C10 A;  5CLK A;  3MG2 A;  1G96 A;  4XDW A;  1EA2 A;  1RHL A;  3NV0 A;  4Q53 A;  1FUS A;  1GOV A;  2W04 A;  4RNT A;  2CFL A;  3BLZ A;  1BNJ A;  1BGS A;  1UUG B;  1GD4 A;  1YGE A;  1JKG B;  3N9H A;  4HM1 B;  5AEU B;  5AEW B;  5DRE A;  2ZL8 A;  3KFQ C;  6GSP A;  1RN1 A;  4O8S A;  5EVH A;  2XRX B;  1LNH A;  1M9G A;  3DUK A;  2QGU A;  3K0Z A;  2C4B A;  2IMJ A;  4XBY A;  3GZR A;  2CC3 A;  1I2G A;  2XF3 A;  3Q3F A;  3M8C A;  1I0X A;  1O7P B;  1X1Y A;  1FGT A;  1OCV A;  1YGW A;  2R4I A;  2STD A;  2W6J H;  1TP6 A;  3B4O A;  4LSO A;  5DRV A;  1SIH A;  1LQG C;  4N6N B;  1WMN A;  2ZA4 A;  1BSA A;  3BIR A;  1BU4 A;  1MWS A;  1O7H B;  1I0V A;  2O3O A;  3ROB A;  1IQ8 A;  2OTL 3;  2AAE A;  3RDE A;  1JJ2 2;  1NWW A;  3DMC A;  3EC9 A;  1E3R A;  2FXT A;  3N54 B;  4WYK A;  3SX1 A;  1GS3 A;  3NV0 B;  3WOD G;  3I0Y A;  1LOW A;  3K9M C;  3F9S A;  4KFF A;  4N6O B;  5IG0 A;  3GZY B;  1R4Y A;  4HKV B;  2ML6 A;  2KRT A;  4FMD A;  1IVV A;  3BU4 A;  1EEJ A;  4BTW A;  5M19 A;  2OOV A;  2H0I A;  1B2M A;  2KF3 A;  4PEJ A;  4KT3 B;  1U8C B;  3BB9 A;  3HII A;  4GHO A;  1KD1 4;  1WMP A;  4RNY A;  1A2V A;  1NU3 A;  2QEX 3;  2AAD A;  4H3U A;  1U5O A;  2HMK B;  1VQ7 3;  1RSN A;  2W9P A;  3DGM A;  3A5E A;  3LML A;  3WDG B;  3WMD A;  3X3Z A;  1WNH A;  1IQX A;  1ZO2 A;  1M1K 4;  1UGI A;  2P0X A;  3S29 A;  5IF6 A;  2RFR A;  1BRI A;  2Q07 A;  1D6Z A;  3D9R A;  3LTB A;  4I4K A;  5G2G A;  2B1X B;  1YIT 3;  1N8Q A;  3CME 3;  1V57 A;  4WYK B;  2CHC A;  3B8L A;  3EN8 A;  3NHX A;  3IJE B;  4IT7 A;  4ORL A;  3VSY A;  2GEX A;  1UUW B;  1B2X A;  1JV2 B;  1K41 A;  2F5W A;  2RGQ A;  2XFS A;  4HZ9 B;  3F14 A;  3OX9 A;  1B27 A;  1MOL A;  1CH0 A;  4TX4 A;  1GD3 A;  3H51 A;  3G6E 3;  4I5Q A;  2WO0 A;  1LVN A;  2GSP A;  3ER7 A;  1SJW A;  3F7X A;  3CXC 2;  3PYJ A;  2ML5 A;  4IPB A;  1GOY A;  4AEQ A;  5HOH A;  1RN4 A;  3H3H A;  4N3V A;  3V98 A;  1QMA A;  5HGR A;  5CF1 A;  3AGO A;  1DMM A;  3QK9 A;  3ALA A;  5G1L A;  1VZZ A;  5D81 A;  4FCZ A;  1VQO 3;  1HU9 A;  1V58 A;  1W01 A;  2H0H A;  9RNT A;  1RDS A;  4R1K A;  3KSE D;  1LOX A;  3T8U A;  3MYT A;  5BIR A;  3EBY A;  3OW2 2;  3GWR A;  2UGI A;  2A15 A;  4OVM A;  1MWU A;  2RNT A;  3FF2 A;  1NDO B;  5AIF A;  1BSC A;  1BRH A;  3AGN A;  1C7H A;  2CX1 A;  4EBG A;  1A67 A;  1NB5 I;  1MNL A;  2E2U A;  3UL6 A;  1LXE A;  6RNT A;  1TRQ A;  3PS8 A;  1HZ1 A;  1QVG 2;  3NBR A;  2CWT A;  4CJN A;  2F56 A;  4GSP A;  1VQ6 3;  1GMQ A;  4X2H A;  3SXX A;  1G02 A;  3FLJ A;  1CYV A;  1WQL B;  1QVF 2;  1ZS7 A;  3ZFZ A;  5AIH A;  1YIJ 3;  1BRK A;  1MGR A;  1S5A A;  1KQS 2;  2HML B;  4N6V 0;  1GMP A;  3UNL A;  3JVC A;  2LQV A;  1O7W B;  1BNG A;  2OTJ 3;  1BNI A;  5FW5 A;  2F4Y A;  1SAR A;  4EC6 A;  1I3F A;  3CCV 3;  2GXF A;  1CEW I;  1D6Y A;  1T3B A;  3KCH A;  3FF0 A;  3D5G A;  1BIR A;  5ELU A;  1A2K A;  2RBI A;  6STD A;  3N8B A;  1HYF A;  1PFP A;  3B4P A;  2XGN A;  3RGA A;  2YX9 A;  3KE7 A;  1ZX2 A;  1IU7 A;  3NQY A;  3SYU A;  1W5Z A;  3EB8 A;  3F8H A;  4N6T A;  1RTU A;  3DGL A;  4EXR A;  1RGL A;  1UI8 A;  3DXO A;  1J2B A;  3MKI A;  3EQQ B;  1W02 A;  3WR2 A;  1S72 3;  3JUM A;  3OWU A;  1IDP A;  2SBL A;  3VGN A;  1N5H A;  1KWI A;  1OH0 A;  3FGY A;  4O2H A;  4HM5 B;  4STD A;  4EYC A;  1LOY A;  2IYJ A;  1VQN 3;  1O7M B;  4KVH A;  1O7G B;  1MWR A;  1T2I A;  3TDG A;  5IEP A;  3KN4 A;  1RGA A;  4LEH A;  1NO3 A;  7STD A;  3IMA B;  3U1W A;  3SOY A;  3LOY A;  4J5G A;  1CQS A;  2ZDJ A;  4LMI A;  2Z6B A;  5STD A;  1O7N B;  4XDV A;  2CK3 H;  4MJD A;  4WHA A;  5CF2 A;  1TU5 A;  4BU4 A;  1RGG A;  3NX0 A;  1ULJ B;  4HYZ A;  1JRQ A;  3CMA 3;  1JBR A;  1SPU A;  1TIJ A;  3CCQ 3;  1Q40 A;  1UCI A;  4WP5 A;  5KP4 A;  1LQM B;  4OUQ A;  3K5T A;  1FUT A;  4MMZ B;  4OK0 A;  1AR0 A;  3F7S A;  3J7Y d;  2LYX A;  5AII A;  3HIG A;  3B7C A;  3S67 A;  2V1L A;  1X1U A;  3RNT A;  1JB4 A;  1D6U A;  1TJD A;  3DH2 A;  2PZV A;  3OWY A;  1DET A;  4H61 A;  1W2Z A;  3X42 A;  5KP1 A;  1JB5 A;  2CW9 A;  2HMJ B;  3BNC A;  3EF8 A;  2IUK A;  5AIG A;  3SED A;  4U13 A;  4EV2 A;  2HMO B;  1B20 A;  5G1K A;  1IT8 A;  1UCK A;  3NM7 A;  1FZU A;  3HOH A;  1BNF A;  3GRD A;  4BTX A;  2F5M A;  2UUG C;  2QA4 3;  4O3V A;  2KAA A;  4K61 A;  1BNR A;  3BND A;  1VQ8 3;  1N9J A;  1W4N A;  2L1S A;  3DY5 A;  4HM7 B;  1B2Z A;  1B21 A;  4AKZ A;  1K28 A;  1VQ4 3;  1LOV A;  2OQE C;  5IW9 A;  1BSB A;  1Q42 A;  1TFK A;  3Q1C A;  3NXJ A;  1Q40 B;  4HM2 B;  3D4A A;  5A0O B;  2JDI H;  3GSP A;  1W6G A;  1GOU A;  4FMB A;  1RNB A;  2I9W A;  1BNS A;  5JPU A;  4WWU C;  1BRG A;  4J8T A;  1C54 A;  1X1W A;  3WA3 A;  2HOH A;  3LT9 A;  4HAA A;  3MG1 A;  4ILF A;  4QWT A;  1SII A;  3FCS B;  4HM6 B;  1IK3 A;  5TGN A;  1N5P A;  1RRL A;  3CCE 3;  1KSI A;  1BAO A;  1QAK A;  2W2C A;  3A76 A;  4X2O A;  3WHO A;  2Z7A A;  1BUJ A;  4R80 A;  3FG1 A;  2XSH B;  7RNT A;  1JNQ A;  1B3S A;  2XR8 B;  5BXQ A;  4MMY B;  1PY3 A;  1IVW A;  2GBW B;  3BNB A;  3DGO A;  3OXA A;  5I97 A;  5IG5 A;  2KXG A;  3WA2 X;  1ASK A;  4GL6 A;  4FR9 A;  3LYG A;  3JUQ A;  1GY5 A;  1YHQ 3;  2KCD A;  4XBX A;  4LYL B;  2W56 A;  2PNC A;  1FW7 A;  1I3I A;  3HX8 A;  2BNG A;  2CFW A;  3NQZ A;  1JB2 A;  3SLU A;  3URP A;  1BNE A;  3EE1 A;  1WMO A;  2XSO B;  4O02 B;  4HM4 B;  1JN5 B;  3DM8 A;  1W7C A;  4R4K A;  1QJG A;  3U97 A;  2F98 A;  2BT3 A;  2HMN B;  3QRD A;  1I2E A;  1OHP A;  1ZGX A;  2YFL B;  2H0G A;  3AHS A;  1OPY A;  2CH9 A;  2FGT A;  1OHO A; 
#chains in the Genus database with same CATH homology
 1RTU A;  1T2H A;  1AY7 A;  2BU4 A;  1RGL A;  1LOW A;  1RGE A;  4HOH A;  1R4Y A;  1BAN A;  3WR2 A;  3BU4 A;  8RNT A;  1YNV X;  1X1X A;  2SAR A;  1B2M A;  1LOY A;  2KF5 A;  2KF3 A;  1T2I A;  1RGA A;  1TRP A;  4GHO A;  4J5G A;  2AAD A;  1RSN A;  1B2U A;  1RGG A;  4BU4 A;  1JBR A;  3A5E A;  5BU4 A;  1FYS A;  3DGY A;  5RNT A;  1UCI A;  3D5I A;  1BOX A;  1BRI A;  4J5K A;  1RLS A;  1FUT A;  1MGW A;  1I8V A;  1B2S A;  1X1U A;  1TTO A;  1RGK A;  3RNT A;  1B2X A;  2F5W A;  2KF6 A;  3DH2 A;  1BVI A;  1DET A;  1B27 A;  1GMR A;  1CH0 A;  5GSP A;  1BRS A;  1YVS A;  1BRJ A;  7GSP A;  1B20 A;  1AQZ A;  2GSP A;  1RMS A;  2BIR A;  1UCK A;  1FZU A;  1RGH A;  1BNF A;  3HOH A;  1GOY A;  2F5M A;  5HOH A;  1RN4 A;  2KAA A;  1UCJ A;  1BNR A;  1LNI A;  1I70 A;  3AGO A;  2KF4 A;  1B2Z A;  9RNT A;  1RDS A;  1B21 A;  1RNT A;  1RGF A;  5BIR A;  1BSD A;  1LOV A;  1RCL A;  1BSB A;  1JBS A;  1JBT A;  1GSP A;  4BIR A;  1Q9E A;  2RNT A;  3D4A A;  1BRN L;  3GSP A;  1RNB A;  1GOU A;  1BSC A;  1BRH A;  1DE3 A;  1BNS A;  1LRA A;  1BRG A;  3AGN A;  1C54 A;  1A2P A;  1X1W A;  2HOH A;  4HAA A;  6RNT A;  1TRQ A;  1RHL A;  1RGC A;  1FUS A;  1GOV A;  1BAO A;  1HZ1 A;  1PYL A;  2F56 A;  4GSP A;  4RNT A;  1GMQ A;  3WHO A;  1G02 A;  1BNJ A;  1BUJ A;  1BGS A;  7RNT A;  6GSP A;  1BRK A;  1B3S A;  1MGR A;  1RN1 A;  1PY3 A;  1GMP A;  1IYY A;  2C4B A;  1BNG A;  1I2G A;  1BNI A;  2F4Y A;  1SAR A;  3Q3F A;  1I3F A;  1I0X A;  1UCL A;  1X1Y A;  1YGW A;  3KCH A;  1FW7 A;  1I3I A;  1I2F A;  3AHW A;  3D5G A;  3URP A;  1BIR A;  1BNE A;  2ZA4 A;  1BSA A;  3BIR A;  1BU4 A;  2RBI A;  1I0V A;  1HYF A;  1I2E A;  1ZGX A;  2AAE A;  3AHS A;  1BSE A;  3SYU A;  1RCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...