2HMNB

Crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmnB00
4R1KA 1JN5A 4I4KA 1EG9B 3NXJA 1OPYA 2HMLB 3BB9A 1OHOA 3EX9A 2F99A 3IPTA 5KP1A 2A15A 3F14A 2B1XB 3UJMA 3NBRA 3KZTA 4XBTA 4L7KA 4PEJA 6STDA 4X2OA 3OV4A 3EN1B 4XBYA 5IG5A 1OH0A 4FCJA 1HKXA 3HZPA 3EF8A 3KE7A 1E3VA 1OHPA 3MG2A 3SOYA 3ECFA 3I0YA 4OUQA 4HJLB 1QJGA 1C7HA 3FLJA 1JB5A 5KP4A 3B8LA 5STDA 3GZBA 1DMMA 2I9WA 1JB4A 1S5AA 1TUHA 1OGXA 3KKGA 4MJDA 5G2GA 1BUQA 3F7SA 4R9KA 5BVBA 3EHCA 1W00A 3NV0A 2HMJB 2RGQA 4HM3B 4STDA 2R4IA 3DMCA 5IERA 4H3UA 4Q53A 3SEDA 3CU3A 2CHCA 4L8PA 2BMOB 1NDOB 1EA2A 3STDA 3VSYA 3EQQB 2YFJB 1Z1SA 3MHEA 4HM4B 2Z7AA 2HMMB 1Q40A 1O7MB 2BMQB 2CKFB 3FKAA 5CF2A 2F86B 3S5CA 4HZBB 1O7HB 2INXA 3MSOA 4LMIA 3HK4A 3WMDA 1O7WB 3H51A 1ZO2A 2YFLB 5IF6A 3CNMA 4WP5A 2GXFA 8CHOA 3MG1A 3DZLA 4KVHA 4FCMA 3F8HA 1ZX2A 3FH1A 1UUVB 3GWRA 1NU3A 3LZAA 2GBXB 3MYTA 4XDVA 2XRXB 1A2KA 3HX8A 4N3VA 1ULIB 3GRDA 2RCDA 1NWWA 4X2HA 1ISKA 3KSPA 3MG3A 1OCVA 3OX9A 1Q40B 3JUPA 4HM1B 4HM8B 4CDLA 4WWUC 3DM8A 3FF2A 3EBYA 4XBXA 3F8XA 5IG0A 3H3HA 1VZZA 5JPUA 4LEHA 3BLZA 1W6YA 5IG4A 4L8OA 1Q42A 3FSDA 3T8NA 3DUKA 3NM2A 3B7CA 1STDA 2PZVA 7STDA 1OF5B 3DXOA 4IIAA 3ER7A 2BMRB 5TGNA 4GB5A 5IENA 2B24B 1GS3A 3F40A 5AIIA 5IEPA 1OUNA 2IMJA 2BNGA 3EN8A 3GZYB 4J8TA 3GZXB 2YFIB 3CPOA 3G0KA 1SJWA 4K1UA 1AR0A 4WYKB 1W01A 3B4PA 3CNXA 3JUMA 5D82A 5KP3A 3FF0A 1W02A 2GEXA 4RZMA 2UX0A 3NUVA 3D9RA 5D81A 2QGUA 4XDWA 3NHXA 5IEOA 3ROBA 2JQ5A 4OVMA 3UNLA 1O7PB 3OWYA 1GY6A 2W2CA 1IDPA 3Q90A 2HMOB 1OF5A 5IG3A 5AEWB 3OXAA 1GY5A 3JUQA 4U13A 3EBTA 3B4OA 3FZWA 3T8UA 4HM6B 2GEYA 1WQLB 4HZ9B 1O7NB 1GY7A 3K0ZA 4HM5B 4HKVB 3MKIA 2OWPA 4WYKA 5HGRA 5D83A 3OWSA 5DREA 5AEUB 5CLKA 4HM7B 3OWUA 1OHSA 1DMQA 4HM2B 4K1VA 3VGNA 1U5OA 2XSHB 2Z76A 4HM0B 3A76A 1CQSA 1JN5B 2QIYA 5DRVA 3LYGA 1ASKA 2XR8B 2Z77A 1ULJB 4LGQA 1E97A 5FW5A 5AIHA 3RGAA 2RFRA 1JKGA 4R9LA 3FGYA 2STDA 1GYBA 4XM4A 1TP6A 2HMNB 3JUNA 3M8CA 3G8ZA 5AIGA 4J9AA 1UUWB 1DMNA 3E99A 5BXQA 1QMAA 3EJVA 3GZRA 5CXOA 3RGRA 3JUOA 3G16A 5AI1A 2XSOB 3K7CA 2K54A 1JB2A 2HMKB 2F98A 4ORLA 5CF1A 1OGZA 4HVNA 2GBWB 3F9SA 5JPPA 3EC9A 4XB5A 1K41A 1O7GB 5CK6A 3F7XA 5AIFA 5EVHA 1JKGB 3NV0B 3SOAA 1E3RA
chains in the Genus database with same CATH superfamily
4R1KA 1JN5A 3NQYA 6RNTA 3CXC2 3HIGA 1US1A 4I4KA 1M904 1EG9B 1RNTA 1FUWA 3WOEB 1HYFA 2C11A 3KCHA 3NXJA 3J7Yd 1JBTA 3WA3A 1STFI 4BTYA 1BRKA 1OPYA 2HMLB 1FW7A 3BB9A 3V98A 1OHOA 3BNCA 1IU7A 1DVCA 1UI7A 3EX9A 2F99A 3G6E3 2XH9A 3IPTA 3LTDA 5KP1A 4EXRA 3WOFB 2A15A 3F14A 2B1XB 3RDEA 3UJMA 1VQM3 3NBRA 3KZTA 4XBTA 4L7KA 1RNBA 1ZS7A 4PEJA 4FMDA 4JF8A 4N6V0 1W2B2 1FGMA 1LQMB 1UGIA 1TFKA 2IY2A 2Y74A 2O9UX 1KD14 4RBNA 2V1LA 1RN1A 2GSPA 6STDA 4X2OA 1NNVA 4AEQA 3X3YA 3CC23 3OV4A 2CW9A 3EN1B 4XBYA 2XFSA 1JZDA 4R4KA 1UCKA 5IG5A 4QWTA 1G96A 1OH0A 4FCJA 1HKXA 1W2ZA 3HZPA 3EF8A 1BSEA 3KE7A 1B27A 1E3VA 3HOHA 3TDGA 2OQEC 4KZ1A 1YVSA 1FUTA 1OHPA 1I70A 1RKYA 3MG2A 1RCKA 2KRTA 4K90B 3ECFA 3SOYA 1VQP3 3I0YA 3WHOA 1YHQ3 4OUQA 1BSDA 1ROAA 4HJLB 1QJGA 1C7HA 3FLJA 3ZG0A 2BHMA 1JB5A 1Q9EA 4O3VA 5KP4A 3B8LA 5STDA 1DE3A 1QAKA 3LT8A 1GOVA 3AGNA 3GZBA 4LSOA 5AYSC 1DMMA 1X1YA 1IQYA 4GSPA 2I9WA 1BNJA 1JB4A 4FMCA 4CJNA 2QA43 1S5AA 1FUSA 1TUHA 1OGXA 1W6GA 2RNTA 2ZDJA 3K5TA 3KKGA 3LTCA 4MJDA 4EBGA 3A5EA 3ZG5A 3SLUA 5G2GA 3AHSA 2AADA 4RNZA 3WODG 3F7SA 1BUQA 4R9KA 5BVBA 4RNYA 3EHCA 1BRGA 1W00A 2ML5A 3V92A 3GAXA 2C4BA 3QK9A 3NV0A 1G0TA 3O8YA 2HMJB 3LMLA 1CH0A 1A2VA 1KSIA 2RGQA 1YNVX 4FMBA 4HM3B 3D79A 3CPW2 1K734 1GMRA 2XGNA 4STDA 1FGOA 1LOXA 1MNLA 1JV2B 1JNQA 4IPBA 3BU4A 1GD3A 3N54B 2Q07A 2R4IA 3LOYA 4I5QA 3DMCA 1B2ZA 4KT3B 1BIRA 3D4AA 2CX0A 4AKYA 5IERA 1WMOA 2E2UA 4H3UA 3PXMA 3NX0A 4H61A 4Q53A 1W5ZA 2UUGC 2CX1A 1GMQA 5M1AA 3SXXA 2F5MA 5IW9A 1Y4KA 3SEDA 1Q824 4KFDA 3IMAB 1NB3I 1GMPA 1U8CB 2KAAA 3X3ZA 3CU3A 4ZM8A 3BNEA 2BIRA 1BRSA 1ROVA 1A67A 5FGOA 4N6LA 4MMZB 2CHCA 2XFTA 3QRDA 6GSPA 1RCLA 2BMOB 1BSAA 4L8PA 1NDOB 1EA2A 1TIJA 3STDA 3VSYA 1AVLA 3EQQB 2YFJB 1N5HA 3U97A 1Z1SA 5HOHA 1K8A4 3MHEA 1UDII 2J8XB 4HM4B 2Z7AA 1RGLA 2HMMB 1IVWA 1Q40A 2MF7A 1O7MB 1WMPA 1RGKA 2BMQB 2CKFB 3FKAA 2F86B 5CF2A 3S5CA 7GSPA 3D3LA 4HZBB 1GSPA 1O7HB 1SQWA 2INXA 3MSOA 4LMIA 4EC6A 3HK4A 3WMDA 1O7WB 3H51A 1ZO2A 4HYZA 2YFLB 1NJI4 5IF6A 1W4NA 1T2IA 3CNMA 1FGRA 4WP5A 3UL6A 2GXFA 1IK3A 2F5WA 8CHOA 1D6ZA 3MG1A 3DZLA 1G02A 2FGTA 4KVHA 1UUGB 4FCMA 3F8HA 1ZX2A 2M7OA 3BNDA 4NREA 3FH1A 1UUVB 3GWRA 1NU3A 3LZAA 3G4S3 2OTL3 3S67A 3X40A 2GBXB 1Q814 3MYTA 4XDVA 2XRXB 5EEOA 3CD63 3D5IA 3LTBA 2XGLA 1PY3A 2O3OA 2XEPA 3FG1A 1HU9A 1A2KA 1T5YA 1B20A 3HX8A 1ZGXA 1ULIB 4N3VA 2ZHXB 1LOWA 1VQK3 3GRDA 2MC8A 5LC6A 2RCDA 1YJ93 1NWWA 1MWUA 1TU5A 1JBRA 4X2HA 1ISKA 1N9EA 2CWUA 4LZIA 3Q3FA 3KSPA 3MG3A 3NBBA 1L5GB 1IVUA 3MPHA 1I2GA 1OCVA 2CC3A 4N6OB 4BIRA 4LYLB 3OX9A 3DGOA 1NB5I 1FGTA 5M19A 1PU4A 1VQ73 1JRQA 1Q40B 3JUPA 3CCJ3 4HM1B 1LRAA 4HM8B 1DETA 4ILFA 4WWUC 4CDLA 5BU4A 3DM8A 1VQ53 1GOYA 1DVDA 4IT7A 2L1SA 3FF2A 1BOXA 3EBYA 4XBXA 3F8XA 3URPA 3T0UA 1BAOA 2IA7A 5IG0A 3H3HA 1VZZA 1FGQA 2CFWA 5JPUA 5ELJA 3CCS3 1VQL3 4LEHA 4RNTA 2QEX3 4WFOA 2F56A 1B3SA 2ZL8A 1MWSA 4MEIA 4OK0A 3BLZA 4NHFA 2IUJA 1SARA 1W6YA 1TRPA 2H0GA 1LQGC 1RTUA 4BL3A 5IG4A 1AVKA 1QVG2 4L8OA 2F4YA 1AY7A 1D6UA 1Q42A 3ZFZA 2UGIA 1A2PA 3FSDA 3KN4A 3I553 1YJN3 2Z6BA 5EQLA 1I8VA 3T8NA 3DUKA 3WA2X 1RMSA 3NM2A 3B7CA 1STDA 3PS8A 2PZVA 2KCDA 3DGYA 1HZ1A 4MMYB 1F8NA 1OF5B 1RLSA 2P0XA 1RSNA 7STDA 1Q7Y4 1BSBA 1CEWI 3DXOA 3CC43 4DKIA 3CMA3 3JVCA 4IIAA 1X1UA 1PFPA 3ER7A 4G1MB 5ELUA 1GD4A 2BMRB 5TGNA 4GB5A 5IENA 1VQQA 2B24B 1FZUA 2CIUA 1GS3A 1UCJA 1IVVA 1J2BA 3F40A 5AIIA 1VQ83 1RDSA 5IEPA 1OUNA 1KC84 1BSCA 2IMJA 2HOHA 2BNGA 2W04A 3EN8A 1BVIA 3HI7A 3GZYB 1JJ22 1MGWA 1RGCA 3DGNA 2SBLA 1AV4A 3SYUA 2H0IA 3U1WA 4J8TA 1VQO3 1OACA 2GU3A 1UW1A 3IJEB 1YGEA 1K28A 1LOVA 3GZXB 3LH4A 2YFIB 1TTOA 3CPOA 1NO3A 1BNGA 3G0KA 1SJWA 1RJOA 3LXUX 4K1UA 2YX9A 2P0MA 1AR0A 2CWTA 4HOHA 1IVXA 4WYKB 1IYYA 1W01A 5M18A 1BU4A 1I3IA 5JBSA 5GSPA 3B4PA 3CNXA 3JUMA 4N6MA 3DGLA 2OQEA 1BRNL 1W6CA 5D82A 2KF5A 1I0XA 3FF0A 4GL6A 4J5GA 5KP3A 1JBSA 1W02A 3S27A 2FNQA 2GEXA 4RZMA 2R41A 4HAAA 4HBRA 1VQN3 3D5GA 1LNIA 2KF6A 2UX0A 3CCL3 3NM7A 3NUVA 1QALA 2W56A 1QAFA 5I97A 3CC73 3D9RA 5D81A 1MWTA 2QGUA 1BGSA 1I2EA 1BNIA 4K61A 1B2XA 1BANA 2CG0A 4XDWA 1S723 3RNTA 2E2TA 1SIHA 3NHXA 1R4YA 1UCIA 5IEOA 2CFLA 2P05A 1IQ8A 3ROBA 2OCTA 2JQ5A 2W9PA 4OVMA 1B2MA 1RGEA 1V57A 1IQXA 1N9JA 1O7PB 3K9MC 1BNFA 4KFEA 3UNLA 3OWYA 3CCR3 1GY6A 2H0HA 2W2CA 3WR2A 1BNRA 5G1LA 1IDPA 1N5PA 2P09A 4NPBA 4CCVA 3LTAA 2CK3H 3Q90A 2KF3A 3GSPA 1UGHI 3Q2PA 3S28A 2BU4A 2HMOB 5G1KA 1FYSA 1OF5A 2OOVA 2W9QA 3SX1A 3K63A 1LXEA 1RGHA 3CCV3 1TRQA 2BT3A 1BRHA 2LQVA 5AEWB 5IG3A 3OXAA 1GY5A 3AGOA 3JUQA 4U13A 3EBTA 3B4OA 1K9M4 1AQZA 5BIRA 1VQ63 4BTWA 1Q7HA 2D42A 3VF1A 3FZWA 1DYUA 1SPUA 1V74A 3T8UA 3CCU3 4HM6B 2IUKA 2GU1A 4O2HA 2K0MA 2GEYA 1WQLB 1I0VA 3G713 4TX4A 4HZ9B 2JDIH 2RSXA 3KFQC 4J5KA 1LOYA 3X41A 1TFOA 1BNSA 3OW22 1RN4A 1X1WA 3FG3A 1EUIC 3AMOA 4KFFA 1FA3A 1O7NB 1GY7A 3ALAA 1BUJA 2W56B 1UCLA 3K0ZA 1JZOA 3KIIA 3MWZA 3NQZA 3PCSA 4HM5B 4O02B 4BL2A 1C54A 4HKVB 4EYCA 3I563 3MKIA 2OWPA 4N6TA 4WYKA 4CPKA 5HGRA 1WTHA 1BRJA 3DY5A 1CYUA 3PGBA 5D83A 3OWSA 5DREA 5AEUB 1QVF2 1X1XA 1RGAA 7RNTA 1B2UA 5CLKA 1A90A 2CFGA 3EB8A 3SVAA 1PYLA 4HM7B 1EKMA 2D1WA 3OWUA 1Q864 1OHSA 3BNBA 1V58A 1DMQA 1M9GA 2PNCA 2W6JH 4HM2B 2SARA 4K1VA 3CCQ3 1VQ93 2E2VA 3VGNA 3EE1A 4GHOA 1CYVA 1RGFA 2KXGA 1U5OA 2XSHB 3WDGB 1IT7A 2CWVA 3FG4A 2C10A 2Z76A 2CFKA 3AHWA 1RHLA 3NBJA 4HM0B 3A76A 4AKZA 1CQSA 2WGOA 1YIJ3 1JN5B 4N6UA 3PYJA 2WO0A 3BIRA 1TJDA 1LNHA 2WGQA 2QIYA 5DRVA 3LYGA 3N9HA 1ASKA 1T2HA 1KQS2 1BRIA 2XR8B 1I3FA 3N8BA 1MWRA 2Z77A 3FCSB 1M1XB 1T3BA 1ULJB 4LGQA 2L4VA 1E97A 1RRLA 3S29A 1W7CA 3AMOB 1B21A 4EV2A 5FW5A 5AIHA 3DH2A 2RFRA 3RGAA 1JKGA 2W0QA 4R9LA 3FGYA 2STDA 4WHAA 4FR9A 2IYJA 1GYBA 4XM4A 3X3XA 1TP6A 2HMNB 3JUNA 1IT8A 3M8CA 3L0RA 3X42A 3DGMA 4BU4A 4O8SA 3G8ZA 5AIGA 3Q1CA 4J9AA 4EV5A 1IV9A 1UUWB 1M1K4 2KF4A 3CCE3 3PCRA 1RRHA 1WMNA 2OOVC 3UB1A 3CME3 2W03A 1DMNA 3KSED 1MGRA 3E99A 1B2SA 5BXQA 2P38A 3V99A 1QMAA 1IV7A 3EJVA 3GZRA 3HIIA 5CXOA 3JUOA 3RGRA 1UI8A 1N8R4 2ML6A 3UL5A 3G16A 1R4CA 2Y73A 5AI1A 1N8QA 4FCZA 1I2FA 2XSOB 3K7CA 5A0OB 4JRFA 2K54A 3CCM3 2OTJ3 4FMAA 1JB2A 2HMKB 1GOUA 1RGGA 2F98A 2ZA4A 4ORLA 1YVBI 1LVNA 5AYRB 1EQKA 2FXTA 5CF1A 1MOLA 2BO9B 1BNEA 1OGZA 2LYXA 4HVNA 2XF3A 2WOFA 2GBWB 3F9SA 3LT9A 2CFDA 5RNTA 5JPPA 3EC9A 4XB5A 1YGWA 1K41A 1O7GB 1KWIA 4N6NB 1RN7A 3PZWA 1WNHA 2RBIA 1YJW3 5CK6A 3F7XA 5AIFA 2CH9A 4EW5A 4R80A 5EVHA 2WOHA 2CG1A 9RNTA 1YIT3 1JKGB 2K3DA 4BTXA 5LC7A 3NV0B 1VQ43 1D6YA 1YI23 4MMXB 1EEJA 2AAEA 3SOAA 8RNTA 1E3RA 1SIIA
chains in the Genus database with same CATH topology
4R1KA 1JN5A 3NQYA 3CXC2 3HIGA 1US1A 4I4KA 1M904 1EG9B 3WOEB 2C11A 3NXJA 3J7Yd 3WA3A 1STFI 4BTYA 1OPYA 2HMLB 3BB9A 3V98A 1OHOA 3BNCA 1IU7A 1DVCA 1UI7A 3EX9A 2F99A 3G6E3 2XH9A 3IPTA 3LTDA 5KP1A 4EXRA 3WOFB 2A15A 3F14A 2B1XB 3RDEA 3UJMA 1VQM3 3NBRA 3KZTA 4XBTA 4L7KA 4PEJA 4FMDA 4JF8A 4N6V0 1W2B2 1FGMA 1TFKA 2Y74A 2O9UX 1KD14 4RBNA 2V1LA 6STDA 4X2OA 4AEQA 3CC23 3X3YA 3OV4A 2CW9A 3EN1B 4XBYA 2XFSA 4R4KA 5IG5A 4QWTA 1G96A 1OH0A 4FCJA 1HKXA 1W2ZA 3HZPA 3EF8A 3KE7A 1E3VA 3TDGA 2OQEC 4KZ1A 1OHPA 1RKYA 3MG2A 3SOYA 2KRTA 4K90B 3ECFA 1VQP3 3I0YA 1YHQ3 4OUQA 1ROAA 4HJLB 1QJGA 1C7HA 3FLJA 2BHMA 1JB5A 4O3VA 5KP4A 3B8LA 5STDA 1QAKA 3LT8A 4LSOA 3GZBA 5AYSC 1DMMA 1IQYA 2QA43 2I9WA 4FMCA 1JB4A 1S5AA 1W6GA 1TUHA 1OGXA 3K5TA 3KKGA 2ZDJA 3LTCA 4EBGA 4MJDA 3SLUA 5G2GA 1BUQA 4RNZA 3WODG 3F7SA 4R9KA 5BVBA 4RNYA 3EHCA 1W00A 2ML5A 3V92A 3GAXA 3QK9A 3NV0A 3O8YA 2HMJB 3LMLA 4FMBA 1A2VA 1KSIA 2RGQA 4HM3B 3CPW2 1K734 2XGNA 4STDA 1FGOA 1LOXA 1MNLA 1JV2B 1JNQA 4IPBA 1GD3A 3N54B 2Q07A 2R4IA 3LOYA 3DMCA 4AKYA 5IERA 1WMOA 2E2UA 4H3UA 3PXMA 3NX0A 4H61A 4Q53A 1W5ZA 3SXXA 5IW9A 1Y4KA 3SEDA 1Q824 4KFDA 3IMAB 1NB3I 1U8CB 3X3ZA 3CU3A 4ZM8A 3BNEA 1ROVA 1A67A 5FGOA 4N6LA 4MMZB 2CHCA 2XFTA 3QRDA 4L8PA 2BMOB 1NDOB 1EA2A 1TIJA 3STDA 3VSYA 1AVLA 3EQQB 2YFJB 1N5HA 3U97A 1Z1SA 1K8A4 3MHEA 4HM4B 2Z7AA 2HMMB 1IVWA 1Q40A 2MF7A 1O7MB 1WMPA 2BMQB 2CKFB 3FKAA 5CF2A 2F86B 3S5CA 3D3LA 4HZBB 1O7HB 1SQWA 2INXA 3MSOA 4LMIA 4EC6A 3HK4A 3WMDA 1O7WB 3H51A 1ZO2A 4HYZA 2YFLB 1NJI4 5IF6A 1W4NA 3CNMA 1FGRA 4WP5A 3UL6A 2GXFA 1IK3A 8CHOA 1D6ZA 3MG1A 3DZLA 2FGTA 4KVHA 4FCMA 3F8HA 1ZX2A 2M7OA 3BNDA 4NREA 3FH1A 1UUVB 3GWRA 1NU3A 3LZAA 3G4S3 2OTL3 3S67A 3X40A 2GBXB 1Q814 3MYTA 4XDVA 2XRXB 5EEOA 3CD63 3LTBA 2XGLA 2O3OA 2XEPA 3FG1A 1HU9A 1A2KA 1T5YA 3HX8A 4N3VA 1ULIB 1VQK3 3GRDA 2MC8A 5LC6A 2RCDA 1YJ93 1NWWA 1TU5A 4X2HA 1ISKA 1N9EA 2CWUA 4LZIA 3KSPA 3MG3A 3NBBA 1L5GB 1IVUA 3MPHA 1OCVA 4N6OB 2CC3A 3OX9A 3DGOA 1NB5I 1FGTA 1VQ73 1PU4A 1JRQA 1Q40B 3JUPA 3CCJ3 4HM1B 4HM8B 4CDLA 4WWUC 3DM8A 1VQ53 1DVDA 4IT7A 3FF2A 3EBYA 4XBXA 3F8XA 1YI23 3T0UA 2IA7A 5IG0A 3H3HA 1VZZA 1FGQA 2CFWA 5JPUA 5ELJA 3CCS3 1VQL3 4LEHA 2QEX3 4WFOA 2ZL8A 4MEIA 4OK0A 3BLZA 4NHFA 2IUJA 1W6YA 5IG4A 1AVKA 1QVG2 4L8OA 1D6UA 1Q42A 3FSDA 3KN4A 1YJN3 3I553 2Z6BA 5EQLA 3T8NA 3WA2X 3DUKA 3NM2A 3B7CA 1STDA 3PS8A 2PZVA 2KCDA 4MMYB 3G713 7STDA 1F8NA 1OF5B 2P0XA 1Q7Y4 1CEWI 3DXOA 3CC43 3CMA3 3JVCA 4IIAA 3ER7A 1PFPA 4G1MB 5ELUA 1GD4A 2BMRB 5TGNA 4GB5A 5IENA 2B24B 2CIUA 1GS3A 1IVVA 1J2BA 3F40A 5AIIA 1VQ83 5IEPA 1OUNA 1KC84 2IMJA 2BNGA 2W04A 3EN8A 3HI7A 3GZYB 1JJ22 3DGNA 2SBLA 1AV4A 3U1WA 4J8TA 1VQO3 1OACA 2GU3A 1UW1A 3IJEB 1YGEA 1K28A 3LH4A 3GZXB 2YFIB 3CPOA 1NO3A 3G0KA 1SJWA 1RJOA 3LXUX 4K1UA 2YX9A 2P0MA 1AR0A 2CWTA 1IVXA 4WYKB 1W01A 5JBSA 3B4PA 3CNXA 3JUMA 4N6MA 3DGLA 2OQEA 1W6CA 5D82A 5KP3A 3FF0A 4GL6A 1W02A 3S27A 2FNQA 2GEXA 4RZMA 4HBRA 1VQN3 2UX0A 3CCL3 3NM7A 3NUVA 1QALA 2W56A 1QAFA 5I97A 3CC73 3D9RA 5D81A 2QGUA 4K61A 1S723 2CG0A 4XDWA 2E2TA 1SIHA 3NHXA 5IEOA 2CFLA 2P05A 1IQ8A 3ROBA 2OCTA 2JQ5A 2W9PA 4OVMA 1IQXA 1N9JA 1O7PB 3K9MC 4KFEA 3UNLA 3CCR3 3OWYA 1GY6A 2W2CA 1IDPA 1N5PA 2P09A 4CCVA 3LTAA 2CK3H 3Q90A 3S28A 3Q2PA 2HMOB 1OF5A 2OOVA 2W9QA 3SX1A 3K63A 1LXEA 3CCV3 2BT3A 2LQVA 5AEWB 5IG3A 3OXAA 1GY5A 3JUQA 4U13A 3EBTA 3B4OA 1K9M4 1VQ63 4BTWA 2D42A 3VF1A 3FZWA 1DYUA 1SPUA 1V74A 3T8UA 3CCU3 4HM6B 2IUKA 2GU1A 4O2HA 2K0MA 2GEYA 1WQLB 4TX4A 4HZ9B 2JDIH 2RSXA 3KFQC 3X41A 1TFOA 3OW22 3FG3A 3AMOA 4KFFA 1FA3A 1O7NB 1GY7A 3ALAA 2W56B 3K0ZA 3KIIA 3MWZA 3NQZA 3PCSA 4HM5B 4O02B 4HKVB 4EYCA 3I563 3MKIA 2OWPA 4N6TA 4WYKA 5HGRA 1WTHA 3DY5A 1CYUA 3PGBA 5D83A 3OWSA 5DREA 5AEUB 1QVF2 5CLKA 1A90A 2CFGA 3EB8A 3SVAA 4HM7B 1EKMA 2D1WA 3OWUA 1Q864 1OHSA 3BNBA 1DMQA 1M9GA 2PNCA 2W6JH 4HM2B 4K1VA 3CCQ3 1VQ93 2E2VA 3VGNA 3EE1A 1CYVA 2KXGA 1U5OA 2XSHB 3WDGB 1IT7A 2CWVA 3FG4A 2C10A 2Z76A 2CFKA 3NBJA 4HM0B 3A76A 4AKZA 1CQSA 2WGOA 1YIJ3 1JN5B 4N6UA 3PYJA 2WO0A 1LNHA 2WGQA 2QIYA 5DRVA 3LYGA 3N9HA 1ASKA 1KQS2 2XR8B 3N8BA 2Z77A 3FCSB 1M1XB 1ULJB 4LGQA 2L4VA 1E97A 1RRLA 3S29A 1W7CA 3AMOB 4EV2A 5FW5A 5AIHA 2RFRA 3RGAA 1JKGA 2W0QA 4R9LA 3FGYA 2STDA 4WHAA 4FR9A 1GYBA 4XM4A 3X3XA 1TP6A 2HMNB 3JUNA 1IT8A 3M8CA 3L0RA 3X42A 3DGMA 4O8SA 3G8ZA 5AIGA 3Q1CA 4J9AA 4EV5A 1IV9A 1UUWB 1M1K4 3CCE3 3PCRA 1RRHA 1WMNA 2OOVC 3UB1A 3CME3 2W03A 1DMNA 3KSED 3E99A 5BXQA 2P38A 3V99A 1QMAA 1IV7A 3EJVA 3GZRA 3HIIA 5CXOA 3JUOA 3RGRA 1UI8A 1N8R4 2ML6A 3UL5A 3G16A 1R4CA 2Y73A 5AI1A 1N8QA 4FCZA 2XSOB 3K7CA 5A0OB 4JRFA 2K54A 3CCM3 2OTJ3 4FMAA 1JB2A 2HMKB 2F98A 4ORLA 1LVNA 1YVBI 5AYRB 1EQKA 2FXTA 5CF1A 1MOLA 2BO9B 2LYXA 1OGZA 4HVNA 2XF3A 2WOFA 2GBWB 3F9SA 3LT9A 2CFDA 5JPPA 3EC9A 4XB5A 1K41A 1O7GB 1KWIA 4N6NB 1RN7A 3PZWA 1WNHA 1YJW3 5CK6A 3F7XA 5AIFA 2CH9A 4R80A 5EVHA 2WOHA 2CG1A 1YIT3 1JKGB 4BTXA 5LC7A 3NV0B 1VQ43 1D6YA 4MMXB 1FUWA 3SOAA 1E3RA 1SIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1K A;  1JN5 A;  4I4K A;  1EG9 B;  3NXJ A;  1OPY A;  2HML B;  3BB9 A;  1OHO A;  3EX9 A;  2F99 A;  3IPT A;  5KP1 A;  2A15 A;  3F14 A;  2B1X B;  3UJM A;  3NBR A;  3KZT A;  4XBT A;  4L7K A;  4PEJ A;  6STD A;  4X2O A;  3OV4 A;  3EN1 B;  4XBY A;  5IG5 A;  1OH0 A;  4FCJ A;  1HKX A;  3HZP A;  3EF8 A;  3KE7 A;  1E3V A;  1OHP A;  3MG2 A;  3SOY A;  3ECF A;  3I0Y A;  4OUQ A;  4HJL B;  1QJG A;  1C7H A;  3FLJ A;  1JB5 A;  5KP4 A;  3B8L A;  5STD A;  3GZB A;  1DMM A;  2I9W A;  1JB4 A;  1S5A A;  1TUH A;  1OGX A;  3KKG A;  4MJD A;  5G2G A;  1BUQ A;  3F7S A;  4R9K A;  5BVB A;  3EHC A;  1W00 A;  3NV0 A;  2HMJ B;  2RGQ A;  4HM3 B;  4STD A;  2R4I A;  3DMC A;  5IER A;  4H3U A;  4Q53 A;  3SED A;  3CU3 A;  2CHC A;  4L8P A;  2BMO B;  1NDO B;  1EA2 A;  3STD A;  3VSY A;  3EQQ B;  2YFJ B;  1Z1S A;  3MHE A;  4HM4 B;  2Z7A A;  2HMM B;  1Q40 A;  1O7M B;  2BMQ B;  2CKF B;  3FKA A;  5CF2 A;  2F86 B;  3S5C A;  4HZB B;  1O7H B;  2INX A;  3MSO A;  4LMI A;  3HK4 A;  3WMD A;  1O7W B;  3H51 A;  1ZO2 A;  2YFL B;  5IF6 A;  3CNM A;  4WP5 A;  2GXF A;  8CHO A;  3MG1 A;  3DZL A;  4KVH A;  4FCM A;  3F8H A;  1ZX2 A;  3FH1 A;  1UUV B;  3GWR A;  1NU3 A;  3LZA A;  2GBX B;  3MYT A;  4XDV A;  2XRX B;  1A2K A;  3HX8 A;  4N3V A;  1ULI B;  3GRD A;  2RCD A;  1NWW A;  4X2H A;  1ISK A;  3KSP A;  3MG3 A;  1OCV A;  3OX9 A;  1Q40 B;  3JUP A;  4HM1 B;  4HM8 B;  4CDL A;  4WWU C;  3DM8 A;  3FF2 A;  3EBY A;  4XBX A;  3F8X A;  5IG0 A;  3H3H A;  1VZZ A;  5JPU A;  4LEH A;  3BLZ A;  1W6Y A;  5IG4 A;  4L8O A;  1Q42 A;  3FSD A;  3T8N A;  3DUK A;  3NM2 A;  3B7C A;  1STD A;  2PZV A;  7STD A;  1OF5 B;  3DXO A;  4IIA A;  3ER7 A;  2BMR B;  5TGN A;  4GB5 A;  5IEN A;  2B24 B;  1GS3 A;  3F40 A;  5AII A;  5IEP A;  1OUN A;  2IMJ A;  2BNG A;  3EN8 A;  3GZY B;  4J8T A;  3GZX B;  2YFI B;  3CPO A;  3G0K A;  1SJW A;  4K1U A;  1AR0 A;  4WYK B;  1W01 A;  3B4P A;  3CNX A;  3JUM A;  5D82 A;  5KP3 A;  3FF0 A;  1W02 A;  2GEX A;  4RZM A;  2UX0 A;  3NUV A;  3D9R A;  5D81 A;  2QGU A;  4XDW A;  3NHX A;  5IEO A;  3ROB A;  2JQ5 A;  4OVM A;  3UNL A;  1O7P B;  3OWY A;  1GY6 A;  2W2C A;  1IDP A;  3Q90 A;  2HMO B;  1OF5 A;  5IG3 A;  5AEW B;  3OXA A;  1GY5 A;  3JUQ A;  4U13 A;  3EBT A;  3B4O A;  3FZW A;  3T8U A;  4HM6 B;  2GEY A;  1WQL B;  4HZ9 B;  1O7N B;  1GY7 A;  3K0Z A;  4HM5 B;  4HKV B;  3MKI A;  2OWP A;  4WYK A;  5HGR A;  5D83 A;  3OWS A;  5DRE A;  5AEU B;  5CLK A;  4HM7 B;  3OWU A;  1OHS A;  1DMQ A;  4HM2 B;  4K1V A;  3VGN A;  1U5O A;  2XSH B;  2Z76 A;  4HM0 B;  3A76 A;  1CQS A;  1JN5 B;  2QIY A;  5DRV A;  3LYG A;  1ASK A;  2XR8 B;  2Z77 A;  1ULJ B;  4LGQ A;  1E97 A;  5FW5 A;  5AIH A;  3RGA A;  2RFR A;  1JKG A;  4R9L A;  3FGY A;  2STD A;  1GYB A;  4XM4 A;  1TP6 A;  2HMN B;  3JUN A;  3M8C A;  3G8Z A;  5AIG A;  4J9A A;  1UUW B;  1DMN A;  3E99 A;  5BXQ A;  1QMA A;  3EJV A;  3GZR A;  5CXO A;  3RGR A;  3JUO A;  3G16 A;  5AI1 A;  2XSO B;  3K7C A;  2K54 A;  1JB2 A;  2HMK B;  2F98 A;  4ORL A;  5CF1 A;  1OGZ A;  4HVN A;  2GBW B;  3F9S A;  5JPP A;  3EC9 A;  4XB5 A;  1K41 A;  1O7G B;  5CK6 A;  3F7X A;  5AIF A;  5EVH A;  1JKG B;  3NV0 B;  3SOA A;  1E3R A; 
#chains in the Genus database with same CATH topology
 4R1K A;  1JN5 A;  3NQY A;  6RNT A;  3CXC 2;  3HIG A;  1US1 A;  4I4K A;  1M90 4;  1EG9 B;  1RNT A;  1FUW A;  3WOE B;  1HYF A;  2C11 A;  3KCH A;  3NXJ A;  3J7Y d;  1JBT A;  3WA3 A;  1STF I;  4BTY A;  1BRK A;  1OPY A;  2HML B;  1FW7 A;  3BB9 A;  3V98 A;  1OHO A;  3BNC A;  1IU7 A;  1DVC A;  1UI7 A;  3EX9 A;  2F99 A;  3G6E 3;  2XH9 A;  3IPT A;  3LTD A;  5KP1 A;  4EXR A;  3WOF B;  2A15 A;  3F14 A;  2B1X B;  3RDE A;  3UJM A;  1VQM 3;  3NBR A;  3KZT A;  4XBT A;  4L7K A;  1RNB A;  1ZS7 A;  4PEJ A;  4FMD A;  4JF8 A;  4N6V 0;  1W2B 2;  1FGM A;  1LQM B;  1UGI A;  1TFK A;  2IY2 A;  2Y74 A;  2O9U X;  1KD1 4;  4RBN A;  2V1L A;  1RN1 A;  2GSP A;  6STD A;  4X2O A;  1NNV A;  4AEQ A;  3X3Y A;  3CC2 3;  3OV4 A;  2CW9 A;  3EN1 B;  4XBY A;  2XFS A;  1JZD A;  4R4K A;  1UCK A;  5IG5 A;  4QWT A;  1G96 A;  1OH0 A;  4FCJ A;  1HKX A;  1W2Z A;  3HZP A;  3EF8 A;  1BSE A;  3KE7 A;  1B27 A;  1E3V A;  3HOH A;  3TDG A;  2OQE C;  4KZ1 A;  1YVS A;  1FUT A;  1OHP A;  1I70 A;  1RKY A;  3MG2 A;  1RCK A;  2KRT A;  4K90 B;  3ECF A;  3SOY A;  1VQP 3;  3I0Y A;  3WHO A;  1YHQ 3;  4OUQ A;  1BSD A;  1ROA A;  4HJL B;  1QJG A;  1C7H A;  3FLJ A;  3ZG0 A;  2BHM A;  1JB5 A;  1Q9E A;  4O3V A;  5KP4 A;  3B8L A;  5STD A;  1DE3 A;  1QAK A;  3LT8 A;  1GOV A;  3AGN A;  3GZB A;  4LSO A;  5AYS C;  1DMM A;  1X1Y A;  1IQY A;  4GSP A;  2I9W A;  1BNJ A;  1JB4 A;  4FMC A;  4CJN A;  2QA4 3;  1S5A A;  1FUS A;  1TUH A;  1OGX A;  1W6G A;  2RNT A;  2ZDJ A;  3K5T A;  3KKG A;  3LTC A;  4MJD A;  4EBG A;  3A5E A;  3ZG5 A;  3SLU A;  5G2G A;  3AHS A;  2AAD A;  4RNZ A;  3WOD G;  3F7S A;  1BUQ A;  4R9K A;  5BVB A;  4RNY A;  3EHC A;  1BRG A;  1W00 A;  2ML5 A;  3V92 A;  3GAX A;  2C4B A;  3QK9 A;  3NV0 A;  1G0T A;  3O8Y A;  2HMJ B;  3LML A;  1CH0 A;  1A2V A;  1KSI A;  2RGQ A;  1YNV X;  4FMB A;  4HM3 B;  3D79 A;  3CPW 2;  1K73 4;  1GMR A;  2XGN A;  4STD A;  1FGO A;  1LOX A;  1MNL A;  1JV2 B;  1JNQ A;  4IPB A;  3BU4 A;  1GD3 A;  3N54 B;  2Q07 A;  2R4I A;  3LOY A;  4I5Q A;  3DMC A;  1B2Z A;  4KT3 B;  1BIR A;  3D4A A;  2CX0 A;  4AKY A;  5IER A;  1WMO A;  2E2U A;  4H3U A;  3PXM A;  3NX0 A;  4H61 A;  4Q53 A;  1W5Z A;  2UUG C;  2CX1 A;  1GMQ A;  5M1A A;  3SXX A;  2F5M A;  5IW9 A;  1Y4K A;  3SED A;  1Q82 4;  4KFD A;  3IMA B;  1NB3 I;  1GMP A;  1U8C B;  2KAA A;  3X3Z A;  3CU3 A;  4ZM8 A;  3BNE A;  2BIR A;  1BRS A;  1ROV A;  1A67 A;  5FGO A;  4N6L A;  4MMZ B;  2CHC A;  2XFT A;  3QRD A;  6GSP A;  1RCL A;  2BMO B;  1BSA A;  4L8P A;  1NDO B;  1EA2 A;  1TIJ A;  3STD A;  3VSY A;  1AVL A;  3EQQ B;  2YFJ B;  1N5H A;  3U97 A;  1Z1S A;  5HOH A;  1K8A 4;  3MHE A;  1UDI I;  2J8X B;  4HM4 B;  2Z7A A;  1RGL A;  2HMM B;  1IVW A;  1Q40 A;  2MF7 A;  1O7M B;  1WMP A;  1RGK A;  2BMQ B;  2CKF B;  3FKA A;  2F86 B;  5CF2 A;  3S5C A;  7GSP A;  3D3L A;  4HZB B;  1GSP A;  1O7H B;  1SQW A;  2INX A;  3MSO A;  4LMI A;  4EC6 A;  3HK4 A;  3WMD A;  1O7W B;  3H51 A;  1ZO2 A;  4HYZ A;  2YFL B;  1NJI 4;  5IF6 A;  1W4N A;  1T2I A;  3CNM A;  1FGR A;  4WP5 A;  3UL6 A;  2GXF A;  1IK3 A;  2F5W A;  8CHO A;  1D6Z A;  3MG1 A;  3DZL A;  1G02 A;  2FGT A;  4KVH A;  1UUG B;  4FCM A;  3F8H A;  1ZX2 A;  2M7O A;  3BND A;  4NRE A;  3FH1 A;  1UUV B;  3GWR A;  1NU3 A;  3LZA A;  3G4S 3;  2OTL 3;  3S67 A;  3X40 A;  2GBX B;  1Q81 4;  3MYT A;  4XDV A;  2XRX B;  5EEO A;  3CD6 3;  3D5I A;  3LTB A;  2XGL A;  1PY3 A;  2O3O A;  2XEP A;  3FG1 A;  1HU9 A;  1A2K A;  1T5Y A;  1B20 A;  3HX8 A;  1ZGX A;  1ULI B;  4N3V A;  2ZHX B;  1LOW A;  1VQK 3;  3GRD A;  2MC8 A;  5LC6 A;  2RCD A;  1YJ9 3;  1NWW A;  1MWU A;  1TU5 A;  1JBR A;  4X2H A;  1ISK A;  1N9E A;  2CWU A;  4LZI A;  3Q3F A;  3KSP A;  3MG3 A;  3NBB A;  1L5G B;  1IVU A;  3MPH A;  1I2G A;  1OCV A;  2CC3 A;  4N6O B;  4BIR A;  4LYL B;  3OX9 A;  3DGO A;  1NB5 I;  1FGT A;  5M19 A;  1PU4 A;  1VQ7 3;  1JRQ A;  1Q40 B;  3JUP A;  3CCJ 3;  4HM1 B;  1LRA A;  4HM8 B;  1DET A;  4ILF A;  4WWU C;  4CDL A;  5BU4 A;  3DM8 A;  1VQ5 3;  1GOY A;  1DVD A;  4IT7 A;  2L1S A;  3FF2 A;  1BOX A;  3EBY A;  4XBX A;  3F8X A;  3URP A;  3T0U A;  1BAO A;  2IA7 A;  5IG0 A;  3H3H A;  1VZZ A;  1FGQ A;  2CFW A;  5JPU A;  5ELJ A;  3CCS 3;  1VQL 3;  4LEH A;  4RNT A;  2QEX 3;  4WFO A;  2F56 A;  1B3S A;  2ZL8 A;  1MWS A;  4MEI A;  4OK0 A;  3BLZ A;  4NHF A;  2IUJ A;  1SAR A;  1W6Y A;  1TRP A;  2H0G A;  1LQG C;  1RTU A;  4BL3 A;  5IG4 A;  1AVK A;  1QVG 2;  4L8O A;  2F4Y A;  1AY7 A;  1D6U A;  1Q42 A;  3ZFZ A;  2UGI A;  1A2P A;  3FSD A;  3KN4 A;  3I55 3;  1YJN 3;  2Z6B A;  5EQL A;  1I8V A;  3T8N A;  3DUK A;  3WA2 X;  1RMS A;  3NM2 A;  3B7C A;  1STD A;  3PS8 A;  2PZV A;  2KCD A;  3DGY A;  1HZ1 A;  4MMY B;  1F8N A;  1OF5 B;  1RLS A;  2P0X A;  1RSN A;  7STD A;  1Q7Y 4;  1BSB A;  1CEW I;  3DXO A;  3CC4 3;  4DKI A;  3CMA 3;  3JVC A;  4IIA A;  1X1U A;  1PFP A;  3ER7 A;  4G1M B;  5ELU A;  1GD4 A;  2BMR B;  5TGN A;  4GB5 A;  5IEN A;  1VQQ A;  2B24 B;  1FZU A;  2CIU A;  1GS3 A;  1UCJ A;  1IVV A;  1J2B A;  3F40 A;  5AII A;  1VQ8 3;  1RDS A;  5IEP A;  1OUN A;  1KC8 4;  1BSC A;  2IMJ A;  2HOH A;  2BNG A;  2W04 A;  3EN8 A;  1BVI A;  3HI7 A;  3GZY B;  1JJ2 2;  1MGW A;  1RGC A;  3DGN A;  2SBL A;  1AV4 A;  3SYU A;  2H0I A;  3U1W A;  4J8T A;  1VQO 3;  1OAC A;  2GU3 A;  1UW1 A;  3IJE B;  1YGE A;  1K28 A;  1LOV A;  3GZX B;  3LH4 A;  2YFI B;  1TTO A;  3CPO A;  1NO3 A;  1BNG A;  3G0K A;  1SJW A;  1RJO A;  3LXU X;  4K1U A;  2YX9 A;  2P0M A;  1AR0 A;  2CWT A;  4HOH A;  1IVX A;  4WYK B;  1IYY A;  1W01 A;  5M18 A;  1BU4 A;  1I3I A;  5JBS A;  5GSP A;  3B4P A;  3CNX A;  3JUM A;  4N6M A;  3DGL A;  2OQE A;  1BRN L;  1W6C A;  5D82 A;  2KF5 A;  1I0X A;  3FF0 A;  4GL6 A;  4J5G A;  5KP3 A;  1JBS A;  1W02 A;  3S27 A;  2FNQ A;  2GEX A;  4RZM A;  2R41 A;  4HAA A;  4HBR A;  1VQN 3;  3D5G A;  1LNI A;  2KF6 A;  2UX0 A;  3CCL 3;  3NM7 A;  3NUV A;  1QAL A;  2W56 A;  1QAF A;  5I97 A;  3CC7 3;  3D9R A;  5D81 A;  1MWT A;  2QGU A;  1BGS A;  1I2E A;  1BNI A;  4K61 A;  1B2X A;  1BAN A;  2CG0 A;  4XDW A;  1S72 3;  3RNT A;  2E2T A;  1SIH A;  3NHX A;  1R4Y A;  1UCI A;  5IEO A;  2CFL A;  2P05 A;  1IQ8 A;  3ROB A;  2OCT A;  2JQ5 A;  2W9P A;  4OVM A;  1B2M A;  1RGE A;  1V57 A;  1IQX A;  1N9J A;  1O7P B;  3K9M C;  1BNF A;  4KFE A;  3UNL A;  3OWY A;  3CCR 3;  1GY6 A;  2H0H A;  2W2C A;  3WR2 A;  1BNR A;  5G1L A;  1IDP A;  1N5P A;  2P09 A;  4NPB A;  4CCV A;  3LTA A;  2CK3 H;  3Q90 A;  2KF3 A;  3GSP A;  1UGH I;  3Q2P A;  3S28 A;  2BU4 A;  2HMO B;  5G1K A;  1FYS A;  1OF5 A;  2OOV A;  2W9Q A;  3SX1 A;  3K63 A;  1LXE A;  1RGH A;  3CCV 3;  1TRQ A;  2BT3 A;  1BRH A;  2LQV A;  5AEW B;  5IG3 A;  3OXA A;  1GY5 A;  3AGO A;  3JUQ A;  4U13 A;  3EBT A;  3B4O A;  1K9M 4;  1AQZ A;  5BIR A;  1VQ6 3;  4BTW A;  1Q7H A;  2D42 A;  3VF1 A;  3FZW A;  1DYU A;  1SPU A;  1V74 A;  3T8U A;  3CCU 3;  4HM6 B;  2IUK A;  2GU1 A;  4O2H A;  2K0M A;  2GEY A;  1WQL B;  1I0V A;  3G71 3;  4TX4 A;  4HZ9 B;  2JDI H;  2RSX A;  3KFQ C;  4J5K A;  1LOY A;  3X41 A;  1TFO A;  1BNS A;  3OW2 2;  1RN4 A;  1X1W A;  3FG3 A;  1EUI C;  3AMO A;  4KFF A;  1FA3 A;  1O7N B;  1GY7 A;  3ALA A;  1BUJ A;  2W56 B;  1UCL A;  3K0Z A;  1JZO A;  3KII A;  3MWZ A;  3NQZ A;  3PCS A;  4HM5 B;  4O02 B;  4BL2 A;  1C54 A;  4HKV B;  4EYC A;  3I56 3;  3MKI A;  2OWP A;  4N6T A;  4WYK A;  4CPK A;  5HGR A;  1WTH A;  1BRJ A;  3DY5 A;  1CYU A;  3PGB A;  5D83 A;  3OWS A;  5DRE A;  5AEU B;  1QVF 2;  1X1X A;  1RGA A;  7RNT A;  1B2U A;  5CLK A;  1A90 A;  2CFG A;  3EB8 A;  3SVA A;  1PYL A;  4HM7 B;  1EKM A;  2D1W A;  3OWU A;  1Q86 4;  1OHS A;  3BNB A;  1V58 A;  1DMQ A;  1M9G A;  2PNC A;  2W6J H;  4HM2 B;  2SAR A;  4K1V A;  3CCQ 3;  1VQ9 3;  2E2V A;  3VGN A;  3EE1 A;  4GHO A;  1CYV A;  1RGF A;  2KXG A;  1U5O A;  2XSH B;  3WDG B;  1IT7 A;  2CWV A;  3FG4 A;  2C10 A;  2Z76 A;  2CFK A;  3AHW A;  1RHL A;  3NBJ A;  4HM0 B;  3A76 A;  4AKZ A;  1CQS A;  2WGO A;  1YIJ 3;  1JN5 B;  4N6U A;  3PYJ A;  2WO0 A;  3BIR A;  1TJD A;  1LNH A;  2WGQ A;  2QIY A;  5DRV A;  3LYG A;  3N9H A;  1ASK A;  1T2H A;  1KQS 2;  1BRI A;  2XR8 B;  1I3F A;  3N8B A;  1MWR A;  2Z77 A;  3FCS B;  1M1X B;  1T3B A;  1ULJ B;  4LGQ A;  2L4V A;  1E97 A;  1RRL A;  3S29 A;  1W7C A;  3AMO B;  1B21 A;  4EV2 A;  5FW5 A;  5AIH A;  3DH2 A;  2RFR A;  3RGA A;  1JKG A;  2W0Q A;  4R9L A;  3FGY A;  2STD A;  4WHA A;  4FR9 A;  2IYJ A;  1GYB A;  4XM4 A;  3X3X A;  1TP6 A;  2HMN B;  3JUN A;  1IT8 A;  3M8C A;  3L0R A;  3X42 A;  3DGM A;  4BU4 A;  4O8S A;  3G8Z A;  5AIG A;  3Q1C A;  4J9A A;  4EV5 A;  1IV9 A;  1UUW B;  1M1K 4;  2KF4 A;  3CCE 3;  3PCR A;  1RRH A;  1WMN A;  2OOV C;  3UB1 A;  3CME 3;  2W03 A;  1DMN A;  3KSE D;  1MGR A;  3E99 A;  1B2S A;  5BXQ A;  2P38 A;  3V99 A;  1QMA A;  1IV7 A;  3EJV A;  3GZR A;  3HII A;  5CXO A;  3JUO A;  3RGR A;  1UI8 A;  1N8R 4;  2ML6 A;  3UL5 A;  3G16 A;  1R4C A;  2Y73 A;  5AI1 A;  1N8Q A;  4FCZ A;  1I2F A;  2XSO B;  3K7C A;  5A0O B;  4JRF A;  2K54 A;  3CCM 3;  2OTJ 3;  4FMA A;  1JB2 A;  2HMK B;  1GOU A;  1RGG A;  2F98 A;  2ZA4 A;  4ORL A;  1YVB I;  1LVN A;  5AYR B;  1EQK A;  2FXT A;  5CF1 A;  1MOL A;  2BO9 B;  1BNE A;  1OGZ A;  2LYX A;  4HVN A;  2XF3 A;  2WOF A;  2GBW B;  3F9S A;  3LT9 A;  2CFD A;  5RNT A;  5JPP A;  3EC9 A;  4XB5 A;  1YGW A;  1K41 A;  1O7G B;  1KWI A;  4N6N B;  1RN7 A;  3PZW A;  1WNH A;  2RBI A;  1YJW 3;  5CK6 A;  3F7X A;  5AIF A;  2CH9 A;  4EW5 A;  4R80 A;  5EVH A;  2WOH A;  2CG1 A;  9RNT A;  1YIT 3;  1JKG B;  2K3D A;  4BTX A;  5LC7 A;  3NV0 B;  1VQ4 3;  1D6Y A;  1YI2 3;  4MMX B;  1EEJ A;  2AAE A;  3SOA A;  8RNT A;  1E3R A;  1SII A; 
#chains in the Genus database with same CATH homology
 4R1K A;  1JN5 A;  3NQY A;  3CXC 2;  3HIG A;  1US1 A;  4I4K A;  1M90 4;  1EG9 B;  3WOE B;  2C11 A;  3NXJ A;  3J7Y d;  3WA3 A;  1STF I;  4BTY A;  1OPY A;  2HML B;  3BB9 A;  3V98 A;  1OHO A;  3BNC A;  1IU7 A;  1DVC A;  1UI7 A;  3EX9 A;  2F99 A;  3G6E 3;  2XH9 A;  3IPT A;  3LTD A;  5KP1 A;  4EXR A;  3WOF B;  2A15 A;  3F14 A;  2B1X B;  3RDE A;  3UJM A;  1VQM 3;  3NBR A;  3KZT A;  4XBT A;  4L7K A;  4PEJ A;  4FMD A;  4JF8 A;  4N6V 0;  1W2B 2;  1FGM A;  1TFK A;  2Y74 A;  2O9U X;  1KD1 4;  4RBN A;  2V1L A;  6STD A;  4X2O A;  4AEQ A;  3CC2 3;  3X3Y A;  3OV4 A;  2CW9 A;  3EN1 B;  4XBY A;  2XFS A;  4R4K A;  5IG5 A;  4QWT A;  1G96 A;  1OH0 A;  4FCJ A;  1HKX A;  1W2Z A;  3HZP A;  3EF8 A;  3KE7 A;  1E3V A;  3TDG A;  2OQE C;  4KZ1 A;  1OHP A;  1RKY A;  3MG2 A;  3SOY A;  2KRT A;  4K90 B;  3ECF A;  1VQP 3;  3I0Y A;  1YHQ 3;  4OUQ A;  1ROA A;  4HJL B;  1QJG A;  1C7H A;  3FLJ A;  2BHM A;  1JB5 A;  4O3V A;  5KP4 A;  3B8L A;  5STD A;  1QAK A;  3LT8 A;  4LSO A;  3GZB A;  5AYS C;  1DMM A;  1IQY A;  2QA4 3;  2I9W A;  4FMC A;  1JB4 A;  1S5A A;  1W6G A;  1TUH A;  1OGX A;  3K5T A;  3KKG A;  2ZDJ A;  3LTC A;  4EBG A;  4MJD A;  3SLU A;  5G2G A;  1BUQ A;  4RNZ A;  3WOD G;  3F7S A;  4R9K A;  5BVB A;  4RNY A;  3EHC A;  1W00 A;  2ML5 A;  3V92 A;  3GAX A;  3QK9 A;  3NV0 A;  3O8Y A;  2HMJ B;  3LML A;  4FMB A;  1A2V A;  1KSI A;  2RGQ A;  4HM3 B;  3CPW 2;  1K73 4;  2XGN A;  4STD A;  1FGO A;  1LOX A;  1MNL A;  1JV2 B;  1JNQ A;  4IPB A;  1GD3 A;  3N54 B;  2Q07 A;  2R4I A;  3LOY A;  3DMC A;  4AKY A;  5IER A;  1WMO A;  2E2U A;  4H3U A;  3PXM A;  3NX0 A;  4H61 A;  4Q53 A;  1W5Z A;  3SXX A;  5IW9 A;  1Y4K A;  3SED A;  1Q82 4;  4KFD A;  3IMA B;  1NB3 I;  1U8C B;  3X3Z A;  3CU3 A;  4ZM8 A;  3BNE A;  1ROV A;  1A67 A;  5FGO A;  4N6L A;  4MMZ B;  2CHC A;  2XFT A;  3QRD A;  4L8P A;  2BMO B;  1NDO B;  1EA2 A;  1TIJ A;  3STD A;  3VSY A;  1AVL A;  3EQQ B;  2YFJ B;  1N5H A;  3U97 A;  1Z1S A;  1K8A 4;  3MHE A;  4HM4 B;  2Z7A A;  2HMM B;  1IVW A;  1Q40 A;  2MF7 A;  1O7M B;  1WMP A;  2BMQ B;  2CKF B;  3FKA A;  5CF2 A;  2F86 B;  3S5C A;  3D3L A;  4HZB B;  1O7H B;  1SQW A;  2INX A;  3MSO A;  4LMI A;  4EC6 A;  3HK4 A;  3WMD A;  1O7W B;  3H51 A;  1ZO2 A;  4HYZ A;  2YFL B;  1NJI 4;  5IF6 A;  1W4N A;  3CNM A;  1FGR A;  4WP5 A;  3UL6 A;  2GXF A;  1IK3 A;  8CHO A;  1D6Z A;  3MG1 A;  3DZL A;  2FGT A;  4KVH A;  4FCM A;  3F8H A;  1ZX2 A;  2M7O A;  3BND A;  4NRE A;  3FH1 A;  1UUV B;  3GWR A;  1NU3 A;  3LZA A;  3G4S 3;  2OTL 3;  3S67 A;  3X40 A;  2GBX B;  1Q81 4;  3MYT A;  4XDV A;  2XRX B;  5EEO A;  3CD6 3;  3LTB A;  2XGL A;  2O3O A;  2XEP A;  3FG1 A;  1HU9 A;  1A2K A;  1T5Y A;  3HX8 A;  4N3V A;  1ULI B;  1VQK 3;  3GRD A;  2MC8 A;  5LC6 A;  2RCD A;  1YJ9 3;  1NWW A;  1TU5 A;  4X2H A;  1ISK A;  1N9E A;  2CWU A;  4LZI A;  3KSP A;  3MG3 A;  3NBB A;  1L5G B;  1IVU A;  3MPH A;  1OCV A;  4N6O B;  2CC3 A;  3OX9 A;  3DGO A;  1NB5 I;  1FGT A;  1VQ7 3;  1PU4 A;  1JRQ A;  1Q40 B;  3JUP A;  3CCJ 3;  4HM1 B;  4HM8 B;  4CDL A;  4WWU C;  3DM8 A;  1VQ5 3;  1DVD A;  4IT7 A;  3FF2 A;  3EBY A;  4XBX A;  3F8X A;  1YI2 3;  3T0U A;  2IA7 A;  5IG0 A;  3H3H A;  1VZZ A;  1FGQ A;  2CFW A;  5JPU A;  5ELJ A;  3CCS 3;  1VQL 3;  4LEH A;  2QEX 3;  4WFO A;  2ZL8 A;  4MEI A;  4OK0 A;  3BLZ A;  4NHF A;  2IUJ A;  1W6Y A;  5IG4 A;  1AVK A;  1QVG 2;  4L8O A;  1D6U A;  1Q42 A;  3FSD A;  3KN4 A;  1YJN 3;  3I55 3;  2Z6B A;  5EQL A;  3T8N A;  3WA2 X;  3DUK A;  3NM2 A;  3B7C A;  1STD A;  3PS8 A;  2PZV A;  2KCD A;  4MMY B;  3G71 3;  7STD A;  1F8N A;  1OF5 B;  2P0X A;  1Q7Y 4;  1CEW I;  3DXO A;  3CC4 3;  3CMA 3;  3JVC A;  4IIA A;  3ER7 A;  1PFP A;  4G1M B;  5ELU A;  1GD4 A;  2BMR B;  5TGN A;  4GB5 A;  5IEN A;  2B24 B;  2CIU A;  1GS3 A;  1IVV A;  1J2B A;  3F40 A;  5AII A;  1VQ8 3;  5IEP A;  1OUN A;  1KC8 4;  2IMJ A;  2BNG A;  2W04 A;  3EN8 A;  3HI7 A;  3GZY B;  1JJ2 2;  3DGN A;  2SBL A;  1AV4 A;  3U1W A;  4J8T A;  1VQO 3;  1OAC A;  2GU3 A;  1UW1 A;  3IJE B;  1YGE A;  1K28 A;  3LH4 A;  3GZX B;  2YFI B;  3CPO A;  1NO3 A;  3G0K A;  1SJW A;  1RJO A;  3LXU X;  4K1U A;  2YX9 A;  2P0M A;  1AR0 A;  2CWT A;  1IVX A;  4WYK B;  1W01 A;  5JBS A;  3B4P A;  3CNX A;  3JUM A;  4N6M A;  3DGL A;  2OQE A;  1W6C A;  5D82 A;  5KP3 A;  3FF0 A;  4GL6 A;  1W02 A;  3S27 A;  2FNQ A;  2GEX A;  4RZM A;  4HBR A;  1VQN 3;  2UX0 A;  3CCL 3;  3NM7 A;  3NUV A;  1QAL A;  2W56 A;  1QAF A;  5I97 A;  3CC7 3;  3D9R A;  5D81 A;  2QGU A;  4K61 A;  1S72 3;  2CG0 A;  4XDW A;  2E2T A;  1SIH A;  3NHX A;  5IEO A;  2CFL A;  2P05 A;  1IQ8 A;  3ROB A;  2OCT A;  2JQ5 A;  2W9P A;  4OVM A;  1IQX A;  1N9J A;  1O7P B;  3K9M C;  4KFE A;  3UNL A;  3CCR 3;  3OWY A;  1GY6 A;  2W2C A;  1IDP A;  1N5P A;  2P09 A;  4CCV A;  3LTA A;  2CK3 H;  3Q90 A;  3S28 A;  3Q2P A;  2HMO B;  1OF5 A;  2OOV A;  2W9Q A;  3SX1 A;  3K63 A;  1LXE A;  3CCV 3;  2BT3 A;  2LQV A;  5AEW B;  5IG3 A;  3OXA A;  1GY5 A;  3JUQ A;  4U13 A;  3EBT A;  3B4O A;  1K9M 4;  1VQ6 3;  4BTW A;  2D42 A;  3VF1 A;  3FZW A;  1DYU A;  1SPU A;  1V74 A;  3T8U A;  3CCU 3;  4HM6 B;  2IUK A;  2GU1 A;  4O2H A;  2K0M A;  2GEY A;  1WQL B;  4TX4 A;  4HZ9 B;  2JDI H;  2RSX A;  3KFQ C;  3X41 A;  1TFO A;  3OW2 2;  3FG3 A;  3AMO A;  4KFF A;  1FA3 A;  1O7N B;  1GY7 A;  3ALA A;  2W56 B;  3K0Z A;  3KII A;  3MWZ A;  3NQZ A;  3PCS A;  4HM5 B;  4O02 B;  4HKV B;  4EYC A;  3I56 3;  3MKI A;  2OWP A;  4N6T A;  4WYK A;  5HGR A;  1WTH A;  3DY5 A;  1CYU A;  3PGB A;  5D83 A;  3OWS A;  5DRE A;  5AEU B;  1QVF 2;  5CLK A;  1A90 A;  2CFG A;  3EB8 A;  3SVA A;  4HM7 B;  1EKM A;  2D1W A;  3OWU A;  1Q86 4;  1OHS A;  3BNB A;  1DMQ A;  1M9G A;  2PNC A;  2W6J H;  4HM2 B;  4K1V A;  3CCQ 3;  1VQ9 3;  2E2V A;  3VGN A;  3EE1 A;  1CYV A;  2KXG A;  1U5O A;  2XSH B;  3WDG B;  1IT7 A;  2CWV A;  3FG4 A;  2C10 A;  2Z76 A;  2CFK A;  3NBJ A;  4HM0 B;  3A76 A;  4AKZ A;  1CQS A;  2WGO A;  1YIJ 3;  1JN5 B;  4N6U A;  3PYJ A;  2WO0 A;  1LNH A;  2WGQ A;  2QIY A;  5DRV A;  3LYG A;  3N9H A;  1ASK A;  1KQS 2;  2XR8 B;  3N8B A;  2Z77 A;  3FCS B;  1M1X B;  1ULJ B;  4LGQ A;  2L4V A;  1E97 A;  1RRL A;  3S29 A;  1W7C A;  3AMO B;  4EV2 A;  5FW5 A;  5AIH A;  2RFR A;  3RGA A;  1JKG A;  2W0Q A;  4R9L A;  3FGY A;  2STD A;  4WHA A;  4FR9 A;  1GYB A;  4XM4 A;  3X3X A;  1TP6 A;  2HMN B;  3JUN A;  1IT8 A;  3M8C A;  3L0R A;  3X42 A;  3DGM A;  4O8S A;  3G8Z A;  5AIG A;  3Q1C A;  4J9A A;  4EV5 A;  1IV9 A;  1UUW B;  1M1K 4;  3CCE 3;  3PCR A;  1RRH A;  1WMN A;  2OOV C;  3UB1 A;  3CME 3;  2W03 A;  1DMN A;  3KSE D;  3E99 A;  5BXQ A;  2P38 A;  3V99 A;  1QMA A;  1IV7 A;  3EJV A;  3GZR A;  3HII A;  5CXO A;  3JUO A;  3RGR A;  1UI8 A;  1N8R 4;  2ML6 A;  3UL5 A;  3G16 A;  1R4C A;  2Y73 A;  5AI1 A;  1N8Q A;  4FCZ A;  2XSO B;  3K7C A;  5A0O B;  4JRF A;  2K54 A;  3CCM 3;  2OTJ 3;  4FMA A;  1JB2 A;  2HMK B;  2F98 A;  4ORL A;  1LVN A;  1YVB I;  5AYR B;  1EQK A;  2FXT A;  5CF1 A;  1MOL A;  2BO9 B;  2LYX A;  1OGZ A;  4HVN A;  2XF3 A;  2WOF A;  2GBW B;  3F9S A;  3LT9 A;  2CFD A;  5JPP A;  3EC9 A;  4XB5 A;  1K41 A;  1O7G B;  1KWI A;  4N6N B;  1RN7 A;  3PZW A;  1WNH A;  1YJW 3;  5CK6 A;  3F7X A;  5AIF A;  2CH9 A;  4R80 A;  5EVH A;  2WOH A;  2CG1 A;  1YIT 3;  1JKG B;  4BTX A;  5LC7 A;  3NV0 B;  1VQ4 3;  1D6Y A;  4MMX B;  1FUW A;  3SOA A;  1E3R A;  1SII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...