1BRIA

Barnase mutant with ile 76 replaced by ala
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADANYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1briA00
1RSNA 2KF5A 1BSCA 1B2UA 3WHOA 1X1UA 3AHSA 1I0XA 2KF4A 1GOYA 1JBRA 3BIRA 3DGYA 1UCLA 1BRKA 1AQZA 1I2EA 4HOHA 1BGSA 3BU4A 1BRJA 3WR2A 1RHLA 2RBIA 1LNIA 3HOHA 1BRGA 1UCJA 1BUJA 1BU4A 2KAAA 2SARA 3D4AA 7GSPA 2BU4A 1LRAA 8RNTA 1JBSA 1BANA 1BNSA 1BIRA 2F5MA 2AAEA 1BAOA 5GSPA 3A5EA 1RGLA 3AGNA 1FYSA 1TRPA 1BVIA 1X1WA 1B3SA 5BU4A 4GHOA 1FUTA 1PYLA 4J5GA 4BU4A 1HYFA 1YGWA 3AGOA 1JBTA 1X1YA 1RGHA 1GOVA 1BSBA 1TTOA 1I3IA 1Q9EA 1BRSA 1FZUA 1AY7A 1I0VA 2HOHA 2KF6A 6RNTA 1BNGA 1BNIA 1BNJA 3AHWA 1RGEA 1HZ1A 1PY3A 2F56A 1RCLA 2C4BA 1FW7A 1GMRA 1TRQA 1LOYA 1MGRA 1B20A 1R4YA 1RGFA 1YVSA 3D5GA 4BIRA 1C54A 1B2ZA 1SARA 7RNTA 1GOUA 1LOWA 1YNVX 4HAAA 1I2GA 1I2FA 1RN1A 4J5KA 2ZA4A 1UCKA 1RGCA 1FUSA 2AADA 3SYUA 1RN4A 1BSDA 1B27A 3RNTA 5HOHA 1IYYA 2F5WA 1I8VA 1RNTA 1RNBA 1DETA 3D5IA 9RNTA 1BNFA 2RNTA 1GMQA 1BOXA 1X1XA 2GSPA 1RDSA 1BNEA 2F4YA 1GMPA 3DH2A 1B2SA 1BSAA 5BIRA 5RNTA 3Q3FA 2KF3A 4GSPA 1BRHA 1I70A 1BSEA 1RGAA 1T2HA 1B2MA 1I3FA 1CH0A 1BNRA 2BIRA 1B2XA 1LOVA 1RLSA 3KCHA 1A2PA 1RMSA 1B21A 1RGKA 1GSPA 3URPA 4RNTA 3GSPA 1RCKA 6GSPA 1RTUA 1UCIA 1RGGA 1BRIA 1G02A 1MGWA 1T2IA 1BRNL 1DE3A 1ZGXA
chains in the Genus database with same CATH superfamily
3GZBA 1TFOA 2L4VA 4K1UA 3PYJA 5I97A 3CNMA 1OGZA 2CW9A 3SX1A 4HM5B 5IW9A 3CXC2 3UL5A 1KSIA 1JZDA 2H0HA 3AHSA 3OWSA 3PCRA 4FMBA 3UL6A 3EBTA 1BRKA 1A2VA 1N5PA 4STDA 1IQXA 2P0MA 4IT7A 1BGSA 1W2ZA 4HM1B 2GEYA 2Z7AA 3WR2A 3F7XA 5AEUB 1IDPA 3RGRA 3KZTA 3GWRA 4Q53A 4GL6A 3LOYA 4O2HA 1YI23 3KN4A 1QVG2 2O9UX 3FF2A 1A67A 2KAAA 2F86B 1LRAA 2FXTA 4XDWA 5M1AA 1R4CA 1O7NB 4XBYA 5GSPA 3ZFZA 3AGNA 2Z76A 2OOVA 1O7WB 5CF2A 1M904 3H51A 3NBRA 4N3VA 1FUWA 1TRPA 3E99A 3WOFB 4XBTA 1LXEA 2F98A 3X3YA 1QJGA 3S27A 1NB3I 3NM7A 4HZ9B 4ILFA 3CME3 4GB5A 2CIUA 1VQP3 1IVVA 4BTWA 1E3VA 3NBBA 2F99A 2XRXB 1BSBA 3EC9A 3VSYA 1Q7HA 1I3IA 3CCU3 1I0VA 1AY7A 2WO0A 4OUQA 1BNIA 1BNJA 4MEIA 3BNCA 5ELUA 3X41A 3CC23 3CCQ3 2C11A 4QWTA 3OW22 1YIT3 2BMQB 3G6E3 3EJVA 1JN5A 5BXQA 1R4YA 4LSOA 3LT9A 1SQWA 3LTAA 1SARA 4EYCA 3STDA 2GBXB 4KVHA 2OCTA 4HJLB 1HKXA 1NDOB 2Q07A 1DVCA 4HAAA 2CFGA 3BNEA 1I2FA 1JB2A 4N6MA 3MKIA 1RGCA 1EUIC 1V74A 2Z77A 3EN8A 4KFFA 5ELJA 3N8BA 3G8ZA 1RNTA 2SBLA 1RNBA 3D5IA 1FGTA 1LVNA 2IY2A 3F9SA 8CHOA 1NWWA 4XDVA 2W03A 4H3UA 3L0RA 3LT8A 5G1LA 3Q2PA 4WYKA 3K9MC 5M19A 1JKGB 3ER7A 2F4YA 1E3RA 1GD4A 3DH2A 2W56A 2WGQA 2YX9A 3VF1A 3CCM3 5IG5A 2CG0A 1DMQA 2CFDA 1GY6A 1JNQA 3GZXB 4OK0A 1U5OA 5KP3A 1RGAA 4WWUC 1YIJ3 2CX1A 2BMRB 1B2MA 2CKFB 2PZVA 1TFKA 4IIAA 3BNBA 1VQL3 1B2XA 2OOVC 1AVLA 1JZOA 3HK4A 3KCHA 4XBXA 4CDLA 2K0MA 4WFOA 1B21A 1O7HB 1NJI4 3ROBA 3WA3A 3G4S3 1S5AA 1HU9A 1KC84 6GSPA 4HM6B 1YJW3 1GY5A 2KCDA 4CJNA 1UCIA 4J8TA 3PS8A 1BRIA 1G0TA 3NX0A 5LC7A 1ASKA 1ZGXA 1W6YA 2XGLA 5CK6A 3CCR3 1BSCA 1JB4A 1B2UA 1IK3A 2IA7A 3MPHA 2K54A 1JBRA 2KF4A 3F8HA 3JUOA 2GXFA 1UCLA 4K1VA 3CPW2 5AIIA 4O02B 1QMAA 3CD63 4HOHA 1UI7A 1RHLA 1OH0A 2ML6A 3U1WA 3WA2X 1M1K4 1VQ53 1LNIA 1VQK3 4L8PA 2BMOB 2W2CA 1BRGA 1Q40A 2C10A 2D42A 4KT3B 2STDA 2RCDA 4I5QA 2O3OA 5AIFA 1CQSA 4NHFA 1JBSA 2BU4A 3CCL3 1BNSA 2GEXA 3BB9A 1QAKA 2INXA 5IG0A 4LGQA 1QVF2 3MSOA 2XR8B 1O7GB 4WP5A 4H61A 5M18A 1N9JA 1FYSA 3EN1B 3MG1A 2HMNB 4I4KA 1IVWA 1Q814 2XEPA 2RGQA 1VQO3 5BU4A 4NPBA 2WOHA 2P05A 1W01A 5STDA 1D6YA 1JBTA 1X1YA 3EBYA 3OXAA 1EKMA 1RGHA 4N6OB 3ZG0A 4BL3A 3LH4A 1GYBA 1YJN3 3X40A 1OF5A 1TTOA 4KFDA 4NREA 1Q9EA 3D9RA 3CCS3 3DGOA 2XF3A 2R41A 4FR9A 1VQ73 3NQZA 4N6UA 3BNDA 1SIHA 1UI8A 2FGTA 2H0GA 1RGEA 3O8YA 1N9EA 1SJWA 1RCLA 2C4BA 1TUHA 3CNXA 1VQ93 1RRHA 1BUQA 1VQ43 3QRDA 1KQS2 2YFIB 2LYXA 3EX9A 4BIRA 2MF7A 4BTYA 2V1LA 7RNTA 1GOUA 2JQ5A 3DZLA 3JUQA 4AKYA 1RN1A 5FW5A 3Q1CA 1MWUA 2ZA4A 1UCKA 4N6LA 2W56B 2P38A 2LQVA 3HIGA 1BSDA 4MMZB 3RNTA 5HOHA 3NBJA 3V92A 4FCZA 1I8VA 1DETA 1Y4KA 9RNTA 3V98A 1GMQA 3DXOA 1AR0A 1X1XA 2HMJB 3UNLA 1VQ83 4ZM8A 2BNGA 4JF8A 2GSPA 1O7PB 3FG4A 5G2GA 4EW5A 3SLUA 3LTDA 4FCMA 3FLJA 1GMPA 2CC3A 5RNTA 2XSOB 3RGAA 3WODG 2KF3A 2K3DA 4GSPA 3N54B 2IUKA 3NHXA 1I70A 2OTL3 1W7CA 1IV9A 2BT3A 2W9QA 2P0XA 1W4NA 1Z1SA 5LC6A 1JRQA 1SIIA 3T8NA 1K734 3SXXA 1N8QA 1OHSA 3LXUX 3UB1A 4EBGA 3DUKA 5EVHA 1CH0A 3GZYB 2OQEA 2BIRA 3KFQC 2J8XB 2CWTA 2ZL8A 1OF5B 1PU4A 5JPPA 1E97A 3S67A 1TIJA 3I0YA 4RNTA 3DM8A 4BTXA 3GSPA 1W2B2 1NO3A 4WYKB 5JBSA 1W02A 1RGGA 1LQMB 1G02A 2WOFA 3FCSB 3N9HA 4HZBB 1BRNL 3F40A 5DREA 3S5CA 1FGOA 1DE3A 2W9PA 1RSNA 1WMPA 2KF5A 1EQKA 2ML5A 1W6CA 1X1UA 3H3HA 1YGEA 4IPBA 4LYLB 1AVKA 4KFEA 4HKVB 3DGYA 4N6NB 1AQZA 4G1MB 1I2EA 2RSXA 2H0IA 5A0OB 1FA3A 1UUVB 3T8UA 3BU4A 3F8XA 7STDA 2HMOB 2RBIA 1MNLA 3HOHA 4TX4A 5G1KA 1BUJA 3G713 5EQLA 3FSDA 1BU4A 3EE1A 7GSPA 3D4AA 3FG3A 1BANA 2YFJB 3VGNA 1TJDA 1BIRA 3DMCA 1V58A 1BAOA 1V57A 1JN5B 1RGLA 2E2TA 3A5EA 3IMAB 1WMOA 1Q864 3DGMA 3B4PA 5IG3A 1STFI 3DGLA 4FCJA 2OWPA 3GZRA 1B3SA 1TU5A 1CEWI 4GHOA 1EA2A 1PYLA 2B24B 4J5GA 5KP4A 4HM2B 1YGWA 3SOAA 5IENA 1YHQ3 3I563 5HGRA 3D3LA 5TGNA 3OX9A 2CX0A 1GOVA 1UUWB 4OVMA 2GBWB 1VQM3 3Q90A 2IMJA 1BRSA 1VQ63 1FZUA 2HOHA 2KF6A 1OACA 1BNGA 1RJOA 3DY5A 3B4OA 6RNTA 3LTBA 5JPUA 5AYRB 1FGMA 2R4IA 4R80A 2CFLA 2XH9A 1YJ93 4DKIA 1HZ1A 1PY3A 3K7CA 1EEJA 4R4KA 5IF6A 1A90A 1WNHA 2CFKA 1TRQA 1FW7A 1DMMA 2W04A 4RZMA 1NU3A 1UGIA 1RGFA 3OV4A 3V99A 4EV2A 1YVSA 1U8CB 3D5GA 2XSHB 1C54A 4O3VA 3LTCA 3TDGA 2IYJA 3S29A 4CCVA 2QA43 2E2UA 3A76A 2P09A 4BL2A 2B1XB 1IVUA 2CWUA 2QEX3 1DVDA 3F14A 3JUPA 1I2GA 3X3ZA 4AEQA 4JRFA 4FMCA 3MYTA 1ULIB 5IG4A 2AADA 3SYUA 1RN4A 3PXMA 2D1WA 3K63A 3LMLA 3SEDA 1IYYA 1DMNA 2F5WA 3FKAA 1SPUA 5AIHA 1BNFA 2RFRA 1VQQA 1BOXA 1F8NA 4HM7B 3MWZA 1ZX2A 2CHCA 1UDII 3AMOA 4LZIA 1IT7A 1IV7A 3BLZA 2WGOA 1B2SA 1BSAA 1M1XB 3KIIA 3OWUA 4ORLA 4X2OA 1K28A 3Q3FA 2HMKB 1Q824 3CCE3 5AI1A 1ZS7A 1W5ZA 4KZ1A 3FG1A 1T2HA 1M9GA 2CK3H 1IQYA 4LEHA 5CLKA 3J7Yd 1I3FA 1T5YA 1OHOA 3LYGA 1RKYA 1TP6A 1GS3A 1PFPA 2XFSA 3CCV3 1BNRA 3KSED 3NM2A 1LOVA 1US1A 2XGNA 4HM0B 1RLSA 1OGXA 2UUGC 4RNYA 1W6GA 1A2PA 3NV0B 5EEOA 4PEJA 1RGKA 3MG3A 3GRDA 2CWVA 2W0QA 3NUVA 1RCKA 3T0UA 3CC73 5FGOA 1IU7A 1MWRA 3HX8A 2L1SA 3GAXA 4N6V0 1G96A 3PCSA 5CF1A 3HIIA 3UJMA 1UGHI 4EV5A 2FNQA 1KWIA 3PGBA 5D81A 4X2HA 1Q7Y4 4WHAA 3WHOA 4EC6A 1K9M4 4HBRA 3EF8A 2GU3A 1LOXA 4R9KA 1MWTA 1I0XA 3HI7A 1GOYA 3SOYA 4U13A 3BIRA 5AYSC 2QGUA 3DGNA 4R1KA 1BRJA 4MJDA 1WMNA 1GD3A 1JKGA 4N6TA 3RDEA 2W6JH 1IVXA 3FH1A 1CYUA 3KE7A 1STDA 1JB5A 1UCJA 1FGQA 1ZO2A 3CC43 1D6ZA 1WTHA 1ULJB 4HM3B 2CG1A 2PNCA 2SARA 3K0ZA 3M8CA 1KD14 8RNTA 1J2BA 2HMLB 2F5MA 4HM8B 5IEPA 2AAEA 3EB8A 3FZWA 3FF0A 1IT8A 2JDIH 3JUMA 3LZAA 4O8SA 5D83A 1LNHA 4LMIA 1ROVA 1BVIA 1X1WA 1OHPA 4FMDA 2IUJA 3EHCA 1FUTA 3HZPA 3U97A 3ECFA 4BU4A 1HYFA 3KKGA 3OWYA 3AGOA 1EG9B 1N5HA 4L8OA 1VQN3 3D79A 3SVAA 3IJEB 2CH9A 1CYVA 3JVCA 2BO9B 5AIGA 4XM4A 2HMMB 1S723 2ZHXB 4MMXB 6STDA 4MMYB 2KXGA 1MOLA 2MC8A 3AHWA 2I9WA 3QK9A 1RRLA 1JJ22 2F56A 3ZG5A 5AEWB 3WOEB 1GMRA 3FGYA 1LOYA 1DYUA 1MGRA 5IERA 1B20A 1ISKA 1W00A 2Y74A 3X3XA 2OQEC 3K5TA 3CCJ3 1B2ZA 2GU1A 4R9LA 2XFTA 1LOWA 1RN7A 1YNVX 4XB5A 1OUNA 1JV2B 2UGIA 4J9AA 3NQYA 4J5KA 2E2VA 1FGRA 4HYZA 1FUSA 5KP1A 1O7MB 3X42A 1LQGC 1L5GB 3MG2A 1B27A 1D6UA 5CXOA 2QIYA 4EXRA 2M7OA 3ALAA 2RNTA 3I553 1QALA 1Q40B 1UW1A 2Z6BA 2A15A 1QAFA 3B7CA 3CMA3 2BHMA 2Y73A 1MWSA 5DRVA 4K90B 1C7HA 1RDSA 5BVBA 3PZWA 1BNEA 1NB5I 1NNVA 4CPKA 1VZZA 1A2KA 3NV0A 3NXJA 5D82A 5IEOA 3WMDA 5BIRA 1K8A4 1BRHA 1K41A 3CU3A 1BSEA 3G0KA 1AV4A 1IQ8A 2OTJ3 1Q42A 3F7SA 4K61A 4FMAA 3S28A 3B8LA 3IPTA 3MHEA 1UUGB 2CFWA 2KRTA 1N8R4 1OPYA 2YFLB 1OCVA 4RBNA 3JUNA 4AKZA 1YVBI 1RMSA 3G16A 3CPOA 1ROAA 3EQQB 1GSPA 3URPA 3WDGB 2ZDJA 3KSPA 2UX0A 1RTUA 3AMOB 1T3BA 1WQLB 1MGWA 1GY7A 1T2IA 4HVNA 4RNZA 4L7KA 4HM4B
chains in the Genus database with same CATH topology
1RSNA 2KF5A 1BSCA 1B2UA 3WHOA 1X1UA 3AHSA 1I0XA 2KF4A 1GOYA 1JBRA 3BIRA 3DGYA 1UCLA 1BRKA 1AQZA 1I2EA 4HOHA 1BGSA 3BU4A 1BRJA 3WR2A 1RHLA 2RBIA 1LNIA 3HOHA 1BRGA 1UCJA 1BUJA 1BU4A 2KAAA 2SARA 3D4AA 7GSPA 2BU4A 1LRAA 8RNTA 1JBSA 1BANA 1BNSA 1BIRA 2F5MA 2AAEA 1BAOA 5GSPA 3A5EA 1RGLA 3AGNA 1FYSA 1TRPA 1BVIA 1X1WA 1B3SA 5BU4A 4GHOA 1FUTA 1PYLA 4J5GA 4BU4A 1HYFA 1YGWA 3AGOA 1JBTA 1X1YA 1RGHA 1GOVA 1BSBA 1TTOA 1I3IA 1Q9EA 1BRSA 1FZUA 1AY7A 1I0VA 2HOHA 2KF6A 6RNTA 1BNGA 1BNIA 1BNJA 3AHWA 1RGEA 1HZ1A 1PY3A 2F56A 1RCLA 2C4BA 1FW7A 1GMRA 1TRQA 1LOYA 1MGRA 1B20A 1R4YA 1RGFA 1YVSA 3D5GA 4BIRA 1C54A 1B2ZA 1SARA 7RNTA 1GOUA 1LOWA 1YNVX 4HAAA 1I2GA 1I2FA 1RN1A 4J5KA 2ZA4A 1UCKA 1RGCA 1FUSA 2AADA 3SYUA 1RN4A 1BSDA 1B27A 3RNTA 5HOHA 1IYYA 2F5WA 1I8VA 1RNTA 1RNBA 1DETA 3D5IA 9RNTA 1BNFA 2RNTA 1GMQA 1BOXA 1X1XA 2GSPA 1RDSA 1BNEA 2F4YA 1GMPA 3DH2A 1B2SA 1BSAA 5BIRA 5RNTA 3Q3FA 2KF3A 4GSPA 1BRHA 1I70A 1BSEA 1RGAA 1T2HA 1B2MA 1I3FA 1CH0A 1BNRA 2BIRA 1B2XA 1LOVA 1RLSA 3KCHA 1A2PA 1RMSA 1B21A 1RGKA 1GSPA 3URPA 4RNTA 3GSPA 1RCKA 6GSPA 1RTUA 1UCIA 1RGGA 1BRIA 1G02A 1MGWA 1T2IA 1BRNL 1DE3A 1ZGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSN A;  2KF5 A;  1BSC A;  1B2U A;  3WHO A;  1X1U A;  3AHS A;  1I0X A;  2KF4 A;  1GOY A;  1JBR A;  3BIR A;  3DGY A;  1UCL A;  1BRK A;  1AQZ A;  1I2E A;  4HOH A;  1BGS A;  3BU4 A;  1BRJ A;  3WR2 A;  1RHL A;  2RBI A;  1LNI A;  3HOH A;  1BRG A;  1UCJ A;  1BUJ A;  1BU4 A;  2KAA A;  2SAR A;  3D4A A;  7GSP A;  2BU4 A;  1LRA A;  8RNT A;  1JBS A;  1BAN A;  1BNS A;  1BIR A;  2F5M A;  2AAE A;  1BAO A;  5GSP A;  3A5E A;  1RGL A;  3AGN A;  1FYS A;  1TRP A;  1BVI A;  1X1W A;  1B3S A;  5BU4 A;  4GHO A;  1FUT A;  1PYL A;  4J5G A;  4BU4 A;  1HYF A;  1YGW A;  3AGO A;  1JBT A;  1X1Y A;  1RGH A;  1GOV A;  1BSB A;  1TTO A;  1I3I A;  1Q9E A;  1BRS A;  1FZU A;  1AY7 A;  1I0V A;  2HOH A;  2KF6 A;  6RNT A;  1BNG A;  1BNI A;  1BNJ A;  3AHW A;  1RGE A;  1HZ1 A;  1PY3 A;  2F56 A;  1RCL A;  2C4B A;  1FW7 A;  1GMR A;  1TRQ A;  1LOY A;  1MGR A;  1B20 A;  1R4Y A;  1RGF A;  1YVS A;  3D5G A;  4BIR A;  1C54 A;  1B2Z A;  1SAR A;  7RNT A;  1GOU A;  1LOW A;  1YNV X;  4HAA A;  1I2G A;  1I2F A;  1RN1 A;  4J5K A;  2ZA4 A;  1UCK A;  1RGC A;  1FUS A;  2AAD A;  3SYU A;  1RN4 A;  1BSD A;  1B27 A;  3RNT A;  5HOH A;  1IYY A;  2F5W A;  1I8V A;  1RNT A;  1RNB A;  1DET A;  3D5I A;  9RNT A;  1BNF A;  2RNT A;  1GMQ A;  1BOX A;  1X1X A;  2GSP A;  1RDS A;  1BNE A;  2F4Y A;  1GMP A;  3DH2 A;  1B2S A;  1BSA A;  5BIR A;  5RNT A;  3Q3F A;  2KF3 A;  4GSP A;  1BRH A;  1I70 A;  1BSE A;  1RGA A;  1T2H A;  1B2M A;  1I3F A;  1CH0 A;  1BNR A;  2BIR A;  1B2X A;  1LOV A;  1RLS A;  3KCH A;  1A2P A;  1RMS A;  1B21 A;  1RGK A;  1GSP A;  3URP A;  4RNT A;  3GSP A;  1RCK A;  6GSP A;  1RTU A;  1UCI A;  1RGG A;  1BRI A;  1G02 A;  1MGW A;  1T2I A;  1BRN L;  1DE3 A;  1ZGX A; 
#chains in the Genus database with same CATH topology
 3GZB A;  1TFO A;  2L4V A;  4K1U A;  3PYJ A;  5I97 A;  3CNM A;  1OGZ A;  2CW9 A;  3SX1 A;  4HM5 B;  5IW9 A;  3CXC 2;  3UL5 A;  1KSI A;  1JZD A;  2H0H A;  3AHS A;  3OWS A;  3PCR A;  4FMB A;  3UL6 A;  3EBT A;  1BRK A;  1A2V A;  1N5P A;  4STD A;  1IQX A;  2P0M A;  4IT7 A;  1BGS A;  1W2Z A;  4HM1 B;  2GEY A;  2Z7A A;  3WR2 A;  3F7X A;  5AEU B;  1IDP A;  3RGR A;  3KZT A;  3GWR A;  4Q53 A;  4GL6 A;  3LOY A;  4O2H A;  1YI2 3;  3KN4 A;  1QVG 2;  2O9U X;  3FF2 A;  1A67 A;  2KAA A;  2F86 B;  1LRA A;  2FXT A;  4XDW A;  5M1A A;  1R4C A;  1O7N B;  4XBY A;  5GSP A;  3ZFZ A;  3AGN A;  2Z76 A;  2OOV A;  1O7W B;  5CF2 A;  1M90 4;  3H51 A;  3NBR A;  4N3V A;  1FUW A;  1TRP A;  3E99 A;  3WOF B;  4XBT A;  1LXE A;  2F98 A;  3X3Y A;  1QJG A;  3S27 A;  1NB3 I;  3NM7 A;  4HZ9 B;  4ILF A;  3CME 3;  4GB5 A;  2CIU A;  1VQP 3;  1IVV A;  4BTW A;  1E3V A;  3NBB A;  2F99 A;  2XRX B;  1BSB A;  3EC9 A;  3VSY A;  1Q7H A;  1I3I A;  3CCU 3;  1I0V A;  1AY7 A;  2WO0 A;  4OUQ A;  1BNI A;  1BNJ A;  4MEI A;  3BNC A;  5ELU A;  3X41 A;  3CC2 3;  3CCQ 3;  2C11 A;  4QWT A;  3OW2 2;  1YIT 3;  2BMQ B;  3G6E 3;  3EJV A;  1JN5 A;  5BXQ A;  1R4Y A;  4LSO A;  3LT9 A;  1SQW A;  3LTA A;  1SAR A;  4EYC A;  3STD A;  2GBX B;  4KVH A;  2OCT A;  4HJL B;  1HKX A;  1NDO B;  2Q07 A;  1DVC A;  4HAA A;  2CFG A;  3BNE A;  1I2F A;  1JB2 A;  4N6M A;  3MKI A;  1RGC A;  1EUI C;  1V74 A;  2Z77 A;  3EN8 A;  4KFF A;  5ELJ A;  3N8B A;  3G8Z A;  1RNT A;  2SBL A;  1RNB A;  3D5I A;  1FGT A;  1LVN A;  2IY2 A;  3F9S A;  8CHO A;  1NWW A;  4XDV A;  2W03 A;  4H3U A;  3L0R A;  3LT8 A;  5G1L A;  3Q2P A;  4WYK A;  3K9M C;  5M19 A;  1JKG B;  3ER7 A;  2F4Y A;  1E3R A;  1GD4 A;  3DH2 A;  2W56 A;  2WGQ A;  2YX9 A;  3VF1 A;  3CCM 3;  5IG5 A;  2CG0 A;  1DMQ A;  2CFD A;  1GY6 A;  1JNQ A;  3GZX B;  4OK0 A;  1U5O A;  5KP3 A;  1RGA A;  4WWU C;  1YIJ 3;  2CX1 A;  2BMR B;  1B2M A;  2CKF B;  2PZV A;  1TFK A;  4IIA A;  3BNB A;  1VQL 3;  1B2X A;  2OOV C;  1AVL A;  1JZO A;  3HK4 A;  3KCH A;  4XBX A;  4CDL A;  2K0M A;  4WFO A;  1B21 A;  1O7H B;  1NJI 4;  3ROB A;  3WA3 A;  3G4S 3;  1S5A A;  1HU9 A;  1KC8 4;  6GSP A;  4HM6 B;  1YJW 3;  1GY5 A;  2KCD A;  4CJN A;  1UCI A;  4J8T A;  3PS8 A;  1BRI A;  1G0T A;  3NX0 A;  5LC7 A;  1ASK A;  1ZGX A;  1W6Y A;  2XGL A;  5CK6 A;  3CCR 3;  1BSC A;  1JB4 A;  1B2U A;  1IK3 A;  2IA7 A;  3MPH A;  2K54 A;  1JBR A;  2KF4 A;  3F8H A;  3JUO A;  2GXF A;  1UCL A;  4K1V A;  3CPW 2;  5AII A;  4O02 B;  1QMA A;  3CD6 3;  4HOH A;  1UI7 A;  1RHL A;  1OH0 A;  2ML6 A;  3U1W A;  3WA2 X;  1M1K 4;  1VQ5 3;  1LNI A;  1VQK 3;  4L8P A;  2BMO B;  2W2C A;  1BRG A;  1Q40 A;  2C10 A;  2D42 A;  4KT3 B;  2STD A;  2RCD A;  4I5Q A;  2O3O A;  5AIF A;  1CQS A;  4NHF A;  1JBS A;  2BU4 A;  3CCL 3;  1BNS A;  2GEX A;  3BB9 A;  1QAK A;  2INX A;  5IG0 A;  4LGQ A;  1QVF 2;  3MSO A;  2XR8 B;  1O7G B;  4WP5 A;  4H61 A;  5M18 A;  1N9J A;  1FYS A;  3EN1 B;  3MG1 A;  2HMN B;  4I4K A;  1IVW A;  1Q81 4;  2XEP A;  2RGQ A;  1VQO 3;  5BU4 A;  4NPB A;  2WOH A;  2P05 A;  1W01 A;  5STD A;  1D6Y A;  1JBT A;  1X1Y A;  3EBY A;  3OXA A;  1EKM A;  1RGH A;  4N6O B;  3ZG0 A;  4BL3 A;  3LH4 A;  1GYB A;  1YJN 3;  3X40 A;  1OF5 A;  1TTO A;  4KFD A;  4NRE A;  1Q9E A;  3D9R A;  3CCS 3;  3DGO A;  2XF3 A;  2R41 A;  4FR9 A;  1VQ7 3;  3NQZ A;  4N6U A;  3BND A;  1SIH A;  1UI8 A;  2FGT A;  2H0G A;  1RGE A;  3O8Y A;  1N9E A;  1SJW A;  1RCL A;  2C4B A;  1TUH A;  3CNX A;  1VQ9 3;  1RRH A;  1BUQ A;  1VQ4 3;  3QRD A;  1KQS 2;  2YFI B;  2LYX A;  3EX9 A;  4BIR A;  2MF7 A;  4BTY A;  2V1L A;  7RNT A;  1GOU A;  2JQ5 A;  3DZL A;  3JUQ A;  4AKY A;  1RN1 A;  5FW5 A;  3Q1C A;  1MWU A;  2ZA4 A;  1UCK A;  4N6L A;  2W56 B;  2P38 A;  2LQV A;  3HIG A;  1BSD A;  4MMZ B;  3RNT A;  5HOH A;  3NBJ A;  3V92 A;  4FCZ A;  1I8V A;  1DET A;  1Y4K A;  9RNT A;  3V98 A;  1GMQ A;  3DXO A;  1AR0 A;  1X1X A;  2HMJ B;  3UNL A;  1VQ8 3;  4ZM8 A;  2BNG A;  4JF8 A;  2GSP A;  1O7P B;  3FG4 A;  5G2G A;  4EW5 A;  3SLU A;  3LTD A;  4FCM A;  3FLJ A;  1GMP A;  2CC3 A;  5RNT A;  2XSO B;  3RGA A;  3WOD G;  2KF3 A;  2K3D A;  4GSP A;  3N54 B;  2IUK A;  3NHX A;  1I70 A;  2OTL 3;  1W7C A;  1IV9 A;  2BT3 A;  2W9Q A;  2P0X A;  1W4N A;  1Z1S A;  5LC6 A;  1JRQ A;  1SII A;  3T8N A;  1K73 4;  3SXX A;  1N8Q A;  1OHS A;  3LXU X;  3UB1 A;  4EBG A;  3DUK A;  5EVH A;  1CH0 A;  3GZY B;  2OQE A;  2BIR A;  3KFQ C;  2J8X B;  2CWT A;  2ZL8 A;  1OF5 B;  1PU4 A;  5JPP A;  1E97 A;  3S67 A;  1TIJ A;  3I0Y A;  4RNT A;  3DM8 A;  4BTX A;  3GSP A;  1W2B 2;  1NO3 A;  4WYK B;  5JBS A;  1W02 A;  1RGG A;  1LQM B;  1G02 A;  2WOF A;  3FCS B;  3N9H A;  4HZB B;  1BRN L;  3F40 A;  5DRE A;  3S5C A;  1FGO A;  1DE3 A;  2W9P A;  1RSN A;  1WMP A;  2KF5 A;  1EQK A;  2ML5 A;  1W6C A;  1X1U A;  3H3H A;  1YGE A;  4IPB A;  4LYL B;  1AVK A;  4KFE A;  4HKV B;  3DGY A;  4N6N B;  1AQZ A;  4G1M B;  1I2E A;  2RSX A;  2H0I A;  5A0O B;  1FA3 A;  1UUV B;  3T8U A;  3BU4 A;  3F8X A;  7STD A;  2HMO B;  2RBI A;  1MNL A;  3HOH A;  4TX4 A;  5G1K A;  1BUJ A;  3G71 3;  5EQL A;  3FSD A;  1BU4 A;  3EE1 A;  7GSP A;  3D4A A;  3FG3 A;  1BAN A;  2YFJ B;  3VGN A;  1TJD A;  1BIR A;  3DMC A;  1V58 A;  1BAO A;  1V57 A;  1JN5 B;  1RGL A;  2E2T A;  3A5E A;  3IMA B;  1WMO A;  1Q86 4;  3DGM A;  3B4P A;  5IG3 A;  1STF I;  3DGL A;  4FCJ A;  2OWP A;  3GZR A;  1B3S A;  1TU5 A;  1CEW I;  4GHO A;  1EA2 A;  1PYL A;  2B24 B;  4J5G A;  5KP4 A;  4HM2 B;  1YGW A;  3SOA A;  5IEN A;  1YHQ 3;  3I56 3;  5HGR A;  3D3L A;  5TGN A;  3OX9 A;  2CX0 A;  1GOV A;  1UUW B;  4OVM A;  2GBW B;  1VQM 3;  3Q90 A;  2IMJ A;  1BRS A;  1VQ6 3;  1FZU A;  2HOH A;  2KF6 A;  1OAC A;  1BNG A;  1RJO A;  3DY5 A;  3B4O A;  6RNT A;  3LTB A;  5JPU A;  5AYR B;  1FGM A;  2R4I A;  4R80 A;  2CFL A;  2XH9 A;  1YJ9 3;  4DKI A;  1HZ1 A;  1PY3 A;  3K7C A;  1EEJ A;  4R4K A;  5IF6 A;  1A90 A;  1WNH A;  2CFK A;  1TRQ A;  1FW7 A;  1DMM A;  2W04 A;  4RZM A;  1NU3 A;  1UGI A;  1RGF A;  3OV4 A;  3V99 A;  4EV2 A;  1YVS A;  1U8C B;  3D5G A;  2XSH B;  1C54 A;  4O3V A;  3LTC A;  3TDG A;  2IYJ A;  3S29 A;  4CCV A;  2QA4 3;  2E2U A;  3A76 A;  2P09 A;  4BL2 A;  2B1X B;  1IVU A;  2CWU A;  2QEX 3;  1DVD A;  3F14 A;  3JUP A;  1I2G A;  3X3Z A;  4AEQ A;  4JRF A;  4FMC A;  3MYT A;  1ULI B;  5IG4 A;  2AAD A;  3SYU A;  1RN4 A;  3PXM A;  2D1W A;  3K63 A;  3LML A;  3SED A;  1IYY A;  1DMN A;  2F5W A;  3FKA A;  1SPU A;  5AIH A;  1BNF A;  2RFR A;  1VQQ A;  1BOX A;  1F8N A;  4HM7 B;  3MWZ A;  1ZX2 A;  2CHC A;  1UDI I;  3AMO A;  4LZI A;  1IT7 A;  1IV7 A;  3BLZ A;  2WGO A;  1B2S A;  1BSA A;  1M1X B;  3KII A;  3OWU A;  4ORL A;  4X2O A;  1K28 A;  3Q3F A;  2HMK B;  1Q82 4;  3CCE 3;  5AI1 A;  1ZS7 A;  1W5Z A;  4KZ1 A;  3FG1 A;  1T2H A;  1M9G A;  2CK3 H;  1IQY A;  4LEH A;  5CLK A;  3J7Y d;  1I3F A;  1T5Y A;  1OHO A;  3LYG A;  1RKY A;  1TP6 A;  1GS3 A;  1PFP A;  2XFS A;  3CCV 3;  1BNR A;  3KSE D;  3NM2 A;  1LOV A;  1US1 A;  2XGN A;  4HM0 B;  1RLS A;  1OGX A;  2UUG C;  4RNY A;  1W6G A;  1A2P A;  3NV0 B;  5EEO A;  4PEJ A;  1RGK A;  3MG3 A;  3GRD A;  2CWV A;  2W0Q A;  3NUV A;  1RCK A;  3T0U A;  3CC7 3;  5FGO A;  1IU7 A;  1MWR A;  3HX8 A;  2L1S A;  3GAX A;  4N6V 0;  1G96 A;  3PCS A;  5CF1 A;  3HII A;  3UJM A;  1UGH I;  4EV5 A;  2FNQ A;  1KWI A;  3PGB A;  5D81 A;  4X2H A;  1Q7Y 4;  4WHA A;  3WHO A;  4EC6 A;  1K9M 4;  4HBR A;  3EF8 A;  2GU3 A;  1LOX A;  4R9K A;  1MWT A;  1I0X A;  3HI7 A;  1GOY A;  3SOY A;  4U13 A;  3BIR A;  5AYS C;  2QGU A;  3DGN A;  4R1K A;  1BRJ A;  4MJD A;  1WMN A;  1GD3 A;  1JKG A;  4N6T A;  3RDE A;  2W6J H;  1IVX A;  3FH1 A;  1CYU A;  3KE7 A;  1STD A;  1JB5 A;  1UCJ A;  1FGQ A;  1ZO2 A;  3CC4 3;  1D6Z A;  1WTH A;  1ULJ B;  4HM3 B;  2CG1 A;  2PNC A;  2SAR A;  3K0Z A;  3M8C A;  1KD1 4;  8RNT A;  1J2B A;  2HML B;  2F5M A;  4HM8 B;  5IEP A;  2AAE A;  3EB8 A;  3FZW A;  3FF0 A;  1IT8 A;  2JDI H;  3JUM A;  3LZA A;  4O8S A;  5D83 A;  1LNH A;  4LMI A;  1ROV A;  1BVI A;  1X1W A;  1OHP A;  4FMD A;  2IUJ A;  3EHC A;  1FUT A;  3HZP A;  3U97 A;  3ECF A;  4BU4 A;  1HYF A;  3KKG A;  3OWY A;  3AGO A;  1EG9 B;  1N5H A;  4L8O A;  1VQN 3;  3D79 A;  3SVA A;  3IJE B;  2CH9 A;  1CYV A;  3JVC A;  2BO9 B;  5AIG A;  4XM4 A;  2HMM B;  1S72 3;  2ZHX B;  4MMX B;  6STD A;  4MMY B;  2KXG A;  1MOL A;  2MC8 A;  3AHW A;  2I9W A;  3QK9 A;  1RRL A;  1JJ2 2;  2F56 A;  3ZG5 A;  5AEW B;  3WOE B;  1GMR A;  3FGY A;  1LOY A;  1DYU A;  1MGR A;  5IER A;  1B20 A;  1ISK A;  1W00 A;  2Y74 A;  3X3X A;  2OQE C;  3K5T A;  3CCJ 3;  1B2Z A;  2GU1 A;  4R9L A;  2XFT A;  1LOW A;  1RN7 A;  1YNV X;  4XB5 A;  1OUN A;  1JV2 B;  2UGI A;  4J9A A;  3NQY A;  4J5K A;  2E2V A;  1FGR A;  4HYZ A;  1FUS A;  5KP1 A;  1O7M B;  3X42 A;  1LQG C;  1L5G B;  3MG2 A;  1B27 A;  1D6U A;  5CXO A;  2QIY A;  4EXR A;  2M7O A;  3ALA A;  2RNT A;  3I55 3;  1QAL A;  1Q40 B;  1UW1 A;  2Z6B A;  2A15 A;  1QAF A;  3B7C A;  3CMA 3;  2BHM A;  2Y73 A;  1MWS A;  5DRV A;  4K90 B;  1C7H A;  1RDS A;  5BVB A;  3PZW A;  1BNE A;  1NB5 I;  1NNV A;  4CPK A;  1VZZ A;  1A2K A;  3NV0 A;  3NXJ A;  5D82 A;  5IEO A;  3WMD A;  5BIR A;  1K8A 4;  1BRH A;  1K41 A;  3CU3 A;  1BSE A;  3G0K A;  1AV4 A;  1IQ8 A;  2OTJ 3;  1Q42 A;  3F7S A;  4K61 A;  4FMA A;  3S28 A;  3B8L A;  3IPT A;  3MHE A;  1UUG B;  2CFW A;  2KRT A;  1N8R 4;  1OPY A;  2YFL B;  1OCV A;  4RBN A;  3JUN A;  4AKZ A;  1YVB I;  1RMS A;  3G16 A;  3CPO A;  1ROA A;  3EQQ B;  1GSP A;  3URP A;  3WDG B;  2ZDJ A;  3KSP A;  2UX0 A;  1RTU A;  3AMO B;  1T3B A;  1WQL B;  1MGW A;  1GY7 A;  1T2I A;  4HVN A;  4RNZ A;  4L7K A;  4HM4 B; 
#chains in the Genus database with same CATH homology
 1RSN A;  2KF5 A;  1BSC A;  1B2U A;  3WHO A;  1X1U A;  3AHS A;  1I0X A;  2KF4 A;  1GOY A;  1JBR A;  3BIR A;  3DGY A;  1UCL A;  1BRK A;  1AQZ A;  1I2E A;  4HOH A;  1BGS A;  3BU4 A;  1BRJ A;  3WR2 A;  1RHL A;  2RBI A;  1LNI A;  3HOH A;  1BRG A;  1UCJ A;  1BUJ A;  1BU4 A;  2KAA A;  2SAR A;  3D4A A;  7GSP A;  2BU4 A;  1LRA A;  8RNT A;  1JBS A;  1BAN A;  1BNS A;  1BIR A;  2F5M A;  2AAE A;  1BAO A;  5GSP A;  3A5E A;  1RGL A;  3AGN A;  1FYS A;  1TRP A;  1BVI A;  1X1W A;  1B3S A;  5BU4 A;  4GHO A;  1FUT A;  1PYL A;  4J5G A;  4BU4 A;  1HYF A;  1YGW A;  3AGO A;  1JBT A;  1X1Y A;  1RGH A;  1GOV A;  1BSB A;  1TTO A;  1I3I A;  1Q9E A;  1BRS A;  1FZU A;  1AY7 A;  1I0V A;  2HOH A;  2KF6 A;  6RNT A;  1BNG A;  1BNI A;  1BNJ A;  3AHW A;  1RGE A;  1HZ1 A;  1PY3 A;  2F56 A;  1RCL A;  2C4B A;  1FW7 A;  1GMR A;  1TRQ A;  1LOY A;  1MGR A;  1B20 A;  1R4Y A;  1RGF A;  1YVS A;  3D5G A;  4BIR A;  1C54 A;  1B2Z A;  1SAR A;  7RNT A;  1GOU A;  1LOW A;  1YNV X;  4HAA A;  1I2G A;  1I2F A;  1RN1 A;  4J5K A;  2ZA4 A;  1UCK A;  1RGC A;  1FUS A;  2AAD A;  3SYU A;  1RN4 A;  1BSD A;  1B27 A;  3RNT A;  5HOH A;  1IYY A;  2F5W A;  1I8V A;  1RNT A;  1RNB A;  1DET A;  3D5I A;  9RNT A;  1BNF A;  2RNT A;  1GMQ A;  1BOX A;  1X1X A;  2GSP A;  1RDS A;  1BNE A;  2F4Y A;  1GMP A;  3DH2 A;  1B2S A;  1BSA A;  5BIR A;  5RNT A;  3Q3F A;  2KF3 A;  4GSP A;  1BRH A;  1I70 A;  1BSE A;  1RGA A;  1T2H A;  1B2M A;  1I3F A;  1CH0 A;  1BNR A;  2BIR A;  1B2X A;  1LOV A;  1RLS A;  3KCH A;  1A2P A;  1RMS A;  1B21 A;  1RGK A;  1GSP A;  3URP A;  4RNT A;  3GSP A;  1RCK A;  6GSP A;  1RTU A;  1UCI A;  1RGG A;  1BRI A;  1G02 A;  1MGW A;  1T2I A;  1BRN L;  1DE3 A;  1ZGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...