1BRIA

Barnase mutant with ile 76 replaced by ala
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
INTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADANYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 33
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1briA00
1RSNA 1BNSA 1I2GA 1I3IA 1BRKA 4J5KA 6GSPA 3WHOA 1FW7A 4BIRA 1FUTA 1X1WA 1BSDA 4HAAA 3Q3FA 1B20A 1BIRA 3SYUA 2F5WA 1BNRA 6RNTA 1RGAA 4RNTA 1ZGXA 1BRGA 2F4YA 1G02A 2KF3A 1RGGA 2GSPA 1GMPA 1I2FA 1I0XA 1PY3A 1BSEA 1HYFA 1T2IA 1PYLA 4BU4A 1UCKA 1X1YA 5HOHA 4GSPA 1DE3A 1BNFA 3DH2A 1AY7A 1LRAA 1UCJA 2HOHA 1A2PA 1YGWA 1R4YA 1BNEA 1AQZA 1GOUA 1BAOA 2AADA 3D5GA 3AGOA 1RGFA 1Q9EA 1RTUA 1RN1A 3HOHA 1RCKA 1BU4A 1RCLA 1BNGA 3A5EA 1JBRA 1B2XA 1FZUA 1B21A 1I0VA 1LOYA 1SARA 1I2EA 1X1UA 2RNTA 1BNJA 3WR2A 3BIRA 1BRIA 7GSPA 1YNVX 4HOHA 1BRHA 2ZA4A 1FUSA 7RNTA 2KF6A 3D4AA 3URPA 2AAEA 1BOXA 1DETA 1I70A 1LOWA 1MGRA 9RNTA 1RN4A 1B2UA 3GSPA 1TRPA 1LNIA 2KF4A 1BSCA 1JBTA 1BUJA 3RNTA 1RLSA 4J5GA 1C54A 1I8VA 3BU4A 1TTOA 1RNTA 2F56A 1JBSA 1B27A 1RHLA 2BU4A 1RGCA 1BSAA 1MGWA 1IYYA 1UCLA 1FYSA 2RBIA 5GSPA 1I3FA 1BNIA 2F5MA 1BRSA 1BSBA 1RDSA 3AHWA 2SARA 3KCHA 1LOVA 5BU4A 1CH0A 1GOYA 1X1XA 1B2MA 1GSPA 2KAAA 1T2HA 1GMRA 4GHOA 1TRQA 1RMSA 5BIRA 1B2ZA 1RNBA 2KF5A 3DGYA 1B2SA 3AHSA 1BRNL 1B3SA 5RNTA 3D5IA 3AGNA 2C4BA 2BIRA 1HZ1A 1RGLA 1BVIA 1RGEA 1RGKA 8RNTA 1UCIA 1RGHA 1BANA 1YVSA 1BRJA 1GOVA 1GMQA 1BGSA
chains in the Genus database with same CATH superfamily
1RSNA 1I3IA 1O7MB 5FGOA 3WHOA 5CXOA 5IF6A 3DGNA 3PCSA 4WFOA 1O7WB 3NUVA 2OWPA 2P0XA 4HAAA 1TJDA 3WMDA 4ILFA 2QEX3 3T8NA 2Z6BA 3Q3FA 1B20A 1OCVA 4HM5B 1VQM3 3S67A 2F5WA 3MYTA 1RGAA 3I553 1FA3A 1UUVB 5IEPA 1ZGXA 3LTCA 1BRGA 3NM2A 5IG5A 1KC84 1G02A 2KF3A 3PGBA 1ZX2A 2XH9A 3PCRA 1R4CA 1TUHA 4KFDA 3N8BA 2KRTA 1IQ8A 3QK9A 4NHFA 1EG9B 1KSIA 4HBRA 2JQ5A 3SOAA 4GSPA 4I5QA 3U1WA 1BNFA 3SEDA 1AY7A 3MPHA 1A2PA 1YGWA 2XGLA 1QALA 2XRXB 2W2CA 1AQZA 1WTHA 1YGEA 2AADA 3KN4A 3OWSA 2CX1A 2B24B 4N6LA 1YIJ3 3EBYA 3LOYA 2GEXA 3CCM3 8CHOA 3B7CA 5FW5A 1MWRA 3HOHA 1GY6A 2QIYA 3GWRA 3A5EA 3FZWA 2BMOB 2IUJA 3LTDA 4U13A 4HJLB 1B2XA 1W7CA 1JKGA 4XBXA 1B21A 2CKFB 3PS8A 1D6ZA 3H3HA 2B1XB 1CEWI 1S723 1X1UA 1A90A 1BNJA 4EC6A 1NB3I 4FMCA 3BIRA 2L1SA 1T5YA 7GSPA 1YNVX 2CG0A 1YJW3 2ZA4A 1RRHA 3F7SA 1FUSA 3JVCA 4WYKB 2HMMB 1V57A 4NPBA 1Q42A 2WGOA 4EBGA 1DVDA 1NDOB 2E2VA 3URPA 2UGIA 4LGQA 2AAEA 3RGAA 2BNGA 1JN5A 1LOWA 1LXEA 9RNTA 2BMRB 2H0GA 1GY7A 2RGQA 4IT7A 1B2UA 5ELJA 3L0RA 1J2BA 2BT3A 1LNIA 3MG3A 3DY5A 4HM7B 1IVXA 2YX9A 4XB5A 3LYGA 4BL2A 1JZOA 1VZZA 3NHXA 1RLSA 4PEJA 1C54A 2OQEC 1K28A 1Q814 2Y73A 1I8VA 1NU3A 2WOHA 2UUGC 3LT8A 2P0MA 1JV2B 1RNTA 2IYJA 3LZAA 3MKIA 2LYXA 4FCZA 3VGNA 1JBSA 1RHLA 1WQLB 2L4VA 1HKXA 3UL6A 3BNEA 1Y4KA 1C7HA 3CCL3 1N8R4 1CYUA 4K1VA 3JUNA 3ALAA 3DGOA 3E99A 1JB4A 3PYJA 3EX9A 4OK0A 5LC6A 3AHWA 1FGOA 5DRVA 1LQMB 1TIJA 1CH0A 2CG1A 3S27A 3FF2A 2MF7A 4KZ1A 2CH9A 2RFRA 3SVAA 4GHOA 5AYSC 4G1MB 4MMZB 3HK4A 2BMQB 3SLUA 2CFGA 1RNBA 1IVUA 4IIAA 5JPUA 1Q864 1N8QA 3CXC2 1BRNL 3EQQB 2F86B 1MWTA 5JPPA 1MWSA 2D42A 3AGNA 4FR9A 5IG0A 1N9JA 1HZ1A 3A76A 2R4IA 1BVIA 3IPTA 4LEHA 3UJMA 1GYBA 1MWUA 1RGHA 3EN1B 3HX8A 1BRJA 2HMKB 3GZXB 2QA43 1BNSA 1IQYA 3MHEA 4J5KA 3LXUX 3FKAA 1FW7A 1IDPA 2XFSA 4CDLA 2PNCA 5I97A 1BSDA 2FGTA 2H0IA 2GEYA 2Y74A 3X40A 1BIRA 1UW1A 4IPBA 4MEIA 3G8ZA 5G2GA 6RNTA 1ISKA 3VSYA 4RNTA 5IEOA 2QGUA 2Z76A 3K5TA 1I2FA 3G16A 1PY3A 1BSEA 1HYFA 1W01A 5CF2A 1PYLA 4BU4A 1UCKA 1OF5A 3CU3A 4HKVB 4R80A 1K734 1DE3A 1YI23 3FCSB 5IG4A 1UCJA 2GU1A 2XEPA 2O3OA 2CWUA 1GD4A 1OGXA 2HOHA 1FUWA 5BXQA 2OOVA 1R4YA 3I0YA 1QVG2 3PZWA 1GOUA 1VQL3 1EEJA 1OF5B 3D5GA 1YVBI 2FXTA 4R9KA 1D6UA 1G0TA 3EN8A 3JUOA 3K0ZA 3NXJA 1Q7Y4 1RCKA 1BU4A 3OWYA 1GY5A 3CCU3 3UB1A 2ML5A 1NJI4 3EF8A 1I0VA 1DMNA 5DREA 5AI1A 1EKMA 2E2UA 1OACA 1IU7A 2CFDA 2RNTA 3Q2PA 5CLKA 2MC8A 3X42A 2IUKA 1EUIC 3B8LA 2E2TA 1VQO3 2IY2A 1UI8A 2F98A 3WODG 1TP6A 2W6JH 4K1UA 4BTXA 3F7XA 2C10A 1DETA 1I70A 3DM8A 3AMOA 1QJGA 1AV4A 2XSHB 1QAKA 5D82A 1UGIA 3FGYA 1KQS2 2P09A 2KF4A 3V98A 1JBTA 2D1WA 1BUJA 2SBLA 3CC43 4O8SA 4RBNA 3FG3A 3LT9A 4BTYA 1S5AA 1W6GA 4I4KA 5LC7A 3AMOB 2CHCA 4WYKA 2ZL8A 1W6CA 5AIFA 3KSPA 2ML6A 3WOFB 2GXFA 1JJ22 1RGCA 1MGWA 3K9MC 3NM7A 4HVNA 4N6OB 1YHQ3 1LOXA 5EEOA 5IENA 2JDIH 2W56B 5AIGA 5GSPA 2W03A 3N54B 2F5MA 4FCMA 5TGNA 1GS3A 3KCHA 1DYUA 1W00A 3RGRA 2XFTA 1B2MA 3Q1CA 1AVKA 1V74A 1W02A 2KAAA 3EHCA 3DGLA 3U97A 1RMSA 3LH4A 3FF0A 3DUKA 5M19A 3GZBA 3AHSA 4EV2A 4N3VA 3ZG5A 5AEWB 5RNTA 3D5IA 1RGEA 4WP5A 4HM6B 3CCQ3 5JBSA 1Q7HA 1UCIA 1VQQA 2CC3A 2PZVA 2W0QA 1IT8A 1YVSA 3LMLA 3RDEA 4FMBA 1GOVA 2CX0A 1IK3A 3J7Yd 6GSPA 3FG1A 1IVWA 3KE7A 1BRKA 3EB8A 1Q40A 1L5GB 3CCS3 3CCE3 1LQGC 4J9AA 4WHAA 1NNVA 3OX9A 4BIRA 1FUTA 1OHSA 1X1WA 2YFLB 1W2B2 1FGQA 1STFI 3B4OA 4MJDA 3NBJA 2OQEA 4HM3B 1WMOA 1Q40B 3BB9A 3FSDA 5M18A 1BNRA 3S28A 4O2HA 3EC9A 4EXRA 2LQVA 3KFQC 1G96A 2F4YA 1T3BA 3CNMA 1GMPA 1I0XA 4K90B 4DKIA 5M1AA 4QWTA 3G6E3 1T2IA 3X3ZA 4HM2B 2HMLB 1X1YA 5HOHA 1Z1SA 3DH2A 3ECFA 1EA2A 2A15A 4FMDA 2GU3A 1YIT3 3JUPA 1LRAA 3G713 4HYZA 1IVVA 4K61A 3D3LA 4RNZA 5G1LA 4EYCA 1VQN3 6STDA 2IMJA 3KSED 3MG2A 3JUQA 4LYLB 1W4NA 1JZDA 1N9EA 1IQXA 3GRDA 1OUNA 3G4S3 2K54A 1RGFA 3CCR3 1QVF2 1K9M4 1UUGB 3CNXA 2GBWB 1IV9A 5IW9A 2XSOB 3K63A 1JRQA 1ROAA 5AIHA 4H3UA 1VQK3 1A2KA 3OW22 2Q07A 1DMQA 1JBRA 4HM4B 3B4PA 4O02B 3V99A 1NO3A 1FZUA 4OVMA 1LOYA 1QMAA 1M904 1M9GA 1UI7A 1I2EA 2P05A 1O7NB 3UL5A 3WR2A 1LNHA 3EBTA 1GD3A 1W6YA 3F8HA 1CYVA 1BRHA 1VQ83 3V92A 2KF6A 3D4AA 4BTWA 3NQYA 3CCV3 3NBBA 4L7KA 1BOXA 2RSXA 3GAXA 4KVHA 3N9HA 2W9PA 2Z7AA 3BNDA 3GSPA 1TRPA 1US1A 2BHMA 3G0KA 1UUWB 4STDA 1STDA 4CJNA 4JRFA 4J5GA 3LTBA 3X41A 1WMNA 1N5HA 4FMAA 3K7CA 3MG1A 2UX0A 4N6TA 4Q53A 3BU4A 5A0OB 1V58A 2F56A 2WGQA 3CPW2 4AKZA 1O7GB 3WA2X 1B27A 3CPOA 1M1XB 1IYYA 1FYSA 2RBIA 1MOLA 3IMAB 3F8XA 4HM1B 3BLZA 3HI7A 3ZFZA 1UGHI 2STDA 5G1KA 3DMCA 4OUQA 5ELUA 1SJWA 2RCDA 5EVHA 3VF1A 7STDA 3HIIA 2SARA 2H0HA 2HMNB 1TFKA 1KD14 5KP1A 1GOYA 1X1XA 2XR8B 3ZG0A 1GSPA 1PU4A 1T2HA 2WO0A 3JUMA 1GMRA 3KIIA 4XBTA 1TRQA 3TDGA 5BIRA 4KFEA 3NQZA 4RNYA 2KF5A 3DGYA 5CF1A 1NB5I 4HZ9B 1OHOA 1VQ53 4GL6A 2W56A 4L8OA 4HZBB 5AEUB 3HZPA 1WMPA 2C4BA 4JF8A 4TX4A 2BIRA 2CIUA 1RGLA 1A67A 1BUQA 3DZLA 3BNBA 2FNQA 8RNTA 1N5PA 4R4KA 1AR0A 1BANA 1K8A4 5AYRB 1GMQA 1BGSA 3CC73 1I2GA 2OTJ3 4EV5A 2ZDJA 1DVCA 4EW5A 1NWWA 1IV7A 1SPUA 4KFFA 4R9LA 2W9QA 4KT3B 3FG4A 3Q90A 3STDA 3F40A 2KXGA 2P38A 1YJ93 4CPKA 3WOEB 3CCJ3 1SIIA 2Z77A 3SYUA 3LTAA 3M8CA 3S5CA 3KZTA 4N6UA 2CWVA 1VQ73 2XF3A 4CCVA 1RGGA 2GSPA 4LZIA 4N6V0 1A2VA 2YFJB 1OH0A 3MSOA 4N6NB 1KWIA 3WA3A 4HM0B 1U5OA 4RZMA 3O8YA 4HM8B 4ORLA 1JKGB 3OV4A 4GB5A 2OCTA 1OGZA 4LMIA 4AKYA 1BNEA 1RKYA 1IT7A 1BAOA 1RRLA 2GBXB 3AGOA 3OWUA 3PXMA 2CFWA 1TFOA 2CFKA 1Q9EA 4J8TA 5EQLA 1RTUA 1M1K4 1RN1A 1Q824 1RJOA 1RCLA 1BNGA 1DMMA 3D79A 1EQKA 2HMJB 1JN5B 4WWUC 4AEQA 4FCJA 5KP4A 1D6YA 3MWZA 1JB5A 1O7HB 1JNQA 3F9SA 4X2HA 3CC23 1SARA 2CK3H 2OTL3 5D83A 1ZS7A 4R1KA 1E3RA 3EJVA 2CW9A 1BRIA 2YFIB 3HIGA 4HOHA 1OHPA 3S29A 3DXOA 4MMXB 1W2ZA 3H51A 7RNTA 3IJEB 2IA7A 4X2OA 3ROBA 3T0UA 3OXAA 1FGMA 1W5ZA 2F99A 2INXA 1U8CB 4XM4A 1MGRA 2I9WA 3KKGA 3QRDA 5CK6A 1ULJB 1MNLA 1OPYA 1RN4A 2XGNA 5STDA 3CMA3 5AIIA 2CWTA 1BSCA 3NX0A 1E3VA 2K3DA 4XDVA 3RNTA 1CQSA 3SX1A 2W04A 1K41A 3I563 3FLJA 2R41A 1F8NA 3UNLA 4XDWA 1TTOA 2WOFA 2C11A 3ER7A 1SQWA 5BVBA 5IG3A 2KCDA 1FGRA 1ASKA 2BU4A 3SOYA 1BSAA 2V1LA 2J8XB 3D9RA 3SXXA 3CME3 1ROVA 1AVLA 1E97A 1UCLA 4XBYA 1TU5A 1HU9A 1FGTA 3T8UA 1I3FA 1BNIA 2HMOB 1RN7A 3NV0A 1BRSA 3GZYB 3CD63 1BSBA 1RDSA 2CFLA 5IERA 3F14A 1LOVA 3X3YA 3GZRA 3DGMA 2OOVC 3WDGB 5BU4A 1YJN3 2O9UX 2BO9B 3X3XA 4BL3A 3NV0B 1ULIB 1PFPA 1VQ43 1SIHA 5D81A 1QAFA 1WNHA 1JB2A 1B2ZA 3EE1A 4MMYB 4N6MA 1B2SA 3BNCA 4NREA 1O7PB 4O3VA 1B3SA 1VQ63 5HGRA 2M7OA 1UDII 5KP3A 3FH1A 2ZHXB 1LVNA 1RGKA 2K0MA 1VQP3 4H61A 4ZM8A 1ZO2A 4L8PA 3NBRA 4LSOA 1VQ93
chains in the Genus database with same CATH topology
1RSNA 1BNSA 1I2GA 1I3IA 1BRKA 4J5KA 6GSPA 3WHOA 1FW7A 4BIRA 1FUTA 1X1WA 1BSDA 4HAAA 3Q3FA 1B20A 1BIRA 3SYUA 2F5WA 1BNRA 6RNTA 1RGAA 4RNTA 1ZGXA 1BRGA 2F4YA 1G02A 2KF3A 1RGGA 2GSPA 1GMPA 1I2FA 1I0XA 1PY3A 1BSEA 1HYFA 1T2IA 1PYLA 4BU4A 1UCKA 1X1YA 5HOHA 4GSPA 1DE3A 1BNFA 3DH2A 1AY7A 1LRAA 1UCJA 2HOHA 1A2PA 1YGWA 1R4YA 1BNEA 1AQZA 1GOUA 1BAOA 2AADA 3D5GA 3AGOA 1RGFA 1Q9EA 1RTUA 1RN1A 3HOHA 1RCKA 1BU4A 1RCLA 1BNGA 3A5EA 1JBRA 1B2XA 1FZUA 1B21A 1I0VA 1LOYA 1SARA 1I2EA 1X1UA 2RNTA 1BNJA 3WR2A 3BIRA 1BRIA 7GSPA 1YNVX 4HOHA 1BRHA 2ZA4A 1FUSA 7RNTA 2KF6A 3D4AA 3URPA 2AAEA 1BOXA 1DETA 1I70A 1LOWA 1MGRA 9RNTA 1RN4A 1B2UA 3GSPA 1TRPA 1LNIA 2KF4A 1BSCA 1JBTA 1BUJA 3RNTA 1RLSA 4J5GA 1C54A 1I8VA 3BU4A 1TTOA 1RNTA 2F56A 1JBSA 1B27A 1RHLA 2BU4A 1RGCA 1BSAA 1MGWA 1IYYA 1UCLA 1FYSA 2RBIA 5GSPA 1I3FA 1BNIA 2F5MA 1BRSA 1BSBA 1RDSA 3AHWA 2SARA 3KCHA 1LOVA 5BU4A 1CH0A 1GOYA 1X1XA 1B2MA 1GSPA 2KAAA 1T2HA 1GMRA 4GHOA 1TRQA 1RMSA 5BIRA 1B2ZA 1RNBA 2KF5A 3DGYA 1B2SA 3AHSA 1BRNL 1B3SA 5RNTA 3D5IA 3AGNA 2C4BA 2BIRA 1HZ1A 1RGLA 1BVIA 1RGEA 1RGKA 8RNTA 1UCIA 1RGHA 1BANA 1YVSA 1BRJA 1GOVA 1GMQA 1BGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSN A;  1BNS A;  1I2G A;  1I3I A;  1BRK A;  4J5K A;  6GSP A;  3WHO A;  1FW7 A;  4BIR A;  1FUT A;  1X1W A;  1BSD A;  4HAA A;  3Q3F A;  1B20 A;  1BIR A;  3SYU A;  2F5W A;  1BNR A;  6RNT A;  1RGA A;  4RNT A;  1ZGX A;  1BRG A;  2F4Y A;  1G02 A;  2KF3 A;  1RGG A;  2GSP A;  1GMP A;  1I2F A;  1I0X A;  1PY3 A;  1BSE A;  1HYF A;  1T2I A;  1PYL A;  4BU4 A;  1UCK A;  1X1Y A;  5HOH A;  4GSP A;  1DE3 A;  1BNF A;  3DH2 A;  1AY7 A;  1LRA A;  1UCJ A;  2HOH A;  1A2P A;  1YGW A;  1R4Y A;  1BNE A;  1AQZ A;  1GOU A;  1BAO A;  2AAD A;  3D5G A;  3AGO A;  1RGF A;  1Q9E A;  1RTU A;  1RN1 A;  3HOH A;  1RCK A;  1BU4 A;  1RCL A;  1BNG A;  3A5E A;  1JBR A;  1B2X A;  1FZU A;  1B21 A;  1I0V A;  1LOY A;  1SAR A;  1I2E A;  1X1U A;  2RNT A;  1BNJ A;  3WR2 A;  3BIR A;  1BRI A;  7GSP A;  1YNV X;  4HOH A;  1BRH A;  2ZA4 A;  1FUS A;  7RNT A;  2KF6 A;  3D4A A;  3URP A;  2AAE A;  1BOX A;  1DET A;  1I70 A;  1LOW A;  1MGR A;  9RNT A;  1RN4 A;  1B2U A;  3GSP A;  1TRP A;  1LNI A;  2KF4 A;  1BSC A;  1JBT A;  1BUJ A;  3RNT A;  1RLS A;  4J5G A;  1C54 A;  1I8V A;  3BU4 A;  1TTO A;  1RNT A;  2F56 A;  1JBS A;  1B27 A;  1RHL A;  2BU4 A;  1RGC A;  1BSA A;  1MGW A;  1IYY A;  1UCL A;  1FYS A;  2RBI A;  5GSP A;  1I3F A;  1BNI A;  2F5M A;  1BRS A;  1BSB A;  1RDS A;  3AHW A;  2SAR A;  3KCH A;  1LOV A;  5BU4 A;  1CH0 A;  1GOY A;  1X1X A;  1B2M A;  1GSP A;  2KAA A;  1T2H A;  1GMR A;  4GHO A;  1TRQ A;  1RMS A;  5BIR A;  1B2Z A;  1RNB A;  2KF5 A;  3DGY A;  1B2S A;  3AHS A;  1BRN L;  1B3S A;  5RNT A;  3D5I A;  3AGN A;  2C4B A;  2BIR A;  1HZ1 A;  1RGL A;  1BVI A;  1RGE A;  1RGK A;  8RNT A;  1UCI A;  1RGH A;  1BAN A;  1YVS A;  1BRJ A;  1GOV A;  1GMQ A;  1BGS A; 
#chains in the Genus database with same CATH topology
 1RSN A;  1I3I A;  1O7M B;  5FGO A;  3WHO A;  5CXO A;  5IF6 A;  3DGN A;  3PCS A;  4WFO A;  1O7W B;  3NUV A;  2OWP A;  2P0X A;  4HAA A;  1TJD A;  3WMD A;  4ILF A;  2QEX 3;  3T8N A;  2Z6B A;  3Q3F A;  1B20 A;  1OCV A;  4HM5 B;  1VQM 3;  3S67 A;  2F5W A;  3MYT A;  1RGA A;  3I55 3;  1FA3 A;  1UUV B;  5IEP A;  1ZGX A;  3LTC A;  1BRG A;  3NM2 A;  5IG5 A;  1KC8 4;  1G02 A;  2KF3 A;  3PGB A;  1ZX2 A;  2XH9 A;  3PCR A;  1R4C A;  1TUH A;  4KFD A;  3N8B A;  2KRT A;  1IQ8 A;  3QK9 A;  4NHF A;  1EG9 B;  1KSI A;  4HBR A;  2JQ5 A;  3SOA A;  4GSP A;  4I5Q A;  3U1W A;  1BNF A;  3SED A;  1AY7 A;  3MPH A;  1A2P A;  1YGW A;  2XGL A;  1QAL A;  2XRX B;  2W2C A;  1AQZ A;  1WTH A;  1YGE A;  2AAD A;  3KN4 A;  3OWS A;  2CX1 A;  2B24 B;  4N6L A;  1YIJ 3;  3EBY A;  3LOY A;  2GEX A;  3CCM 3;  8CHO A;  3B7C A;  5FW5 A;  1MWR A;  3HOH A;  1GY6 A;  2QIY A;  3GWR A;  3A5E A;  3FZW A;  2BMO B;  2IUJ A;  3LTD A;  4U13 A;  4HJL B;  1B2X A;  1W7C A;  1JKG A;  4XBX A;  1B21 A;  2CKF B;  3PS8 A;  1D6Z A;  3H3H A;  2B1X B;  1CEW I;  1S72 3;  1X1U A;  1A90 A;  1BNJ A;  4EC6 A;  1NB3 I;  4FMC A;  3BIR A;  2L1S A;  1T5Y A;  7GSP A;  1YNV X;  2CG0 A;  1YJW 3;  2ZA4 A;  1RRH A;  3F7S A;  1FUS A;  3JVC A;  4WYK B;  2HMM B;  1V57 A;  4NPB A;  1Q42 A;  2WGO A;  4EBG A;  1DVD A;  1NDO B;  2E2V A;  3URP A;  2UGI A;  4LGQ A;  2AAE A;  3RGA A;  2BNG A;  1JN5 A;  1LOW A;  1LXE A;  9RNT A;  2BMR B;  2H0G A;  1GY7 A;  2RGQ A;  4IT7 A;  1B2U A;  5ELJ A;  3L0R A;  1J2B A;  2BT3 A;  1LNI A;  3MG3 A;  3DY5 A;  4HM7 B;  1IVX A;  2YX9 A;  4XB5 A;  3LYG A;  4BL2 A;  1JZO A;  1VZZ A;  3NHX A;  1RLS A;  4PEJ A;  1C54 A;  2OQE C;  1K28 A;  1Q81 4;  2Y73 A;  1I8V A;  1NU3 A;  2WOH A;  2UUG C;  3LT8 A;  2P0M A;  1JV2 B;  1RNT A;  2IYJ A;  3LZA A;  3MKI A;  2LYX A;  4FCZ A;  3VGN A;  1JBS A;  1RHL A;  1WQL B;  2L4V A;  1HKX A;  3UL6 A;  3BNE A;  1Y4K A;  1C7H A;  3CCL 3;  1N8R 4;  1CYU A;  4K1V A;  3JUN A;  3ALA A;  3DGO A;  3E99 A;  1JB4 A;  3PYJ A;  3EX9 A;  4OK0 A;  5LC6 A;  3AHW A;  1FGO A;  5DRV A;  1LQM B;  1TIJ A;  1CH0 A;  2CG1 A;  3S27 A;  3FF2 A;  2MF7 A;  4KZ1 A;  2CH9 A;  2RFR A;  3SVA A;  4GHO A;  5AYS C;  4G1M B;  4MMZ B;  3HK4 A;  2BMQ B;  3SLU A;  2CFG A;  1RNB A;  1IVU A;  4IIA A;  5JPU A;  1Q86 4;  1N8Q A;  3CXC 2;  1BRN L;  3EQQ B;  2F86 B;  1MWT A;  5JPP A;  1MWS A;  2D42 A;  3AGN A;  4FR9 A;  5IG0 A;  1N9J A;  1HZ1 A;  3A76 A;  2R4I A;  1BVI A;  3IPT A;  4LEH A;  3UJM A;  1GYB A;  1MWU A;  1RGH A;  3EN1 B;  3HX8 A;  1BRJ A;  2HMK B;  3GZX B;  2QA4 3;  1BNS A;  1IQY A;  3MHE A;  4J5K A;  3LXU X;  3FKA A;  1FW7 A;  1IDP A;  2XFS A;  4CDL A;  2PNC A;  5I97 A;  1BSD A;  2FGT A;  2H0I A;  2GEY A;  2Y74 A;  3X40 A;  1BIR A;  1UW1 A;  4IPB A;  4MEI A;  3G8Z A;  5G2G A;  6RNT A;  1ISK A;  3VSY A;  4RNT A;  5IEO A;  2QGU A;  2Z76 A;  3K5T A;  1I2F A;  3G16 A;  1PY3 A;  1BSE A;  1HYF A;  1W01 A;  5CF2 A;  1PYL A;  4BU4 A;  1UCK A;  1OF5 A;  3CU3 A;  4HKV B;  4R80 A;  1K73 4;  1DE3 A;  1YI2 3;  3FCS B;  5IG4 A;  1UCJ A;  2GU1 A;  2XEP A;  2O3O A;  2CWU A;  1GD4 A;  1OGX A;  2HOH A;  1FUW A;  5BXQ A;  2OOV A;  1R4Y A;  3I0Y A;  1QVG 2;  3PZW A;  1GOU A;  1VQL 3;  1EEJ A;  1OF5 B;  3D5G A;  1YVB I;  2FXT A;  4R9K A;  1D6U A;  1G0T A;  3EN8 A;  3JUO A;  3K0Z A;  3NXJ A;  1Q7Y 4;  1RCK A;  1BU4 A;  3OWY A;  1GY5 A;  3CCU 3;  3UB1 A;  2ML5 A;  1NJI 4;  3EF8 A;  1I0V A;  1DMN A;  5DRE A;  5AI1 A;  1EKM A;  2E2U A;  1OAC A;  1IU7 A;  2CFD A;  2RNT A;  3Q2P A;  5CLK A;  2MC8 A;  3X42 A;  2IUK A;  1EUI C;  3B8L A;  2E2T A;  1VQO 3;  2IY2 A;  1UI8 A;  2F98 A;  3WOD G;  1TP6 A;  2W6J H;  4K1U A;  4BTX A;  3F7X A;  2C10 A;  1DET A;  1I70 A;  3DM8 A;  3AMO A;  1QJG A;  1AV4 A;  2XSH B;  1QAK A;  5D82 A;  1UGI A;  3FGY A;  1KQS 2;  2P09 A;  2KF4 A;  3V98 A;  1JBT A;  2D1W A;  1BUJ A;  2SBL A;  3CC4 3;  4O8S A;  4RBN A;  3FG3 A;  3LT9 A;  4BTY A;  1S5A A;  1W6G A;  4I4K A;  5LC7 A;  3AMO B;  2CHC A;  4WYK A;  2ZL8 A;  1W6C A;  5AIF A;  3KSP A;  2ML6 A;  3WOF B;  2GXF A;  1JJ2 2;  1RGC A;  1MGW A;  3K9M C;  3NM7 A;  4HVN A;  4N6O B;  1YHQ 3;  1LOX A;  5EEO A;  5IEN A;  2JDI H;  2W56 B;  5AIG A;  5GSP A;  2W03 A;  3N54 B;  2F5M A;  4FCM A;  5TGN A;  1GS3 A;  3KCH A;  1DYU A;  1W00 A;  3RGR A;  2XFT A;  1B2M A;  3Q1C A;  1AVK A;  1V74 A;  1W02 A;  2KAA A;  3EHC A;  3DGL A;  3U97 A;  1RMS A;  3LH4 A;  3FF0 A;  3DUK A;  5M19 A;  3GZB A;  3AHS A;  4EV2 A;  4N3V A;  3ZG5 A;  5AEW B;  5RNT A;  3D5I A;  1RGE A;  4WP5 A;  4HM6 B;  3CCQ 3;  5JBS A;  1Q7H A;  1UCI A;  1VQQ A;  2CC3 A;  2PZV A;  2W0Q A;  1IT8 A;  1YVS A;  3LML A;  3RDE A;  4FMB A;  1GOV A;  2CX0 A;  1IK3 A;  3J7Y d;  6GSP A;  3FG1 A;  1IVW A;  3KE7 A;  1BRK A;  3EB8 A;  1Q40 A;  1L5G B;  3CCS 3;  3CCE 3;  1LQG C;  4J9A A;  4WHA A;  1NNV A;  3OX9 A;  4BIR A;  1FUT A;  1OHS A;  1X1W A;  2YFL B;  1W2B 2;  1FGQ A;  1STF I;  3B4O A;  4MJD A;  3NBJ A;  2OQE A;  4HM3 B;  1WMO A;  1Q40 B;  3BB9 A;  3FSD A;  5M18 A;  1BNR A;  3S28 A;  4O2H A;  3EC9 A;  4EXR A;  2LQV A;  3KFQ C;  1G96 A;  2F4Y A;  1T3B A;  3CNM A;  1GMP A;  1I0X A;  4K90 B;  4DKI A;  5M1A A;  4QWT A;  3G6E 3;  1T2I A;  3X3Z A;  4HM2 B;  2HML B;  1X1Y A;  5HOH A;  1Z1S A;  3DH2 A;  3ECF A;  1EA2 A;  2A15 A;  4FMD A;  2GU3 A;  1YIT 3;  3JUP A;  1LRA A;  3G71 3;  4HYZ A;  1IVV A;  4K61 A;  3D3L A;  4RNZ A;  5G1L A;  4EYC A;  1VQN 3;  6STD A;  2IMJ A;  3KSE D;  3MG2 A;  3JUQ A;  4LYL B;  1W4N A;  1JZD A;  1N9E A;  1IQX A;  3GRD A;  1OUN A;  3G4S 3;  2K54 A;  1RGF A;  3CCR 3;  1QVF 2;  1K9M 4;  1UUG B;  3CNX A;  2GBW B;  1IV9 A;  5IW9 A;  2XSO B;  3K63 A;  1JRQ A;  1ROA A;  5AIH A;  4H3U A;  1VQK 3;  1A2K A;  3OW2 2;  2Q07 A;  1DMQ A;  1JBR A;  4HM4 B;  3B4P A;  4O02 B;  3V99 A;  1NO3 A;  1FZU A;  4OVM A;  1LOY A;  1QMA A;  1M90 4;  1M9G A;  1UI7 A;  1I2E A;  2P05 A;  1O7N B;  3UL5 A;  3WR2 A;  1LNH A;  3EBT A;  1GD3 A;  1W6Y A;  3F8H A;  1CYV A;  1BRH A;  1VQ8 3;  3V92 A;  2KF6 A;  3D4A A;  4BTW A;  3NQY A;  3CCV 3;  3NBB A;  4L7K A;  1BOX A;  2RSX A;  3GAX A;  4KVH A;  3N9H A;  2W9P A;  2Z7A A;  3BND A;  3GSP A;  1TRP A;  1US1 A;  2BHM A;  3G0K A;  1UUW B;  4STD A;  1STD A;  4CJN A;  4JRF A;  4J5G A;  3LTB A;  3X41 A;  1WMN A;  1N5H A;  4FMA A;  3K7C A;  3MG1 A;  2UX0 A;  4N6T A;  4Q53 A;  3BU4 A;  5A0O B;  1V58 A;  2F56 A;  2WGQ A;  3CPW 2;  4AKZ A;  1O7G B;  3WA2 X;  1B27 A;  3CPO A;  1M1X B;  1IYY A;  1FYS A;  2RBI A;  1MOL A;  3IMA B;  3F8X A;  4HM1 B;  3BLZ A;  3HI7 A;  3ZFZ A;  1UGH I;  2STD A;  5G1K A;  3DMC A;  4OUQ A;  5ELU A;  1SJW A;  2RCD A;  5EVH A;  3VF1 A;  7STD A;  3HII A;  2SAR A;  2H0H A;  2HMN B;  1TFK A;  1KD1 4;  5KP1 A;  1GOY A;  1X1X A;  2XR8 B;  3ZG0 A;  1GSP A;  1PU4 A;  1T2H A;  2WO0 A;  3JUM A;  1GMR A;  3KII A;  4XBT A;  1TRQ A;  3TDG A;  5BIR A;  4KFE A;  3NQZ A;  4RNY A;  2KF5 A;  3DGY A;  5CF1 A;  1NB5 I;  4HZ9 B;  1OHO A;  1VQ5 3;  4GL6 A;  2W56 A;  4L8O A;  4HZB B;  5AEU B;  3HZP A;  1WMP A;  2C4B A;  4JF8 A;  4TX4 A;  2BIR A;  2CIU A;  1RGL A;  1A67 A;  1BUQ A;  3DZL A;  3BNB A;  2FNQ A;  8RNT A;  1N5P A;  4R4K A;  1AR0 A;  1BAN A;  1K8A 4;  5AYR B;  1GMQ A;  1BGS A;  3CC7 3;  1I2G A;  2OTJ 3;  4EV5 A;  2ZDJ A;  1DVC A;  4EW5 A;  1NWW A;  1IV7 A;  1SPU A;  4KFF A;  4R9L A;  2W9Q A;  4KT3 B;  3FG4 A;  3Q90 A;  3STD A;  3F40 A;  2KXG A;  2P38 A;  1YJ9 3;  4CPK A;  3WOE B;  3CCJ 3;  1SII A;  2Z77 A;  3SYU A;  3LTA A;  3M8C A;  3S5C A;  3KZT A;  4N6U A;  2CWV A;  1VQ7 3;  2XF3 A;  4CCV A;  1RGG A;  2GSP A;  4LZI A;  4N6V 0;  1A2V A;  2YFJ B;  1OH0 A;  3MSO A;  4N6N B;  1KWI A;  3WA3 A;  4HM0 B;  1U5O A;  4RZM A;  3O8Y A;  4HM8 B;  4ORL A;  1JKG B;  3OV4 A;  4GB5 A;  2OCT A;  1OGZ A;  4LMI A;  4AKY A;  1BNE A;  1RKY A;  1IT7 A;  1BAO A;  1RRL A;  2GBX B;  3AGO A;  3OWU A;  3PXM A;  2CFW A;  1TFO A;  2CFK A;  1Q9E A;  4J8T A;  5EQL A;  1RTU A;  1M1K 4;  1RN1 A;  1Q82 4;  1RJO A;  1RCL A;  1BNG A;  1DMM A;  3D79 A;  1EQK A;  2HMJ B;  1JN5 B;  4WWU C;  4AEQ A;  4FCJ A;  5KP4 A;  1D6Y A;  3MWZ A;  1JB5 A;  1O7H B;  1JNQ A;  3F9S A;  4X2H A;  3CC2 3;  1SAR A;  2CK3 H;  2OTL 3;  5D83 A;  1ZS7 A;  4R1K A;  1E3R A;  3EJV A;  2CW9 A;  1BRI A;  2YFI B;  3HIG A;  4HOH A;  1OHP A;  3S29 A;  3DXO A;  4MMX B;  1W2Z A;  3H51 A;  7RNT A;  3IJE B;  2IA7 A;  4X2O A;  3ROB A;  3T0U A;  3OXA A;  1FGM A;  1W5Z A;  2F99 A;  2INX A;  1U8C B;  4XM4 A;  1MGR A;  2I9W A;  3KKG A;  3QRD A;  5CK6 A;  1ULJ B;  1MNL A;  1OPY A;  1RN4 A;  2XGN A;  5STD A;  3CMA 3;  5AII A;  2CWT A;  1BSC A;  3NX0 A;  1E3V A;  2K3D A;  4XDV A;  3RNT A;  1CQS A;  3SX1 A;  2W04 A;  1K41 A;  3I56 3;  3FLJ A;  2R41 A;  1F8N A;  3UNL A;  4XDW A;  1TTO A;  2WOF A;  2C11 A;  3ER7 A;  1SQW A;  5BVB A;  5IG3 A;  2KCD A;  1FGR A;  1ASK A;  2BU4 A;  3SOY A;  1BSA A;  2V1L A;  2J8X B;  3D9R A;  3SXX A;  3CME 3;  1ROV A;  1AVL A;  1E97 A;  1UCL A;  4XBY A;  1TU5 A;  1HU9 A;  1FGT A;  3T8U A;  1I3F A;  1BNI A;  2HMO B;  1RN7 A;  3NV0 A;  1BRS A;  3GZY B;  3CD6 3;  1BSB A;  1RDS A;  2CFL A;  5IER A;  3F14 A;  1LOV A;  3X3Y A;  3GZR A;  3DGM A;  2OOV C;  3WDG B;  5BU4 A;  1YJN 3;  2O9U X;  2BO9 B;  3X3X A;  4BL3 A;  3NV0 B;  1ULI B;  1PFP A;  1VQ4 3;  1SIH A;  5D81 A;  1QAF A;  1WNH A;  1JB2 A;  1B2Z A;  3EE1 A;  4MMY B;  4N6M A;  1B2S A;  3BNC A;  4NRE A;  1O7P B;  4O3V A;  1B3S A;  1VQ6 3;  5HGR A;  2M7O A;  1UDI I;  5KP3 A;  3FH1 A;  2ZHX B;  1LVN A;  1RGK A;  2K0M A;  1VQP 3;  4H61 A;  4ZM8 A;  1ZO2 A;  4L8P A;  3NBR A;  4LSO A;  1VQ9 3; 
#chains in the Genus database with same CATH homology
 1RSN A;  1BNS A;  1I2G A;  1I3I A;  1BRK A;  4J5K A;  6GSP A;  3WHO A;  1FW7 A;  4BIR A;  1FUT A;  1X1W A;  1BSD A;  4HAA A;  3Q3F A;  1B20 A;  1BIR A;  3SYU A;  2F5W A;  1BNR A;  6RNT A;  1RGA A;  4RNT A;  1ZGX A;  1BRG A;  2F4Y A;  1G02 A;  2KF3 A;  1RGG A;  2GSP A;  1GMP A;  1I2F A;  1I0X A;  1PY3 A;  1BSE A;  1HYF A;  1T2I A;  1PYL A;  4BU4 A;  1UCK A;  1X1Y A;  5HOH A;  4GSP A;  1DE3 A;  1BNF A;  3DH2 A;  1AY7 A;  1LRA A;  1UCJ A;  2HOH A;  1A2P A;  1YGW A;  1R4Y A;  1BNE A;  1AQZ A;  1GOU A;  1BAO A;  2AAD A;  3D5G A;  3AGO A;  1RGF A;  1Q9E A;  1RTU A;  1RN1 A;  3HOH A;  1RCK A;  1BU4 A;  1RCL A;  1BNG A;  3A5E A;  1JBR A;  1B2X A;  1FZU A;  1B21 A;  1I0V A;  1LOY A;  1SAR A;  1I2E A;  1X1U A;  2RNT A;  1BNJ A;  3WR2 A;  3BIR A;  1BRI A;  7GSP A;  1YNV X;  4HOH A;  1BRH A;  2ZA4 A;  1FUS A;  7RNT A;  2KF6 A;  3D4A A;  3URP A;  2AAE A;  1BOX A;  1DET A;  1I70 A;  1LOW A;  1MGR A;  9RNT A;  1RN4 A;  1B2U A;  3GSP A;  1TRP A;  1LNI A;  2KF4 A;  1BSC A;  1JBT A;  1BUJ A;  3RNT A;  1RLS A;  4J5G A;  1C54 A;  1I8V A;  3BU4 A;  1TTO A;  1RNT A;  2F56 A;  1JBS A;  1B27 A;  1RHL A;  2BU4 A;  1RGC A;  1BSA A;  1MGW A;  1IYY A;  1UCL A;  1FYS A;  2RBI A;  5GSP A;  1I3F A;  1BNI A;  2F5M A;  1BRS A;  1BSB A;  1RDS A;  3AHW A;  2SAR A;  3KCH A;  1LOV A;  5BU4 A;  1CH0 A;  1GOY A;  1X1X A;  1B2M A;  1GSP A;  2KAA A;  1T2H A;  1GMR A;  4GHO A;  1TRQ A;  1RMS A;  5BIR A;  1B2Z A;  1RNB A;  2KF5 A;  3DGY A;  1B2S A;  3AHS A;  1BRN L;  1B3S A;  5RNT A;  3D5I A;  3AGN A;  2C4B A;  2BIR A;  1HZ1 A;  1RGL A;  1BVI A;  1RGE A;  1RGK A;  8RNT A;  1UCI A;  1RGH A;  1BAN A;  1YVS A;  1BRJ A;  1GOV A;  1GMQ A;  1BGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...