2HMNB

Crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmnB00
3F8XA 5D82A 4PEJA 4WWUC 3WMDA 1A2KA 3OV4A 1OPYA 3KSPA 5CK6A 1S5AA 3GRDA 3NBRA 2GEYA 1HKXA 3F8HA 5KP4A 4R1KA 2STDA 4H3UA 4CDLA 1DMNA 2GBXB 2F86B 5IG4A 3EBYA 2HMLB 1O7MB 2A15A 4XBYA 1OCVA 5D81A 3FGYA 3LZAA 3EHCA 3CNMA 3FF2A 3UNLA 4I4KA 3JUMA 5AIGA 4XB5A 5CXOA 4L7KA 4N3VA 3OXAA 4LGQA 1GY6A 3JUNA 3GWRA 3GZBA 2BMRB 2B1XB 4ORLA 4XM4A 3G8ZA 3NM2A 4HM4B 3HK4A 1OF5A 4FCMA 2B24B 4IIAA 3FZWA 3EQQB 1OHOA 1WQLB 3OWYA 5FW5A 3FKAA 3D9RA 1IDPA 3K0ZA 3STDA 1Q40A 3ER7A 2JQ5A 5IG0A 1E3VA 3T8NA 4J9AA 2F98A 4WYKB 5KP3A 1GY7A 2XRXB 4R9KA 3NV0A 5IG5A 3JUPA 1JKGB 5IEPA 5BVBA 2Z77A 4HM1B 3CPOA 1ISKA 1BUQA 4K1VA 5AIIA 3EBTA 5KP1A 3MHEA 1AR0A 2XSOB 1EA2A 3FF0A 4J8TA 1U5OA 2BNGA 3GZYB 5AEUB 3E99A 1UUVB 1ASKA 3EJVA 4R9LA 5EVHA 4U13A 4XBTA 4HM7B 4HZ9B 1OGXA 3CU3A 3BB9A 4FCJA 1NWWA 1JN5B 1GY5A 3DZLA 3F7SA 1TUHA 2I9WA 1JB4A 1GS3A 5IERA 1W6YA 1E97A 3OWSA 3IPTA 4OVMA 5IEOA 1STDA 1OUNA 1JB5A 4HM5B 4L8PA 4X2HA 3MYTA 1O7GB 3T8UA 3SOYA 3DXOA 1QJGA 3F14A 2QIYA 3MKIA 4HM6B 2HMNB 4XDWA 2BMOB 5AEWB 3VSYA 2IMJA 3BLZA 2RFRA 2R4IA 3CNXA 4WP5A 3S5CA 1NDOB 1W01A 6STDA 1DMQA 2INXA 3MG3A 2BMQB 3SOAA 1EG9B 3G0KA 3JUQA 1Q42A 3RGRA 3ECFA 3EN8A 1W00A 3VGNA 3FLJA 4HJLB 4RZMA 3EF8A 1CQSA 3UJMA 4XDVA 3H3HA 2PZVA 4HKVB 1Z1SA 7STDA 4HM3B 3B8LA 3OWUA 4L8OA 1NU3A 2GEXA 1OGZA 3M8CA 1E3RA 5CF2A 3GZRA 3Q90A 5CLKA 2W2CA 1ULIB 5D83A 3ROBA 3SEDA 4HM0B 1OF5B 2OWPA 5STDA 3F9SA 3FH1A 3RGAA 1O7HB 4MJDA 3FSDA 5BXQA 2Z7AA 3HX8A 4KVHA 1Q40B 4K1UA 3NHXA 3HZPA 3DUKA 4STDA 3MG1A 3OX9A 3F40A 3A76A 1ZO2A 3DMCA 3F7XA 2YFJB 2UX0A 3H51A 4LMIA 2HMMB 2XR8B 3NV0B 2CHCA 1JB2A 4HZBB 3I0YA 3EX9A 1VZZA 1O7NB 5IF6A 1DMMA 3LYGA 1K41A 4WYKA 1OHSA 5DRVA 1C7HA 1OH0A 1OHPA 3B4OA 3K7CA 5AIFA 2QGUA 3KZTA 5IENA 5AI1A 1JKGA 1W02A 1TP6A 3NUVA 8CHOA 1GYBA 2F99A 3DM8A 4OUQA 3NXJA 2HMJB 5JPUA 4LEHA 3G16A 5IG3A 5JPPA 1SJWA 1O7WB 3JUOA 2K54A 2XSHB 3MSOA 2YFIB 2GXFA 4GB5A 3KKGA 3EC9A 2HMKB 4XBXA 5TGNA 3KE7A 2YFLB 2HMOB 3EN1B 4HVNA 4X2OA 3MG2A 4HM2B 1QMAA 1O7PB 2Z76A 1JN5A 2GBWB 1ZX2A 2CKFB 5DREA 3B4PA 5AIHA 3GZXB 2RCDA 5HGRA 1UUWB 2RGQA 5G2GA 5CF1A 4HM8B 4Q53A 1ULJB 3B7CA
chains in the Genus database with same CATH superfamily
1VQN3 1RSNA 2WOHA 3F8XA 5D82A 1S723 5IW9A 1AVKA 3Q1CA 4I5QA 4HOHA 1CEWI 4PEJA 4WWUC 1A2KA 1D6UA 1PYLA 2OQEC 1OPYA 2YX9A 3OV4A 3KSPA 4WFOA 5CK6A 5M19A 1S5AA 3ALAA 4N6MA 3GRDA 3NBRA 2GEYA 1HKXA 2CX0A 2F5WA 3HOHA 3F8HA 3Q2PA 4HYZA 5KP4A 2CC3A 4R1KA 1TFKA 2IY2A 4MMXB 1BRHA 1MGWA 4BU4A 1GMQA 4AEQA 2WGOA 3LTAA 3HIIA 5JBSA 6GSPA 3DY5A 1C54A 2STDA 2V1LA 4N6LA 3CCR3 4H3UA 4TX4A 3CCL3 4IPBA 4CDLA 1JJ22 3CD63 1DMNA 2GBXB 2CWVA 3EB8A 2F86B 5IG4A 3EBYA 2HMLB 3BIRA 5LC6A 4BTWA 1KSIA 1O7MB 3WODG 1LXEA 1DVCA 2A15A 4GHOA 2W6JH 1YJ93 1BOXA 1FA3A 2Q07A 5I97A 1JZOA 4GSPA 4XBYA 3NBBA 2E2VA 1K8A4 1OCVA 5D81A 4CCVA 1GMPA 1I70A 3FGYA 3LZAA 1Q9EA 1A67A 1FGTA 1I0VA 1BSBA 3EHCA 3IMAB 3Q3FA 2CFGA 1FGRA 1TFOA 1NB3I 3CNMA 3FF2A 3S67A 4RNZA 1IYYA 2Y73A 4N6TA 1IQ8A 1UCKA 1BANA 4I4KA 1SPUA 3UNLA 1DYUA 3JUMA 5AIGA 4LSOA 1JBRA 4XB5A 5CXOA 1RRLA 4LYLB 4L7KA 4N3VA 3SYUA 1QAKA 2L1SA 1W5ZA 1JZDA 3FCSB 3OXAA 4N6OB 4LGQA 1GY6A 1TJDA 3JUNA 4O3VA 3GWRA 3GZBA 2BMRB 1AV4A 3QK9A 1N8QA 2B1XB 2SBLA 1JRQA 2XFSA 3K9MC 4ORLA 3X3ZA 4FMCA 4NREA 3AMOB 4XM4A 1NNVA 1VQM3 4GL6A 1IQXA 1QALA 3G8ZA 4J5KA 3NM2A 1YIJ3 2GSPA 4HM4B 5FGOA 1LOXA 1VQ93 3CC43 3HK4A 2CWTA 1OF5A 2UGIA 4FCMA 2B24B 3T0UA 4IIAA 2C4BA 2R41A 1BSEA 3FZWA 2H0GA 2K3DA 3EQQB 2OQEA 1OHOA 3AGOA 1N9EA 2KXGA 1VQ83 2K0MA 1WQLB 1I3IA 1KWIA 3OWYA 3PCSA 4AKYA 1F8NA 3FKAA 5FW5A 4LZIA 3D9RA 1IDPA 3K0ZA 3STDA 3CCV3 1EQKA 1Q40A 3NM7A 3ER7A 3N54B 2JQ5A 4RNTA 5IG0A 2P05A 2QA43 1E3VA 1VQ53 2PNCA 3T8NA 1LQMB 1B21A 2W0QA 3HIGA 2BO9B 1ROVA 4J9AA 2QEX3 1BRSA 1I2FA 1VQK3 3LH4A 1VQL3 1FW7A 1BIRA 2F98A 4WYKB 3ZG5A 1JNQA 2Y74A 8RNTA 3G4S3 3JVCA 5KP3A 1RNTA 4NHFA 9RNTA 1GY7A 2IA7A 1VQP3 3AHWA 1WTHA 2C11A 1CYUA 2XRXB 1BNGA 3WDGB 4R9KA 3NV0A 3FG1A 3LOYA 5IG5A 3JUPA 3PXMA 1JKGB 1UUGB 3AGNA 5IEPA 5BVBA 1QVG2 2Z77A 4HM1B 3CPOA 4JF8A 1ISKA 1BUJA 2XFTA 1BUQA 4K1VA 1NB5I 3BNCA 5BU4A 3CC73 5AIIA 1M1K4 2OOVC 3I553 2HOHA 2O3OA 3EBTA 5KP1A 1DE3A 4FMAA 1ROAA 1HU9A 3MHEA 2D1WA 1AR0A 2FXTA 3BNDA 2XSOB 1IVWA 1JV2B 1N5PA 2KRTA 1SIHA 4EV5A 1IVXA 3KN4A 1EA2A 1AQZA 3FF0A 3FG4A 3PGBA 1U5OA 2BNGA 3QRDA 1YVSA 3GZYB 1EKMA 4J8TA 4R80A 4MEIA 1RMSA 4RNYA 6RNTA 5AEUB 3LXUX 3E99A 1UUVB 1ZS7A 1QAFA 3WA3A 1FGOA 1RGKA 2KAAA 1ASKA 2XH9A 3EJVA 4BTXA 3LMLA 4R9LA 3U1WA 5EVHA 1A2VA 4U13A 4XBTA 3IJEB 4HM7B 4N6UA 1B2UA 3CCS3 3DGMA 4HZ9B 1BNJA 5A0OB 2ML5A 1OGXA 1T2HA 3CU3A 1FUSA 1N8R4 3BB9A 3D4AA 3X41A 3CCE3 1LNHA 3V99A 1BVIA 1UGIA 3AHSA 4FCJA 2P38A 3CPW2 1NWWA 1LQGC 1B2MA 1JN5B 1TTOA 1GY5A 4KZ1A 1YIT3 3DZLA 3NX0A 3F7SA 5AYRB 1TU5A 1TUHA 1WNHA 1Q864 5ELJA 2I9WA 2W56A 5ELUA 4CPKA 1JB4A 1GS3A 3WR2A 3LT9A 4FCZA 3WMDA 1I3FA 2H0HA 1A2PA 2IUKA 1U8CB 3VF1A 5AYSC 4ILFA 1RKYA 4HBRA 1J2BA 1B27A 5IERA 5G1LA 4EYCA 1W6YA 1E97A 1G96A 3HI7A 2FGTA 3OWSA 2JDIH 3IPTA 3V92A 1VQ73 3PYJA 1HZ1A 2XGNA 1FGQA 1B20A 1M904 4OVMA 2P0XA 5IEOA 4DKIA 1STDA 2RSXA 1OUNA 1V74A 1JB5A 4KFFA 1RGHA 3DGLA 1BSCA 4HM5B 2AAEA 1VQO3 1X1UA 4L8PA 4X2HA 3CC23 3MYTA 1O7GB 1FZUA 2CWUA 3T8UA 1RN4A 1EUIC 3DXOA 3SOYA 1A90A 1GD4A 4O2HA 1BU4A 3GAXA 4WHAA 4KT3B 3X3YA 2W03A 1UCLA 4N6V0 2F56A 1QJGA 2OOVA 3F14A 1BRGA 2QIYA 1UW1A 4EC6A 1MOLA 3TDGA 1D6YA 3MKIA 3WA2X 2KF5A 5BIRA 1T3BA 2F4YA 3PS8A 4BTYA 4HM6B 2KCDA 3S28A 4N6NB 1YNVX 2HMNB 2E2UA 1RGFA 4XDWA 1B2XA 4KFEA 3N8BA 2BMOB 5AEWB 1KC84 1NJI4 3VSYA 1RGGA 1TIJA 1PY3A 1AY7A 2IMJA 3BLZA 2RFRA 4O02B 2R4IA 1WMPA 3CNXA 4WP5A 3SX1A 4KFDA 3S5CA 2AADA 1NDOB 1PFPA 1Q7HA 1W01A 2CX1A 1DMQA 2INXA 3MG3A 3SXXA 1B2SA 6STDA 2BMQB 1GD3A 2OCTA 1G0TA 2WO0A 3SOAA 1I2EA 1RGEA 3WHOA 1EG9B 3G0KA 1GOYA 3JUQA 1Q42A 3WOEB 5RNTA 3RGRA 1D6ZA 2BU4A 2XF3A 2Z6BA 1LOYA 3ECFA 4BIRA 1N9JA 2GU3A 3S27A 3EN8A 1W00A 3VGNA 3X40A 3KCHA 3CCQ3 3I563 1V57A 3FLJA 3LT8A 1IT8A 4HJLB 1US1A 1BRIA 2LQVA 4RZMA 2CFKA 2C10A 3EF8A 1M9GA 3NQYA 1CQSA 3UJMA 4XDVA 1RNBA 1CYVA 3H3HA 2W9QA 3CMA3 2PZVA 4HKVB 1IT7A 1Z1SA 7STDA 3BNBA 4ZM8A 1IQYA 2FNQA 4HM3B 1LOVA 1IVVA 1SQWA 3B8LA 3OWUA 3D3LA 4L8OA 1NU3A 2GEXA 2ZDJA 1BNSA 3BU4A 1OGZA 1W7CA 1E3RA 3M8CA 1NO3A 3GZRA 5CF2A 3OW22 2ZHXB 3GSPA 3Q90A 1YI23 5CLKA 4QWTA 1SARA 1RN1A 1MGRA 3DGOA 2H0IA 1T2IA 3KIIA 2W2CA 4JRFA 1ULIB 3FG3A 1EEJA 5D83A 3ROBA 3SEDA 2J8XB 4HM0B 1OF5B 2OWPA 2WOFA 3D5GA 1LNIA 1LVNA 1BNIA 5STDA 1Q814 1IV9A 1TRQA 3F9SA 3FH1A 1FUWA 3RGAA 1KQS2 2P0MA 2W9PA 1O7HB 2D42A 4MJDA 3G6E3 2IYJA 3FSDA 1I8VA 1UCIA 5BXQA 2KF4A 2OTL3 2Z7AA 3HX8A 1UI7A 4EBGA 2SARA 1K28A 1GMRA 3K63A 1VQQA 2WGQA 1Q40B 3MPHA 4K1UA 4KVHA 2L4VA 5G1KA 3URPA 1VQ43 3NHXA 3ZFZA 1K734 3AMOA 2CG1A 2F5MA 1YGEA 2XGLA 2MC8A 3HZPA 3UL5A 3DUKA 1SIIA 3V98A 1DVDA 1FUTA 4STDA 3MG1A 3OX9A 3F40A 1I0XA 3A76A 1ZGXA 1RTUA 3X42A 4FMBA 3DGYA 1WMNA 1PU4A 1RN7A 1ZO2A 3DMCA 3F7XA 1M1XB 1RLSA 3S29A 1LRAA 1JBSA 1RGLA 1IV7A 4MMYB 3EE1A 2YFJB 2UX0A 1GSPA 3H51A 4LMIA 1IU7A 5M18A 3CME3 2HMMB 3PZWA 2XR8B 3NV0B 1VQ63 2CHCA 1BNRA 4AKZA 1T5YA 1JB2A 3KFQC 1AVLA 4HZBB 1BSDA 3I0YA 3EX9A 1MWUA 1VZZA 3SLUA 1IK3A 1GOVA 1WMOA 2XEPA 4HAAA 1QVF2 3LTCA 4FMDA 5M1AA 1O7NB 5IF6A 2OTJ3 3X3XA 2BHMA 1DMMA 1BNEA 1K41A 3LYGA 7GSPA 5GSPA 4WYKA 1OHSA 1R4YA 1X1XA 5DRVA 5LC7A 1Y4KA 1W6CA 3L0RA 1C7HA 3N9HA 1OH0A 2ML6A 1BGSA 1OHPA 2CK3H 2P09A 1BRJA 1RHLA 3B4OA 3K7CA 1X1WA 2QGUA 5AIFA 1YJN3 1BRKA 2ZL8A 1BRNL 2LYXA 3KZTA 1RGAA 4H61A 4RBNA 5IENA 3CCU3 5AI1A 1JKGA 1HYFA 2RBIA 1W02A 1TP6A 2MF7A 3NUVA 3CCM3 4EXRA 1UI8A 2CW9A 1L5GB 8CHOA 1W4NA 1MWRA 1RRHA 1TRPA 3RNTA 1YGWA 3SVAA 1GYBA 1R4CA 2F99A 3DM8A 4BL2A 4OUQA 3NXJA 2HMJB 1GOUA 5JPUA 4LEHA 1MWSA 1DETA 3G16A 3D5IA 4NPBA 5IG3A 3J7Yd 5JPPA 3WOFB 2KF6A 4K90B 1SJWA 1IVUA 1UDII 1BSAA 1X1YA 3RDEA 3CXC2 2RNTA 2E2TA 1YHQ3 1O7WB 1KD14 3JUOA 4J5GA 1RCLA 1V58A 1W6GA 5EQLA 4EW5A 1CH0A 5HOHA 1JBTA 1BNFA 2K54A 4EV2A 1Q7Y4 2XSHB 1BAOA 1I2GA 3MSOA 3KSED 2O9UX 1RCKA 2YFIB 1N5HA 1OACA 2GXFA 4GB5A 4OK0A 2ZA4A 3KKGA 1B2ZA 2CH9A 3EC9A 2CFLA 2HMKB 3MWZA 3DH2A 4XBXA 2W56B 5TGNA 1YVBI 3UB1A 1FYSA 2CFWA 3KE7A 2YFLB 1MWTA 3NQZA 4O8SA 1Q824 3D79A 2HMOB 1YJW3 2BIRA 1G02A 3EN1B 3LTBA 1LOWA 4HVNA 4X2OA 4CJNA 3MG2A 1RJOA 4FR9A 1FGMA 3PCRA 4HM2B 1QMAA 3A5EA 1UCJA 4BL3A 1O7PB 2Z76A 1RDSA 7RNTA 1JN5A 2GBWB 3DGNA 2IUJA 1W2B2 1MNLA 1UGHI 1ZX2A 2CKFB 3BNEA 3B4PA 3LTDA 4IT7A 5DREA 2GU1A 2BT3A 3U97A 5AIHA 2CG0A 3CCJ3 2M7OA 1B3SA 3GZXB 2W04A 2RCDA 2KF3A 1RGCA 5HGRA 1K9M4 1UUWB 2RGQA 3K5TA 4G1MB 4MMZB 3ZG0A 4R4KA 5G2GA 5CF1A 3NBJA 2CIUA 2CFDA 3G713 3UL6A 1W2ZA 3O8YA 2UUGC 4HM8B 4K61A 5EEOA 1STFI 4Q53A 1ULJB 3B7CA
chains in the Genus database with same CATH topology
1VQN3 2WOHA 3F8XA 5D82A 1S723 5IW9A 1AVKA 3Q1CA 4PEJA 1CEWI 4WWUC 4WFOA 1A2KA 1D6UA 2OQEC 2YX9A 1OPYA 3OV4A 3WMDA 3KSPA 5CK6A 1S5AA 3ALAA 4N6MA 3GRDA 3NBRA 2GEYA 1HKXA 4HYZA 3F8HA 3Q2PA 5KP4A 2CC3A 4R1KA 1TFKA 4MMXB 4AEQA 2WGOA 3LTAA 3HIIA 5JBSA 3DY5A 2STDA 2V1LA 4N6LA 3CCR3 4H3UA 4TX4A 3CCL3 4IPBA 4CDLA 1JJ22 3CD63 1DMNA 2GBXB 2CWVA 3EB8A 2F86B 5IG4A 3EBYA 2HMLB 5LC6A 4BTWA 1KSIA 1O7MB 3WODG 1LXEA 1DVCA 2A15A 2W6JH 1YJ93 1FA3A 2Q07A 5I97A 4XBYA 3NBBA 2E2VA 1K8A4 1OCVA 5D81A 4CCVA 3FGYA 3LZAA 1A67A 1FGTA 3IMAB 3EHCA 3S67A 2CFGA 1FGRA 1TFOA 1NB3I 3CNMA 3FF2A 4RNZA 2Y73A 4N6TA 1IQ8A 3UNLA 4I4KA 1SPUA 1DYUA 3JUMA 5AIGA 4LSOA 4XB5A 5CXOA 1RRLA 4L7KA 4N3VA 1QAKA 1W5ZA 3FCSB 3OXAA 4N6OB 4LGQA 1GY6A 3JUNA 4O3VA 3GWRA 3GZBA 2BMRB 1AV4A 3QK9A 1N8QA 2B1XB 2SBLA 1JRQA 2XFSA 3K9MC 4ORLA 3X3ZA 4FMCA 4NREA 3AMOB 4XM4A 1VQM3 4GL6A 1IQXA 1QALA 3G8ZA 3NM2A 1YIJ3 5FGOA 4HM4B 1LOXA 1VQ93 3CC43 3HK4A 2CWTA 1OF5A 4FCMA 3T0UA 2B24B 4IIAA 3FZWA 3EQQB 2OQEA 1OHOA 1N9EA 2KXGA 1VQ83 2K0MA 1WQLB 1KWIA 3OWYA 3PCSA 4AKYA 1F8NA 3FKAA 5FW5A 4LZIA 3D9RA 1IDPA 3K0ZA 3STDA 3CCV3 1EQKA 1Q40A 3NM7A 3ER7A 3N54B 2JQ5A 5IG0A 2P05A 2QA43 1E3VA 1VQ53 2PNCA 3T8NA 3HIGA 2W0QA 2BO9B 1ROVA 4J9AA 2QEX3 1VQK3 3LH4A 1VQL3 2F98A 4WYKB 1JNQA 2Y74A 3G4S3 3JVCA 5KP3A 4NHFA 1GY7A 2IA7A 1VQP3 1WTHA 2C11A 1CYUA 2XRXB 3WDGB 4R9KA 3NV0A 3FG1A 3LOYA 5IG5A 3JUPA 3PXMA 1JKGB 5IEPA 5BVBA 1QVG2 2Z77A 4HM1B 3CPOA 4JF8A 1ISKA 2XFTA 1BUQA 4K1VA 1NB5I 3BNCA 3CC73 1M1K4 5AIIA 2OOVC 3I553 2O3OA 3EBTA 5KP1A 4FMAA 1ROAA 1HU9A 3MHEA 2D1WA 1AR0A 2FXTA 3BNDA 2XSOB 1IVWA 1JV2B 1N5PA 2KRTA 1SIHA 4EV5A 1IVXA 3KN4A 1EA2A 3FF0A 3FG4A 3PGBA 1U5OA 2BNGA 3QRDA 4J8TA 3GZYB 1EKMA 4R80A 4MEIA 4RNYA 5AEUB 3LXUX 3E99A 1UUVB 1QAFA 3WA3A 1FGOA 2XH9A 4BTXA 1ASKA 3EJVA 3LMLA 4R9LA 3U1WA 5EVHA 1A2VA 4U13A 4XBTA 3IJEB 4HM7B 4N6UA 3CCS3 3DGMA 4HZ9B 5A0OB 2ML5A 1OGXA 3CU3A 1N8R4 3BB9A 3X41A 3CCE3 1LNHA 3V99A 4FCJA 2P38A 3CPW2 1NWWA 1JN5B 1GY5A 4KZ1A 1YIT3 3DZLA 3NX0A 3F7SA 5AYRB 1TU5A 1TUHA 1WNHA 1Q864 5ELJA 2I9WA 2W56A 5ELUA 1JB4A 1GS3A 3LT9A 4FCZA 2IUKA 1U8CB 3VF1A 5AYSC 1RKYA 4HBRA 1J2BA 5IERA 4EYCA 1W6YA 1E97A 1G96A 3HI7A 2FGTA 3OWSA 2JDIH 3IPTA 3V92A 1VQ73 3PYJA 2XGNA 1FGQA 1M904 4OVMA 2P0XA 5IEOA 1STDA 2RSXA 1OUNA 1V74A 1JB5A 4KFFA 3DGLA 4HM5B 1VQO3 4L8PA 4X2HA 3CC23 3MYTA 1O7GB 2CWUA 3T8UA 3DXOA 3SOYA 1A90A 1GD4A 4O2HA 3GAXA 4WHAA 3X3YA 2W03A 4N6V0 1QJGA 2OOVA 3F14A 2QIYA 1UW1A 4EC6A 1MOLA 3TDGA 1D6YA 3MKIA 3WA2X 4BTYA 3PS8A 4HM6B 2KCDA 3S28A 4N6NB 2HMNB 2E2UA 4XDWA 4KFEA 3N8BA 2BMOB 5AEWB 1KC84 1NJI4 3VSYA 1TIJA 2IMJA 3BLZA 2RFRA 4O02B 2R4IA 1WMPA 3CNXA 4WP5A 3SX1A 4KFDA 3S5CA 4EBGA 1NDOB 1PFPA 1W01A 3SXXA 1DMQA 2INXA 3MG3A 6STDA 2BMQB 1GD3A 2OCTA 2WO0A 3SOAA 1EG9B 3G0KA 3JUQA 3WOEB 1Q42A 3RGRA 1D6ZA 2XF3A 2Z6BA 3ECFA 1N9JA 2GU3A 3S27A 3EN8A 1W00A 3VGNA 3X40A 3CCQ3 3I563 3FLJA 3LT8A 1IT8A 4HJLB 1US1A 2LQVA 4RZMA 2CFKA 2C10A 3EF8A 1M9GA 3NQYA 1CQSA 3UJMA 4XDVA 1CYVA 3H3HA 2W9QA 3CMA3 2PZVA 4HKVB 1IT7A 1Z1SA 7STDA 3BNBA 4ZM8A 1IQYA 2FNQA 4HM3B 1IVVA 1SQWA 3B8LA 3OWUA 3D3LA 4L8OA 1NU3A 2GEXA 2ZDJA 1OGZA 1W7CA 1E3RA 3M8CA 1NO3A 3GZRA 5CF2A 3OW22 3Q90A 1YI23 5CLKA 4QWTA 3DGOA 3KIIA 2W2CA 4JRFA 1ULIB 3FG3A 5D83A 3ROBA 3SEDA 4HM0B 1OF5B 2OWPA 2WOFA 1LVNA 5STDA 1Q814 1IV9A 3F9SA 3FH1A 3RGAA 1KQS2 2P0MA 2W9PA 1O7HB 2D42A 4MJDA 3G6E3 3FSDA 5BXQA 2OTL3 2Z7AA 3HX8A 1UI7A 3MPHA 1K28A 3K63A 2WGQA 4KVHA 1Q40B 4K1UA 1VQ43 2L4VA 3NHXA 1K734 3AMOA 2CG1A 2MC8A 1YGEA 2XGLA 3UL5A 3HZPA 3V98A 3DUKA 1SIIA 1DVDA 4STDA 3MG1A 3OX9A 3F40A 3A76A 3X42A 4FMBA 1WMNA 1PU4A 1RN7A 1ZO2A 3DMCA 3F7XA 1M1XB 3S29A 1IV7A 4MMYB 3EE1A 2YFJB 2UX0A 3H51A 4LMIA 1IU7A 3CME3 1VQ63 2HMMB 3PZWA 2XR8B 3NV0B 2CHCA 4AKZA 1T5YA 1JB2A 3KFQC 1AVLA 4HZBB 3I0YA 3EX9A 1VZZA 3SLUA 1IK3A 1QVF2 1WMOA 2XEPA 3LTCA 4FMDA 1O7NB 5IF6A 2OTJ3 3X3XA 2BHMA 1DMMA 3LYGA 1K41A 4WYKA 1OHSA 5DRVA 5LC7A 1Y4KA 1W6CA 3L0RA 1C7HA 3N9HA 1OH0A 2ML6A 1OHPA 2CK3H 2P09A 3B4OA 3K7CA 5AIFA 1YJN3 2QGUA 2ZL8A 2LYXA 3KZTA 4H61A 3CCU3 4RBNA 5IENA 5AI1A 1JKGA 1W02A 1TP6A 2MF7A 3NUVA 3CCM3 4EXRA 1UI8A 2CW9A 1L5GB 8CHOA 1W4NA 3SVAA 1RRHA 1GYBA 1R4CA 2F99A 3DM8A 4OUQA 3NXJA 2HMJB 5JPUA 4LEHA 3G16A 5IG3A 3J7Yd 5JPPA 3WOFB 4K90B 3CXC2 1SJWA 1IVUA 3RDEA 2E2TA 1YHQ3 1O7WB 1KD14 3JUOA 1W6GA 5EQLA 2K54A 4EV2A 1Q7Y4 2XSHB 3MSOA 3KSED 2O9UX 2YFIB 1N5HA 1OACA 2GXFA 4GB5A 4OK0A 3KKGA 3MWZA 2CH9A 3EC9A 2CFLA 2HMKB 4XBXA 2W56B 5TGNA 1YVBI 3UB1A 2CFWA 3KE7A 2YFLB 3NQZA 4O8SA 1Q824 2HMOB 1YJW3 3LTBA 3EN1B 4HVNA 4X2OA 3MG2A 1RJOA 4FR9A 1FGMA 3PCRA 4HM2B 1QMAA 1FUWA 1O7PB 2Z76A 1JN5A 2GBWB 3DGNA 2IUJA 1W2B2 1MNLA 1ZX2A 2CKFB 3BNEA 3LTDA 3B4PA 4IT7A 5DREA 2GU1A 2BT3A 3U97A 5AIHA 2CG0A 3CCJ3 2M7OA 3GZXB 2W04A 2RCDA 5HGRA 1K9M4 1UUWB 2RGQA 3K5TA 4G1MB 4MMZB 4R4KA 5G2GA 5CF1A 3NBJA 2CIUA 2CFDA 3G713 3UL6A 1W2ZA 3O8YA 4HM8B 4K61A 5EEOA 1STFI 4Q53A 1ULJB 3B7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8X A;  5D82 A;  4PEJ A;  4WWU C;  3WMD A;  1A2K A;  3OV4 A;  1OPY A;  3KSP A;  5CK6 A;  1S5A A;  3GRD A;  3NBR A;  2GEY A;  1HKX A;  3F8H A;  5KP4 A;  4R1K A;  2STD A;  4H3U A;  4CDL A;  1DMN A;  2GBX B;  2F86 B;  5IG4 A;  3EBY A;  2HML B;  1O7M B;  2A15 A;  4XBY A;  1OCV A;  5D81 A;  3FGY A;  3LZA A;  3EHC A;  3CNM A;  3FF2 A;  3UNL A;  4I4K A;  3JUM A;  5AIG A;  4XB5 A;  5CXO A;  4L7K A;  4N3V A;  3OXA A;  4LGQ A;  1GY6 A;  3JUN A;  3GWR A;  3GZB A;  2BMR B;  2B1X B;  4ORL A;  4XM4 A;  3G8Z A;  3NM2 A;  4HM4 B;  3HK4 A;  1OF5 A;  4FCM A;  2B24 B;  4IIA A;  3FZW A;  3EQQ B;  1OHO A;  1WQL B;  3OWY A;  5FW5 A;  3FKA A;  3D9R A;  1IDP A;  3K0Z A;  3STD A;  1Q40 A;  3ER7 A;  2JQ5 A;  5IG0 A;  1E3V A;  3T8N A;  4J9A A;  2F98 A;  4WYK B;  5KP3 A;  1GY7 A;  2XRX B;  4R9K A;  3NV0 A;  5IG5 A;  3JUP A;  1JKG B;  5IEP A;  5BVB A;  2Z77 A;  4HM1 B;  3CPO A;  1ISK A;  1BUQ A;  4K1V A;  5AII A;  3EBT A;  5KP1 A;  3MHE A;  1AR0 A;  2XSO B;  1EA2 A;  3FF0 A;  4J8T A;  1U5O A;  2BNG A;  3GZY B;  5AEU B;  3E99 A;  1UUV B;  1ASK A;  3EJV A;  4R9L A;  5EVH A;  4U13 A;  4XBT A;  4HM7 B;  4HZ9 B;  1OGX A;  3CU3 A;  3BB9 A;  4FCJ A;  1NWW A;  1JN5 B;  1GY5 A;  3DZL A;  3F7S A;  1TUH A;  2I9W A;  1JB4 A;  1GS3 A;  5IER A;  1W6Y A;  1E97 A;  3OWS A;  3IPT A;  4OVM A;  5IEO A;  1STD A;  1OUN A;  1JB5 A;  4HM5 B;  4L8P A;  4X2H A;  3MYT A;  1O7G B;  3T8U A;  3SOY A;  3DXO A;  1QJG A;  3F14 A;  2QIY A;  3MKI A;  4HM6 B;  2HMN B;  4XDW A;  2BMO B;  5AEW B;  3VSY A;  2IMJ A;  3BLZ A;  2RFR A;  2R4I A;  3CNX A;  4WP5 A;  3S5C A;  1NDO B;  1W01 A;  6STD A;  1DMQ A;  2INX A;  3MG3 A;  2BMQ B;  3SOA A;  1EG9 B;  3G0K A;  3JUQ A;  1Q42 A;  3RGR A;  3ECF A;  3EN8 A;  1W00 A;  3VGN A;  3FLJ A;  4HJL B;  4RZM A;  3EF8 A;  1CQS A;  3UJM A;  4XDV A;  3H3H A;  2PZV A;  4HKV B;  1Z1S A;  7STD A;  4HM3 B;  3B8L A;  3OWU A;  4L8O A;  1NU3 A;  2GEX A;  1OGZ A;  3M8C A;  1E3R A;  5CF2 A;  3GZR A;  3Q90 A;  5CLK A;  2W2C A;  1ULI B;  5D83 A;  3ROB A;  3SED A;  4HM0 B;  1OF5 B;  2OWP A;  5STD A;  3F9S A;  3FH1 A;  3RGA A;  1O7H B;  4MJD A;  3FSD A;  5BXQ A;  2Z7A A;  3HX8 A;  4KVH A;  1Q40 B;  4K1U A;  3NHX A;  3HZP A;  3DUK A;  4STD A;  3MG1 A;  3OX9 A;  3F40 A;  3A76 A;  1ZO2 A;  3DMC A;  3F7X A;  2YFJ B;  2UX0 A;  3H51 A;  4LMI A;  2HMM B;  2XR8 B;  3NV0 B;  2CHC A;  1JB2 A;  4HZB B;  3I0Y A;  3EX9 A;  1VZZ A;  1O7N B;  5IF6 A;  1DMM A;  3LYG A;  1K41 A;  4WYK A;  1OHS A;  5DRV A;  1C7H A;  1OH0 A;  1OHP A;  3B4O A;  3K7C A;  5AIF A;  2QGU A;  3KZT A;  5IEN A;  5AI1 A;  1JKG A;  1W02 A;  1TP6 A;  3NUV A;  8CHO A;  1GYB A;  2F99 A;  3DM8 A;  4OUQ A;  3NXJ A;  2HMJ B;  5JPU A;  4LEH A;  3G16 A;  5IG3 A;  5JPP A;  1SJW A;  1O7W B;  3JUO A;  2K54 A;  2XSH B;  3MSO A;  2YFI B;  2GXF A;  4GB5 A;  3KKG A;  3EC9 A;  2HMK B;  4XBX A;  5TGN A;  3KE7 A;  2YFL B;  2HMO B;  3EN1 B;  4HVN A;  4X2O A;  3MG2 A;  4HM2 B;  1QMA A;  1O7P B;  2Z76 A;  1JN5 A;  2GBW B;  1ZX2 A;  2CKF B;  5DRE A;  3B4P A;  5AIH A;  3GZX B;  2RCD A;  5HGR A;  1UUW B;  2RGQ A;  5G2G A;  5CF1 A;  4HM8 B;  4Q53 A;  1ULJ B;  3B7C A; 
#chains in the Genus database with same CATH topology
 1VQN 3;  1RSN A;  2WOH A;  3F8X A;  5D82 A;  1S72 3;  5IW9 A;  1AVK A;  3Q1C A;  4I5Q A;  4HOH A;  1CEW I;  4PEJ A;  4WWU C;  1A2K A;  1D6U A;  1PYL A;  2OQE C;  1OPY A;  2YX9 A;  3OV4 A;  3KSP A;  4WFO A;  5CK6 A;  5M19 A;  1S5A A;  3ALA A;  4N6M A;  3GRD A;  3NBR A;  2GEY A;  1HKX A;  2CX0 A;  2F5W A;  3HOH A;  3F8H A;  3Q2P A;  4HYZ A;  5KP4 A;  2CC3 A;  4R1K A;  1TFK A;  2IY2 A;  4MMX B;  1BRH A;  1MGW A;  4BU4 A;  1GMQ A;  4AEQ A;  2WGO A;  3LTA A;  3HII A;  5JBS A;  6GSP A;  3DY5 A;  1C54 A;  2STD A;  2V1L A;  4N6L A;  3CCR 3;  4H3U A;  4TX4 A;  3CCL 3;  4IPB A;  4CDL A;  1JJ2 2;  3CD6 3;  1DMN A;  2GBX B;  2CWV A;  3EB8 A;  2F86 B;  5IG4 A;  3EBY A;  2HML B;  3BIR A;  5LC6 A;  4BTW A;  1KSI A;  1O7M B;  3WOD G;  1LXE A;  1DVC A;  2A15 A;  4GHO A;  2W6J H;  1YJ9 3;  1BOX A;  1FA3 A;  2Q07 A;  5I97 A;  1JZO A;  4GSP A;  4XBY A;  3NBB A;  2E2V A;  1K8A 4;  1OCV A;  5D81 A;  4CCV A;  1GMP A;  1I70 A;  3FGY A;  3LZA A;  1Q9E A;  1A67 A;  1FGT A;  1I0V A;  1BSB A;  3EHC A;  3IMA B;  3Q3F A;  2CFG A;  1FGR A;  1TFO A;  1NB3 I;  3CNM A;  3FF2 A;  3S67 A;  4RNZ A;  1IYY A;  2Y73 A;  4N6T A;  1IQ8 A;  1UCK A;  1BAN A;  4I4K A;  1SPU A;  3UNL A;  1DYU A;  3JUM A;  5AIG A;  4LSO A;  1JBR A;  4XB5 A;  5CXO A;  1RRL A;  4LYL B;  4L7K A;  4N3V A;  3SYU A;  1QAK A;  2L1S A;  1W5Z A;  1JZD A;  3FCS B;  3OXA A;  4N6O B;  4LGQ A;  1GY6 A;  1TJD A;  3JUN A;  4O3V A;  3GWR A;  3GZB A;  2BMR B;  1AV4 A;  3QK9 A;  1N8Q A;  2B1X B;  2SBL A;  1JRQ A;  2XFS A;  3K9M C;  4ORL A;  3X3Z A;  4FMC A;  4NRE A;  3AMO B;  4XM4 A;  1NNV A;  1VQM 3;  4GL6 A;  1IQX A;  1QAL A;  3G8Z A;  4J5K A;  3NM2 A;  1YIJ 3;  2GSP A;  4HM4 B;  5FGO A;  1LOX A;  1VQ9 3;  3CC4 3;  3HK4 A;  2CWT A;  1OF5 A;  2UGI A;  4FCM A;  2B24 B;  3T0U A;  4IIA A;  2C4B A;  2R41 A;  1BSE A;  3FZW A;  2H0G A;  2K3D A;  3EQQ B;  2OQE A;  1OHO A;  3AGO A;  1N9E A;  2KXG A;  1VQ8 3;  2K0M A;  1WQL B;  1I3I A;  1KWI A;  3OWY A;  3PCS A;  4AKY A;  1F8N A;  3FKA A;  5FW5 A;  4LZI A;  3D9R A;  1IDP A;  3K0Z A;  3STD A;  3CCV 3;  1EQK A;  1Q40 A;  3NM7 A;  3ER7 A;  3N54 B;  2JQ5 A;  4RNT A;  5IG0 A;  2P05 A;  2QA4 3;  1E3V A;  1VQ5 3;  2PNC A;  3T8N A;  1LQM B;  1B21 A;  2W0Q A;  3HIG A;  2BO9 B;  1ROV A;  4J9A A;  2QEX 3;  1BRS A;  1I2F A;  1VQK 3;  3LH4 A;  1VQL 3;  1FW7 A;  1BIR A;  2F98 A;  4WYK B;  3ZG5 A;  1JNQ A;  2Y74 A;  8RNT A;  3G4S 3;  3JVC A;  5KP3 A;  1RNT A;  4NHF A;  9RNT A;  1GY7 A;  2IA7 A;  1VQP 3;  3AHW A;  1WTH A;  2C11 A;  1CYU A;  2XRX B;  1BNG A;  3WDG B;  4R9K A;  3NV0 A;  3FG1 A;  3LOY A;  5IG5 A;  3JUP A;  3PXM A;  1JKG B;  1UUG B;  3AGN A;  5IEP A;  5BVB A;  1QVG 2;  2Z77 A;  4HM1 B;  3CPO A;  4JF8 A;  1ISK A;  1BUJ A;  2XFT A;  1BUQ A;  4K1V A;  1NB5 I;  3BNC A;  5BU4 A;  3CC7 3;  5AII A;  1M1K 4;  2OOV C;  3I55 3;  2HOH A;  2O3O A;  3EBT A;  5KP1 A;  1DE3 A;  4FMA A;  1ROA A;  1HU9 A;  3MHE A;  2D1W A;  1AR0 A;  2FXT A;  3BND A;  2XSO B;  1IVW A;  1JV2 B;  1N5P A;  2KRT A;  1SIH A;  4EV5 A;  1IVX A;  3KN4 A;  1EA2 A;  1AQZ A;  3FF0 A;  3FG4 A;  3PGB A;  1U5O A;  2BNG A;  3QRD A;  1YVS A;  3GZY B;  1EKM A;  4J8T A;  4R80 A;  4MEI A;  1RMS A;  4RNY A;  6RNT A;  5AEU B;  3LXU X;  3E99 A;  1UUV B;  1ZS7 A;  1QAF A;  3WA3 A;  1FGO A;  1RGK A;  2KAA A;  1ASK A;  2XH9 A;  3EJV A;  4BTX A;  3LML A;  4R9L A;  3U1W A;  5EVH A;  1A2V A;  4U13 A;  4XBT A;  3IJE B;  4HM7 B;  4N6U A;  1B2U A;  3CCS 3;  3DGM A;  4HZ9 B;  1BNJ A;  5A0O B;  2ML5 A;  1OGX A;  1T2H A;  3CU3 A;  1FUS A;  1N8R 4;  3BB9 A;  3D4A A;  3X41 A;  3CCE 3;  1LNH A;  3V99 A;  1BVI A;  1UGI A;  3AHS A;  4FCJ A;  2P38 A;  3CPW 2;  1NWW A;  1LQG C;  1B2M A;  1JN5 B;  1TTO A;  1GY5 A;  4KZ1 A;  1YIT 3;  3DZL A;  3NX0 A;  3F7S A;  5AYR B;  1TU5 A;  1TUH A;  1WNH A;  1Q86 4;  5ELJ A;  2I9W A;  2W56 A;  5ELU A;  4CPK A;  1JB4 A;  1GS3 A;  3WR2 A;  3LT9 A;  4FCZ A;  3WMD A;  1I3F A;  2H0H A;  1A2P A;  2IUK A;  1U8C B;  3VF1 A;  5AYS C;  4ILF A;  1RKY A;  4HBR A;  1J2B A;  1B27 A;  5IER A;  5G1L A;  4EYC A;  1W6Y A;  1E97 A;  1G96 A;  3HI7 A;  2FGT A;  3OWS A;  2JDI H;  3IPT A;  3V92 A;  1VQ7 3;  3PYJ A;  1HZ1 A;  2XGN A;  1FGQ A;  1B20 A;  1M90 4;  4OVM A;  2P0X A;  5IEO A;  4DKI A;  1STD A;  2RSX A;  1OUN A;  1V74 A;  1JB5 A;  4KFF A;  1RGH A;  3DGL A;  1BSC A;  4HM5 B;  2AAE A;  1VQO 3;  1X1U A;  4L8P A;  4X2H A;  3CC2 3;  3MYT A;  1O7G B;  1FZU A;  2CWU A;  3T8U A;  1RN4 A;  1EUI C;  3DXO A;  3SOY A;  1A90 A;  1GD4 A;  4O2H A;  1BU4 A;  3GAX A;  4WHA A;  4KT3 B;  3X3Y A;  2W03 A;  1UCL A;  4N6V 0;  2F56 A;  1QJG A;  2OOV A;  3F14 A;  1BRG A;  2QIY A;  1UW1 A;  4EC6 A;  1MOL A;  3TDG A;  1D6Y A;  3MKI A;  3WA2 X;  2KF5 A;  5BIR A;  1T3B A;  2F4Y A;  3PS8 A;  4BTY A;  4HM6 B;  2KCD A;  3S28 A;  4N6N B;  1YNV X;  2HMN B;  2E2U A;  1RGF A;  4XDW A;  1B2X A;  4KFE A;  3N8B A;  2BMO B;  5AEW B;  1KC8 4;  1NJI 4;  3VSY A;  1RGG A;  1TIJ A;  1PY3 A;  1AY7 A;  2IMJ A;  3BLZ A;  2RFR A;  4O02 B;  2R4I A;  1WMP A;  3CNX A;  4WP5 A;  3SX1 A;  4KFD A;  3S5C A;  2AAD A;  1NDO B;  1PFP A;  1Q7H A;  1W01 A;  2CX1 A;  1DMQ A;  2INX A;  3MG3 A;  3SXX A;  1B2S A;  6STD A;  2BMQ B;  1GD3 A;  2OCT A;  1G0T A;  2WO0 A;  3SOA A;  1I2E A;  1RGE A;  3WHO A;  1EG9 B;  3G0K A;  1GOY A;  3JUQ A;  1Q42 A;  3WOE B;  5RNT A;  3RGR A;  1D6Z A;  2BU4 A;  2XF3 A;  2Z6B A;  1LOY A;  3ECF A;  4BIR A;  1N9J A;  2GU3 A;  3S27 A;  3EN8 A;  1W00 A;  3VGN A;  3X40 A;  3KCH A;  3CCQ 3;  3I56 3;  1V57 A;  3FLJ A;  3LT8 A;  1IT8 A;  4HJL B;  1US1 A;  1BRI A;  2LQV A;  4RZM A;  2CFK A;  2C10 A;  3EF8 A;  1M9G A;  3NQY A;  1CQS A;  3UJM A;  4XDV A;  1RNB A;  1CYV A;  3H3H A;  2W9Q A;  3CMA 3;  2PZV A;  4HKV B;  1IT7 A;  1Z1S A;  7STD A;  3BNB A;  4ZM8 A;  1IQY A;  2FNQ A;  4HM3 B;  1LOV A;  1IVV A;  1SQW A;  3B8L A;  3OWU A;  3D3L A;  4L8O A;  1NU3 A;  2GEX A;  2ZDJ A;  1BNS A;  3BU4 A;  1OGZ A;  1W7C A;  1E3R A;  3M8C A;  1NO3 A;  3GZR A;  5CF2 A;  3OW2 2;  2ZHX B;  3GSP A;  3Q90 A;  1YI2 3;  5CLK A;  4QWT A;  1SAR A;  1RN1 A;  1MGR A;  3DGO A;  2H0I A;  1T2I A;  3KII A;  2W2C A;  4JRF A;  1ULI B;  3FG3 A;  1EEJ A;  5D83 A;  3ROB A;  3SED A;  2J8X B;  4HM0 B;  1OF5 B;  2OWP A;  2WOF A;  3D5G A;  1LNI A;  1LVN A;  1BNI A;  5STD A;  1Q81 4;  1IV9 A;  1TRQ A;  3F9S A;  3FH1 A;  1FUW A;  3RGA A;  1KQS 2;  2P0M A;  2W9P A;  1O7H B;  2D42 A;  4MJD A;  3G6E 3;  2IYJ A;  3FSD A;  1I8V A;  1UCI A;  5BXQ A;  2KF4 A;  2OTL 3;  2Z7A A;  3HX8 A;  1UI7 A;  4EBG A;  2SAR A;  1K28 A;  1GMR A;  3K63 A;  1VQQ A;  2WGQ A;  1Q40 B;  3MPH A;  4K1U A;  4KVH A;  2L4V A;  5G1K A;  3URP A;  1VQ4 3;  3NHX A;  3ZFZ A;  1K73 4;  3AMO A;  2CG1 A;  2F5M A;  1YGE A;  2XGL A;  2MC8 A;  3HZP A;  3UL5 A;  3DUK A;  1SII A;  3V98 A;  1DVD A;  1FUT A;  4STD A;  3MG1 A;  3OX9 A;  3F40 A;  1I0X A;  3A76 A;  1ZGX A;  1RTU A;  3X42 A;  4FMB A;  3DGY A;  1WMN A;  1PU4 A;  1RN7 A;  1ZO2 A;  3DMC A;  3F7X A;  1M1X B;  1RLS A;  3S29 A;  1LRA A;  1JBS A;  1RGL A;  1IV7 A;  4MMY B;  3EE1 A;  2YFJ B;  2UX0 A;  1GSP A;  3H51 A;  4LMI A;  1IU7 A;  5M18 A;  3CME 3;  2HMM B;  3PZW A;  2XR8 B;  3NV0 B;  1VQ6 3;  2CHC A;  1BNR A;  4AKZ A;  1T5Y A;  1JB2 A;  3KFQ C;  1AVL A;  4HZB B;  1BSD A;  3I0Y A;  3EX9 A;  1MWU A;  1VZZ A;  3SLU A;  1IK3 A;  1GOV A;  1WMO A;  2XEP A;  4HAA A;  1QVF 2;  3LTC A;  4FMD A;  5M1A A;  1O7N B;  5IF6 A;  2OTJ 3;  3X3X A;  2BHM A;  1DMM A;  1BNE A;  1K41 A;  3LYG A;  7GSP A;  5GSP A;  4WYK A;  1OHS A;  1R4Y A;  1X1X A;  5DRV A;  5LC7 A;  1Y4K A;  1W6C A;  3L0R A;  1C7H A;  3N9H A;  1OH0 A;  2ML6 A;  1BGS A;  1OHP A;  2CK3 H;  2P09 A;  1BRJ A;  1RHL A;  3B4O A;  3K7C A;  1X1W A;  2QGU A;  5AIF A;  1YJN 3;  1BRK A;  2ZL8 A;  1BRN L;  2LYX A;  3KZT A;  1RGA A;  4H61 A;  4RBN A;  5IEN A;  3CCU 3;  5AI1 A;  1JKG A;  1HYF A;  2RBI A;  1W02 A;  1TP6 A;  2MF7 A;  3NUV A;  3CCM 3;  4EXR A;  1UI8 A;  2CW9 A;  1L5G B;  8CHO A;  1W4N A;  1MWR A;  1RRH A;  1TRP A;  3RNT A;  1YGW A;  3SVA A;  1GYB A;  1R4C A;  2F99 A;  3DM8 A;  4BL2 A;  4OUQ A;  3NXJ A;  2HMJ B;  1GOU A;  5JPU A;  4LEH A;  1MWS A;  1DET A;  3G16 A;  3D5I A;  4NPB A;  5IG3 A;  3J7Y d;  5JPP A;  3WOF B;  2KF6 A;  4K90 B;  1SJW A;  1IVU A;  1UDI I;  1BSA A;  1X1Y A;  3RDE A;  3CXC 2;  2RNT A;  2E2T A;  1YHQ 3;  1O7W B;  1KD1 4;  3JUO A;  4J5G A;  1RCL A;  1V58 A;  1W6G A;  5EQL A;  4EW5 A;  1CH0 A;  5HOH A;  1JBT A;  1BNF A;  2K54 A;  4EV2 A;  1Q7Y 4;  2XSH B;  1BAO A;  1I2G A;  3MSO A;  3KSE D;  2O9U X;  1RCK A;  2YFI B;  1N5H A;  1OAC A;  2GXF A;  4GB5 A;  4OK0 A;  2ZA4 A;  3KKG A;  1B2Z A;  2CH9 A;  3EC9 A;  2CFL A;  2HMK B;  3MWZ A;  3DH2 A;  4XBX A;  2W56 B;  5TGN A;  1YVB I;  3UB1 A;  1FYS A;  2CFW A;  3KE7 A;  2YFL B;  1MWT A;  3NQZ A;  4O8S A;  1Q82 4;  3D79 A;  2HMO B;  1YJW 3;  2BIR A;  1G02 A;  3EN1 B;  3LTB A;  1LOW A;  4HVN A;  4X2O A;  4CJN A;  3MG2 A;  1RJO A;  4FR9 A;  1FGM A;  3PCR A;  4HM2 B;  1QMA A;  3A5E A;  1UCJ A;  4BL3 A;  1O7P B;  2Z76 A;  1RDS A;  7RNT A;  1JN5 A;  2GBW B;  3DGN A;  2IUJ A;  1W2B 2;  1MNL A;  1UGH I;  1ZX2 A;  2CKF B;  3BNE A;  3B4P A;  3LTD A;  4IT7 A;  5DRE A;  2GU1 A;  2BT3 A;  3U97 A;  5AIH A;  2CG0 A;  3CCJ 3;  2M7O A;  1B3S A;  3GZX B;  2W04 A;  2RCD A;  2KF3 A;  1RGC A;  5HGR A;  1K9M 4;  1UUW B;  2RGQ A;  3K5T A;  4G1M B;  4MMZ B;  3ZG0 A;  4R4K A;  5G2G A;  5CF1 A;  3NBJ A;  2CIU A;  2CFD A;  3G71 3;  3UL6 A;  1W2Z A;  3O8Y A;  2UUG C;  4HM8 B;  4K61 A;  5EEO A;  1STF I;  4Q53 A;  1ULJ B;  3B7C A; 
#chains in the Genus database with same CATH homology
 1VQN 3;  2WOH A;  3F8X A;  5D82 A;  1S72 3;  5IW9 A;  1AVK A;  3Q1C A;  4PEJ A;  1CEW I;  4WWU C;  4WFO A;  1A2K A;  1D6U A;  2OQE C;  2YX9 A;  1OPY A;  3OV4 A;  3WMD A;  3KSP A;  5CK6 A;  1S5A A;  3ALA A;  4N6M A;  3GRD A;  3NBR A;  2GEY A;  1HKX A;  4HYZ A;  3F8H A;  3Q2P A;  5KP4 A;  2CC3 A;  4R1K A;  1TFK A;  4MMX B;  4AEQ A;  2WGO A;  3LTA A;  3HII A;  5JBS A;  3DY5 A;  2STD A;  2V1L A;  4N6L A;  3CCR 3;  4H3U A;  4TX4 A;  3CCL 3;  4IPB A;  4CDL A;  1JJ2 2;  3CD6 3;  1DMN A;  2GBX B;  2CWV A;  3EB8 A;  2F86 B;  5IG4 A;  3EBY A;  2HML B;  5LC6 A;  4BTW A;  1KSI A;  1O7M B;  3WOD G;  1LXE A;  1DVC A;  2A15 A;  2W6J H;  1YJ9 3;  1FA3 A;  2Q07 A;  5I97 A;  4XBY A;  3NBB A;  2E2V A;  1K8A 4;  1OCV A;  5D81 A;  4CCV A;  3FGY A;  3LZA A;  1A67 A;  1FGT A;  3IMA B;  3EHC A;  3S67 A;  2CFG A;  1FGR A;  1TFO A;  1NB3 I;  3CNM A;  3FF2 A;  4RNZ A;  2Y73 A;  4N6T A;  1IQ8 A;  3UNL A;  4I4K A;  1SPU A;  1DYU A;  3JUM A;  5AIG A;  4LSO A;  4XB5 A;  5CXO A;  1RRL A;  4L7K A;  4N3V A;  1QAK A;  1W5Z A;  3FCS B;  3OXA A;  4N6O B;  4LGQ A;  1GY6 A;  3JUN A;  4O3V A;  3GWR A;  3GZB A;  2BMR B;  1AV4 A;  3QK9 A;  1N8Q A;  2B1X B;  2SBL A;  1JRQ A;  2XFS A;  3K9M C;  4ORL A;  3X3Z A;  4FMC A;  4NRE A;  3AMO B;  4XM4 A;  1VQM 3;  4GL6 A;  1IQX A;  1QAL A;  3G8Z A;  3NM2 A;  1YIJ 3;  5FGO A;  4HM4 B;  1LOX A;  1VQ9 3;  3CC4 3;  3HK4 A;  2CWT A;  1OF5 A;  4FCM A;  3T0U A;  2B24 B;  4IIA A;  3FZW A;  3EQQ B;  2OQE A;  1OHO A;  1N9E A;  2KXG A;  1VQ8 3;  2K0M A;  1WQL B;  1KWI A;  3OWY A;  3PCS A;  4AKY A;  1F8N A;  3FKA A;  5FW5 A;  4LZI A;  3D9R A;  1IDP A;  3K0Z A;  3STD A;  3CCV 3;  1EQK A;  1Q40 A;  3NM7 A;  3ER7 A;  3N54 B;  2JQ5 A;  5IG0 A;  2P05 A;  2QA4 3;  1E3V A;  1VQ5 3;  2PNC A;  3T8N A;  3HIG A;  2W0Q A;  2BO9 B;  1ROV A;  4J9A A;  2QEX 3;  1VQK 3;  3LH4 A;  1VQL 3;  2F98 A;  4WYK B;  1JNQ A;  2Y74 A;  3G4S 3;  3JVC A;  5KP3 A;  4NHF A;  1GY7 A;  2IA7 A;  1VQP 3;  1WTH A;  2C11 A;  1CYU A;  2XRX B;  3WDG B;  4R9K A;  3NV0 A;  3FG1 A;  3LOY A;  5IG5 A;  3JUP A;  3PXM A;  1JKG B;  5IEP A;  5BVB A;  1QVG 2;  2Z77 A;  4HM1 B;  3CPO A;  4JF8 A;  1ISK A;  2XFT A;  1BUQ A;  4K1V A;  1NB5 I;  3BNC A;  3CC7 3;  1M1K 4;  5AII A;  2OOV C;  3I55 3;  2O3O A;  3EBT A;  5KP1 A;  4FMA A;  1ROA A;  1HU9 A;  3MHE A;  2D1W A;  1AR0 A;  2FXT A;  3BND A;  2XSO B;  1IVW A;  1JV2 B;  1N5P A;  2KRT A;  1SIH A;  4EV5 A;  1IVX A;  3KN4 A;  1EA2 A;  3FF0 A;  3FG4 A;  3PGB A;  1U5O A;  2BNG A;  3QRD A;  4J8T A;  3GZY B;  1EKM A;  4R80 A;  4MEI A;  4RNY A;  5AEU B;  3LXU X;  3E99 A;  1UUV B;  1QAF A;  3WA3 A;  1FGO A;  2XH9 A;  4BTX A;  1ASK A;  3EJV A;  3LML A;  4R9L A;  3U1W A;  5EVH A;  1A2V A;  4U13 A;  4XBT A;  3IJE B;  4HM7 B;  4N6U A;  3CCS 3;  3DGM A;  4HZ9 B;  5A0O B;  2ML5 A;  1OGX A;  3CU3 A;  1N8R 4;  3BB9 A;  3X41 A;  3CCE 3;  1LNH A;  3V99 A;  4FCJ A;  2P38 A;  3CPW 2;  1NWW A;  1JN5 B;  1GY5 A;  4KZ1 A;  1YIT 3;  3DZL A;  3NX0 A;  3F7S A;  5AYR B;  1TU5 A;  1TUH A;  1WNH A;  1Q86 4;  5ELJ A;  2I9W A;  2W56 A;  5ELU A;  1JB4 A;  1GS3 A;  3LT9 A;  4FCZ A;  2IUK A;  1U8C B;  3VF1 A;  5AYS C;  1RKY A;  4HBR A;  1J2B A;  5IER A;  4EYC A;  1W6Y A;  1E97 A;  1G96 A;  3HI7 A;  2FGT A;  3OWS A;  2JDI H;  3IPT A;  3V92 A;  1VQ7 3;  3PYJ A;  2XGN A;  1FGQ A;  1M90 4;  4OVM A;  2P0X A;  5IEO A;  1STD A;  2RSX A;  1OUN A;  1V74 A;  1JB5 A;  4KFF A;  3DGL A;  4HM5 B;  1VQO 3;  4L8P A;  4X2H A;  3CC2 3;  3MYT A;  1O7G B;  2CWU A;  3T8U A;  3DXO A;  3SOY A;  1A90 A;  1GD4 A;  4O2H A;  3GAX A;  4WHA A;  3X3Y A;  2W03 A;  4N6V 0;  1QJG A;  2OOV A;  3F14 A;  2QIY A;  1UW1 A;  4EC6 A;  1MOL A;  3TDG A;  1D6Y A;  3MKI A;  3WA2 X;  4BTY A;  3PS8 A;  4HM6 B;  2KCD A;  3S28 A;  4N6N B;  2HMN B;  2E2U A;  4XDW A;  4KFE A;  3N8B A;  2BMO B;  5AEW B;  1KC8 4;  1NJI 4;  3VSY A;  1TIJ A;  2IMJ A;  3BLZ A;  2RFR A;  4O02 B;  2R4I A;  1WMP A;  3CNX A;  4WP5 A;  3SX1 A;  4KFD A;  3S5C A;  4EBG A;  1NDO B;  1PFP A;  1W01 A;  3SXX A;  1DMQ A;  2INX A;  3MG3 A;  6STD A;  2BMQ B;  1GD3 A;  2OCT A;  2WO0 A;  3SOA A;  1EG9 B;  3G0K A;  3JUQ A;  3WOE B;  1Q42 A;  3RGR A;  1D6Z A;  2XF3 A;  2Z6B A;  3ECF A;  1N9J A;  2GU3 A;  3S27 A;  3EN8 A;  1W00 A;  3VGN A;  3X40 A;  3CCQ 3;  3I56 3;  3FLJ A;  3LT8 A;  1IT8 A;  4HJL B;  1US1 A;  2LQV A;  4RZM A;  2CFK A;  2C10 A;  3EF8 A;  1M9G A;  3NQY A;  1CQS A;  3UJM A;  4XDV A;  1CYV A;  3H3H A;  2W9Q A;  3CMA 3;  2PZV A;  4HKV B;  1IT7 A;  1Z1S A;  7STD A;  3BNB A;  4ZM8 A;  1IQY A;  2FNQ A;  4HM3 B;  1IVV A;  1SQW A;  3B8L A;  3OWU A;  3D3L A;  4L8O A;  1NU3 A;  2GEX A;  2ZDJ A;  1OGZ A;  1W7C A;  1E3R A;  3M8C A;  1NO3 A;  3GZR A;  5CF2 A;  3OW2 2;  3Q90 A;  1YI2 3;  5CLK A;  4QWT A;  3DGO A;  3KII A;  2W2C A;  4JRF A;  1ULI B;  3FG3 A;  5D83 A;  3ROB A;  3SED A;  4HM0 B;  1OF5 B;  2OWP A;  2WOF A;  1LVN A;  5STD A;  1Q81 4;  1IV9 A;  3F9S A;  3FH1 A;  3RGA A;  1KQS 2;  2P0M A;  2W9P A;  1O7H B;  2D42 A;  4MJD A;  3G6E 3;  3FSD A;  5BXQ A;  2OTL 3;  2Z7A A;  3HX8 A;  1UI7 A;  3MPH A;  1K28 A;  3K63 A;  2WGQ A;  4KVH A;  1Q40 B;  4K1U A;  1VQ4 3;  2L4V A;  3NHX A;  1K73 4;  3AMO A;  2CG1 A;  2MC8 A;  1YGE A;  2XGL A;  3UL5 A;  3HZP A;  3V98 A;  3DUK A;  1SII A;  1DVD A;  4STD A;  3MG1 A;  3OX9 A;  3F40 A;  3A76 A;  3X42 A;  4FMB A;  1WMN A;  1PU4 A;  1RN7 A;  1ZO2 A;  3DMC A;  3F7X A;  1M1X B;  3S29 A;  1IV7 A;  4MMY B;  3EE1 A;  2YFJ B;  2UX0 A;  3H51 A;  4LMI A;  1IU7 A;  3CME 3;  1VQ6 3;  2HMM B;  3PZW A;  2XR8 B;  3NV0 B;  2CHC A;  4AKZ A;  1T5Y A;  1JB2 A;  3KFQ C;  1AVL A;  4HZB B;  3I0Y A;  3EX9 A;  1VZZ A;  3SLU A;  1IK3 A;  1QVF 2;  1WMO A;  2XEP A;  3LTC A;  4FMD A;  1O7N B;  5IF6 A;  2OTJ 3;  3X3X A;  2BHM A;  1DMM A;  3LYG A;  1K41 A;  4WYK A;  1OHS A;  5DRV A;  5LC7 A;  1Y4K A;  1W6C A;  3L0R A;  1C7H A;  3N9H A;  1OH0 A;  2ML6 A;  1OHP A;  2CK3 H;  2P09 A;  3B4O A;  3K7C A;  5AIF A;  1YJN 3;  2QGU A;  2ZL8 A;  2LYX A;  3KZT A;  4H61 A;  3CCU 3;  4RBN A;  5IEN A;  5AI1 A;  1JKG A;  1W02 A;  1TP6 A;  2MF7 A;  3NUV A;  3CCM 3;  4EXR A;  1UI8 A;  2CW9 A;  1L5G B;  8CHO A;  1W4N A;  3SVA A;  1RRH A;  1GYB A;  1R4C A;  2F99 A;  3DM8 A;  4OUQ A;  3NXJ A;  2HMJ B;  5JPU A;  4LEH A;  3G16 A;  5IG3 A;  3J7Y d;  5JPP A;  3WOF B;  4K90 B;  3CXC 2;  1SJW A;  1IVU A;  3RDE A;  2E2T A;  1YHQ 3;  1O7W B;  1KD1 4;  3JUO A;  1W6G A;  5EQL A;  2K54 A;  4EV2 A;  1Q7Y 4;  2XSH B;  3MSO A;  3KSE D;  2O9U X;  2YFI B;  1N5H A;  1OAC A;  2GXF A;  4GB5 A;  4OK0 A;  3KKG A;  3MWZ A;  2CH9 A;  3EC9 A;  2CFL A;  2HMK B;  4XBX A;  2W56 B;  5TGN A;  1YVB I;  3UB1 A;  2CFW A;  3KE7 A;  2YFL B;  3NQZ A;  4O8S A;  1Q82 4;  2HMO B;  1YJW 3;  3LTB A;  3EN1 B;  4HVN A;  4X2O A;  3MG2 A;  1RJO A;  4FR9 A;  1FGM A;  3PCR A;  4HM2 B;  1QMA A;  1FUW A;  1O7P B;  2Z76 A;  1JN5 A;  2GBW B;  3DGN A;  2IUJ A;  1W2B 2;  1MNL A;  1ZX2 A;  2CKF B;  3BNE A;  3LTD A;  3B4P A;  4IT7 A;  5DRE A;  2GU1 A;  2BT3 A;  3U97 A;  5AIH A;  2CG0 A;  3CCJ 3;  2M7O A;  3GZX B;  2W04 A;  2RCD A;  5HGR A;  1K9M 4;  1UUW B;  2RGQ A;  3K5T A;  4G1M B;  4MMZ B;  4R4K A;  5G2G A;  5CF1 A;  3NBJ A;  2CIU A;  2CFD A;  3G71 3;  3UL6 A;  1W2Z A;  3O8Y A;  4HM8 B;  4K61 A;  5EEO A;  1STF I;  4Q53 A;  1ULJ B;  3B7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...