2HMNB

Crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 58
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmnB00
4OVMA 4STDA 5DRVA 3H51A 4ORLA 2R4IA 4L7KA 3F14A 5AIGA 1W6YA 3JUQA 4MJDA 3KZTA 3ROBA 4HM7B 3F8HA 3FF2A 5IEOA 4HM4B 3KSPA 4KVHA 6STDA 1UUWB 1Q40B 1QMAA 5BVBA 3GZBA 1O7GB 3DZLA 2XSOB 4CDLA 3G8ZA 3FKAA 1Q40A 5JPPA 5AI1A 1E97A 4FCJA 3G16A 3EBTA 5CK6A 3EJVA 3VSYA 3GZXB 4HJLB 4H3UA 5IG4A 1GY7A 1JB5A 3NUVA 4XDVA 3F40A 2BMOB 5D83A 5CF2A 1ISKA 4WYKB 5AEUB 3RGAA 5IEPA 1JB2A 3ER7A 1O7PB 1OHPA 2JQ5A 1DMNA 4WYKA 3E99A 2XRXB 1OGXA 1SJWA 4XBYA 5TGNA 2QGUA 3B4OA 5IG5A 2YFLB 3OV4A 3UJMA 4HM5B 4XM4A 2HMKB 1WQLB 5CF1A 3HX8A 3NXJA 2B1XB 3D9RA 4GB5A 3GZYB 2GEXA 3KE7A 4HZBB 3G0KA 4IIAA 4J8TA 4XB5A 3A76A 4X2HA 4XDWA 1W01A 1OHOA 1AR0A 3GRDA 2OWPA 3OWYA 1JN5B 1O7WB 5AIHA 5KP1A 1NU3A 7STDA 4R9KA 4HM6B 3DM8A 3FZWA 5AEWB 1GY6A 2BMQB 1O7NB 1CQSA 1JN5A 2CHCA 3EN1B 4HM3B 3K0ZA 1OH0A 3IPTA 1O7MB 2IMJA 3LYGA 4WP5A 2XSHB 4R9LA 4X2OA 4XBXA 5G2GA 3EX9A 1Z1SA 3LZAA 4HM0B 4HZ9B 5CLKA 2XR8B 3VGNA 4K1VA 4Q53A 1OHSA 1OF5B 3B8LA 5AIFA 1JB4A 3JUOA 2BNGA 2GEYA 1U5OA 1A2KA 2Z7AA 3MG2A 3Q90A 3UNLA 2A15A 1OF5A 4I4KA 3ECFA 1TUHA 4U13A 3JUPA 2RFRA 1DMMA 1O7HB 3FH1A 4HVNA 4LEHA 3DXOA 2CKFB 3NHXA 3BLZA 5STDA 3F9SA 1HKXA 2F98A 4HKVB 2UX0A 3CU3A 1EA2A 3EN8A 3F8XA 2HMJB 3F7XA 2HMMB 1GY5A 3STDA 1W02A 2F99A 1IDPA 3MHEA 3MSOA 5EVHA 5BXQA 1UUVB 1C7HA 3FLJA 8CHOA 2I9WA 1ZX2A 4RZMA 1ASKA 3F7SA 5HGRA 3B4PA 1TP6A 2YFJB 3DMCA 2HMNB 1S5AA 1STDA 4PEJA 1W00A 3WMDA 3EBYA 1E3VA 2F86B 4XBTA 4WWUC 3H3HA 3NBRA 1QJGA 5IF6A 5JPUA 4L8PA 1OCVA 4LGQA 3NM2A 3JUMA 3OXAA 2YFIB 3I0YA 1OPYA 3MYTA 1JKGB 5D82A 5CXOA 3HZPA 3SOAA 2RGQA 3NV0B 4K1UA 3EF8A 3T8NA 4J9AA 3RGRA 2GBXB 2GBWB 3B7CA 1JKGA 2GXFA 2RCDA 4R1KA 2K54A 1EG9B 5IG0A 1DMQA 1GS3A 3CPOA 2Z76A 3NV0A 2Z77A 5KP3A 1OUNA 5IG3A 4OUQA 3OX9A 3GZRA 3MG1A 3KKGA 3FSDA 2QIYA 1VZZA 3OWSA 5IERA 1NWWA 1K41A 2B24B 3MKIA 3MG3A 3BB9A 2HMOB 3FF0A 3OWUA 2BMRB 3GWRA 5IENA 2INXA 3CNXA 2PZVA 5D81A 3CNMA 4HM1B 2STDA 1GYBA 3M8CA 3T8UA 1ULIB 1ZO2A 1ULJB 5AIIA 3EC9A 5KP4A 1E3RA 4L8OA 3JUNA 1BUQA 2W2CA 4LMIA 3EQQB 3K7CA 2HMLB 1Q42A 1OGZA 4HM2B 3SEDA 5DREA 5FW5A 3S5CA 4N3VA 3DUKA 3SOYA 3EHCA 1NDOB 4HM8B 4FCMA 3HK4A 3FGYA
chains in the Genus database with same CATH superfamily
4OVMA 3HI7A 4WFOA 4STDA 2F56A 1I3FA 4GHOA 3S67A 2XF3A 3NQYA 3KCHA 3PCRA 1LRAA 3PYJA 1IVVA 2XGNA 4QWTA 4K61A 5DRVA 4BL2A 3H51A 1N8R4 1TRQA 1JJ22 1DYUA 4ORLA 5FGOA 1MOLA 2R4IA 4L7KA 3F14A 4N6UA 5AIGA 5LC7A 4FR9A 5RNTA 1FW7A 1W6YA 3JUQA 1TFKA 2AAEA 1BSEA 1X1WA 3KN4A 2UGIA 1KD14 3X40A 4MJDA 3KZTA 2CWTA 3ROBA 2KXGA 4HM7B 3F8HA 3FF2A 1X1YA 1Q7HA 2F4YA 2CFKA 1DVDA 4O2HA 3WR2A 1V58A 5IEOA 4AKYA 4HM4B 3KSPA 4KVHA 1FGRA 1TFOA 2OCTA 6STDA 1UUWB 1BSDA 2FNQA 5BU4A 1Q40B 3AHSA 1IU7A 1GD3A 1QMAA 2P09A 2WGQA 5AYSC 5BVBA 1B2MA 1MGWA 3GZBA 1Q864 3CME3 2OQEC 1O7GB 1RN1A 1BGSA 1RN4A 3DZLA 4HYZA 3FG3A 1L5GB 4CJNA 1VQP3 3AGOA 1BRJA 1RHLA 1OACA 2XSOB 4CDLA 3LTBA 2CX1A 3G8ZA 3FKAA 1Q40A 3IJEB 2IUJA 5JPPA 2KF6A 1IVWA 2ZA4A 1MGRA 2Q07A 1LOYA 5AI1A 1E97A 1IQ8A 4BU4A 1KC84 4FCJA 3G713 2KF3A 1RN7A 1IT8A 4N6NB 1PY3A 3G16A 3Q3FA 4GL6A 2OTL3 1IQYA 3EBTA 8RNTA 4JRFA 3NQZA 5CK6A 3SX1A 3O8YA 1G02A 2ML5A 3EJVA 4FMBA 1I2EA 3VSYA 5I97A 2E2UA 5JBSA 1FUTA 3GZXB 3N8BA 1CEWI 3BNDA 4HJLB 4H3UA 3SXXA 2H0IA 1GY7A 7RNTA 5IG4A 1JB5A 1M1XB 3NUVA 1B27A 3CCS3 1RTUA 1RGKA 1UI8A 3FG1A 4XDVA 3CC73 1BRKA 4G1MB 3CCQ3 1RGLA 3RDEA 3TDGA 1BSBA 1M9GA 3CCL3 3F40A 3I563 3V99A 2BMOB 5D83A 5CF2A 1A67A 1ISKA 2L4VA 1RGFA 4WYKB 3WOFB 5AEUB 3I553 1YHQ3 1RSNA 2ZDJA 2E2TA 5M19A 1BNSA 1A2VA 2ML6A 5HOHA 2ZHXB 3RGAA 5IEPA 1JB2A 3T0UA 3ER7A 1O7PB 1I2FA 2CG0A 1NB3I 3AGNA 2MC8A 3WDGB 1MWRA 4RBNA 3VF1A 1BNRA 1FUWA 1IYYA 1R4CA 1OHPA 4FCZA 2JQ5A 1DMNA 2HOHA 4WYKA 3E99A 2XRXB 1OGXA 1SJWA 1UGHI 3Q2PA 4XBYA 5TGNA 1PFPA 1BRIA 3LT9A 3V98A 2UUGC 4CCVA 6GSPA 3CXC2 1S723 1BUJA 3CD63 1PYLA 1US1A 2QGUA 3B4OA 5IG5A 2WO0A 1UCJA 3D4AA 2YFLB 1BANA 5ELUA 5G1LA 1BU4A 1MWTA 3OV4A 3AMOB 2P0XA 3UJMA 3WODG 3MPHA 4HM5B 4XM4A 3EB8A 2J8XB 4N6TA 1WMPA 2HMKB 1GMPA 1WQLB 1IV9A 1IVXA 2CX0A 1T2IA 6RNTA 3KFQC 4KFEA 5CF1A 4N6LA 1UCLA 3JVCA 4FMCA 2Y73A 4FMAA 3HX8A 3IMAB 3NXJA 2CFLA 1VQL3 2B1XB 3D9RA 1IK3A 3SLUA 3AMOA 1MWUA 2H0GA 3KSED 1FZUA 1YVBI 3GSPA 3Q1CA 4GB5A 4AKZA 1Q9EA 3LMLA 3GZYB 1VQ73 3D5GA 3BNEA 1UI7A 2P38A 2XH9A 3A5EA 2GEXA 3KE7A 4HZBB 1ZS7A 5GSPA 2CW9A 3CCM3 1LOVA 2GSPA 3CPW2 1LQGC 3G0KA 1IQXA 3KIIA 1VQ83 2P05A 4IIAA 4J8TA 4XB5A 3A76A 1YVSA 4X2HA 3X42A 4XDWA 2D1WA 4CPKA 2C11A 1W01A 1OHOA 1AR0A 2PNCA 4EC6A 3ZG5A 3GRDA 1I70A 1FYSA 3FCSB 1RCLA 2OWPA 1SARA 3OWYA 3S28A 1JN5B 1YIJ3 3CCJ3 1O7WB 5AIHA 3CCV3 3HIGA 3D79A 1EQKA 3PGBA 1T5YA 2W03A 1EKMA 3AHWA 1NU3A 5KP1A 7STDA 4R9KA 1RLSA 5EEOA 3K5TA 4HM6B 3DM8A 3FZWA 5AEWB 1FGOA 1LVNA 1GY6A 2BMQB 2CFWA 1AVKA 1O7NB 1VQ63 1CQSA 1JN5A 2CHCA 2KF4A 2CG1A 2BO9B 3EN1B 4HM3B 3K0ZA 1B2SA 1LOXA 4LYLB 1SPUA 1A90A 1OH0A 3IPTA 1O7MB 2IMJA 3LYGA 2E2VA 4WP5A 1CYUA 2XSHB 4R9LA 1R4YA 3LOYA 4X2OA 4XBXA 5G2GA 3EX9A 1KSIA 1Z1SA 3LZAA 4HM0B 4R4KA 4NHFA 1LXEA 1VQM3 4HZ9B 1DVCA 2IY2A 4J5GA 3EE1A 5CLKA 1G96A 4JF8A 1C54A 1N5PA 2XR8B 3VGNA 1D6ZA 1UUGB 2W9QA 1IVUA 4K1VA 2O9UX 4Q53A 1BOXA 3V92A 2XFTA 4HBRA 2LQVA 2WOFA 1ROAA 1JBRA 1B20A 2BIRA 2W6JH 4N6MA 1OHSA 1OF5B 3B8LA 5AIFA 1GMRA 4MMZB 1YJW3 1AY7A 2SARA 1JB4A 3JUOA 4EBGA 2BNGA 1Q824 4RNYA 2GEYA 1I0XA 1YI23 3DGLA 1U5OA 1SIHA 1A2KA 2Z7AA 4IT7A 3MG2A 1IT7A 3Q90A 3UNLA 3GAXA 1JZDA 2KAAA 1B2UA 1UDII 2W0QA 4BL3A 1QVG2 3CCR3 2A15A 4TX4A 1OF5A 4I4KA 1N8QA 1WMNA 3DGMA 1TUHA 3ECFA 4U13A 4LZIA 3JUPA 3NM7A 1K8A4 2BT3A 5IW9A 2RFRA 2XFSA 1DMMA 1MWSA 1O7HB 1WTHA 3FH1A 4HVNA 3LTDA 4BTXA 4KFFA 2GU1A 1ROVA 2W9PA 2ZL8A 3SYUA 3LXUX 1VQ53 4LEHA 2BHMA 3DXOA 1DETA 1ZGXA 2CKFB 1STFI 2P0MA 3X41A 1FGMA 2K0MA 3BLZA 3NHXA 3NBJA 1VQK3 3LT8A 3QRDA 5STDA 3F9SA 1K734 1HKXA 2F98A 1BIRA 4HKVB 2M7OA 2UX0A 3CU3A 1EA2A 3EN8A 3K63A 3F8XA 2W56B 2HMJB 2QEX3 1CYVA 2CWVA 3F7XA 4EW5A 1BNGA 1NNVA 1GY5A 1AQZA 2HMMB 2W04A 2YX9A 3URPA 3LTCA 1JV2B 1W02A 2F99A 3STDA 3CMA3 1IDPA 1D6YA 3MHEA 1WMOA 5G1KA 1HU9A 1WNHA 1W5ZA 1Q7Y4 2BU4A 3MSOA 4AEQA 1B2XA 1A2PA 1RGHA 1W6CA 2L1SA 2W56A 1W6GA 5EVHA 2MF7A 3U97A 2KF5A 5BXQA 2JDIH 1GD4A 1UUVB 1C7HA 1KWIA 3FLJA 1RJOA 8CHOA 1BSAA 2I9WA 1V74A 1ZX2A 1T3BA 2WOHA 1W2ZA 1RGAA 5LC6A 3S29A 4EV2A 4RZMA 2CFGA 1RGEA 1TJDA 1ASKA 3CC23 2OTJ3 1I0VA 1QALA 1UCKA 3F7SA 2OOVA 1EEJA 1GOYA 5HGRA 3B4PA 1TP6A 3PCSA 1VQO3 3FGYA 1JRQA 2YFJB 3NBBA 4R80A 3DMCA 3G6E3 1BRSA 1GOUA 1S5AA 2HMNB 4BIRA 1STDA 4PEJA 1W00A 1YGEA 1BAOA 4KZ1A 1Y4KA 1VQ93 2D42A 3WMDA 1BRNL 1AVLA 1JZOA 3OW22 1K9M4 3EBYA 1UW1A 1W2B2 1E3VA 2F86B 3LTAA 4XBTA 4WWUC 5A0OB 3H3HA 3NBRA 1HYFA 3L0RA 1QJGA 2R41A 4O02B 1I2GA 3DGYA 4EXRA 5IF6A 1LNIA 3UL5A 4L8PA 3WHOA 5JPUA 1NJI4 2C10A 3ALAA 1OCVA 1QAKA 3HOHA 1NB5I 1LNHA 1U8CB 4BTYA 5EQLA 2IYJA 2XGLA 1N5HA 4N6V0 2C4BA 4LGQA 3NM2A 1G0TA 4ZM8A 4NREA 2RNTA 2CK3H 3JUMA 3N9HA 3OXAA 3N54B 2YFIB 3I0YA 3CCE3 3WA3A 1FUSA 2KRTA 1OPYA 3MYTA 1JKGB 5D82A 5CXOA 4ILFA 1YJ93 3HZPA 3SOAA 4HOHA 4GSPA 1BRHA 2RGQA 1BNIA 3NV0B 4K1UA 3EF8A 3T8NA 1X1XA 2GBXB 4J9AA 3RGRA 2GBWB 5M18A 1M1K4 3BNBA 4FMDA 3B7CA 1YGWA 1JKGA 2CFDA 2GXFA 3MWZA 4OK0A 2RCDA 5M1AA 1GSPA 4R1KA 5BIRA 2K54A 2CC3A 1EG9B 2RBIA 2Y74A 3D5IA 3QK9A 3SVAA 1GOVA 5IG0A 7GSPA 1DMQA 1GS3A 4RNZA 4MMXB 1DE3A 3CPOA 4HAAA 2Z76A 2V1LA 3NV0A 3BU4A 1LOWA 3DY5A 4RNTA 1UCIA 3DH2A 2F5MA 1W7CA 2Z77A 2Z6BA 5KP3A 3U1WA 1OUNA 3RNTA 4NPBA 1FGTA 5IG3A 4OUQA 3PZWA 1VQ43 3OX9A 1T2HA 3WOEB 1TU5A 1YIT3 3GZRA 1B3SA 3KKGA 3MG1A 4H61A 3X3YA 4IPBA 2GU3A 5ELJA 3FSDA 2QIYA 2WGOA 3J7Yd 1JNQA 1N9JA 2QA43 1AV4A 1VZZA 3S27A 3OWSA 1YJN3 3D3LA 1UGIA 3DGOA 1K28A 1NWWA 4EYCA 5IERA 1K41A 2B24B 3MKIA 1TTOA 2K3DA 3MG3A 1RGCA 3PS8A 3BB9A 2HMOB 3FF0A 3BIRA 2IA7A 2CH9A 3OWUA 2BMRB 3GWRA 4I5QA 1RKYA 2KCDA 4MMYB 3WA2X 5IENA 1PU4A 2O3OA 2CWUA 2H0HA 2INXA 1I3IA 1I8VA 1RCKA 3CNXA 2OQEA 2PZVA 1IV7A 1N9EA 3BNCA 1X1UA 4KT3B 1SQWA 1BNEA 1YNVX 4LSOA 4KFDA 5D81A 1F8NA 1HZ1A 3CNMA 3CCU3 4HM1B 2OOVC 1RRLA 1QVF2 1TRPA 2STDA 1RDSA 4WHAA 1GYBA 3X3XA 3M8CA 1RMSA 1BSCA 2FXTA 3T8UA 3PXMA 3UL6A 1VQN3 1LQMB 1ULIB 3K9MC 2SBLA 1GMQA 1RGGA 4N6OB 1BNFA 1SIIA 4O3VA 1W4NA 1JBTA 4BTWA 4O8SA 1ZO2A 1EUIC 1ULJB 1NO3A 5AIIA 3G4S3 1RNTA 3FG4A 3EC9A 1RNBA 5KP4A 1E3RA 1RRHA 1V57A 4L8OA 1M904 2LYXA 1JBSA 3UB1A 3JUNA 1Q814 1BVIA 1BUQA 2XEPA 2W2CA 1FA3A 4LMIA 1BRGA 1KQS2 1D6UA 4K90B 1VQQA 2AADA 3CC43 3ZFZA 4J5KA 1CH0A 3EQQB 3K7CA 2HMLB 1MNLA 2IUKA 3X3ZA 4MEIA 1Q42A 1OGZA 3NX0A 4HM2B 2F5WA 3SEDA 5DREA 5AYRB 2FGTA 2CIUA 5FW5A 3S5CA 1QAFA 4DKIA 4N3VA 3DUKA 1FGQA 1B2ZA 3SOYA 4EV5A 1TIJA 3EHCA 2RSXA 1NDOB 3DGNA 1J2BA 1B21A 3LH4A 4HM8B 3HIIA 4FCMA 3ZG0A 3HK4A 1BNJA 9RNTA
chains in the Genus database with same CATH topology
4OVMA 3HI7A 4WFOA 4STDA 3S67A 2XF3A 3NQYA 3PCRA 3PYJA 1IVVA 2XGNA 4QWTA 4K61A 5DRVA 3H51A 1N8R4 1JJ22 1DYUA 4ORLA 5FGOA 1MOLA 2R4IA 4L7KA 3F14A 4N6UA 5AIGA 5LC7A 4FR9A 1W6YA 3JUQA 1TFKA 3KN4A 1KD14 3X40A 4MJDA 3KZTA 2CWTA 3ROBA 2KXGA 4HM7B 3F8HA 3FF2A 1DVDA 2CFKA 4O2HA 5IEOA 4AKYA 4HM4B 3KSPA 4KVHA 1FGRA 1TFOA 2OCTA 6STDA 1UUWB 2FNQA 1Q40B 1IU7A 1GD3A 1QMAA 2P09A 2WGQA 5AYSC 5BVBA 3GZBA 1Q864 3CME3 2OQEC 1O7GB 3DZLA 4HYZA 3FG3A 1L5GB 1VQP3 1OACA 2XSOB 4CDLA 3LTBA 3G8ZA 3FKAA 1Q40A 3IJEB 2IUJA 5JPPA 1IVWA 2Q07A 5AI1A 1E97A 1IQ8A 1KC84 4FCJA 3G713 1RN7A 1IT8A 4N6NB 3G16A 4GL6A 2OTL3 1IQYA 3EBTA 4JRFA 3NQZA 5CK6A 3SX1A 3O8YA 2ML5A 3EJVA 4FMBA 3VSYA 5I97A 2E2UA 5JBSA 3GZXB 3N8BA 1CEWI 3BNDA 4HJLB 4H3UA 3SXXA 5IG4A 1GY7A 1JB5A 1M1XB 3NUVA 3CCS3 1UI8A 3FG1A 4XDVA 3CC73 4G1MB 3CCQ3 3RDEA 3TDGA 1M9GA 3CCL3 3F40A 3I563 3V99A 2BMOB 5D83A 5CF2A 1A67A 1ISKA 2L4VA 4WYKB 3WOFB 5AEUB 3I553 1YHQ3 2ZDJA 2E2TA 1A2VA 2ML6A 3RGAA 5IEPA 1JB2A 3T0UA 3ER7A 1O7PB 2CG0A 1NB3I 2MC8A 3WDGB 4RBNA 3VF1A 1FUWA 1R4CA 1OHPA 4FCZA 2JQ5A 1DMNA 4WYKA 3E99A 2XRXB 1OGXA 1SJWA 3Q2PA 4XBYA 5TGNA 1PFPA 3V98A 3LT9A 4CCVA 3CXC2 1S723 3CD63 1US1A 2QGUA 3B4OA 5IG5A 2WO0A 2YFLB 5ELUA 3OV4A 3AMOB 2P0XA 3UJMA 3WODG 3MPHA 4HM5B 4XM4A 3EB8A 4N6TA 1WMPA 2HMKB 1WQLB 1IV9A 1IVXA 3KFQC 4KFEA 5CF1A 4N6LA 3JVCA 4FMCA 2Y73A 4FMAA 3HX8A 3IMAB 3NXJA 2CFLA 1VQL3 2B1XB 3D9RA 1IK3A 3SLUA 3AMOA 3KSED 1YVBI 3Q1CA 4GB5A 4AKZA 3LMLA 3GZYB 3BNEA 1UI7A 2P38A 2XH9A 2GEXA 3KE7A 4HZBB 2CW9A 3CCM3 3CPW2 3G0KA 1IQXA 3KIIA 1VQ83 2P05A 4IIAA 4J8TA 4XB5A 3A76A 4X2HA 3X42A 4XDWA 2D1WA 2C11A 1W01A 1OHOA 1AR0A 2PNCA 4EC6A 3GRDA 3FCSB 2OWPA 3OWYA 3S28A 1JN5B 1YIJ3 3CCJ3 1O7WB 5AIHA 3CCV3 3HIGA 1EQKA 3PGBA 1T5YA 2W03A 1EKMA 5KP1A 1NU3A 7STDA 4R9KA 5EEOA 3K5TA 4HM6B 3DM8A 3FZWA 5AEWB 1FGOA 1LVNA 1GY6A 2BMQB 2CFWA 1AVKA 1O7NB 1VQ63 1CQSA 1JN5A 2CHCA 2CG1A 2BO9B 3EN1B 4HM3B 3K0ZA 1LOXA 1SPUA 1A90A 1OH0A 3IPTA 1O7MB 2IMJA 3LYGA 2E2VA 4WP5A 1CYUA 2XSHB 4R9LA 3LOYA 4X2OA 4XBXA 5G2GA 3EX9A 1KSIA 1Z1SA 3LZAA 4HM0B 4R4KA 4NHFA 1LXEA 1VQM3 4HZ9B 1DVCA 3EE1A 5CLKA 1G96A 4JF8A 1N5PA 2XR8B 3VGNA 1D6ZA 2W9QA 1IVUA 4K1VA 2O9UX 4Q53A 3V92A 2XFTA 4HBRA 2LQVA 2WOFA 1ROAA 2W6JH 4N6MA 1OHSA 1OF5B 3B8LA 5AIFA 1YJW3 4MMZB 1JB4A 3JUOA 4EBGA 2BNGA 1Q824 4RNYA 2GEYA 1YI23 3DGLA 1U5OA 1SIHA 1A2KA 2Z7AA 4IT7A 3MG2A 1IT7A 3Q90A 3UNLA 3GAXA 2W0QA 1QVG2 3CCR3 2A15A 4TX4A 1OF5A 4I4KA 1N8QA 1WMNA 3DGMA 1TUHA 3ECFA 4U13A 4LZIA 3JUPA 3NM7A 1K8A4 2BT3A 5IW9A 2RFRA 2XFSA 1DMMA 1O7HB 3FH1A 1WTHA 4HVNA 3LTDA 4BTXA 4KFFA 2GU1A 1ROVA 2W9PA 2ZL8A 1VQ53 3LXUX 4LEHA 2BHMA 3DXOA 3X41A 2P0MA 2CKFB 1STFI 1FGMA 2K0MA 3BLZA 3NHXA 3NBJA 1VQK3 3LT8A 3QRDA 5STDA 3F9SA 1K734 1HKXA 2F98A 4HKVB 2M7OA 2UX0A 3CU3A 1EA2A 3EN8A 3K63A 3F8XA 2W56B 2HMJB 2QEX3 1CYVA 2CWVA 3F7XA 2HMMB 1GY5A 2W04A 2YX9A 3LTCA 1JV2B 1W02A 2F99A 3STDA 3CMA3 1IDPA 1D6YA 3MHEA 1WMOA 1HU9A 1WNHA 1W5ZA 1Q7Y4 3MSOA 2W56A 1W6CA 1W6GA 5EVHA 2MF7A 3U97A 5BXQA 2JDIH 1GD4A 1UUVB 1KWIA 1C7HA 3FLJA 1RJOA 8CHOA 4AEQA 2I9WA 1V74A 1ZX2A 3S29A 2WOHA 1W2ZA 5LC6A 4EV2A 4RZMA 2CFGA 1ASKA 3CC23 2OTJ3 1QALA 3F7SA 2OOVA 5HGRA 3B4PA 1TP6A 3PCSA 1VQO3 1JRQA 2YFJB 3NBBA 4R80A 3DMCA 3G6E3 2HMNB 1S5AA 1STDA 4PEJA 1W00A 1YGEA 4KZ1A 1Y4KA 1VQ93 2D42A 3WMDA 1AVLA 3OW22 1K9M4 3EBYA 1UW1A 1W2B2 1E3VA 2F86B 3LTAA 4XBTA 4WWUC 5A0OB 3H3HA 3NBRA 3L0RA 1QJGA 4O02B 4EXRA 5IF6A 3UL5A 5JPUA 4L8PA 1NJI4 2C10A 3ALAA 1OCVA 1QAKA 1NB5I 1LNHA 1U8CB 4BTYA 5EQLA 2XGLA 1N5HA 4N6V0 4LGQA 3NM2A 4ZM8A 4NREA 3N9HA 2CK3H 3JUMA 3OXAA 3N54B 2YFIB 3I0YA 3CCE3 3WA3A 2KRTA 1OPYA 3MYTA 1JKGB 5D82A 5CXOA 1YJ93 3HZPA 3SOAA 2RGQA 3NV0B 4K1UA 3EF8A 3T8NA 2GBXB 4J9AA 3RGRA 2GBWB 1M1K4 3BNBA 4FMDA 3B7CA 4OK0A 1JKGA 2CFDA 2GXFA 3MWZA 1VQ73 2RCDA 4R1KA 2K54A 2CC3A 1EG9B 2Y74A 3QK9A 3SVAA 5IG0A 1DMQA 1GS3A 4RNZA 4MMXB 3CPOA 2Z76A 2V1LA 3NV0A 3DY5A 1W7CA 2Z77A 2Z6BA 5KP3A 3U1WA 1OUNA 1FGTA 5IG3A 4OUQA 3PZWA 1VQ43 3OX9A 3WOEB 1TU5A 1YIT3 3GZRA 3MG1A 3KKGA 4H61A 3X3YA 4IPBA 2GU3A 5ELJA 3FSDA 2QIYA 2WGOA 3J7Yd 1JNQA 1N9JA 2QA43 1AV4A 1VZZA 3S27A 3OWSA 1YJN3 3D3LA 3DGOA 1K28A 1NWWA 4EYCA 5IERA 1K41A 2B24B 3MKIA 3MG3A 3PS8A 3BB9A 2HMOB 3FF0A 3OWUA 2IA7A 2CH9A 1RKYA 2BMRB 3GWRA 2KCDA 4MMYB 3WA2X 5IENA 1PU4A 2O3OA 2CWUA 2INXA 3CNXA 2OQEA 2PZVA 1IV7A 1N9EA 3BNCA 1SQWA 4LSOA 4KFDA 5D81A 1F8NA 3CNMA 3CCU3 4HM1B 2OOVC 1RRLA 1QVF2 2STDA 4WHAA 3X3XA 1GYBA 3M8CA 2FXTA 3T8UA 3PXMA 3UL6A 1VQN3 1ULIB 3K9MC 2SBLA 4N6OB 1SIIA 4O3VA 1W4NA 4BTWA 4O8SA 1ZO2A 1ULJB 1NO3A 5AIIA 3G4S3 3FG4A 3EC9A 5KP4A 1E3RA 1RRHA 4L8OA 1M904 2LYXA 3UB1A 3JUNA 1Q814 1BUQA 2XEPA 2W2CA 1FA3A 4LMIA 1KQS2 1D6UA 4K90B 3CC43 3EQQB 3K7CA 2HMLB 1MNLA 2IUKA 3X3ZA 4MEIA 1Q42A 1OGZA 3NX0A 4HM2B 3SEDA 5DREA 5AYRB 2FGTA 2CIUA 5FW5A 3S5CA 1QAFA 4N3VA 3DUKA 1FGQA 3SOYA 4EV5A 1TIJA 3EHCA 2RSXA 1NDOB 3DGNA 1J2BA 3LH4A 4HM8B 3HIIA 4FCMA 3HK4A 3FGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVM A;  4STD A;  5DRV A;  3H51 A;  4ORL A;  2R4I A;  4L7K A;  3F14 A;  5AIG A;  1W6Y A;  3JUQ A;  4MJD A;  3KZT A;  3ROB A;  4HM7 B;  3F8H A;  3FF2 A;  5IEO A;  4HM4 B;  3KSP A;  4KVH A;  6STD A;  1UUW B;  1Q40 B;  1QMA A;  5BVB A;  3GZB A;  1O7G B;  3DZL A;  2XSO B;  4CDL A;  3G8Z A;  3FKA A;  1Q40 A;  5JPP A;  5AI1 A;  1E97 A;  4FCJ A;  3G16 A;  3EBT A;  5CK6 A;  3EJV A;  3VSY A;  3GZX B;  4HJL B;  4H3U A;  5IG4 A;  1GY7 A;  1JB5 A;  3NUV A;  4XDV A;  3F40 A;  2BMO B;  5D83 A;  5CF2 A;  1ISK A;  4WYK B;  5AEU B;  3RGA A;  5IEP A;  1JB2 A;  3ER7 A;  1O7P B;  1OHP A;  2JQ5 A;  1DMN A;  4WYK A;  3E99 A;  2XRX B;  1OGX A;  1SJW A;  4XBY A;  5TGN A;  2QGU A;  3B4O A;  5IG5 A;  2YFL B;  3OV4 A;  3UJM A;  4HM5 B;  4XM4 A;  2HMK B;  1WQL B;  5CF1 A;  3HX8 A;  3NXJ A;  2B1X B;  3D9R A;  4GB5 A;  3GZY B;  2GEX A;  3KE7 A;  4HZB B;  3G0K A;  4IIA A;  4J8T A;  4XB5 A;  3A76 A;  4X2H A;  4XDW A;  1W01 A;  1OHO A;  1AR0 A;  3GRD A;  2OWP A;  3OWY A;  1JN5 B;  1O7W B;  5AIH A;  5KP1 A;  1NU3 A;  7STD A;  4R9K A;  4HM6 B;  3DM8 A;  3FZW A;  5AEW B;  1GY6 A;  2BMQ B;  1O7N B;  1CQS A;  1JN5 A;  2CHC A;  3EN1 B;  4HM3 B;  3K0Z A;  1OH0 A;  3IPT A;  1O7M B;  2IMJ A;  3LYG A;  4WP5 A;  2XSH B;  4R9L A;  4X2O A;  4XBX A;  5G2G A;  3EX9 A;  1Z1S A;  3LZA A;  4HM0 B;  4HZ9 B;  5CLK A;  2XR8 B;  3VGN A;  4K1V A;  4Q53 A;  1OHS A;  1OF5 B;  3B8L A;  5AIF A;  1JB4 A;  3JUO A;  2BNG A;  2GEY A;  1U5O A;  1A2K A;  2Z7A A;  3MG2 A;  3Q90 A;  3UNL A;  2A15 A;  1OF5 A;  4I4K A;  3ECF A;  1TUH A;  4U13 A;  3JUP A;  2RFR A;  1DMM A;  1O7H B;  3FH1 A;  4HVN A;  4LEH A;  3DXO A;  2CKF B;  3NHX A;  3BLZ A;  5STD A;  3F9S A;  1HKX A;  2F98 A;  4HKV B;  2UX0 A;  3CU3 A;  1EA2 A;  3EN8 A;  3F8X A;  2HMJ B;  3F7X A;  2HMM B;  1GY5 A;  3STD A;  1W02 A;  2F99 A;  1IDP A;  3MHE A;  3MSO A;  5EVH A;  5BXQ A;  1UUV B;  1C7H A;  3FLJ A;  8CHO A;  2I9W A;  1ZX2 A;  4RZM A;  1ASK A;  3F7S A;  5HGR A;  3B4P A;  1TP6 A;  2YFJ B;  3DMC A;  2HMN B;  1S5A A;  1STD A;  4PEJ A;  1W00 A;  3WMD A;  3EBY A;  1E3V A;  2F86 B;  4XBT A;  4WWU C;  3H3H A;  3NBR A;  1QJG A;  5IF6 A;  5JPU A;  4L8P A;  1OCV A;  4LGQ A;  3NM2 A;  3JUM A;  3OXA A;  2YFI B;  3I0Y A;  1OPY A;  3MYT A;  1JKG B;  5D82 A;  5CXO A;  3HZP A;  3SOA A;  2RGQ A;  3NV0 B;  4K1U A;  3EF8 A;  3T8N A;  4J9A A;  3RGR A;  2GBX B;  2GBW B;  3B7C A;  1JKG A;  2GXF A;  2RCD A;  4R1K A;  2K54 A;  1EG9 B;  5IG0 A;  1DMQ A;  1GS3 A;  3CPO A;  2Z76 A;  3NV0 A;  2Z77 A;  5KP3 A;  1OUN A;  5IG3 A;  4OUQ A;  3OX9 A;  3GZR A;  3MG1 A;  3KKG A;  3FSD A;  2QIY A;  1VZZ A;  3OWS A;  5IER A;  1NWW A;  1K41 A;  2B24 B;  3MKI A;  3MG3 A;  3BB9 A;  2HMO B;  3FF0 A;  3OWU A;  2BMR B;  3GWR A;  5IEN A;  2INX A;  3CNX A;  2PZV A;  5D81 A;  3CNM A;  4HM1 B;  2STD A;  1GYB A;  3M8C A;  3T8U A;  1ULI B;  1ZO2 A;  1ULJ B;  5AII A;  3EC9 A;  5KP4 A;  1E3R A;  4L8O A;  3JUN A;  1BUQ A;  2W2C A;  4LMI A;  3EQQ B;  3K7C A;  2HML B;  1Q42 A;  1OGZ A;  4HM2 B;  3SED A;  5DRE A;  5FW5 A;  3S5C A;  4N3V A;  3DUK A;  3SOY A;  3EHC A;  1NDO B;  4HM8 B;  4FCM A;  3HK4 A;  3FGY A; 
#chains in the Genus database with same CATH topology
 4OVM A;  3HI7 A;  4WFO A;  4STD A;  2F56 A;  1I3F A;  4GHO A;  3S67 A;  2XF3 A;  3NQY A;  3KCH A;  3PCR A;  1LRA A;  3PYJ A;  1IVV A;  2XGN A;  4QWT A;  4K61 A;  5DRV A;  4BL2 A;  3H51 A;  1N8R 4;  1TRQ A;  1JJ2 2;  1DYU A;  4ORL A;  5FGO A;  1MOL A;  2R4I A;  4L7K A;  3F14 A;  4N6U A;  5AIG A;  5LC7 A;  4FR9 A;  5RNT A;  1FW7 A;  1W6Y A;  3JUQ A;  1TFK A;  2AAE A;  1BSE A;  1X1W A;  3KN4 A;  2UGI A;  1KD1 4;  3X40 A;  4MJD A;  3KZT A;  2CWT A;  3ROB A;  2KXG A;  4HM7 B;  3F8H A;  3FF2 A;  1X1Y A;  1Q7H A;  2F4Y A;  2CFK A;  1DVD A;  4O2H A;  3WR2 A;  1V58 A;  5IEO A;  4AKY A;  4HM4 B;  3KSP A;  4KVH A;  1FGR A;  1TFO A;  2OCT A;  6STD A;  1UUW B;  1BSD A;  2FNQ A;  5BU4 A;  1Q40 B;  3AHS A;  1IU7 A;  1GD3 A;  1QMA A;  2P09 A;  2WGQ A;  5AYS C;  5BVB A;  1B2M A;  1MGW A;  3GZB A;  1Q86 4;  3CME 3;  2OQE C;  1O7G B;  1RN1 A;  1BGS A;  1RN4 A;  3DZL A;  4HYZ A;  3FG3 A;  1L5G B;  4CJN A;  1VQP 3;  3AGO A;  1BRJ A;  1RHL A;  1OAC A;  2XSO B;  4CDL A;  3LTB A;  2CX1 A;  3G8Z A;  3FKA A;  1Q40 A;  3IJE B;  2IUJ A;  5JPP A;  2KF6 A;  1IVW A;  2ZA4 A;  1MGR A;  2Q07 A;  1LOY A;  5AI1 A;  1E97 A;  1IQ8 A;  4BU4 A;  1KC8 4;  4FCJ A;  3G71 3;  2KF3 A;  1RN7 A;  1IT8 A;  4N6N B;  1PY3 A;  3G16 A;  3Q3F A;  4GL6 A;  2OTL 3;  1IQY A;  3EBT A;  8RNT A;  4JRF A;  3NQZ A;  5CK6 A;  3SX1 A;  3O8Y A;  1G02 A;  2ML5 A;  3EJV A;  4FMB A;  1I2E A;  3VSY A;  5I97 A;  2E2U A;  5JBS A;  1FUT A;  3GZX B;  3N8B A;  1CEW I;  3BND A;  4HJL B;  4H3U A;  3SXX A;  2H0I A;  1GY7 A;  7RNT A;  5IG4 A;  1JB5 A;  1M1X B;  3NUV A;  1B27 A;  3CCS 3;  1RTU A;  1RGK A;  1UI8 A;  3FG1 A;  4XDV A;  3CC7 3;  1BRK A;  4G1M B;  3CCQ 3;  1RGL A;  3RDE A;  3TDG A;  1BSB A;  1M9G A;  3CCL 3;  3F40 A;  3I56 3;  3V99 A;  2BMO B;  5D83 A;  5CF2 A;  1A67 A;  1ISK A;  2L4V A;  1RGF A;  4WYK B;  3WOF B;  5AEU B;  3I55 3;  1YHQ 3;  1RSN A;  2ZDJ A;  2E2T A;  5M19 A;  1BNS A;  1A2V A;  2ML6 A;  5HOH A;  2ZHX B;  3RGA A;  5IEP A;  1JB2 A;  3T0U A;  3ER7 A;  1O7P B;  1I2F A;  2CG0 A;  1NB3 I;  3AGN A;  2MC8 A;  3WDG B;  1MWR A;  4RBN A;  3VF1 A;  1BNR A;  1FUW A;  1IYY A;  1R4C A;  1OHP A;  4FCZ A;  2JQ5 A;  1DMN A;  2HOH A;  4WYK A;  3E99 A;  2XRX B;  1OGX A;  1SJW A;  1UGH I;  3Q2P A;  4XBY A;  5TGN A;  1PFP A;  1BRI A;  3LT9 A;  3V98 A;  2UUG C;  4CCV A;  6GSP A;  3CXC 2;  1S72 3;  1BUJ A;  3CD6 3;  1PYL A;  1US1 A;  2QGU A;  3B4O A;  5IG5 A;  2WO0 A;  1UCJ A;  3D4A A;  2YFL B;  1BAN A;  5ELU A;  5G1L A;  1BU4 A;  1MWT A;  3OV4 A;  3AMO B;  2P0X A;  3UJM A;  3WOD G;  3MPH A;  4HM5 B;  4XM4 A;  3EB8 A;  2J8X B;  4N6T A;  1WMP A;  2HMK B;  1GMP A;  1WQL B;  1IV9 A;  1IVX A;  2CX0 A;  1T2I A;  6RNT A;  3KFQ C;  4KFE A;  5CF1 A;  4N6L A;  1UCL A;  3JVC A;  4FMC A;  2Y73 A;  4FMA A;  3HX8 A;  3IMA B;  3NXJ A;  2CFL A;  1VQL 3;  2B1X B;  3D9R A;  1IK3 A;  3SLU A;  3AMO A;  1MWU A;  2H0G A;  3KSE D;  1FZU A;  1YVB I;  3GSP A;  3Q1C A;  4GB5 A;  4AKZ A;  1Q9E A;  3LML A;  3GZY B;  1VQ7 3;  3D5G A;  3BNE A;  1UI7 A;  2P38 A;  2XH9 A;  3A5E A;  2GEX A;  3KE7 A;  4HZB B;  1ZS7 A;  5GSP A;  2CW9 A;  3CCM 3;  1LOV A;  2GSP A;  3CPW 2;  1LQG C;  3G0K A;  1IQX A;  3KII A;  1VQ8 3;  2P05 A;  4IIA A;  4J8T A;  4XB5 A;  3A76 A;  1YVS A;  4X2H A;  3X42 A;  4XDW A;  2D1W A;  4CPK A;  2C11 A;  1W01 A;  1OHO A;  1AR0 A;  2PNC A;  4EC6 A;  3ZG5 A;  3GRD A;  1I70 A;  1FYS A;  3FCS B;  1RCL A;  2OWP A;  1SAR A;  3OWY A;  3S28 A;  1JN5 B;  1YIJ 3;  3CCJ 3;  1O7W B;  5AIH A;  3CCV 3;  3HIG A;  3D79 A;  1EQK A;  3PGB A;  1T5Y A;  2W03 A;  1EKM A;  3AHW A;  1NU3 A;  5KP1 A;  7STD A;  4R9K A;  1RLS A;  5EEO A;  3K5T A;  4HM6 B;  3DM8 A;  3FZW A;  5AEW B;  1FGO A;  1LVN A;  1GY6 A;  2BMQ B;  2CFW A;  1AVK A;  1O7N B;  1VQ6 3;  1CQS A;  1JN5 A;  2CHC A;  2KF4 A;  2CG1 A;  2BO9 B;  3EN1 B;  4HM3 B;  3K0Z A;  1B2S A;  1LOX A;  4LYL B;  1SPU A;  1A90 A;  1OH0 A;  3IPT A;  1O7M B;  2IMJ A;  3LYG A;  2E2V A;  4WP5 A;  1CYU A;  2XSH B;  4R9L A;  1R4Y A;  3LOY A;  4X2O A;  4XBX A;  5G2G A;  3EX9 A;  1KSI A;  1Z1S A;  3LZA A;  4HM0 B;  4R4K A;  4NHF A;  1LXE A;  1VQM 3;  4HZ9 B;  1DVC A;  2IY2 A;  4J5G A;  3EE1 A;  5CLK A;  1G96 A;  4JF8 A;  1C54 A;  1N5P A;  2XR8 B;  3VGN A;  1D6Z A;  1UUG B;  2W9Q A;  1IVU A;  4K1V A;  2O9U X;  4Q53 A;  1BOX A;  3V92 A;  2XFT A;  4HBR A;  2LQV A;  2WOF A;  1ROA A;  1JBR A;  1B20 A;  2BIR A;  2W6J H;  4N6M A;  1OHS A;  1OF5 B;  3B8L A;  5AIF A;  1GMR A;  4MMZ B;  1YJW 3;  1AY7 A;  2SAR A;  1JB4 A;  3JUO A;  4EBG A;  2BNG A;  1Q82 4;  4RNY A;  2GEY A;  1I0X A;  1YI2 3;  3DGL A;  1U5O A;  1SIH A;  1A2K A;  2Z7A A;  4IT7 A;  3MG2 A;  1IT7 A;  3Q90 A;  3UNL A;  3GAX A;  1JZD A;  2KAA A;  1B2U A;  1UDI I;  2W0Q A;  4BL3 A;  1QVG 2;  3CCR 3;  2A15 A;  4TX4 A;  1OF5 A;  4I4K A;  1N8Q A;  1WMN A;  3DGM A;  1TUH A;  3ECF A;  4U13 A;  4LZI A;  3JUP A;  3NM7 A;  1K8A 4;  2BT3 A;  5IW9 A;  2RFR A;  2XFS A;  1DMM A;  1MWS A;  1O7H B;  1WTH A;  3FH1 A;  4HVN A;  3LTD A;  4BTX A;  4KFF A;  2GU1 A;  1ROV A;  2W9P A;  2ZL8 A;  3SYU A;  3LXU X;  1VQ5 3;  4LEH A;  2BHM A;  3DXO A;  1DET A;  1ZGX A;  2CKF B;  1STF I;  2P0M A;  3X41 A;  1FGM A;  2K0M A;  3BLZ A;  3NHX A;  3NBJ A;  1VQK 3;  3LT8 A;  3QRD A;  5STD A;  3F9S A;  1K73 4;  1HKX A;  2F98 A;  1BIR A;  4HKV B;  2M7O A;  2UX0 A;  3CU3 A;  1EA2 A;  3EN8 A;  3K63 A;  3F8X A;  2W56 B;  2HMJ B;  2QEX 3;  1CYV A;  2CWV A;  3F7X A;  4EW5 A;  1BNG A;  1NNV A;  1GY5 A;  1AQZ A;  2HMM B;  2W04 A;  2YX9 A;  3URP A;  3LTC A;  1JV2 B;  1W02 A;  2F99 A;  3STD A;  3CMA 3;  1IDP A;  1D6Y A;  3MHE A;  1WMO A;  5G1K A;  1HU9 A;  1WNH A;  1W5Z A;  1Q7Y 4;  2BU4 A;  3MSO A;  4AEQ A;  1B2X A;  1A2P A;  1RGH A;  1W6C A;  2L1S A;  2W56 A;  1W6G A;  5EVH A;  2MF7 A;  3U97 A;  2KF5 A;  5BXQ A;  2JDI H;  1GD4 A;  1UUV B;  1C7H A;  1KWI A;  3FLJ A;  1RJO A;  8CHO A;  1BSA A;  2I9W A;  1V74 A;  1ZX2 A;  1T3B A;  2WOH A;  1W2Z A;  1RGA A;  5LC6 A;  3S29 A;  4EV2 A;  4RZM A;  2CFG A;  1RGE A;  1TJD A;  1ASK A;  3CC2 3;  2OTJ 3;  1I0V A;  1QAL A;  1UCK A;  3F7S A;  2OOV A;  1EEJ A;  1GOY A;  5HGR A;  3B4P A;  1TP6 A;  3PCS A;  1VQO 3;  3FGY A;  1JRQ A;  2YFJ B;  3NBB A;  4R80 A;  3DMC A;  3G6E 3;  1BRS A;  1GOU A;  1S5A A;  2HMN B;  4BIR A;  1STD A;  4PEJ A;  1W00 A;  1YGE A;  1BAO A;  4KZ1 A;  1Y4K A;  1VQ9 3;  2D42 A;  3WMD A;  1BRN L;  1AVL A;  1JZO A;  3OW2 2;  1K9M 4;  3EBY A;  1UW1 A;  1W2B 2;  1E3V A;  2F86 B;  3LTA A;  4XBT A;  4WWU C;  5A0O B;  3H3H A;  3NBR A;  1HYF A;  3L0R A;  1QJG A;  2R41 A;  4O02 B;  1I2G A;  3DGY A;  4EXR A;  5IF6 A;  1LNI A;  3UL5 A;  4L8P A;  3WHO A;  5JPU A;  1NJI 4;  2C10 A;  3ALA A;  1OCV A;  1QAK A;  3HOH A;  1NB5 I;  1LNH A;  1U8C B;  4BTY A;  5EQL A;  2IYJ A;  2XGL A;  1N5H A;  4N6V 0;  2C4B A;  4LGQ A;  3NM2 A;  1G0T A;  4ZM8 A;  4NRE A;  2RNT A;  2CK3 H;  3JUM A;  3N9H A;  3OXA A;  3N54 B;  2YFI B;  3I0Y A;  3CCE 3;  3WA3 A;  1FUS A;  2KRT A;  1OPY A;  3MYT A;  1JKG B;  5D82 A;  5CXO A;  4ILF A;  1YJ9 3;  3HZP A;  3SOA A;  4HOH A;  4GSP A;  1BRH A;  2RGQ A;  1BNI A;  3NV0 B;  4K1U A;  3EF8 A;  3T8N A;  1X1X A;  2GBX B;  4J9A A;  3RGR A;  2GBW B;  5M18 A;  1M1K 4;  3BNB A;  4FMD A;  3B7C A;  1YGW A;  1JKG A;  2CFD A;  2GXF A;  3MWZ A;  4OK0 A;  2RCD A;  5M1A A;  1GSP A;  4R1K A;  5BIR A;  2K54 A;  2CC3 A;  1EG9 B;  2RBI A;  2Y74 A;  3D5I A;  3QK9 A;  3SVA A;  1GOV A;  5IG0 A;  7GSP A;  1DMQ A;  1GS3 A;  4RNZ A;  4MMX B;  1DE3 A;  3CPO A;  4HAA A;  2Z76 A;  2V1L A;  3NV0 A;  3BU4 A;  1LOW A;  3DY5 A;  4RNT A;  1UCI A;  3DH2 A;  2F5M A;  1W7C A;  2Z77 A;  2Z6B A;  5KP3 A;  3U1W A;  1OUN A;  3RNT A;  4NPB A;  1FGT A;  5IG3 A;  4OUQ A;  3PZW A;  1VQ4 3;  3OX9 A;  1T2H A;  3WOE B;  1TU5 A;  1YIT 3;  3GZR A;  1B3S A;  3KKG A;  3MG1 A;  4H61 A;  3X3Y A;  4IPB A;  2GU3 A;  5ELJ A;  3FSD A;  2QIY A;  2WGO A;  3J7Y d;  1JNQ A;  1N9J A;  2QA4 3;  1AV4 A;  1VZZ A;  3S27 A;  3OWS A;  1YJN 3;  3D3L A;  1UGI A;  3DGO A;  1K28 A;  1NWW A;  4EYC A;  5IER A;  1K41 A;  2B24 B;  3MKI A;  1TTO A;  2K3D A;  3MG3 A;  1RGC A;  3PS8 A;  3BB9 A;  2HMO B;  3FF0 A;  3BIR A;  2IA7 A;  2CH9 A;  3OWU A;  2BMR B;  3GWR A;  4I5Q A;  1RKY A;  2KCD A;  4MMY B;  3WA2 X;  5IEN A;  1PU4 A;  2O3O A;  2CWU A;  2H0H A;  2INX A;  1I3I A;  1I8V A;  1RCK A;  3CNX A;  2OQE A;  2PZV A;  1IV7 A;  1N9E A;  3BNC A;  1X1U A;  4KT3 B;  1SQW A;  1BNE A;  1YNV X;  4LSO A;  4KFD A;  5D81 A;  1F8N A;  1HZ1 A;  3CNM A;  3CCU 3;  4HM1 B;  2OOV C;  1RRL A;  1QVF 2;  1TRP A;  2STD A;  1RDS A;  4WHA A;  1GYB A;  3X3X A;  3M8C A;  1RMS A;  1BSC A;  2FXT A;  3T8U A;  3PXM A;  3UL6 A;  1VQN 3;  1LQM B;  1ULI B;  3K9M C;  2SBL A;  1GMQ A;  1RGG A;  4N6O B;  1BNF A;  1SII A;  4O3V A;  1W4N A;  1JBT A;  4BTW A;  4O8S A;  1ZO2 A;  1EUI C;  1ULJ B;  1NO3 A;  5AII A;  3G4S 3;  1RNT A;  3FG4 A;  3EC9 A;  1RNB A;  5KP4 A;  1E3R A;  1RRH A;  1V57 A;  4L8O A;  1M90 4;  2LYX A;  1JBS A;  3UB1 A;  3JUN A;  1Q81 4;  1BVI A;  1BUQ A;  2XEP A;  2W2C A;  1FA3 A;  4LMI A;  1BRG A;  1KQS 2;  1D6U A;  4K90 B;  1VQQ A;  2AAD A;  3CC4 3;  3ZFZ A;  4J5K A;  1CH0 A;  3EQQ B;  3K7C A;  2HML B;  1MNL A;  2IUK A;  3X3Z A;  4MEI A;  1Q42 A;  1OGZ A;  3NX0 A;  4HM2 B;  2F5W A;  3SED A;  5DRE A;  5AYR B;  2FGT A;  2CIU A;  5FW5 A;  3S5C A;  1QAF A;  4DKI A;  4N3V A;  3DUK A;  1FGQ A;  1B2Z A;  3SOY A;  4EV5 A;  1TIJ A;  3EHC A;  2RSX A;  1NDO B;  3DGN A;  1J2B A;  1B21 A;  3LH4 A;  4HM8 B;  3HII A;  4FCM A;  3ZG0 A;  3HK4 A;  1BNJ A;  9RNT A; 
#chains in the Genus database with same CATH homology
 4OVM A;  3HI7 A;  4WFO A;  4STD A;  3S67 A;  2XF3 A;  3NQY A;  3PCR A;  3PYJ A;  1IVV A;  2XGN A;  4QWT A;  4K61 A;  5DRV A;  3H51 A;  1N8R 4;  1JJ2 2;  1DYU A;  4ORL A;  5FGO A;  1MOL A;  2R4I A;  4L7K A;  3F14 A;  4N6U A;  5AIG A;  5LC7 A;  4FR9 A;  1W6Y A;  3JUQ A;  1TFK A;  3KN4 A;  1KD1 4;  3X40 A;  4MJD A;  3KZT A;  2CWT A;  3ROB A;  2KXG A;  4HM7 B;  3F8H A;  3FF2 A;  1DVD A;  2CFK A;  4O2H A;  5IEO A;  4AKY A;  4HM4 B;  3KSP A;  4KVH A;  1FGR A;  1TFO A;  2OCT A;  6STD A;  1UUW B;  2FNQ A;  1Q40 B;  1IU7 A;  1GD3 A;  1QMA A;  2P09 A;  2WGQ A;  5AYS C;  5BVB A;  3GZB A;  1Q86 4;  3CME 3;  2OQE C;  1O7G B;  3DZL A;  4HYZ A;  3FG3 A;  1L5G B;  1VQP 3;  1OAC A;  2XSO B;  4CDL A;  3LTB A;  3G8Z A;  3FKA A;  1Q40 A;  3IJE B;  2IUJ A;  5JPP A;  1IVW A;  2Q07 A;  5AI1 A;  1E97 A;  1IQ8 A;  1KC8 4;  4FCJ A;  3G71 3;  1RN7 A;  1IT8 A;  4N6N B;  3G16 A;  4GL6 A;  2OTL 3;  1IQY A;  3EBT A;  4JRF A;  3NQZ A;  5CK6 A;  3SX1 A;  3O8Y A;  2ML5 A;  3EJV A;  4FMB A;  3VSY A;  5I97 A;  2E2U A;  5JBS A;  3GZX B;  3N8B A;  1CEW I;  3BND A;  4HJL B;  4H3U A;  3SXX A;  5IG4 A;  1GY7 A;  1JB5 A;  1M1X B;  3NUV A;  3CCS 3;  1UI8 A;  3FG1 A;  4XDV A;  3CC7 3;  4G1M B;  3CCQ 3;  3RDE A;  3TDG A;  1M9G A;  3CCL 3;  3F40 A;  3I56 3;  3V99 A;  2BMO B;  5D83 A;  5CF2 A;  1A67 A;  1ISK A;  2L4V A;  4WYK B;  3WOF B;  5AEU B;  3I55 3;  1YHQ 3;  2ZDJ A;  2E2T A;  1A2V A;  2ML6 A;  3RGA A;  5IEP A;  1JB2 A;  3T0U A;  3ER7 A;  1O7P B;  2CG0 A;  1NB3 I;  2MC8 A;  3WDG B;  4RBN A;  3VF1 A;  1FUW A;  1R4C A;  1OHP A;  4FCZ A;  2JQ5 A;  1DMN A;  4WYK A;  3E99 A;  2XRX B;  1OGX A;  1SJW A;  3Q2P A;  4XBY A;  5TGN A;  1PFP A;  3V98 A;  3LT9 A;  4CCV A;  3CXC 2;  1S72 3;  3CD6 3;  1US1 A;  2QGU A;  3B4O A;  5IG5 A;  2WO0 A;  2YFL B;  5ELU A;  3OV4 A;  3AMO B;  2P0X A;  3UJM A;  3WOD G;  3MPH A;  4HM5 B;  4XM4 A;  3EB8 A;  4N6T A;  1WMP A;  2HMK B;  1WQL B;  1IV9 A;  1IVX A;  3KFQ C;  4KFE A;  5CF1 A;  4N6L A;  3JVC A;  4FMC A;  2Y73 A;  4FMA A;  3HX8 A;  3IMA B;  3NXJ A;  2CFL A;  1VQL 3;  2B1X B;  3D9R A;  1IK3 A;  3SLU A;  3AMO A;  3KSE D;  1YVB I;  3Q1C A;  4GB5 A;  4AKZ A;  3LML A;  3GZY B;  3BNE A;  1UI7 A;  2P38 A;  2XH9 A;  2GEX A;  3KE7 A;  4HZB B;  2CW9 A;  3CCM 3;  3CPW 2;  3G0K A;  1IQX A;  3KII A;  1VQ8 3;  2P05 A;  4IIA A;  4J8T A;  4XB5 A;  3A76 A;  4X2H A;  3X42 A;  4XDW A;  2D1W A;  2C11 A;  1W01 A;  1OHO A;  1AR0 A;  2PNC A;  4EC6 A;  3GRD A;  3FCS B;  2OWP A;  3OWY A;  3S28 A;  1JN5 B;  1YIJ 3;  3CCJ 3;  1O7W B;  5AIH A;  3CCV 3;  3HIG A;  1EQK A;  3PGB A;  1T5Y A;  2W03 A;  1EKM A;  5KP1 A;  1NU3 A;  7STD A;  4R9K A;  5EEO A;  3K5T A;  4HM6 B;  3DM8 A;  3FZW A;  5AEW B;  1FGO A;  1LVN A;  1GY6 A;  2BMQ B;  2CFW A;  1AVK A;  1O7N B;  1VQ6 3;  1CQS A;  1JN5 A;  2CHC A;  2CG1 A;  2BO9 B;  3EN1 B;  4HM3 B;  3K0Z A;  1LOX A;  1SPU A;  1A90 A;  1OH0 A;  3IPT A;  1O7M B;  2IMJ A;  3LYG A;  2E2V A;  4WP5 A;  1CYU A;  2XSH B;  4R9L A;  3LOY A;  4X2O A;  4XBX A;  5G2G A;  3EX9 A;  1KSI A;  1Z1S A;  3LZA A;  4HM0 B;  4R4K A;  4NHF A;  1LXE A;  1VQM 3;  4HZ9 B;  1DVC A;  3EE1 A;  5CLK A;  1G96 A;  4JF8 A;  1N5P A;  2XR8 B;  3VGN A;  1D6Z A;  2W9Q A;  1IVU A;  4K1V A;  2O9U X;  4Q53 A;  3V92 A;  2XFT A;  4HBR A;  2LQV A;  2WOF A;  1ROA A;  2W6J H;  4N6M A;  1OHS A;  1OF5 B;  3B8L A;  5AIF A;  1YJW 3;  4MMZ B;  1JB4 A;  3JUO A;  4EBG A;  2BNG A;  1Q82 4;  4RNY A;  2GEY A;  1YI2 3;  3DGL A;  1U5O A;  1SIH A;  1A2K A;  2Z7A A;  4IT7 A;  3MG2 A;  1IT7 A;  3Q90 A;  3UNL A;  3GAX A;  2W0Q A;  1QVG 2;  3CCR 3;  2A15 A;  4TX4 A;  1OF5 A;  4I4K A;  1N8Q A;  1WMN A;  3DGM A;  1TUH A;  3ECF A;  4U13 A;  4LZI A;  3JUP A;  3NM7 A;  1K8A 4;  2BT3 A;  5IW9 A;  2RFR A;  2XFS A;  1DMM A;  1O7H B;  3FH1 A;  1WTH A;  4HVN A;  3LTD A;  4BTX A;  4KFF A;  2GU1 A;  1ROV A;  2W9P A;  2ZL8 A;  1VQ5 3;  3LXU X;  4LEH A;  2BHM A;  3DXO A;  3X41 A;  2P0M A;  2CKF B;  1STF I;  1FGM A;  2K0M A;  3BLZ A;  3NHX A;  3NBJ A;  1VQK 3;  3LT8 A;  3QRD A;  5STD A;  3F9S A;  1K73 4;  1HKX A;  2F98 A;  4HKV B;  2M7O A;  2UX0 A;  3CU3 A;  1EA2 A;  3EN8 A;  3K63 A;  3F8X A;  2W56 B;  2HMJ B;  2QEX 3;  1CYV A;  2CWV A;  3F7X A;  2HMM B;  1GY5 A;  2W04 A;  2YX9 A;  3LTC A;  1JV2 B;  1W02 A;  2F99 A;  3STD A;  3CMA 3;  1IDP A;  1D6Y A;  3MHE A;  1WMO A;  1HU9 A;  1WNH A;  1W5Z A;  1Q7Y 4;  3MSO A;  2W56 A;  1W6C A;  1W6G A;  5EVH A;  2MF7 A;  3U97 A;  5BXQ A;  2JDI H;  1GD4 A;  1UUV B;  1KWI A;  1C7H A;  3FLJ A;  1RJO A;  8CHO A;  4AEQ A;  2I9W A;  1V74 A;  1ZX2 A;  3S29 A;  2WOH A;  1W2Z A;  5LC6 A;  4EV2 A;  4RZM A;  2CFG A;  1ASK A;  3CC2 3;  2OTJ 3;  1QAL A;  3F7S A;  2OOV A;  5HGR A;  3B4P A;  1TP6 A;  3PCS A;  1VQO 3;  1JRQ A;  2YFJ B;  3NBB A;  4R80 A;  3DMC A;  3G6E 3;  2HMN B;  1S5A A;  1STD A;  4PEJ A;  1W00 A;  1YGE A;  4KZ1 A;  1Y4K A;  1VQ9 3;  2D42 A;  3WMD A;  1AVL A;  3OW2 2;  1K9M 4;  3EBY A;  1UW1 A;  1W2B 2;  1E3V A;  2F86 B;  3LTA A;  4XBT A;  4WWU C;  5A0O B;  3H3H A;  3NBR A;  3L0R A;  1QJG A;  4O02 B;  4EXR A;  5IF6 A;  3UL5 A;  5JPU A;  4L8P A;  1NJI 4;  2C10 A;  3ALA A;  1OCV A;  1QAK A;  1NB5 I;  1LNH A;  1U8C B;  4BTY A;  5EQL A;  2XGL A;  1N5H A;  4N6V 0;  4LGQ A;  3NM2 A;  4ZM8 A;  4NRE A;  3N9H A;  2CK3 H;  3JUM A;  3OXA A;  3N54 B;  2YFI B;  3I0Y A;  3CCE 3;  3WA3 A;  2KRT A;  1OPY A;  3MYT A;  1JKG B;  5D82 A;  5CXO A;  1YJ9 3;  3HZP A;  3SOA A;  2RGQ A;  3NV0 B;  4K1U A;  3EF8 A;  3T8N A;  2GBX B;  4J9A A;  3RGR A;  2GBW B;  1M1K 4;  3BNB A;  4FMD A;  3B7C A;  4OK0 A;  1JKG A;  2CFD A;  2GXF A;  3MWZ A;  1VQ7 3;  2RCD A;  4R1K A;  2K54 A;  2CC3 A;  1EG9 B;  2Y74 A;  3QK9 A;  3SVA A;  5IG0 A;  1DMQ A;  1GS3 A;  4RNZ A;  4MMX B;  3CPO A;  2Z76 A;  2V1L A;  3NV0 A;  3DY5 A;  1W7C A;  2Z77 A;  2Z6B A;  5KP3 A;  3U1W A;  1OUN A;  1FGT A;  5IG3 A;  4OUQ A;  3PZW A;  1VQ4 3;  3OX9 A;  3WOE B;  1TU5 A;  1YIT 3;  3GZR A;  3MG1 A;  3KKG A;  4H61 A;  3X3Y A;  4IPB A;  2GU3 A;  5ELJ A;  3FSD A;  2QIY A;  2WGO A;  3J7Y d;  1JNQ A;  1N9J A;  2QA4 3;  1AV4 A;  1VZZ A;  3S27 A;  3OWS A;  1YJN 3;  3D3L A;  3DGO A;  1K28 A;  1NWW A;  4EYC A;  5IER A;  1K41 A;  2B24 B;  3MKI A;  3MG3 A;  3PS8 A;  3BB9 A;  2HMO B;  3FF0 A;  3OWU A;  2IA7 A;  2CH9 A;  1RKY A;  2BMR B;  3GWR A;  2KCD A;  4MMY B;  3WA2 X;  5IEN A;  1PU4 A;  2O3O A;  2CWU A;  2INX A;  3CNX A;  2OQE A;  2PZV A;  1IV7 A;  1N9E A;  3BNC A;  1SQW A;  4LSO A;  4KFD A;  5D81 A;  1F8N A;  3CNM A;  3CCU 3;  4HM1 B;  2OOV C;  1RRL A;  1QVF 2;  2STD A;  4WHA A;  3X3X A;  1GYB A;  3M8C A;  2FXT A;  3T8U A;  3PXM A;  3UL6 A;  1VQN 3;  1ULI B;  3K9M C;  2SBL A;  4N6O B;  1SII A;  4O3V A;  1W4N A;  4BTW A;  4O8S A;  1ZO2 A;  1ULJ B;  1NO3 A;  5AII A;  3G4S 3;  3FG4 A;  3EC9 A;  5KP4 A;  1E3R A;  1RRH A;  4L8O A;  1M90 4;  2LYX A;  3UB1 A;  3JUN A;  1Q81 4;  1BUQ A;  2XEP A;  2W2C A;  1FA3 A;  4LMI A;  1KQS 2;  1D6U A;  4K90 B;  3CC4 3;  3EQQ B;  3K7C A;  2HML B;  1MNL A;  2IUK A;  3X3Z A;  4MEI A;  1Q42 A;  1OGZ A;  3NX0 A;  4HM2 B;  3SED A;  5DRE A;  5AYR B;  2FGT A;  2CIU A;  5FW5 A;  3S5C A;  1QAF A;  4N3V A;  3DUK A;  1FGQ A;  3SOY A;  4EV5 A;  1TIJ A;  3EHC A;  2RSX A;  1NDO B;  3DGN A;  1J2B A;  3LH4 A;  4HM8 B;  3HII A;  4FCM A;  3HK4 A;  3FGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...