1GMRA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(guanyloribonuclease)
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 26
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmrA00
1B2XA 2BU4A 1FUSA 1FZUA 1BNGA 1BRIA 1BSAA 3GSPA 1BRHA 1MGRA 1MGWA 3AHSA 1I8VA 1I2GA 4GHOA 1HZ1A 1X1UA 1RN4A 8RNTA 2SARA 1JBTA 1BSBA 2KAAA 1RGKA 1SARA 1CH0A 1R4YA 1BU4A 1X1WA 1LNIA 1B2SA 4BU4A 1C54A 2ZA4A 1JBSA 6GSPA 1RN1A 3Q3FA 1FUTA 1GSPA 7GSPA 3WHOA 1RNBA 1TRPA 1AQZA 1X1YA 1I3FA 1RGCA 3RNTA 1FW7A 1RGGA 1BANA 3AGOA 1T2HA 2KF5A 1LOVA 1LOYA 2C4BA 1LRAA 2HOHA 1UCJA 4HAAA 1B27A 1RHLA 3D4AA 1BUJA 1A2PA 1BNFA 3BIRA 3URPA 3DGYA 1DETA 1I0XA 1BNSA 1I2FA 1AY7A 5GSPA 1BSEA 4GSPA 1GOYA 2F5WA 4BIRA 9RNTA 2AADA 2RNTA 1YGWA 1BRGA 6RNTA 1BSDA 1RGLA 2KF3A 1RMSA 1BNIA 1GMPA 1YVSA 1RCKA 1GMRA 1RGFA 1RLSA 5BIRA 1FYSA 1UCIA 1TTOA 1B2MA 1I2EA 1YNVX 1BRNL 1BRJA 1IYYA 1RDSA 1X1XA 4RNTA 2F4YA 1BVIA 1T2IA 1BAOA 4J5KA 1LOWA 1B3SA 1B2ZA 3D5IA 1UCLA 1BRSA 5BU4A 1HYFA 2GSPA 3SYUA 7RNTA 1BGSA 1BNRA 3WR2A 3KCHA 3D5GA 1RNTA 3BU4A 1GOVA 1RSNA 2AAEA 1Q9EA 1PY3A 2F5MA 1GMQA 1B20A 3A5EA 2RBIA 3AHWA 3DH2A 1I0VA 2F56A 1BOXA 1I3IA 1I70A 3HOHA 1ZGXA 1PYLA 4J5GA 1BIRA 1RTUA 1JBRA 1BNEA 2KF4A 5HOHA 3AGNA 1RGAA 1RGHA 1BNJA 2KF6A 2BIRA 1G02A 1B2UA 1RGEA 1TRQA 1UCKA 1B21A 5RNTA 1BSCA 1DE3A 1GOUA 4HOHA 1BRKA 1RCLA
chains in the Genus database with same CATH superfamily
4K61A 2ML6A 1STDA 3HK4A 4J8TA 1FUSA 3GSPA 1JN5B 3CXC2 2LYXA 3CPOA 3F9SA 1VZZA 1N5HA 1PFPA 1YVBI 1W6YA 4OK0A 2RCDA 4ORLA 5DRVA 1VQP3 1NDOB 4LEHA 1X1UA 3EC9A 1EQKA 1DYUA 2SARA 1JBTA 1BSBA 1YJW3 3BNBA 3HI7A 5IG3A 1VQM3 4IPBA 3LXUX 1W5ZA 1CH0A 1R4YA 2C11A 2JQ5A 4OUQA 4R80A 1PU4A 2WGQA 3PGBA 2YX9A 1W00A 2F86B 4MMXB 2BMQB 1C54A 1VQ53 2OOVC 2GU1A 1LNHA 1SQWA 1N9JA 2QIYA 1M904 4RNYA 1NB3I 5KP3A 1YIJ3 3OWUA 1RNBA 4KFEA 3CCV3 2Q07A 1AVLA 1RGCA 2CX1A 2HMLB 2W03A 4HM4B 1RGGA 1STFI 1RRLA 3FG4A 1T2HA 1UDII 3FCSB 1M1K4 2KF5A 2CG0A 5D81A 3VF1A 4HM2B 1UGIA 2STDA 1LRAA 2HOHA 2CG1A 4LMIA 1ASKA 3ROBA 2P05A 2XEPA 1BNFA 3FKAA 1DETA 4WFOA 3MG3A 1WMPA 1JB5A 3PXMA 1Q40A 3UJMA 4WYKB 2XRXB 1DMMA 2GXFA 1AY7A 2W2CA 3CME3 4BIRA 1YGEA 3NM7A 4N6MA 2XGNA 2RNTA 3LMLA 1LXEA 1LVNA 6RNTA 1RGLA 3E99A 3F7SA 2UUGC 5ELJA 1YJ93 1GMPA 2IUKA 3LT8A 1LOXA 1RGFA 1T5YA 2CFLA 1FYSA 5AYRB 1UCIA 2UX0A 3GZXB 3DUKA 1QMAA 3KE7A 4Q53A 1BRNL 4RNZA 4EYCA 5KP1A 1BUQA 3ER7A 1BRJA 3HIGA 3X41A 2RSXA 3CCE3 2KXGA 3F14A 3VSYA 3X40A 2XSOB 3MWZA 1UI7A 1EG9B 3UL6A 2F4YA 1T2IA 2RGQA 3T0UA 1FGOA 1RN7A 2GEYA 3I0YA 2L4VA 4MEIA 4TX4A 5LC6A 3V98A 2CFKA 7STDA 2SBLA 7RNTA 1O7MB 2YFJB 2PNCA 3KCHA 5M1AA 1MOLA 2HMJB 5BXQA 3NUVA 4WP5A 4N6OB 4IT7A 4NHFA 1RSNA 2AAEA 3NQZA 4O8SA 1PY3A 1RJOA 4EV5A 3NXJA 3EX9A 3SOYA 3UNLA 2K54A 1NWWA 2D1WA 3X3ZA 3AHWA 1L5GB 3DH2A 2IY2A 1WQLB 2F56A 3STDA 1N8R4 3FF0A 2H0GA 1BIRA 4J5GA 1QJGA 3CCR3 2KF4A 2GEXA 4FMAA 4PEJA 5AIGA 1RGHA 2UGIA 4HM0B 1OHSA 4XBTA 1TRQA 1UCKA 1WMNA 4N6LA 1QAFA 3BNEA 3H3HA 4H61A 5RNTA 2IMJA 2CHCA 1JV2B 1JN5A 3EQQB 1GOUA 3B7CA 4L8OA 4HM6B 2W0QA 2Z6BA 3MHEA 2JDIH 1IT7A 2Z77A 2WOFA 1B2XA 3T8NA 4K90B 3B4OA 1KSIA 1BNGA 1BRIA 5IEPA 2H0HA 3G6E3 1OGXA 1BRHA 1O7WB 3EB8A 1MGWA 2CIUA 1I8VA 1WNHA 3EN8A 2K3DA 3LTBA 4R9LA 2K0MA 4WWUC 4LSOA 4HM5B 3RDEA 1IDPA 3O8YA 5CLKA 3SEDA 2L1SA 2KAAA 4U13A 1TFKA 3K7CA 1FGRA 3KKGA 5I97A 3CCJ3 3EHCA 1W2ZA 3DXOA 1BU4A 3EF8A 5AI1A 3CC43 1LNIA 3LOYA 1AVKA 1RN1A 3Q3FA 1IU7A 1UUWB 1OCVA 1GSPA 5KP4A 2E2VA 4HJLB 4KVHA 2FGTA 2D42A 3RNTA 3FG1A 4BL2A 1T3BA 1O7GB 2C4BA 4EBGA 1IT8A 2M7OA 1NNVA 2W04A 4KFDA 1EA2A 2GU3A 2W56B 4WYKA 5IEOA 3BIRA 2QGUA 3D9RA 3GZYB 3M8CA 1UW1A 1G96A 4XM4A 1BSEA 4GSPA 2CH9A 1GOYA 2F98A 2F5WA 3KSPA 3KSED 9RNTA 2AADA 1VQN3 1BRGA 3DGMA 1BSDA 2KF3A 1RMSA 3HZPA 3OXAA 4BTXA 1YVSA 3QK9A 2W6JH 1RLSA 1VQL3 1SIHA 1I2EA 4XB5A 1YNVX 3PS8A 3CNXA 1YJN3 4AEQA 1W6CA 5D83A 3EN1B 5JBSA 1KWIA 3FSDA 1IYYA 1UI8A 1RDSA 1CEWI 2BNGA 3ZG0A 2HMMB 4CPKA 1BVIA 1BAOA 2V1LA 4L8PA 1B3SA 4DKIA 3IMAB 3ZFZA 3D5IA 3G4S3 1O7PB 2XF3A 1BRSA 4BL3A 3PZWA 5BU4A 5AEUB 3X3XA 1QVF2 3DZLA 5G1KA 3UL5A 4FR9A 3WR2A 4HZBB 2J8XB 1K28A 2OOVA 3CCL3 3X42A 1HKXA 1E3RA 1RNTA 2GBXB 1MWUA 3BU4A 1E3VA 3DGOA 2WOHA 3PCSA 3LTDA 5IG4A 1Q9EA 3B8LA 3GAXA 3KZTA 2F5MA 2IUJA 1GMQA 1B20A 2ZHXB 2OWPA 3F8HA 5ELUA 5DREA 4EW5A 5IW9A 2LQVA 1VQ73 1BOXA 1I3IA 1I70A 2OQEC 1ZGXA 3U1WA 4FCMA 4AKYA 1V57A 3WA2X 1A2KA 1Q42A 3JUQA 4GL6A 4N6NB 5HOHA 3MPHA 4O02B 4MMZB 1RGAA 1OPYA 5EQLA 2BIRA 1G02A 1B2UA 1CYVA 1W2B2 3ALAA 1SJWA 3U97A 1JJ22 1IVVA 1GS3A 2KCDA 1NU3A 4STDA 1V74A 4HOHA 4N3VA 3CCU3 3WOFB 1MWTA 1FZUA 4HZ9B 1Z1SA 1CYUA 1UGHI 3FLJA 2FNQA 3LZAA 1AR0A 2ML5A 1MGRA 4HM3B 4NPBA 1V58A 4K1VA 2CFWA 3MYTA 4EC6A 1GD4A 4FMCA 1GYBA 4K1UA 1IV7A 3K5TA 1RN4A 4R1KA 3CD63 3ECFA 2RFRA 3MKIA 1MNLA 2WO0A 1RGKA 1SARA 2B1XB 3GZBA 4H3UA 1FUWA 4KT3B 3EE1A 1QALA 2BT3A 4GB5A 2ZL8A 3S67A 4J9AA 5AIIA 5EEOA 3EJVA 2A15A 3G713 1FUTA 1LQMB 1EEJA 7GSPA 2CX0A 4O3VA 1K8A4 2QA43 3VGNA 4LZIA 1I3FA 2E2TA 4I4KA 1FW7A 1AV4A 1JZOA 1ULIB 3MSOA 1BANA 2R41A 1EUIC 4ILFA 3FH1A 3TDGA 1IK3A 1LOVA 1LOYA 5FW5A 3HX8A 2W9PA 3Q90A 1DVCA 4CJNA 5CK6A 3K0ZA 1D6YA 1Q814 1B27A 1RHLA 3NBBA 3D4AA 5IERA 1BUJA 2W9QA 1A2PA 3DMCA 3PYJA 2O9UX 3Q2PA 4N6TA 2OTL3 1ULJB 4FCZA 3SLUA 1Q864 1QVG2 3N54B 1I2FA 4JF8A 5GSPA 4LYLB 2XGLA 1W02A 2Y73A 4IIAA 4XDWA 5G2GA 3FZWA 2Y74A 4AKZA 3NHXA 4NREA 5IENA 1RRHA 1N5PA 1GY5A 5M19A 1SIIA 1W6GA 2CFDA 3OWYA 1JNQA 3CC73 1WTHA 3MG1A 3I553 4JRFA 1FGTA 3L0RA 3CCS3 1G0TA 3CNMA 5BIRA 1OF5B 3BLZA 3FGYA 2CW9A 1OGZA 3LTCA 1TJDA 2BO9B 3JUPA 1JRQA 4G1MB 3S27A 3IPTA 1VQQA 3D3LA 3CC23 1F8NA 1NB5I 1JKGB 1VQ63 1A90A 3DGNA 1X1XA 5TGNA 4RZMA 1M9GA 4RNTA 4HKVB 3NV0B 8CHOA 2XH9A 3NM2A 1LOWA 3WDGB 3LH4A 3AMOB 2BHMA 3G8ZA 3GWRA 3K63A 1ROVA 4I5QA 4CCVA 3KFQC 1IQ8A 1HYFA 3D79A 4RBNA 1JB2A 2GSPA 1OH0A 3SYUA 1BGSA 1ZX2A 3FF2A 1UUGB 1N9EA 3DGLA 3EBYA 3D5GA 3G0KA 2CWTA 2O3OA 5STDA 1O7HB 3KN4A 2OCTA 2C10A 2CWVA 3CMA3 3S29A 2KRTA 1K41A 1DMQA 1R4CA 1ROAA 3BB9A 3N9HA 2ZDJA 4FMBA 4WHAA 5FGOA 2HMOB 2CK3H 3A5EA 2RBIA 1ISKA 1FA3A 1IQXA 4XBXA 3S5CA 3HOHA 3NBRA 3EBTA 2I9WA 1BNEA 1RKYA 3I563 2WGOA 1IV9A 3AGNA 2MC8A 1BNJA 2KF6A 3LTAA 1RGEA 5AYSC 2H0IA 2YFIB 3CCQ3 1K734 2OTJ3 5A0OB 1CQSA 1SPUA 3A76A 4R4KA 3JUNA 1BRKA 1YIT3 3F40A 1D6UA 4FMDA 2XR8B 2BU4A 1U8CB 4FCJA 1WMOA 1BSAA 1C7HA 1JB4A 2CC3A 2E2UA 1S723 3DY5A 1Q824 5EVHA 1GD3A 3UB1A 4CDLA 3NX0A 3SVAA 3AHSA 1VQO3 3NBJA 1I2GA 3B4PA 4KZ1A 2B24B 4GHOA 5HGRA 3ZG5A 5IF6A 4X2HA 1HZ1A 1OACA 8RNTA 3WODG 1S5AA 3BNCA 1TUHA 1JBRA 1X1WA 3Q1CA 1IVWA 1B2SA 4BU4A 1DVDA 1KQS2 3CU3A 2ZA4A 5IG5A 1JBSA 6GSPA 1YHQ3 5JPUA 4N6V0 5AIFA 1M1XB 1TFOA 3F7XA 3RGAA 4EV2A 3WHOA 1HU9A 1LQGC 1TRPA 1AQZA 1MWSA 1X1YA 4EXRA 3T8UA 5JPPA 2HMNB 1VQ93 3AGOA 3V99A 1TP6A 2F99A 3N8BA 1U5OA 2CWUA 2XSHB 1KD14 1TIJA 5CF1A 1UCJA 4HAAA 1FGMA 3H51A 3LYGA 3JUOA 2P09A 3BNDA 1IQYA 4KFFA 2BMRB 3HIIA 4X2OA 3RGRA 1FGQA 2BMOB 2INXA 1IVUA 1OHOA 2IYJA 3OX9A 3DGYA 2OQEA 3URPA 3WOEB 1UUVB 3GRDA 1TU5A 3WA3A 1I0XA 1Y4KA 1BNSA 1JZDA 1KC84 4LGQA 3F8XA 3WMDA 4HYZA 3V92A 1OHPA 1YI23 4N6UA 1ZO2A 3NQYA 3OW22 1OF5A 1Q40B 4MMYB 1YGWA 2MF7A 1GY6A 3S28A 1MWRA 4HM7B 1BNIA 3FG3A 1O7NB 2PZVA 4R9KA 5CF2A 1RCKA 1GMRA 5IG0A 1VQ43 1JKGA 5BVBA 1TTOA 2Z7AA 1B2MA 2P38A 1A67A 4BTWA 2W56A 6STDA 3NV0A 1ZS7A 1GY7A 3IJEB 1US1A 2QEX3 3CPW2 3AMOA 1NJI4 4XBYA 2XFSA 3OWSA 2FXTA 4QWTA 2P0XA 3G16A 4HVNA 5AEWB 4HM1B 2CKFB 1N8QA 1W01A 4XDVA 1W7CA 4J5KA 1K9M4 1B2ZA 3JVCA 4HBRA 2P0MA 3LT9A 2Z76A 1UCLA 3SX1A 5G1LA 1VQK3 1DMNA 5AIHA 1OUNA 1NO3A 4HM8B 1BNRA 2YFLB 4BTYA 3PCRA 3QRDA 4ZM8A 3CCM3 2HMKB 3MG2A 1IVXA 1GOVA 3X3YA 2XFTA 5LC7A 3GZRA 1I0VA 1D6ZA 1EKMA 2IA7A 1PYLA 1E97A 1RTUA 3K9MC 5CXOA 2GBWB 4OVMA 1Q7Y4 2CFGA 3OV4A 3DM8A 1W4NA 5M18A 4O2HA 3KIIA 1J2BA 1B21A 1Q7HA 1QAKA 3JUMA 4L7KA 4MJDA 5D82A 1VQ83 3SOAA 1A2VA 1BSCA 3SXXA 1DE3A 2R4IA 3J7Yd 1RCLA
chains in the Genus database with same CATH topology
1B2XA 2BU4A 1FUSA 1FZUA 1BNGA 1BRIA 1BSAA 3GSPA 1BRHA 1MGRA 1MGWA 3AHSA 1I8VA 1I2GA 4GHOA 1HZ1A 1X1UA 1RN4A 8RNTA 2SARA 1JBTA 1BSBA 2KAAA 1RGKA 1SARA 1CH0A 1R4YA 1BU4A 1X1WA 1LNIA 1B2SA 4BU4A 1C54A 2ZA4A 1JBSA 6GSPA 1RN1A 3Q3FA 1FUTA 1GSPA 7GSPA 3WHOA 1RNBA 1TRPA 1AQZA 1X1YA 1I3FA 1RGCA 3RNTA 1FW7A 1RGGA 1BANA 3AGOA 1T2HA 2KF5A 1LOVA 1LOYA 2C4BA 1LRAA 2HOHA 1UCJA 4HAAA 1B27A 1RHLA 3D4AA 1BUJA 1A2PA 1BNFA 3BIRA 3URPA 3DGYA 1DETA 1I0XA 1BNSA 1I2FA 1AY7A 5GSPA 1BSEA 4GSPA 1GOYA 2F5WA 4BIRA 9RNTA 2AADA 2RNTA 1YGWA 1BRGA 6RNTA 1BSDA 1RGLA 2KF3A 1RMSA 1BNIA 1GMPA 1YVSA 1RCKA 1GMRA 1RGFA 1RLSA 5BIRA 1FYSA 1UCIA 1TTOA 1B2MA 1I2EA 1YNVX 1BRNL 1BRJA 1IYYA 1RDSA 1X1XA 4RNTA 2F4YA 1BVIA 1T2IA 1BAOA 4J5KA 1LOWA 1B3SA 1B2ZA 3D5IA 1UCLA 1BRSA 5BU4A 1HYFA 2GSPA 3SYUA 7RNTA 1BGSA 1BNRA 3WR2A 3KCHA 3D5GA 1RNTA 3BU4A 1GOVA 1RSNA 2AAEA 1Q9EA 1PY3A 2F5MA 1GMQA 1B20A 3A5EA 2RBIA 3AHWA 3DH2A 1I0VA 2F56A 1BOXA 1I3IA 1I70A 3HOHA 1ZGXA 1PYLA 4J5GA 1BIRA 1RTUA 1JBRA 1BNEA 2KF4A 5HOHA 3AGNA 1RGAA 1RGHA 1BNJA 2KF6A 2BIRA 1G02A 1B2UA 1RGEA 1TRQA 1UCKA 1B21A 5RNTA 1BSCA 1DE3A 1GOUA 4HOHA 1BRKA 1RCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2X A;  2BU4 A;  1FUS A;  1FZU A;  1BNG A;  1BRI A;  1BSA A;  3GSP A;  1BRH A;  1MGR A;  1MGW A;  3AHS A;  1I8V A;  1I2G A;  4GHO A;  1HZ1 A;  1X1U A;  1RN4 A;  8RNT A;  2SAR A;  1JBT A;  1BSB A;  2KAA A;  1RGK A;  1SAR A;  1CH0 A;  1R4Y A;  1BU4 A;  1X1W A;  1LNI A;  1B2S A;  4BU4 A;  1C54 A;  2ZA4 A;  1JBS A;  6GSP A;  1RN1 A;  3Q3F A;  1FUT A;  1GSP A;  7GSP A;  3WHO A;  1RNB A;  1TRP A;  1AQZ A;  1X1Y A;  1I3F A;  1RGC A;  3RNT A;  1FW7 A;  1RGG A;  1BAN A;  3AGO A;  1T2H A;  2KF5 A;  1LOV A;  1LOY A;  2C4B A;  1LRA A;  2HOH A;  1UCJ A;  4HAA A;  1B27 A;  1RHL A;  3D4A A;  1BUJ A;  1A2P A;  1BNF A;  3BIR A;  3URP A;  3DGY A;  1DET A;  1I0X A;  1BNS A;  1I2F A;  1AY7 A;  5GSP A;  1BSE A;  4GSP A;  1GOY A;  2F5W A;  4BIR A;  9RNT A;  2AAD A;  2RNT A;  1YGW A;  1BRG A;  6RNT A;  1BSD A;  1RGL A;  2KF3 A;  1RMS A;  1BNI A;  1GMP A;  1YVS A;  1RCK A;  1GMR A;  1RGF A;  1RLS A;  5BIR A;  1FYS A;  1UCI A;  1TTO A;  1B2M A;  1I2E A;  1YNV X;  1BRN L;  1BRJ A;  1IYY A;  1RDS A;  1X1X A;  4RNT A;  2F4Y A;  1BVI A;  1T2I A;  1BAO A;  4J5K A;  1LOW A;  1B3S A;  1B2Z A;  3D5I A;  1UCL A;  1BRS A;  5BU4 A;  1HYF A;  2GSP A;  3SYU A;  7RNT A;  1BGS A;  1BNR A;  3WR2 A;  3KCH A;  3D5G A;  1RNT A;  3BU4 A;  1GOV A;  1RSN A;  2AAE A;  1Q9E A;  1PY3 A;  2F5M A;  1GMQ A;  1B20 A;  3A5E A;  2RBI A;  3AHW A;  3DH2 A;  1I0V A;  2F56 A;  1BOX A;  1I3I A;  1I70 A;  3HOH A;  1ZGX A;  1PYL A;  4J5G A;  1BIR A;  1RTU A;  1JBR A;  1BNE A;  2KF4 A;  5HOH A;  3AGN A;  1RGA A;  1RGH A;  1BNJ A;  2KF6 A;  2BIR A;  1G02 A;  1B2U A;  1RGE A;  1TRQ A;  1UCK A;  1B21 A;  5RNT A;  1BSC A;  1DE3 A;  1GOU A;  4HOH A;  1BRK A;  1RCL A; 
#chains in the Genus database with same CATH topology
 4K61 A;  2ML6 A;  1STD A;  3HK4 A;  4J8T A;  1FUS A;  3GSP A;  1JN5 B;  3CXC 2;  2LYX A;  3CPO A;  3F9S A;  1VZZ A;  1N5H A;  1PFP A;  1YVB I;  1W6Y A;  4OK0 A;  2RCD A;  4ORL A;  5DRV A;  1VQP 3;  1NDO B;  4LEH A;  1X1U A;  3EC9 A;  1EQK A;  1DYU A;  2SAR A;  1JBT A;  1BSB A;  1YJW 3;  3BNB A;  3HI7 A;  5IG3 A;  1VQM 3;  4IPB A;  3LXU X;  1W5Z A;  1CH0 A;  1R4Y A;  2C11 A;  2JQ5 A;  4OUQ A;  4R80 A;  1PU4 A;  2WGQ A;  3PGB A;  2YX9 A;  1W00 A;  2F86 B;  4MMX B;  2BMQ B;  1C54 A;  1VQ5 3;  2OOV C;  2GU1 A;  1LNH A;  1SQW A;  1N9J A;  2QIY A;  1M90 4;  4RNY A;  1NB3 I;  5KP3 A;  1YIJ 3;  3OWU A;  1RNB A;  4KFE A;  3CCV 3;  2Q07 A;  1AVL A;  1RGC A;  2CX1 A;  2HML B;  2W03 A;  4HM4 B;  1RGG A;  1STF I;  1RRL A;  3FG4 A;  1T2H A;  1UDI I;  3FCS B;  1M1K 4;  2KF5 A;  2CG0 A;  5D81 A;  3VF1 A;  4HM2 B;  1UGI A;  2STD A;  1LRA A;  2HOH A;  2CG1 A;  4LMI A;  1ASK A;  3ROB A;  2P05 A;  2XEP A;  1BNF A;  3FKA A;  1DET A;  4WFO A;  3MG3 A;  1WMP A;  1JB5 A;  3PXM A;  1Q40 A;  3UJM A;  4WYK B;  2XRX B;  1DMM A;  2GXF A;  1AY7 A;  2W2C A;  3CME 3;  4BIR A;  1YGE A;  3NM7 A;  4N6M A;  2XGN A;  2RNT A;  3LML A;  1LXE A;  1LVN A;  6RNT A;  1RGL A;  3E99 A;  3F7S A;  2UUG C;  5ELJ A;  1YJ9 3;  1GMP A;  2IUK A;  3LT8 A;  1LOX A;  1RGF A;  1T5Y A;  2CFL A;  1FYS A;  5AYR B;  1UCI A;  2UX0 A;  3GZX B;  3DUK A;  1QMA A;  3KE7 A;  4Q53 A;  1BRN L;  4RNZ A;  4EYC A;  5KP1 A;  1BUQ A;  3ER7 A;  1BRJ A;  3HIG A;  3X41 A;  2RSX A;  3CCE 3;  2KXG A;  3F14 A;  3VSY A;  3X40 A;  2XSO B;  3MWZ A;  1UI7 A;  1EG9 B;  3UL6 A;  2F4Y A;  1T2I A;  2RGQ A;  3T0U A;  1FGO A;  1RN7 A;  2GEY A;  3I0Y A;  2L4V A;  4MEI A;  4TX4 A;  5LC6 A;  3V98 A;  2CFK A;  7STD A;  2SBL A;  7RNT A;  1O7M B;  2YFJ B;  2PNC A;  3KCH A;  5M1A A;  1MOL A;  2HMJ B;  5BXQ A;  3NUV A;  4WP5 A;  4N6O B;  4IT7 A;  4NHF A;  1RSN A;  2AAE A;  3NQZ A;  4O8S A;  1PY3 A;  1RJO A;  4EV5 A;  3NXJ A;  3EX9 A;  3SOY A;  3UNL A;  2K54 A;  1NWW A;  2D1W A;  3X3Z A;  3AHW A;  1L5G B;  3DH2 A;  2IY2 A;  1WQL B;  2F56 A;  3STD A;  1N8R 4;  3FF0 A;  2H0G A;  1BIR A;  4J5G A;  1QJG A;  3CCR 3;  2KF4 A;  2GEX A;  4FMA A;  4PEJ A;  5AIG A;  1RGH A;  2UGI A;  4HM0 B;  1OHS A;  4XBT A;  1TRQ A;  1UCK A;  1WMN A;  4N6L A;  1QAF A;  3BNE A;  3H3H A;  4H61 A;  5RNT A;  2IMJ A;  2CHC A;  1JV2 B;  1JN5 A;  3EQQ B;  1GOU A;  3B7C A;  4L8O A;  4HM6 B;  2W0Q A;  2Z6B A;  3MHE A;  2JDI H;  1IT7 A;  2Z77 A;  2WOF A;  1B2X A;  3T8N A;  4K90 B;  3B4O A;  1KSI A;  1BNG A;  1BRI A;  5IEP A;  2H0H A;  3G6E 3;  1OGX A;  1BRH A;  1O7W B;  3EB8 A;  1MGW A;  2CIU A;  1I8V A;  1WNH A;  3EN8 A;  2K3D A;  3LTB A;  4R9L A;  2K0M A;  4WWU C;  4LSO A;  4HM5 B;  3RDE A;  1IDP A;  3O8Y A;  5CLK A;  3SED A;  2L1S A;  2KAA A;  4U13 A;  1TFK A;  3K7C A;  1FGR A;  3KKG A;  5I97 A;  3CCJ 3;  3EHC A;  1W2Z A;  3DXO A;  1BU4 A;  3EF8 A;  5AI1 A;  3CC4 3;  1LNI A;  3LOY A;  1AVK A;  1RN1 A;  3Q3F A;  1IU7 A;  1UUW B;  1OCV A;  1GSP A;  5KP4 A;  2E2V A;  4HJL B;  4KVH A;  2FGT A;  2D42 A;  3RNT A;  3FG1 A;  4BL2 A;  1T3B A;  1O7G B;  2C4B A;  4EBG A;  1IT8 A;  2M7O A;  1NNV A;  2W04 A;  4KFD A;  1EA2 A;  2GU3 A;  2W56 B;  4WYK A;  5IEO A;  3BIR A;  2QGU A;  3D9R A;  3GZY B;  3M8C A;  1UW1 A;  1G96 A;  4XM4 A;  1BSE A;  4GSP A;  2CH9 A;  1GOY A;  2F98 A;  2F5W A;  3KSP A;  3KSE D;  9RNT A;  2AAD A;  1VQN 3;  1BRG A;  3DGM A;  1BSD A;  2KF3 A;  1RMS A;  3HZP A;  3OXA A;  4BTX A;  1YVS A;  3QK9 A;  2W6J H;  1RLS A;  1VQL 3;  1SIH A;  1I2E A;  4XB5 A;  1YNV X;  3PS8 A;  3CNX A;  1YJN 3;  4AEQ A;  1W6C A;  5D83 A;  3EN1 B;  5JBS A;  1KWI A;  3FSD A;  1IYY A;  1UI8 A;  1RDS A;  1CEW I;  2BNG A;  3ZG0 A;  2HMM B;  4CPK A;  1BVI A;  1BAO A;  2V1L A;  4L8P A;  1B3S A;  4DKI A;  3IMA B;  3ZFZ A;  3D5I A;  3G4S 3;  1O7P B;  2XF3 A;  1BRS A;  4BL3 A;  3PZW A;  5BU4 A;  5AEU B;  3X3X A;  1QVF 2;  3DZL A;  5G1K A;  3UL5 A;  4FR9 A;  3WR2 A;  4HZB B;  2J8X B;  1K28 A;  2OOV A;  3CCL 3;  3X42 A;  1HKX A;  1E3R A;  1RNT A;  2GBX B;  1MWU A;  3BU4 A;  1E3V A;  3DGO A;  2WOH A;  3PCS A;  3LTD A;  5IG4 A;  1Q9E A;  3B8L A;  3GAX A;  3KZT A;  2F5M A;  2IUJ A;  1GMQ A;  1B20 A;  2ZHX B;  2OWP A;  3F8H A;  5ELU A;  5DRE A;  4EW5 A;  5IW9 A;  2LQV A;  1VQ7 3;  1BOX A;  1I3I A;  1I70 A;  2OQE C;  1ZGX A;  3U1W A;  4FCM A;  4AKY A;  1V57 A;  3WA2 X;  1A2K A;  1Q42 A;  3JUQ A;  4GL6 A;  4N6N B;  5HOH A;  3MPH A;  4O02 B;  4MMZ B;  1RGA A;  1OPY A;  5EQL A;  2BIR A;  1G02 A;  1B2U A;  1CYV A;  1W2B 2;  3ALA A;  1SJW A;  3U97 A;  1JJ2 2;  1IVV A;  1GS3 A;  2KCD A;  1NU3 A;  4STD A;  1V74 A;  4HOH A;  4N3V A;  3CCU 3;  3WOF B;  1MWT A;  1FZU A;  4HZ9 B;  1Z1S A;  1CYU A;  1UGH I;  3FLJ A;  2FNQ A;  3LZA A;  1AR0 A;  2ML5 A;  1MGR A;  4HM3 B;  4NPB A;  1V58 A;  4K1V A;  2CFW A;  3MYT A;  4EC6 A;  1GD4 A;  4FMC A;  1GYB A;  4K1U A;  1IV7 A;  3K5T A;  1RN4 A;  4R1K A;  3CD6 3;  3ECF A;  2RFR A;  3MKI A;  1MNL A;  2WO0 A;  1RGK A;  1SAR A;  2B1X B;  3GZB A;  4H3U A;  1FUW A;  4KT3 B;  3EE1 A;  1QAL A;  2BT3 A;  4GB5 A;  2ZL8 A;  3S67 A;  4J9A A;  5AII A;  5EEO A;  3EJV A;  2A15 A;  3G71 3;  1FUT A;  1LQM B;  1EEJ A;  7GSP A;  2CX0 A;  4O3V A;  1K8A 4;  2QA4 3;  3VGN A;  4LZI A;  1I3F A;  2E2T A;  4I4K A;  1FW7 A;  1AV4 A;  1JZO A;  1ULI B;  3MSO A;  1BAN A;  2R41 A;  1EUI C;  4ILF A;  3FH1 A;  3TDG A;  1IK3 A;  1LOV A;  1LOY A;  5FW5 A;  3HX8 A;  2W9P A;  3Q90 A;  1DVC A;  4CJN A;  5CK6 A;  3K0Z A;  1D6Y A;  1Q81 4;  1B27 A;  1RHL A;  3NBB A;  3D4A A;  5IER A;  1BUJ A;  2W9Q A;  1A2P A;  3DMC A;  3PYJ A;  2O9U X;  3Q2P A;  4N6T A;  2OTL 3;  1ULJ B;  4FCZ A;  3SLU A;  1Q86 4;  1QVG 2;  3N54 B;  1I2F A;  4JF8 A;  5GSP A;  4LYL B;  2XGL A;  1W02 A;  2Y73 A;  4IIA A;  4XDW A;  5G2G A;  3FZW A;  2Y74 A;  4AKZ A;  3NHX A;  4NRE A;  5IEN A;  1RRH A;  1N5P A;  1GY5 A;  5M19 A;  1SII A;  1W6G A;  2CFD A;  3OWY A;  1JNQ A;  3CC7 3;  1WTH A;  3MG1 A;  3I55 3;  4JRF A;  1FGT A;  3L0R A;  3CCS 3;  1G0T A;  3CNM A;  5BIR A;  1OF5 B;  3BLZ A;  3FGY A;  2CW9 A;  1OGZ A;  3LTC A;  1TJD A;  2BO9 B;  3JUP A;  1JRQ A;  4G1M B;  3S27 A;  3IPT A;  1VQQ A;  3D3L A;  3CC2 3;  1F8N A;  1NB5 I;  1JKG B;  1VQ6 3;  1A90 A;  3DGN A;  1X1X A;  5TGN A;  4RZM A;  1M9G A;  4RNT A;  4HKV B;  3NV0 B;  8CHO A;  2XH9 A;  3NM2 A;  1LOW A;  3WDG B;  3LH4 A;  3AMO B;  2BHM A;  3G8Z A;  3GWR A;  3K63 A;  1ROV A;  4I5Q A;  4CCV A;  3KFQ C;  1IQ8 A;  1HYF A;  3D79 A;  4RBN A;  1JB2 A;  2GSP A;  1OH0 A;  3SYU A;  1BGS A;  1ZX2 A;  3FF2 A;  1UUG B;  1N9E A;  3DGL A;  3EBY A;  3D5G A;  3G0K A;  2CWT A;  2O3O A;  5STD A;  1O7H B;  3KN4 A;  2OCT A;  2C10 A;  2CWV A;  3CMA 3;  3S29 A;  2KRT A;  1K41 A;  1DMQ A;  1R4C A;  1ROA A;  3BB9 A;  3N9H A;  2ZDJ A;  4FMB A;  4WHA A;  5FGO A;  2HMO B;  2CK3 H;  3A5E A;  2RBI A;  1ISK A;  1FA3 A;  1IQX A;  4XBX A;  3S5C A;  3HOH A;  3NBR A;  3EBT A;  2I9W A;  1BNE A;  1RKY A;  3I56 3;  2WGO A;  1IV9 A;  3AGN A;  2MC8 A;  1BNJ A;  2KF6 A;  3LTA A;  1RGE A;  5AYS C;  2H0I A;  2YFI B;  3CCQ 3;  1K73 4;  2OTJ 3;  5A0O B;  1CQS A;  1SPU A;  3A76 A;  4R4K A;  3JUN A;  1BRK A;  1YIT 3;  3F40 A;  1D6U A;  4FMD A;  2XR8 B;  2BU4 A;  1U8C B;  4FCJ A;  1WMO A;  1BSA A;  1C7H A;  1JB4 A;  2CC3 A;  2E2U A;  1S72 3;  3DY5 A;  1Q82 4;  5EVH A;  1GD3 A;  3UB1 A;  4CDL A;  3NX0 A;  3SVA A;  3AHS A;  1VQO 3;  3NBJ A;  1I2G A;  3B4P A;  4KZ1 A;  2B24 B;  4GHO A;  5HGR A;  3ZG5 A;  5IF6 A;  4X2H A;  1HZ1 A;  1OAC A;  8RNT A;  3WOD G;  1S5A A;  3BNC A;  1TUH A;  1JBR A;  1X1W A;  3Q1C A;  1IVW A;  1B2S A;  4BU4 A;  1DVD A;  1KQS 2;  3CU3 A;  2ZA4 A;  5IG5 A;  1JBS A;  6GSP A;  1YHQ 3;  5JPU A;  4N6V 0;  5AIF A;  1M1X B;  1TFO A;  3F7X A;  3RGA A;  4EV2 A;  3WHO A;  1HU9 A;  1LQG C;  1TRP A;  1AQZ A;  1MWS A;  1X1Y A;  4EXR A;  3T8U A;  5JPP A;  2HMN B;  1VQ9 3;  3AGO A;  3V99 A;  1TP6 A;  2F99 A;  3N8B A;  1U5O A;  2CWU A;  2XSH B;  1KD1 4;  1TIJ A;  5CF1 A;  1UCJ A;  4HAA A;  1FGM A;  3H51 A;  3LYG A;  3JUO A;  2P09 A;  3BND A;  1IQY A;  4KFF A;  2BMR B;  3HII A;  4X2O A;  3RGR A;  1FGQ A;  2BMO B;  2INX A;  1IVU A;  1OHO A;  2IYJ A;  3OX9 A;  3DGY A;  2OQE A;  3URP A;  3WOE B;  1UUV B;  3GRD A;  1TU5 A;  3WA3 A;  1I0X A;  1Y4K A;  1BNS A;  1JZD A;  1KC8 4;  4LGQ A;  3F8X A;  3WMD A;  4HYZ A;  3V92 A;  1OHP A;  1YI2 3;  4N6U A;  1ZO2 A;  3NQY A;  3OW2 2;  1OF5 A;  1Q40 B;  4MMY B;  1YGW A;  2MF7 A;  1GY6 A;  3S28 A;  1MWR A;  4HM7 B;  1BNI A;  3FG3 A;  1O7N B;  2PZV A;  4R9K A;  5CF2 A;  1RCK A;  1GMR A;  5IG0 A;  1VQ4 3;  1JKG A;  5BVB A;  1TTO A;  2Z7A A;  1B2M A;  2P38 A;  1A67 A;  4BTW A;  2W56 A;  6STD A;  3NV0 A;  1ZS7 A;  1GY7 A;  3IJE B;  1US1 A;  2QEX 3;  3CPW 2;  3AMO A;  1NJI 4;  4XBY A;  2XFS A;  3OWS A;  2FXT A;  4QWT A;  2P0X A;  3G16 A;  4HVN A;  5AEW B;  4HM1 B;  2CKF B;  1N8Q A;  1W01 A;  4XDV A;  1W7C A;  4J5K A;  1K9M 4;  1B2Z A;  3JVC A;  4HBR A;  2P0M A;  3LT9 A;  2Z76 A;  1UCL A;  3SX1 A;  5G1L A;  1VQK 3;  1DMN A;  5AIH A;  1OUN A;  1NO3 A;  4HM8 B;  1BNR A;  2YFL B;  4BTY A;  3PCR A;  3QRD A;  4ZM8 A;  3CCM 3;  2HMK B;  3MG2 A;  1IVX A;  1GOV A;  3X3Y A;  2XFT A;  5LC7 A;  3GZR A;  1I0V A;  1D6Z A;  1EKM A;  2IA7 A;  1PYL A;  1E97 A;  1RTU A;  3K9M C;  5CXO A;  2GBW B;  4OVM A;  1Q7Y 4;  2CFG A;  3OV4 A;  3DM8 A;  1W4N A;  5M18 A;  4O2H A;  3KII A;  1J2B A;  1B21 A;  1Q7H A;  1QAK A;  3JUM A;  4L7K A;  4MJD A;  5D82 A;  1VQ8 3;  3SOA A;  1A2V A;  1BSC A;  3SXX A;  1DE3 A;  2R4I A;  3J7Y d;  1RCL A; 
#chains in the Genus database with same CATH homology
 1B2X A;  2BU4 A;  1FUS A;  1FZU A;  1BNG A;  1BRI A;  1BSA A;  3GSP A;  1BRH A;  1MGR A;  1MGW A;  3AHS A;  1I8V A;  1I2G A;  4GHO A;  1HZ1 A;  1X1U A;  1RN4 A;  8RNT A;  2SAR A;  1JBT A;  1BSB A;  2KAA A;  1RGK A;  1SAR A;  1CH0 A;  1R4Y A;  1BU4 A;  1X1W A;  1LNI A;  1B2S A;  4BU4 A;  1C54 A;  2ZA4 A;  1JBS A;  6GSP A;  1RN1 A;  3Q3F A;  1FUT A;  1GSP A;  7GSP A;  3WHO A;  1RNB A;  1TRP A;  1AQZ A;  1X1Y A;  1I3F A;  1RGC A;  3RNT A;  1FW7 A;  1RGG A;  1BAN A;  3AGO A;  1T2H A;  2KF5 A;  1LOV A;  1LOY A;  2C4B A;  1LRA A;  2HOH A;  1UCJ A;  4HAA A;  1B27 A;  1RHL A;  3D4A A;  1BUJ A;  1A2P A;  1BNF A;  3BIR A;  3URP A;  3DGY A;  1DET A;  1I0X A;  1BNS A;  1I2F A;  1AY7 A;  5GSP A;  1BSE A;  4GSP A;  1GOY A;  2F5W A;  4BIR A;  9RNT A;  2AAD A;  2RNT A;  1YGW A;  1BRG A;  6RNT A;  1BSD A;  1RGL A;  2KF3 A;  1RMS A;  1BNI A;  1GMP A;  1YVS A;  1RCK A;  1GMR A;  1RGF A;  1RLS A;  5BIR A;  1FYS A;  1UCI A;  1TTO A;  1B2M A;  1I2E A;  1YNV X;  1BRN L;  1BRJ A;  1IYY A;  1RDS A;  1X1X A;  4RNT A;  2F4Y A;  1BVI A;  1T2I A;  1BAO A;  4J5K A;  1LOW A;  1B3S A;  1B2Z A;  3D5I A;  1UCL A;  1BRS A;  5BU4 A;  1HYF A;  2GSP A;  3SYU A;  7RNT A;  1BGS A;  1BNR A;  3WR2 A;  3KCH A;  3D5G A;  1RNT A;  3BU4 A;  1GOV A;  1RSN A;  2AAE A;  1Q9E A;  1PY3 A;  2F5M A;  1GMQ A;  1B20 A;  3A5E A;  2RBI A;  3AHW A;  3DH2 A;  1I0V A;  2F56 A;  1BOX A;  1I3I A;  1I70 A;  3HOH A;  1ZGX A;  1PYL A;  4J5G A;  1BIR A;  1RTU A;  1JBR A;  1BNE A;  2KF4 A;  5HOH A;  3AGN A;  1RGA A;  1RGH A;  1BNJ A;  2KF6 A;  2BIR A;  1G02 A;  1B2U A;  1RGE A;  1TRQ A;  1UCK A;  1B21 A;  5RNT A;  1BSC A;  1DE3 A;  1GOU A;  4HOH A;  1BRK A;  1RCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...