4HZ9B

Crystal structure of the type vi native effector-immunity complex tae3-tai3 from ralstonia pickettii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
QNSPEAAAISFYTWFIQHDSDQTYPLSEPDIERYVATDTVGRLRNDYAHAGPPNGVDYFLKVQDYDSRDWLAHIQVQRALMLGDVAVVPVSFGSQDPVHVLVFLKRVDATWKIIKIDDTWEYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative cytoplasmic protein
publication title Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3
pubmed doi rcsb
source organism Ralstonia pickettii
total genus 38
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12883 DUF3828 Protein of unknown function (DUF3828)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hz9B00
5AEUB 3DM8A 5EVHA 1JN5B 4I4KA 1ULJB 5CF2A 3A76A 1JB4A 3F7XA 2XSHB 3MHEA 1BUQA 2QIYA 4HM1B 4STDA 3SOAA 5FW5A 2R4IA 3UJMA 3EN1B 3F14A 3SEDA 3DZLA 1HKXA 1NU3A 2YFJB 3VGNA 1O7WB 3DXOA 3M8CA 3LZAA 3LYGA 7STDA 1OF5A 4R9KA 3KZTA 2GXFA 1OHSA 1W6YA 3MKIA 5IERA 1EA2A 4GB5A 2HMLB 4X2HA 3KE7A 3SOYA 5KP3A 3DUKA 1O7GB 4L8OA 5AIFA 1JKGB 2XRXB 3K7CA 3F8XA 4LGQA 3FLJA 3RGAA 5AI1A 5CK6A 3NM2A 4IIAA 4XBTA 3VSYA 4HZBB 2B24B 3RGRA 1E3VA 1OUNA 1NDOB 3F40A 3CNXA 3DMCA 2PZVA 4L7KA 4XDWA 5D82A 1Q40B 4CDLA 3NXJA 4XBXA 3H3HA 2K54A 3NBRA 2HMJB 4U13A 2GBXB 5IG0A 3BB9A 4RZMA 2GEYA 3EBTA 2STDA 2INXA 3MYTA 2Z77A 1JN5A 4HM4B 3HK4A 5CLKA 2RCDA 1GY7A 3KSPA 3F8HA 1QJGA 4OUQA 3G0KA 4HM2B 3T8UA 5KP4A 4XB5A 5IF6A 4HKVB 3CNMA 1GY5A 3OWSA 1UUWB 1W01A 5AIGA 3HX8A 1STDA 3BLZA 3NUVA 3OXAA 3EC9A 2I9WA 3GZXB 3MG1A 3GZYB 3UNLA 1Q42A 4H3UA 4HM7B 1AR0A 5BVBA 1ISKA 2F98A 3EF8A 1GY6A 1JKGA 3FH1A 4LMIA 4HM8B 4N3VA 4XDVA 3K0ZA 4HM0B 4HM6B 3G8ZA 3EHCA 4HM3B 2Z76A 1NWWA 1GS3A 5IG5A 1O7PB 5BXQA 1U5OA 2F86B 1Q40A 2CHCA 1E3RA 3E99A 3GZRA 3I0YA 2HMNB 6STDA 4PEJA 1TP6A 3B8LA 5IEOA 5IG4A 4K1UA 1O7MB 1OGZA 5IENA 4K1VA 2F99A 4R9LA 5G2GA 3OWUA 3G16A 1ASKA 2HMMB 3MG2A 3IPTA 2BMRB 4FCJA 2HMKB 2A15A 3EN8A 1W02A 3GRDA 3JUQA 3H51A 1WQLB 1O7HB 2BMOB 5JPPA 1E97A 4WYKB 4LEHA 3GZBA 1ULIB 2IMJA 2XSOB 1OHOA 5D81A 3EQQB 3FGYA 5KP1A 1K41A 1GYBA 5STDA 3CU3A 4HZ9B 3ROBA 4OVMA 5AIIA 1DMMA 3EBYA 4ORLA 4KVHA 5CXOA 5IG3A 3WMDA 1TUHA 2HMOB 2YFIB 1UUVB 1OHPA 5HGRA 5IEPA 3HZPA 2UX0A 8CHOA 3B4PA 2BMQB 3FF2A 1QMAA 2B1XB 3NV0B 1SJWA 2QGUA 1JB5A 3NHXA 3JUMA 5CF1A 3FSDA 1CQSA 1C7HA 2Z7AA 5AIHA 1W00A 3GWRA 5DRVA 1O7NB 4WWUC 3JUNA 3MSOA 3FZWA 3KKGA 3OWYA 5TGNA 3F9SA 3MG3A 3S5CA 5AEWB 1IDPA 2OWPA 3FKAA 3Q90A 2RGQA 3EX9A 2RFRA 3STDA 1A2KA 4R1KA 4WYKA 1OH0A 3EJVA 1DMQA 2BNGA 1ZX2A 4HJLB 3F7SA 1EG9B 2YFLB 5D83A 1OF5B 1JB2A 1OGXA 1S5AA 3D9RA 3JUOA 4XM4A 1OPYA 4FCMA 4HM5B 4XBYA 2GEXA 4X2OA 3JUPA 4J9AA 1ZO2A 3T8NA 1DMNA 2CKFB 1Z1SA 3B7CA 3OV4A 4Q53A 4WP5A 2GBWB 3B4OA 3ER7A 4J8TA 3NV0A 4HVNA 3ECFA 2JQ5A 2XR8B 3OX9A 5JPUA 1VZZA 3CPOA 2W2CA 5DREA 3FF0A 4L8PA 1OCVA 4MJDA
chains in the Genus database with same CATH superfamily
3MWZA 5AEUB 1X1YA 3DM8A 5EVHA 2W56A 1Q824 2ML5A 4N6V0 2GU3A 1JN5B 5BU4A 4I4KA 1ULJB 1RRHA 1K9M4 4FR9A 2WO0A 5CF2A 3CCV3 1FGQA 3A76A 1JB4A 1RN1A 4LSOA 3F7XA 2CWUA 5LC6A 1X1XA 1FA3A 4R80A 4ZM8A 1NO3A 3ZG0A 1TRQA 4HAAA 3IMAB 2XSHB 3L0RA 1BRJA 3MHEA 1BUQA 1D6ZA 4AKYA 1VQ93 1UI7A 2QIYA 1B2ZA 1G96A 1BU4A 4HM1B 3DGNA 4STDA 3SOAA 5M19A 1TU5A 2H0HA 5FW5A 2KF6A 1RCLA 1BNJA 2R4IA 1GMQA 3UJMA 1FUWA 1IV9A 1TIJA 3EN1B 3F14A 3NQYA 3SEDA 2XEPA 3DZLA 1QAFA 1DYUA 1HKXA 3CCM3 1LOWA 1NU3A 3PS8A 1WMOA 1YGWA 1IVWA 1JJ22 1FUSA 2YFJB 3VGNA 2PNCA 3U97A 1LOVA 1RNBA 1O7WB 1RHLA 2K0MA 3DXOA 3WA3A 1UCIA 3M8CA 3LZAA 2H0IA 3KCHA 2CFGA 3LYGA 3NBBA 7STDA 4CCVA 1OF5A 3NQZA 4R9KA 3KZTA 2KF5A 2GXFA 2CC3A 1CEWI 1IQ8A 1OHSA 2BU4A 3LMLA 1W6YA 4RBNA 3MKIA 1GOUA 1KWIA 1YVBI 5IERA 1AV4A 1EA2A 3ALAA 4GB5A 2HMLB 1VQ53 1NNVA 4EXRA 2CK3H 2R41A 1J2BA 1N8QA 4BTYA 1I70A 2CX0A 3ZG5A 3CME3 1RGCA 4X2HA 2WOFA 3KE7A 3D5IA 1W2B2 1RKYA 3SOYA 1L5GB 5AYRB 5KP3A 3DUKA 1O7GB 1RMSA 1BRSA 4L8OA 5AIFA 3QK9A 1JKGB 2XRXB 3K7CA 3F8XA 4LGQA 1JZOA 3FLJA 4FMAA 1MWTA 3RGAA 2IYJA 4O8SA 5AI1A 5CK6A 3NM2A 3CC73 3NBJA 4IIAA 1NB3I 1IVUA 1YI23 3SVAA 4XBTA 3VSYA 1U8CB 3SYUA 1STFI 4RNZA 4HZBB 3RDEA 4EV5A 2B24B 3PCSA 3J7Yd 3CC23 1I2GA 3RGRA 1M1XB 2L1SA 1E3VA 3FCSB 1OUNA 3X3YA 1NDOB 3UB1A 4KZ1A 4WFOA 3F40A 1D6YA 1YJW3 3CNXA 1RGKA 3HOHA 3DMCA 1RTUA 4NPBA 1K734 3BNDA 2PZVA 2CFDA 4L7KA 4XDWA 5D82A 2XF3A 1Q40B 4CDLA 1UCKA 3NXJA 4EYCA 4XBXA 1IV7A 4N6UA 1RNTA 3H3HA 3S27A 2K54A 2E2VA 3NBRA 6RNTA 1GOVA 3ZFZA 4MMZB 4JRFA 3UL5A 1YIT3 5FGOA 2IUKA 2CFWA 3NM7A 1MNLA 2HMJB 4U13A 2ZA4A 2GBXB 1FGRA 1A67A 5IG0A 1SIIA 3BB9A 3KSED 2GEYA 4RZMA 3EBTA 2STDA 2INXA 3MYTA 2Z77A 3LTDA 1JN5A 1RGLA 4HM4B 3HK4A 5AYSC 4BTWA 2XGNA 1X1WA 2ZL8A 4MMXB 5CLKA 2CG1A 1PU4A 3X41A 1BOXA 2IY2A 1GY7A 2RCDA 3AGNA 3KSPA 2ZHXB 1RN4A 3F8HA 3LOYA 1IK3A 1C54A 1T5YA 1VQ43 1QJGA 3PZWA 5IW9A 1GD4A 1N9EA 1R4YA 1G02A 1D6UA 4OUQA 2GSPA 1PYLA 3G0KA 4HM2B 4FMCA 2UUGC 1W6CA 4JF8A 4XB5A 3QRDA 2F56A 3T8UA 5IF6A 3DGLA 5KP4A 3K5TA 3HIIA 3CCL3 4KFDA 4HBRA 3OW22 4HKVB 3O8YA 1FW7A 3CNMA 1B2MA 1GY5A 1RLSA 3OWSA 1G0TA 2CX1A 1B3SA 1RGEA 1UUWB 2ML6A 1W01A 1IVXA 5AIGA 3JVCA 3HX8A 1I3FA 2M7OA 3N54B 3K9MC 3G4S3 1GMPA 3FG1A 1UUGB 4N6TA 1STDA 3BLZA 3NUVA 3OXAA 1Q7Y4 2BO9B 2WOHA 1I0VA 2FGTA 3EC9A 4G1MB 3I563 3D4AA 2I9WA 3GZXB 1M904 3MG1A 2D1WA 3GZYB 3UNLA 2LQVA 2KRTA 1N5PA 3AHWA 1JRQA 1US1A 5GSPA 1QAKA 1Q42A 9RNTA 1IT8A 1BRIA 4J5KA 1TTOA 1DVCA 1I2EA 4H3UA 2CG0A 3NX0A 4HM7B 1AR0A 4ILFA 2HOHA 3GSPA 4BL2A 5BVBA 1ISKA 2F98A 2C10A 2XFSA 1B2XA 3LT8A 4QWTA 2OTJ3 3EF8A 2OOVC 1V74A 1GY6A 3PGBA 2P0MA 3X40A 1JKGA 5M18A 3FH1A 5ELJA 1KSIA 4LMIA 1AQZA 4NHFA 1Q814 4HM8B 1RGGA 1MWRA 1LNHA 1UCLA 1UGHI 3BIRA 3LTAA 4N3VA 2AADA 1BSBA 3LT9A 4XDVA 4LZIA 2BHMA 3PYJA 3K0ZA 2IUJA 4O2HA 1TRPA 3LXUX 4HM0B 4HM6B 2IA7A 1BRKA 3G8ZA 1T2IA 1GOYA 2CH9A 3BU4A 3DGMA 3EHCA 4N6OB 3DGYA 2C4BA 1IYYA 1ROVA 4HM3B 1VQL3 2Z76A 1NWWA 1CH0A 2RNTA 1M1K4 1A2VA 1LOXA 2RSXA 1GS3A 5IG5A 1JBRA 1IU7A 4OK0A 1O7PB 1BNRA 1B20A 1MWSA 1HU9A 1T3BA 1JZDA 2P38A 2XFTA 5BXQA 1K8A4 1U5OA 1DE3A 2F86B 1Q40A 5EQLA 1UW1A 2CW9A 3V98A 3V92A 2CHCA 1FUTA 1E3RA 3RNTA 4MMYB 3E99A 1LQGC 3GZRA 2P0XA 3I0YA 1KD14 2HMNB 6STDA 4PEJA 1TP6A 3B8LA 5IEOA 1RJOA 1ZS7A 3HI7A 3Q2PA 1YNVX 2BT3A 1BNSA 2QA43 5IG4A 1BSAA 4K1UA 1W7CA 1A90A 1EUIC 1O7MB 1OGZA 3PCRA 3SX1A 3A5EA 2KAAA 1BANA 1V57A 5IENA 1V58A 1AVLA 4K1VA 2Q07A 2D42A 2F99A 1BNGA 4R9LA 3DGOA 5G2GA 2OQEC 3WOEB 3OWUA 3G16A 1BSCA 1ASKA 1IQXA 2H0GA 2Y74A 2HMMB 3MG2A 3IPTA 2BMRB 4FCJA 3TDGA 2HMKB 2A15A 1BNEA 1QVF2 1VQO3 2KXGA 1BSEA 4MEIA 3EN8A 2OQEA 3BNEA 4J5GA 2P09A 2KF3A 1PY3A 1W02A 1UGIA 3GRDA 1AY7A 3JUQA 3H51A 1WQLB 1RGFA 3KN4A 4RNYA 1BVIA 5G1KA 1O7HB 3U1WA 3G6E3 3CPW2 1Q864 5HOHA 1SPUA 2C11A 2BMOB 5JPPA 1E97A 4DKIA 1KQS2 4WYKB 2GU1A 4BU4A 4K90B 3X42A 4LEHA 2W0QA 1BAOA 3GZBA 1ULIB 2IMJA 1AVKA 1BNIA 2XSOB 2SBLA 1OHOA 5D81A 3EQQB 3EB8A 3FGYA 1HYFA 2WGOA 5KP1A 1K41A 2UGIA 1GYBA 5STDA 3CU3A 4HZ9B 3ROBA 4OVMA 1N8R4 1LNIA 5AIIA 4GSPA 4BIRA 1DMMA 4FCZA 4KT3B 4GHOA 3EBYA 4ORLA 1GD3A 4KVHA 1BSDA 1BIRA 5CXOA 1FGMA 1UI8A 1VQP3 1NB5I 5IG3A 5LC7A 3WMDA 5JBSA 3G713 4IT7A 3AMOB 2E2UA 4RNTA 1UCJA 1M9GA 5G1LA 1RCKA 1TUHA 2MF7A 3D3LA 3LTBA 3S28A 1IQYA 3MPHA 4N6LA 3BNCA 2HMOB 2WGQA 4FMDA 2YFIB 4N6MA 1UUVB 4KFFA 2SARA 3S67A 1OHPA 1RRLA 2K3DA 3URPA 4HYZA 1VQ63 5HGRA 1RGHA 5IEPA 1W2ZA 2CFKA 1B2UA 3HZPA 2UX0A 1R4CA 8CHOA 1N5HA 3B4PA 3V99A 1LVNA 2Z6BA 2AAEA 3VF1A 1RN7A 1BRNL 2CWVA 2BMQB 1TJDA 2KF4A 1QMAA 2B1XB 1I3IA 1MWUA 3FF2A 3HIGA 3NV0B 4EBGA 4EV2A 1SJWA 2QGUA 4EW5A 1SARA 3X3ZA 1Q7HA 3X3XA 5BIRA 1JB5A 1WTHA 3NHXA 3CCJ3 3FG3A 4KFEA 1ZGXA 2FXTA 2O3OA 4R4KA 4AEQA 1RGAA 3JUMA 1FGTA 1YJN3 5CF1A 1W4NA 1K28A 2OOVA 3FSDA 1CQSA 1I0XA 1EKMA 3WR2A 3S29A 1EQKA 1WMNA 2L4VA 1JNQA 1JV2B 1TFKA 2QEX3 2W6JH 1C7HA 1JBSA 5I97A 1HZ1A 2W9PA 1LRAA 2Z7AA 5AIHA 1W00A 3GWRA 5DRVA 1O7NB 4WWUC 1IT7A 1FZUA 2W56B 1LXEA 2XH9A 3JUNA 4WHAA 1ROAA 1VQ83 1YIJ3 7RNTA 3MSOA 3AHSA 1BRHA 3FZWA 1X1UA 3KKGA 3OWYA 1VQN3 5TGNA 1SQWA 3F9SA 3WOFB 1DVDA 1MGRA 3MG3A 3S5CA 5AEWB 1YVSA 1IDPA 1GSPA 1CYUA 2OWPA 2LYXA 3CMA3 4NREA 1JBTA 3FKAA 3CD63 1CYVA 3Q90A 2RGQA 3Q3FA 1S723 3CCR3 3EX9A 5A0OB 1LQMB 2P05A 2J8XB 4CJNA 3DH2A 1MGWA 4LYLB 4O3VA 1W6GA 2FNQA 4O02B 1QVG2 3CXC2 2RFRA 3STDA 1B21A 1A2KA 3K63A 1EEJA 4GL6A 4BTXA 1I2FA 4R1KA 1YHQ3 4WYKA 1YJ93 5EEOA 1OH0A 3D79A 3EJVA 8RNTA 2OCTA 2CIUA 2W04A 3LH4A 1VQK3 1FYSA 2KCDA 1DMQA 2BNGA 1NJI4 1ZX2A 3SXXA 4HJLB 2W9QA 4K61A 4N6NB 3F7SA 1EG9B 3FG4A 2YFLB 5D83A 1LOYA 1B2SA 1JB2A 1OF5B 1OGXA 2F4YA 3GAXA 1S5AA 3WA2X 3CCU3 1UDII 3WDGB 1Y4KA 2Y73A 3DY5A 5RNTA 3N8BA 3D9RA 3JUOA 4XM4A 1T2HA 1OPYA 1VQ73 3I553 4FCMA 1VQQA 3LTCA 1A2PA 3WODG 4HM5B 4XBYA 4H61A 3EE1A 3CCS3 3AMOA 2GEXA 1GMRA 4X2OA 7GSPA 3JUPA 4J9AA 1I8VA 3BNBA 2JDIH 1ZO2A 2E2TA 3T8NA 1BNFA 1WNHA 1DETA 1N9JA 1OACA 4HOHA 2F5MA 1DMNA 1BGSA 1PFPA 2CKFB 1QALA 3AGOA 4BL3A 1Z1SA 4I5QA 2ZDJA 3B7CA 3UL6A 3WHOA 1Q9EA 3OV4A 3IJEB 4Q53A 4WP5A 2GBWB 1BUJA 3CC43 1YGEA 3B4OA 1SIHA 2W03A 3N9HA 3CCQ3 1MOLA 1W5ZA 4AKZA 3ER7A 4CPKA 3CCE3 4J8TA 1KC84 1FGOA 2F5WA 3NV0A 4HVNA 2YX9A 3ECFA 6GSPA 2JQ5A 1RSNA 1B27A 2XR8B 3KFQC 1VQM3 3OX9A 3D5GA 3T0UA 1BRGA 5JPUA 1VZZA 5ELUA 2MC8A 3CPOA 2CWTA 2V1LA 2W2CA 3KIIA 5DREA 3PXMA 3FF0A 3Q1CA 1TFOA 2O9UX 4FMBA 4EC6A 5M1AA 1WMPA 4IPBA 2CFLA 2BIRA 2XGLA 4TX4A 4L8PA 3SLUA 1IVVA 2RBIA 2OTL3 1RDSA 1OCVA 1F8NA 4MJDA
chains in the Genus database with same CATH topology
3MWZA 5AEUB 1Q824 3DM8A 5EVHA 2W56A 2ML5A 4N6V0 2GU3A 1JN5B 4I4KA 1ULJB 1RRHA 1K9M4 4FR9A 2WO0A 5CF2A 3CCV3 1FGQA 3A76A 1JB4A 4LSOA 3F7XA 2CWUA 5LC6A 1FA3A 4R80A 4ZM8A 1NO3A 3IMAB 2XSHB 3L0RA 3MHEA 1BUQA 1D6ZA 4AKYA 1VQ93 1UI7A 2QIYA 1G96A 4HM1B 3DGNA 4STDA 3SOAA 1TU5A 5FW5A 2R4IA 1FUWA 3UJMA 1IV9A 1TIJA 3EN1B 3F14A 3NQYA 3SEDA 2XEPA 3DZLA 1QAFA 1DYUA 1HKXA 3CCM3 1NU3A 3PS8A 1WMOA 1IVWA 1JJ22 2YFJB 3VGNA 2PNCA 3U97A 1O7WB 2K0MA 3DXOA 3WA3A 3M8CA 3LZAA 3NBBA 2CFGA 3LYGA 7STDA 4CCVA 1OF5A 3NQZA 4R9KA 3KZTA 2GXFA 2CC3A 1CEWI 1IQ8A 1OHSA 3LMLA 1W6YA 4RBNA 3MKIA 1KWIA 1YVBI 5IERA 1AV4A 1EA2A 3ALAA 4GB5A 2HMLB 1VQ53 4EXRA 2CK3H 1J2BA 1N8QA 4BTYA 3CME3 4X2HA 2WOFA 3KE7A 1W2B2 1RKYA 3SOYA 1L5GB 5AYRB 5KP3A 3DUKA 1O7GB 4L8OA 5AIFA 3QK9A 1JKGB 2XRXB 3K7CA 3F8XA 4LGQA 3FLJA 4FMAA 3RGAA 4O8SA 5AI1A 5CK6A 3NM2A 3CC73 3NBJA 4IIAA 1NB3I 1IVUA 1YI23 3SVAA 4XBTA 3VSYA 1U8CB 1STFI 4RNZA 4HZBB 3RDEA 4EV5A 2B24B 3PCSA 3J7Yd 3CC23 3RGRA 1M1XB 1E3VA 3FCSB 1OUNA 3X3YA 1NDOB 3UB1A 4KZ1A 4WFOA 3F40A 1D6YA 1YJW3 3CNXA 3DMCA 1K734 3BNDA 2PZVA 2CFDA 4L7KA 4XDWA 5D82A 2XF3A 1Q40B 4CDLA 4EYCA 3NXJA 4XBXA 1IV7A 4N6UA 3S27A 3H3HA 2K54A 2E2VA 3NBRA 1YIT3 4MMZB 4JRFA 3UL5A 5FGOA 2IUKA 2CFWA 3NM7A 1MNLA 2HMJB 4U13A 1A67A 2GBXB 1FGRA 5IG0A 1SIIA 3BB9A 3KSED 2GEYA 4RZMA 3EBTA 2STDA 2INXA 3MYTA 2Z77A 3LTDA 1JN5A 4HM4B 3HK4A 5AYSC 4BTWA 2XGNA 2ZL8A 4MMXB 5CLKA 2CG1A 1PU4A 3X41A 2RCDA 1GY7A 3KSPA 3LOYA 1IK3A 3F8HA 1T5YA 1VQ43 1QJGA 3PZWA 5IW9A 1GD4A 1N9EA 1D6UA 4OUQA 3G0KA 4HM2B 4FMCA 4JF8A 1W6CA 3T8UA 4XB5A 3QRDA 5KP4A 5IF6A 3DGLA 3K5TA 3HIIA 3CCL3 4KFDA 4HBRA 3OW22 4HKVB 3O8YA 3CNMA 1GY5A 3OWSA 1UUWB 2ML6A 1W01A 1IVXA 5AIGA 3JVCA 3HX8A 2M7OA 3N54B 3K9MC 3G4S3 3FG1A 4N6TA 1STDA 3BLZA 3NUVA 3OXAA 1Q7Y4 2WOHA 2BO9B 4G1MB 2FGTA 3EC9A 3I563 2I9WA 3GZXB 1M904 3MG1A 2D1WA 3GZYB 3UNLA 2LQVA 2KRTA 1N5PA 1JRQA 1US1A 1QAKA 1Q42A 1IT8A 1DVCA 4H3UA 2CG0A 3NX0A 4HM7B 1AR0A 5BVBA 1ISKA 2F98A 2C10A 2XFSA 4QWTA 3LT8A 2OTJ3 3EF8A 2OOVC 1V74A 1GY6A 3PGBA 2P0MA 3X40A 1JKGA 3FH1A 5ELJA 1KSIA 4LMIA 4NHFA 1Q814 4HM8B 4N3VA 1LNHA 3LTAA 3LT9A 4XDVA 4LZIA 2BHMA 3PYJA 3K0ZA 2IUJA 4O2HA 3LXUX 4HM0B 4HM6B 2IA7A 3G8ZA 2CH9A 3DGMA 3EHCA 4N6OB 1ROVA 4HM3B 1VQL3 2Z76A 1NWWA 1M1K4 1A2VA 1LOXA 2RSXA 1GS3A 5IG5A 1IU7A 4OK0A 1O7PB 2P38A 1HU9A 5BXQA 2XFTA 1K8A4 1U5OA 2F86B 1Q40A 5EQLA 1UW1A 2CW9A 3V98A 3V92A 2CHCA 1E3RA 4MMYB 3E99A 3GZRA 2P0XA 3I0YA 1KD14 2HMNB 6STDA 4PEJA 1TP6A 3B8LA 5IEOA 1RJOA 3Q2PA 3HI7A 2BT3A 2QA43 5IG4A 4K1UA 1W7CA 1A90A 1O7MB 1OGZA 3PCRA 3SX1A 5IENA 1AVLA 4K1VA 2Q07A 2D42A 2F99A 4R9LA 3DGOA 5G2GA 2OQEC 3WOEB 3OWUA 3G16A 1ASKA 1IQXA 2Y74A 2HMMB 3MG2A 3IPTA 2BMRB 4FCJA 3TDGA 2HMKB 2A15A 1QVF2 1VQO3 2KXGA 4MEIA 2OQEA 3EN8A 3BNEA 2P09A 1W02A 3GRDA 3JUQA 3H51A 1WQLB 3KN4A 4RNYA 3G6E3 1O7HB 3U1WA 3CPW2 1Q864 1SPUA 2C11A 2BMOB 5JPPA 1E97A 1KQS2 4WYKB 2GU1A 4K90B 3X42A 4LEHA 2W0QA 3GZBA 1ULIB 2IMJA 1AVKA 2XSOB 2SBLA 1OHOA 5D81A 3EQQB 3EB8A 3FGYA 2WGOA 5KP1A 1K41A 1GYBA 5STDA 3CU3A 4HZ9B 3ROBA 4OVMA 1N8R4 5AIIA 1DMMA 4FCZA 3EBYA 4ORLA 1GD3A 4KVHA 5CXOA 1VQP3 1FGMA 1UI8A 1NB5I 5IG3A 5LC7A 3WMDA 5JBSA 3G713 4IT7A 3AMOB 2E2UA 1M9GA 1TUHA 2MF7A 3D3LA 3LTBA 3S28A 1IQYA 3MPHA 4N6LA 3BNCA 2HMOB 2WGQA 4FMDA 2YFIB 4N6MA 1UUVB 4KFFA 3S67A 1OHPA 1RRLA 4HYZA 1VQ63 5HGRA 5IEPA 1W2ZA 2CFKA 3HZPA 2UX0A 1R4CA 8CHOA 1N5HA 3B4PA 3V99A 1LVNA 2Z6BA 3VF1A 1RN7A 2CWVA 2BMQB 3FF2A 1QMAA 2B1XB 3NV0B 4EBGA 3HIGA 4EV2A 1SJWA 2QGUA 3X3ZA 3X3XA 1JB5A 1WTHA 3NHXA 3CCJ3 3FG3A 4KFEA 2FXTA 2O3OA 4R4KA 4AEQA 3JUMA 1FGTA 1YJN3 5CF1A 1W4NA 1K28A 2OOVA 3FSDA 1CQSA 1EKMA 3S29A 1EQKA 1WMNA 2L4VA 1JNQA 1JV2B 1TFKA 2QEX3 2W6JH 1C7HA 5I97A 2W9PA 2Z7AA 5AIHA 1W00A 3GWRA 5DRVA 1O7NB 4WWUC 1IT7A 2W56B 1LXEA 2XH9A 3JUNA 4WHAA 1ROAA 1VQ83 1YIJ3 3MSOA 3FZWA 3KKGA 3OWYA 1VQN3 5TGNA 1SQWA 3F9SA 3WOFB 1DVDA 3MG3A 3S5CA 5AEWB 1IDPA 1CYUA 2OWPA 2LYXA 3CMA3 4NREA 3FKAA 3CD63 1CYVA 3Q90A 2RGQA 1S723 3CCR3 3EX9A 5A0OB 2P05A 4O3VA 1W6GA 2FNQA 4O02B 1QVG2 3CXC2 2RFRA 3STDA 1A2KA 3K63A 4BTXA 4GL6A 4R1KA 1YHQ3 4WYKA 1YJ93 5EEOA 1OH0A 3EJVA 2OCTA 2CIUA 2W04A 3LH4A 1VQK3 2KCDA 1NJI4 1DMQA 2BNGA 1ZX2A 3SXXA 4HJLB 2W9QA 4K61A 4N6NB 3F7SA 1EG9B 3FG4A 2YFLB 5D83A 1OF5B 3CCU3 1JB2A 1OGXA 3GAXA 3WA2X 1S5AA 3WDGB 1Y4KA 2Y73A 3DY5A 3N8BA 3D9RA 3JUOA 4XM4A 1OPYA 1VQ73 3I553 4FCMA 3LTCA 3WODG 4HM5B 4XBYA 4H61A 3EE1A 3CCS3 3AMOA 2GEXA 4X2OA 3JUPA 4J9AA 3BNBA 2JDIH 1ZO2A 2E2TA 3T8NA 1WNHA 1N9JA 1OACA 1DMNA 1PFPA 2CKFB 1QALA 1Z1SA 2ZDJA 3B7CA 3UL6A 3OV4A 3IJEB 4Q53A 4WP5A 2GBWB 3CC43 1YGEA 3B4OA 1SIHA 2W03A 3N9HA 3CCQ3 1MOLA 1W5ZA 4AKZA 3ER7A 3CCE3 4J8TA 1KC84 1FGOA 3NV0A 4HVNA 2YX9A 3ECFA 2JQ5A 1VQM3 2XR8B 3KFQC 3OX9A 3T0UA 5JPUA 1VZZA 5ELUA 2MC8A 3CPOA 2CWTA 2V1LA 2W2CA 3KIIA 5DREA 3PXMA 3FF0A 3Q1CA 1TFOA 2O9UX 4FMBA 4EC6A 1WMPA 4IPBA 2CFLA 4TX4A 2XGLA 4L8PA 3SLUA 1IVVA 2OTL3 1OCVA 1F8NA 4MJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEU B;  3DM8 A;  5EVH A;  1JN5 B;  4I4K A;  1ULJ B;  5CF2 A;  3A76 A;  1JB4 A;  3F7X A;  2XSH B;  3MHE A;  1BUQ A;  2QIY A;  4HM1 B;  4STD A;  3SOA A;  5FW5 A;  2R4I A;  3UJM A;  3EN1 B;  3F14 A;  3SED A;  3DZL A;  1HKX A;  1NU3 A;  2YFJ B;  3VGN A;  1O7W B;  3DXO A;  3M8C A;  3LZA A;  3LYG A;  7STD A;  1OF5 A;  4R9K A;  3KZT A;  2GXF A;  1OHS A;  1W6Y A;  3MKI A;  5IER A;  1EA2 A;  4GB5 A;  2HML B;  4X2H A;  3KE7 A;  3SOY A;  5KP3 A;  3DUK A;  1O7G B;  4L8O A;  5AIF A;  1JKG B;  2XRX B;  3K7C A;  3F8X A;  4LGQ A;  3FLJ A;  3RGA A;  5AI1 A;  5CK6 A;  3NM2 A;  4IIA A;  4XBT A;  3VSY A;  4HZB B;  2B24 B;  3RGR A;  1E3V A;  1OUN A;  1NDO B;  3F40 A;  3CNX A;  3DMC A;  2PZV A;  4L7K A;  4XDW A;  5D82 A;  1Q40 B;  4CDL A;  3NXJ A;  4XBX A;  3H3H A;  2K54 A;  3NBR A;  2HMJ B;  4U13 A;  2GBX B;  5IG0 A;  3BB9 A;  4RZM A;  2GEY A;  3EBT A;  2STD A;  2INX A;  3MYT A;  2Z77 A;  1JN5 A;  4HM4 B;  3HK4 A;  5CLK A;  2RCD A;  1GY7 A;  3KSP A;  3F8H A;  1QJG A;  4OUQ A;  3G0K A;  4HM2 B;  3T8U A;  5KP4 A;  4XB5 A;  5IF6 A;  4HKV B;  3CNM A;  1GY5 A;  3OWS A;  1UUW B;  1W01 A;  5AIG A;  3HX8 A;  1STD A;  3BLZ A;  3NUV A;  3OXA A;  3EC9 A;  2I9W A;  3GZX B;  3MG1 A;  3GZY B;  3UNL A;  1Q42 A;  4H3U A;  4HM7 B;  1AR0 A;  5BVB A;  1ISK A;  2F98 A;  3EF8 A;  1GY6 A;  1JKG A;  3FH1 A;  4LMI A;  4HM8 B;  4N3V A;  4XDV A;  3K0Z A;  4HM0 B;  4HM6 B;  3G8Z A;  3EHC A;  4HM3 B;  2Z76 A;  1NWW A;  1GS3 A;  5IG5 A;  1O7P B;  5BXQ A;  1U5O A;  2F86 B;  1Q40 A;  2CHC A;  1E3R A;  3E99 A;  3GZR A;  3I0Y A;  2HMN B;  6STD A;  4PEJ A;  1TP6 A;  3B8L A;  5IEO A;  5IG4 A;  4K1U A;  1O7M B;  1OGZ A;  5IEN A;  4K1V A;  2F99 A;  4R9L A;  5G2G A;  3OWU A;  3G16 A;  1ASK A;  2HMM B;  3MG2 A;  3IPT A;  2BMR B;  4FCJ A;  2HMK B;  2A15 A;  3EN8 A;  1W02 A;  3GRD A;  3JUQ A;  3H51 A;  1WQL B;  1O7H B;  2BMO B;  5JPP A;  1E97 A;  4WYK B;  4LEH A;  3GZB A;  1ULI B;  2IMJ A;  2XSO B;  1OHO A;  5D81 A;  3EQQ B;  3FGY A;  5KP1 A;  1K41 A;  1GYB A;  5STD A;  3CU3 A;  4HZ9 B;  3ROB A;  4OVM A;  5AII A;  1DMM A;  3EBY A;  4ORL A;  4KVH A;  5CXO A;  5IG3 A;  3WMD A;  1TUH A;  2HMO B;  2YFI B;  1UUV B;  1OHP A;  5HGR A;  5IEP A;  3HZP A;  2UX0 A;  8CHO A;  3B4P A;  2BMQ B;  3FF2 A;  1QMA A;  2B1X B;  3NV0 B;  1SJW A;  2QGU A;  1JB5 A;  3NHX A;  3JUM A;  5CF1 A;  3FSD A;  1CQS A;  1C7H A;  2Z7A A;  5AIH A;  1W00 A;  3GWR A;  5DRV A;  1O7N B;  4WWU C;  3JUN A;  3MSO A;  3FZW A;  3KKG A;  3OWY A;  5TGN A;  3F9S A;  3MG3 A;  3S5C A;  5AEW B;  1IDP A;  2OWP A;  3FKA A;  3Q90 A;  2RGQ A;  3EX9 A;  2RFR A;  3STD A;  1A2K A;  4R1K A;  4WYK A;  1OH0 A;  3EJV A;  1DMQ A;  2BNG A;  1ZX2 A;  4HJL B;  3F7S A;  1EG9 B;  2YFL B;  5D83 A;  1OF5 B;  1JB2 A;  1OGX A;  1S5A A;  3D9R A;  3JUO A;  4XM4 A;  1OPY A;  4FCM A;  4HM5 B;  4XBY A;  2GEX A;  4X2O A;  3JUP A;  4J9A A;  1ZO2 A;  3T8N A;  1DMN A;  2CKF B;  1Z1S A;  3B7C A;  3OV4 A;  4Q53 A;  4WP5 A;  2GBW B;  3B4O A;  3ER7 A;  4J8T A;  3NV0 A;  4HVN A;  3ECF A;  2JQ5 A;  2XR8 B;  3OX9 A;  5JPU A;  1VZZ A;  3CPO A;  2W2C A;  5DRE A;  3FF0 A;  4L8P A;  1OCV A;  4MJD A; 
#chains in the Genus database with same CATH topology
 3MWZ A;  5AEU B;  1X1Y A;  3DM8 A;  5EVH A;  2W56 A;  1Q82 4;  2ML5 A;  4N6V 0;  2GU3 A;  1JN5 B;  5BU4 A;  4I4K A;  1ULJ B;  1RRH A;  1K9M 4;  4FR9 A;  2WO0 A;  5CF2 A;  3CCV 3;  1FGQ A;  3A76 A;  1JB4 A;  1RN1 A;  4LSO A;  3F7X A;  2CWU A;  5LC6 A;  1X1X A;  1FA3 A;  4R80 A;  4ZM8 A;  1NO3 A;  3ZG0 A;  1TRQ A;  4HAA A;  3IMA B;  2XSH B;  3L0R A;  1BRJ A;  3MHE A;  1BUQ A;  1D6Z A;  4AKY A;  1VQ9 3;  1UI7 A;  2QIY A;  1B2Z A;  1G96 A;  1BU4 A;  4HM1 B;  3DGN A;  4STD A;  3SOA A;  5M19 A;  1TU5 A;  2H0H A;  5FW5 A;  2KF6 A;  1RCL A;  1BNJ A;  2R4I A;  1GMQ A;  3UJM A;  1FUW A;  1IV9 A;  1TIJ A;  3EN1 B;  3F14 A;  3NQY A;  3SED A;  2XEP A;  3DZL A;  1QAF A;  1DYU A;  1HKX A;  3CCM 3;  1LOW A;  1NU3 A;  3PS8 A;  1WMO A;  1YGW A;  1IVW A;  1JJ2 2;  1FUS A;  2YFJ B;  3VGN A;  2PNC A;  3U97 A;  1LOV A;  1RNB A;  1O7W B;  1RHL A;  2K0M A;  3DXO A;  3WA3 A;  1UCI A;  3M8C A;  3LZA A;  2H0I A;  3KCH A;  2CFG A;  3LYG A;  3NBB A;  7STD A;  4CCV A;  1OF5 A;  3NQZ A;  4R9K A;  3KZT A;  2KF5 A;  2GXF A;  2CC3 A;  1CEW I;  1IQ8 A;  1OHS A;  2BU4 A;  3LML A;  1W6Y A;  4RBN A;  3MKI A;  1GOU A;  1KWI A;  1YVB I;  5IER A;  1AV4 A;  1EA2 A;  3ALA A;  4GB5 A;  2HML B;  1VQ5 3;  1NNV A;  4EXR A;  2CK3 H;  2R41 A;  1J2B A;  1N8Q A;  4BTY A;  1I70 A;  2CX0 A;  3ZG5 A;  3CME 3;  1RGC A;  4X2H A;  2WOF A;  3KE7 A;  3D5I A;  1W2B 2;  1RKY A;  3SOY A;  1L5G B;  5AYR B;  5KP3 A;  3DUK A;  1O7G B;  1RMS A;  1BRS A;  4L8O A;  5AIF A;  3QK9 A;  1JKG B;  2XRX B;  3K7C A;  3F8X A;  4LGQ A;  1JZO A;  3FLJ A;  4FMA A;  1MWT A;  3RGA A;  2IYJ A;  4O8S A;  5AI1 A;  5CK6 A;  3NM2 A;  3CC7 3;  3NBJ A;  4IIA A;  1NB3 I;  1IVU A;  1YI2 3;  3SVA A;  4XBT A;  3VSY A;  1U8C B;  3SYU A;  1STF I;  4RNZ A;  4HZB B;  3RDE A;  4EV5 A;  2B24 B;  3PCS A;  3J7Y d;  3CC2 3;  1I2G A;  3RGR A;  1M1X B;  2L1S A;  1E3V A;  3FCS B;  1OUN A;  3X3Y A;  1NDO B;  3UB1 A;  4KZ1 A;  4WFO A;  3F40 A;  1D6Y A;  1YJW 3;  3CNX A;  1RGK A;  3HOH A;  3DMC A;  1RTU A;  4NPB A;  1K73 4;  3BND A;  2PZV A;  2CFD A;  4L7K A;  4XDW A;  5D82 A;  2XF3 A;  1Q40 B;  4CDL A;  1UCK A;  3NXJ A;  4EYC A;  4XBX A;  1IV7 A;  4N6U A;  1RNT A;  3H3H A;  3S27 A;  2K54 A;  2E2V A;  3NBR A;  6RNT A;  1GOV A;  3ZFZ A;  4MMZ B;  4JRF A;  3UL5 A;  1YIT 3;  5FGO A;  2IUK A;  2CFW A;  3NM7 A;  1MNL A;  2HMJ B;  4U13 A;  2ZA4 A;  2GBX B;  1FGR A;  1A67 A;  5IG0 A;  1SII A;  3BB9 A;  3KSE D;  2GEY A;  4RZM A;  3EBT A;  2STD A;  2INX A;  3MYT A;  2Z77 A;  3LTD A;  1JN5 A;  1RGL A;  4HM4 B;  3HK4 A;  5AYS C;  4BTW A;  2XGN A;  1X1W A;  2ZL8 A;  4MMX B;  5CLK A;  2CG1 A;  1PU4 A;  3X41 A;  1BOX A;  2IY2 A;  1GY7 A;  2RCD A;  3AGN A;  3KSP A;  2ZHX B;  1RN4 A;  3F8H A;  3LOY A;  1IK3 A;  1C54 A;  1T5Y A;  1VQ4 3;  1QJG A;  3PZW A;  5IW9 A;  1GD4 A;  1N9E A;  1R4Y A;  1G02 A;  1D6U A;  4OUQ A;  2GSP A;  1PYL A;  3G0K A;  4HM2 B;  4FMC A;  2UUG C;  1W6C A;  4JF8 A;  4XB5 A;  3QRD A;  2F56 A;  3T8U A;  5IF6 A;  3DGL A;  5KP4 A;  3K5T A;  3HII A;  3CCL 3;  4KFD A;  4HBR A;  3OW2 2;  4HKV B;  3O8Y A;  1FW7 A;  3CNM A;  1B2M A;  1GY5 A;  1RLS A;  3OWS A;  1G0T A;  2CX1 A;  1B3S A;  1RGE A;  1UUW B;  2ML6 A;  1W01 A;  1IVX A;  5AIG A;  3JVC A;  3HX8 A;  1I3F A;  2M7O A;  3N54 B;  3K9M C;  3G4S 3;  1GMP A;  3FG1 A;  1UUG B;  4N6T A;  1STD A;  3BLZ A;  3NUV A;  3OXA A;  1Q7Y 4;  2BO9 B;  2WOH A;  1I0V A;  2FGT A;  3EC9 A;  4G1M B;  3I56 3;  3D4A A;  2I9W A;  3GZX B;  1M90 4;  3MG1 A;  2D1W A;  3GZY B;  3UNL A;  2LQV A;  2KRT A;  1N5P A;  3AHW A;  1JRQ A;  1US1 A;  5GSP A;  1QAK A;  1Q42 A;  9RNT A;  1IT8 A;  1BRI A;  4J5K A;  1TTO A;  1DVC A;  1I2E A;  4H3U A;  2CG0 A;  3NX0 A;  4HM7 B;  1AR0 A;  4ILF A;  2HOH A;  3GSP A;  4BL2 A;  5BVB A;  1ISK A;  2F98 A;  2C10 A;  2XFS A;  1B2X A;  3LT8 A;  4QWT A;  2OTJ 3;  3EF8 A;  2OOV C;  1V74 A;  1GY6 A;  3PGB A;  2P0M A;  3X40 A;  1JKG A;  5M18 A;  3FH1 A;  5ELJ A;  1KSI A;  4LMI A;  1AQZ A;  4NHF A;  1Q81 4;  4HM8 B;  1RGG A;  1MWR A;  1LNH A;  1UCL A;  1UGH I;  3BIR A;  3LTA A;  4N3V A;  2AAD A;  1BSB A;  3LT9 A;  4XDV A;  4LZI A;  2BHM A;  3PYJ A;  3K0Z A;  2IUJ A;  4O2H A;  1TRP A;  3LXU X;  4HM0 B;  4HM6 B;  2IA7 A;  1BRK A;  3G8Z A;  1T2I A;  1GOY A;  2CH9 A;  3BU4 A;  3DGM A;  3EHC A;  4N6O B;  3DGY A;  2C4B A;  1IYY A;  1ROV A;  4HM3 B;  1VQL 3;  2Z76 A;  1NWW A;  1CH0 A;  2RNT A;  1M1K 4;  1A2V A;  1LOX A;  2RSX A;  1GS3 A;  5IG5 A;  1JBR A;  1IU7 A;  4OK0 A;  1O7P B;  1BNR A;  1B20 A;  1MWS A;  1HU9 A;  1T3B A;  1JZD A;  2P38 A;  2XFT A;  5BXQ A;  1K8A 4;  1U5O A;  1DE3 A;  2F86 B;  1Q40 A;  5EQL A;  1UW1 A;  2CW9 A;  3V98 A;  3V92 A;  2CHC A;  1FUT A;  1E3R A;  3RNT A;  4MMY B;  3E99 A;  1LQG C;  3GZR A;  2P0X A;  3I0Y A;  1KD1 4;  2HMN B;  6STD A;  4PEJ A;  1TP6 A;  3B8L A;  5IEO A;  1RJO A;  1ZS7 A;  3HI7 A;  3Q2P A;  1YNV X;  2BT3 A;  1BNS A;  2QA4 3;  5IG4 A;  1BSA A;  4K1U A;  1W7C A;  1A90 A;  1EUI C;  1O7M B;  1OGZ A;  3PCR A;  3SX1 A;  3A5E A;  2KAA A;  1BAN A;  1V57 A;  5IEN A;  1V58 A;  1AVL A;  4K1V A;  2Q07 A;  2D42 A;  2F99 A;  1BNG A;  4R9L A;  3DGO A;  5G2G A;  2OQE C;  3WOE B;  3OWU A;  3G16 A;  1BSC A;  1ASK A;  1IQX A;  2H0G A;  2Y74 A;  2HMM B;  3MG2 A;  3IPT A;  2BMR B;  4FCJ A;  3TDG A;  2HMK B;  2A15 A;  1BNE A;  1QVF 2;  1VQO 3;  2KXG A;  1BSE A;  4MEI A;  3EN8 A;  2OQE A;  3BNE A;  4J5G A;  2P09 A;  2KF3 A;  1PY3 A;  1W02 A;  1UGI A;  3GRD A;  1AY7 A;  3JUQ A;  3H51 A;  1WQL B;  1RGF A;  3KN4 A;  4RNY A;  1BVI A;  5G1K A;  1O7H B;  3U1W A;  3G6E 3;  3CPW 2;  1Q86 4;  5HOH A;  1SPU A;  2C11 A;  2BMO B;  5JPP A;  1E97 A;  4DKI A;  1KQS 2;  4WYK B;  2GU1 A;  4BU4 A;  4K90 B;  3X42 A;  4LEH A;  2W0Q A;  1BAO A;  3GZB A;  1ULI B;  2IMJ A;  1AVK A;  1BNI A;  2XSO B;  2SBL A;  1OHO A;  5D81 A;  3EQQ B;  3EB8 A;  3FGY A;  1HYF A;  2WGO A;  5KP1 A;  1K41 A;  2UGI A;  1GYB A;  5STD A;  3CU3 A;  4HZ9 B;  3ROB A;  4OVM A;  1N8R 4;  1LNI A;  5AII A;  4GSP A;  4BIR A;  1DMM A;  4FCZ A;  4KT3 B;  4GHO A;  3EBY A;  4ORL A;  1GD3 A;  4KVH A;  1BSD A;  1BIR A;  5CXO A;  1FGM A;  1UI8 A;  1VQP 3;  1NB5 I;  5IG3 A;  5LC7 A;  3WMD A;  5JBS A;  3G71 3;  4IT7 A;  3AMO B;  2E2U A;  4RNT A;  1UCJ A;  1M9G A;  5G1L A;  1RCK A;  1TUH A;  2MF7 A;  3D3L A;  3LTB A;  3S28 A;  1IQY A;  3MPH A;  4N6L A;  3BNC A;  2HMO B;  2WGQ A;  4FMD A;  2YFI B;  4N6M A;  1UUV B;  4KFF A;  2SAR A;  3S67 A;  1OHP A;  1RRL A;  2K3D A;  3URP A;  4HYZ A;  1VQ6 3;  5HGR A;  1RGH A;  5IEP A;  1W2Z A;  2CFK A;  1B2U A;  3HZP A;  2UX0 A;  1R4C A;  8CHO A;  1N5H A;  3B4P A;  3V99 A;  1LVN A;  2Z6B A;  2AAE A;  3VF1 A;  1RN7 A;  1BRN L;  2CWV A;  2BMQ B;  1TJD A;  2KF4 A;  1QMA A;  2B1X B;  1I3I A;  1MWU A;  3FF2 A;  3HIG A;  3NV0 B;  4EBG A;  4EV2 A;  1SJW A;  2QGU A;  4EW5 A;  1SAR A;  3X3Z A;  1Q7H A;  3X3X A;  5BIR A;  1JB5 A;  1WTH A;  3NHX A;  3CCJ 3;  3FG3 A;  4KFE A;  1ZGX A;  2FXT A;  2O3O A;  4R4K A;  4AEQ A;  1RGA A;  3JUM A;  1FGT A;  1YJN 3;  5CF1 A;  1W4N A;  1K28 A;  2OOV A;  3FSD A;  1CQS A;  1I0X A;  1EKM A;  3WR2 A;  3S29 A;  1EQK A;  1WMN A;  2L4V A;  1JNQ A;  1JV2 B;  1TFK A;  2QEX 3;  2W6J H;  1C7H A;  1JBS A;  5I97 A;  1HZ1 A;  2W9P A;  1LRA A;  2Z7A A;  5AIH A;  1W00 A;  3GWR A;  5DRV A;  1O7N B;  4WWU C;  1IT7 A;  1FZU A;  2W56 B;  1LXE A;  2XH9 A;  3JUN A;  4WHA A;  1ROA A;  1VQ8 3;  1YIJ 3;  7RNT A;  3MSO A;  3AHS A;  1BRH A;  3FZW A;  1X1U A;  3KKG A;  3OWY A;  1VQN 3;  5TGN A;  1SQW A;  3F9S A;  3WOF B;  1DVD A;  1MGR A;  3MG3 A;  3S5C A;  5AEW B;  1YVS A;  1IDP A;  1GSP A;  1CYU A;  2OWP A;  2LYX A;  3CMA 3;  4NRE A;  1JBT A;  3FKA A;  3CD6 3;  1CYV A;  3Q90 A;  2RGQ A;  3Q3F A;  1S72 3;  3CCR 3;  3EX9 A;  5A0O B;  1LQM B;  2P05 A;  2J8X B;  4CJN A;  3DH2 A;  1MGW A;  4LYL B;  4O3V A;  1W6G A;  2FNQ A;  4O02 B;  1QVG 2;  3CXC 2;  2RFR A;  3STD A;  1B21 A;  1A2K A;  3K63 A;  1EEJ A;  4GL6 A;  4BTX A;  1I2F A;  4R1K A;  1YHQ 3;  4WYK A;  1YJ9 3;  5EEO A;  1OH0 A;  3D79 A;  3EJV A;  8RNT A;  2OCT A;  2CIU A;  2W04 A;  3LH4 A;  1VQK 3;  1FYS A;  2KCD A;  1DMQ A;  2BNG A;  1NJI 4;  1ZX2 A;  3SXX A;  4HJL B;  2W9Q A;  4K61 A;  4N6N B;  3F7S A;  1EG9 B;  3FG4 A;  2YFL B;  5D83 A;  1LOY A;  1B2S A;  1JB2 A;  1OF5 B;  1OGX A;  2F4Y A;  3GAX A;  1S5A A;  3WA2 X;  3CCU 3;  1UDI I;  3WDG B;  1Y4K A;  2Y73 A;  3DY5 A;  5RNT A;  3N8B A;  3D9R A;  3JUO A;  4XM4 A;  1T2H A;  1OPY A;  1VQ7 3;  3I55 3;  4FCM A;  1VQQ A;  3LTC A;  1A2P A;  3WOD G;  4HM5 B;  4XBY A;  4H61 A;  3EE1 A;  3CCS 3;  3AMO A;  2GEX A;  1GMR A;  4X2O A;  7GSP A;  3JUP A;  4J9A A;  1I8V A;  3BNB A;  2JDI H;  1ZO2 A;  2E2T A;  3T8N A;  1BNF A;  1WNH A;  1DET A;  1N9J A;  1OAC A;  4HOH A;  2F5M A;  1DMN A;  1BGS A;  1PFP A;  2CKF B;  1QAL A;  3AGO A;  4BL3 A;  1Z1S A;  4I5Q A;  2ZDJ A;  3B7C A;  3UL6 A;  3WHO A;  1Q9E A;  3OV4 A;  3IJE B;  4Q53 A;  4WP5 A;  2GBW B;  1BUJ A;  3CC4 3;  1YGE A;  3B4O A;  1SIH A;  2W03 A;  3N9H A;  3CCQ 3;  1MOL A;  1W5Z A;  4AKZ A;  3ER7 A;  4CPK A;  3CCE 3;  4J8T A;  1KC8 4;  1FGO A;  2F5W A;  3NV0 A;  4HVN A;  2YX9 A;  3ECF A;  6GSP A;  2JQ5 A;  1RSN A;  1B27 A;  2XR8 B;  3KFQ C;  1VQM 3;  3OX9 A;  3D5G A;  3T0U A;  1BRG A;  5JPU A;  1VZZ A;  5ELU A;  2MC8 A;  3CPO A;  2CWT A;  2V1L A;  2W2C A;  3KII A;  5DRE A;  3PXM A;  3FF0 A;  3Q1C A;  1TFO A;  2O9U X;  4FMB A;  4EC6 A;  5M1A A;  1WMP A;  4IPB A;  2CFL A;  2BIR A;  2XGL A;  4TX4 A;  4L8P A;  3SLU A;  1IVV A;  2RBI A;  2OTL 3;  1RDS A;  1OCV A;  1F8N A;  4MJD A; 
#chains in the Genus database with same CATH homology
 3MWZ A;  5AEU B;  1Q82 4;  3DM8 A;  5EVH A;  2W56 A;  2ML5 A;  4N6V 0;  2GU3 A;  1JN5 B;  4I4K A;  1ULJ B;  1RRH A;  1K9M 4;  4FR9 A;  2WO0 A;  5CF2 A;  3CCV 3;  1FGQ A;  3A76 A;  1JB4 A;  4LSO A;  3F7X A;  2CWU A;  5LC6 A;  1FA3 A;  4R80 A;  4ZM8 A;  1NO3 A;  3IMA B;  2XSH B;  3L0R A;  3MHE A;  1BUQ A;  1D6Z A;  4AKY A;  1VQ9 3;  1UI7 A;  2QIY A;  1G96 A;  4HM1 B;  3DGN A;  4STD A;  3SOA A;  1TU5 A;  5FW5 A;  2R4I A;  1FUW A;  3UJM A;  1IV9 A;  1TIJ A;  3EN1 B;  3F14 A;  3NQY A;  3SED A;  2XEP A;  3DZL A;  1QAF A;  1DYU A;  1HKX A;  3CCM 3;  1NU3 A;  3PS8 A;  1WMO A;  1IVW A;  1JJ2 2;  2YFJ B;  3VGN A;  2PNC A;  3U97 A;  1O7W B;  2K0M A;  3DXO A;  3WA3 A;  3M8C A;  3LZA A;  3NBB A;  2CFG A;  3LYG A;  7STD A;  4CCV A;  1OF5 A;  3NQZ A;  4R9K A;  3KZT A;  2GXF A;  2CC3 A;  1CEW I;  1IQ8 A;  1OHS A;  3LML A;  1W6Y A;  4RBN A;  3MKI A;  1KWI A;  1YVB I;  5IER A;  1AV4 A;  1EA2 A;  3ALA A;  4GB5 A;  2HML B;  1VQ5 3;  4EXR A;  2CK3 H;  1J2B A;  1N8Q A;  4BTY A;  3CME 3;  4X2H A;  2WOF A;  3KE7 A;  1W2B 2;  1RKY A;  3SOY A;  1L5G B;  5AYR B;  5KP3 A;  3DUK A;  1O7G B;  4L8O A;  5AIF A;  3QK9 A;  1JKG B;  2XRX B;  3K7C A;  3F8X A;  4LGQ A;  3FLJ A;  4FMA A;  3RGA A;  4O8S A;  5AI1 A;  5CK6 A;  3NM2 A;  3CC7 3;  3NBJ A;  4IIA A;  1NB3 I;  1IVU A;  1YI2 3;  3SVA A;  4XBT A;  3VSY A;  1U8C B;  1STF I;  4RNZ A;  4HZB B;  3RDE A;  4EV5 A;  2B24 B;  3PCS A;  3J7Y d;  3CC2 3;  3RGR A;  1M1X B;  1E3V A;  3FCS B;  1OUN A;  3X3Y A;  1NDO B;  3UB1 A;  4KZ1 A;  4WFO A;  3F40 A;  1D6Y A;  1YJW 3;  3CNX A;  3DMC A;  1K73 4;  3BND A;  2PZV A;  2CFD A;  4L7K A;  4XDW A;  5D82 A;  2XF3 A;  1Q40 B;  4CDL A;  4EYC A;  3NXJ A;  4XBX A;  1IV7 A;  4N6U A;  3S27 A;  3H3H A;  2K54 A;  2E2V A;  3NBR A;  1YIT 3;  4MMZ B;  4JRF A;  3UL5 A;  5FGO A;  2IUK A;  2CFW A;  3NM7 A;  1MNL A;  2HMJ B;  4U13 A;  1A67 A;  2GBX B;  1FGR A;  5IG0 A;  1SII A;  3BB9 A;  3KSE D;  2GEY A;  4RZM A;  3EBT A;  2STD A;  2INX A;  3MYT A;  2Z77 A;  3LTD A;  1JN5 A;  4HM4 B;  3HK4 A;  5AYS C;  4BTW A;  2XGN A;  2ZL8 A;  4MMX B;  5CLK A;  2CG1 A;  1PU4 A;  3X41 A;  2RCD A;  1GY7 A;  3KSP A;  3LOY A;  1IK3 A;  3F8H A;  1T5Y A;  1VQ4 3;  1QJG A;  3PZW A;  5IW9 A;  1GD4 A;  1N9E A;  1D6U A;  4OUQ A;  3G0K A;  4HM2 B;  4FMC A;  4JF8 A;  1W6C A;  3T8U A;  4XB5 A;  3QRD A;  5KP4 A;  5IF6 A;  3DGL A;  3K5T A;  3HII A;  3CCL 3;  4KFD A;  4HBR A;  3OW2 2;  4HKV B;  3O8Y A;  3CNM A;  1GY5 A;  3OWS A;  1UUW B;  2ML6 A;  1W01 A;  1IVX A;  5AIG A;  3JVC A;  3HX8 A;  2M7O A;  3N54 B;  3K9M C;  3G4S 3;  3FG1 A;  4N6T A;  1STD A;  3BLZ A;  3NUV A;  3OXA A;  1Q7Y 4;  2WOH A;  2BO9 B;  4G1M B;  2FGT A;  3EC9 A;  3I56 3;  2I9W A;  3GZX B;  1M90 4;  3MG1 A;  2D1W A;  3GZY B;  3UNL A;  2LQV A;  2KRT A;  1N5P A;  1JRQ A;  1US1 A;  1QAK A;  1Q42 A;  1IT8 A;  1DVC A;  4H3U A;  2CG0 A;  3NX0 A;  4HM7 B;  1AR0 A;  5BVB A;  1ISK A;  2F98 A;  2C10 A;  2XFS A;  4QWT A;  3LT8 A;  2OTJ 3;  3EF8 A;  2OOV C;  1V74 A;  1GY6 A;  3PGB A;  2P0M A;  3X40 A;  1JKG A;  3FH1 A;  5ELJ A;  1KSI A;  4LMI A;  4NHF A;  1Q81 4;  4HM8 B;  4N3V A;  1LNH A;  3LTA A;  3LT9 A;  4XDV A;  4LZI A;  2BHM A;  3PYJ A;  3K0Z A;  2IUJ A;  4O2H A;  3LXU X;  4HM0 B;  4HM6 B;  2IA7 A;  3G8Z A;  2CH9 A;  3DGM A;  3EHC A;  4N6O B;  1ROV A;  4HM3 B;  1VQL 3;  2Z76 A;  1NWW A;  1M1K 4;  1A2V A;  1LOX A;  2RSX A;  1GS3 A;  5IG5 A;  1IU7 A;  4OK0 A;  1O7P B;  2P38 A;  1HU9 A;  5BXQ A;  2XFT A;  1K8A 4;  1U5O A;  2F86 B;  1Q40 A;  5EQL A;  1UW1 A;  2CW9 A;  3V98 A;  3V92 A;  2CHC A;  1E3R A;  4MMY B;  3E99 A;  3GZR A;  2P0X A;  3I0Y A;  1KD1 4;  2HMN B;  6STD A;  4PEJ A;  1TP6 A;  3B8L A;  5IEO A;  1RJO A;  3Q2P A;  3HI7 A;  2BT3 A;  2QA4 3;  5IG4 A;  4K1U A;  1W7C A;  1A90 A;  1O7M B;  1OGZ A;  3PCR A;  3SX1 A;  5IEN A;  1AVL A;  4K1V A;  2Q07 A;  2D42 A;  2F99 A;  4R9L A;  3DGO A;  5G2G A;  2OQE C;  3WOE B;  3OWU A;  3G16 A;  1ASK A;  1IQX A;  2Y74 A;  2HMM B;  3MG2 A;  3IPT A;  2BMR B;  4FCJ A;  3TDG A;  2HMK B;  2A15 A;  1QVF 2;  1VQO 3;  2KXG A;  4MEI A;  2OQE A;  3EN8 A;  3BNE A;  2P09 A;  1W02 A;  3GRD A;  3JUQ A;  3H51 A;  1WQL B;  3KN4 A;  4RNY A;  3G6E 3;  1O7H B;  3U1W A;  3CPW 2;  1Q86 4;  1SPU A;  2C11 A;  2BMO B;  5JPP A;  1E97 A;  1KQS 2;  4WYK B;  2GU1 A;  4K90 B;  3X42 A;  4LEH A;  2W0Q A;  3GZB A;  1ULI B;  2IMJ A;  1AVK A;  2XSO B;  2SBL A;  1OHO A;  5D81 A;  3EQQ B;  3EB8 A;  3FGY A;  2WGO A;  5KP1 A;  1K41 A;  1GYB A;  5STD A;  3CU3 A;  4HZ9 B;  3ROB A;  4OVM A;  1N8R 4;  5AII A;  1DMM A;  4FCZ A;  3EBY A;  4ORL A;  1GD3 A;  4KVH A;  5CXO A;  1VQP 3;  1FGM A;  1UI8 A;  1NB5 I;  5IG3 A;  5LC7 A;  3WMD A;  5JBS A;  3G71 3;  4IT7 A;  3AMO B;  2E2U A;  1M9G A;  1TUH A;  2MF7 A;  3D3L A;  3LTB A;  3S28 A;  1IQY A;  3MPH A;  4N6L A;  3BNC A;  2HMO B;  2WGQ A;  4FMD A;  2YFI B;  4N6M A;  1UUV B;  4KFF A;  3S67 A;  1OHP A;  1RRL A;  4HYZ A;  1VQ6 3;  5HGR A;  5IEP A;  1W2Z A;  2CFK A;  3HZP A;  2UX0 A;  1R4C A;  8CHO A;  1N5H A;  3B4P A;  3V99 A;  1LVN A;  2Z6B A;  3VF1 A;  1RN7 A;  2CWV A;  2BMQ B;  3FF2 A;  1QMA A;  2B1X B;  3NV0 B;  4EBG A;  3HIG A;  4EV2 A;  1SJW A;  2QGU A;  3X3Z A;  3X3X A;  1JB5 A;  1WTH A;  3NHX A;  3CCJ 3;  3FG3 A;  4KFE A;  2FXT A;  2O3O A;  4R4K A;  4AEQ A;  3JUM A;  1FGT A;  1YJN 3;  5CF1 A;  1W4N A;  1K28 A;  2OOV A;  3FSD A;  1CQS A;  1EKM A;  3S29 A;  1EQK A;  1WMN A;  2L4V A;  1JNQ A;  1JV2 B;  1TFK A;  2QEX 3;  2W6J H;  1C7H A;  5I97 A;  2W9P A;  2Z7A A;  5AIH A;  1W00 A;  3GWR A;  5DRV A;  1O7N B;  4WWU C;  1IT7 A;  2W56 B;  1LXE A;  2XH9 A;  3JUN A;  4WHA A;  1ROA A;  1VQ8 3;  1YIJ 3;  3MSO A;  3FZW A;  3KKG A;  3OWY A;  1VQN 3;  5TGN A;  1SQW A;  3F9S A;  3WOF B;  1DVD A;  3MG3 A;  3S5C A;  5AEW B;  1IDP A;  1CYU A;  2OWP A;  2LYX A;  3CMA 3;  4NRE A;  3FKA A;  3CD6 3;  1CYV A;  3Q90 A;  2RGQ A;  1S72 3;  3CCR 3;  3EX9 A;  5A0O B;  2P05 A;  4O3V A;  1W6G A;  2FNQ A;  4O02 B;  1QVG 2;  3CXC 2;  2RFR A;  3STD A;  1A2K A;  3K63 A;  4BTX A;  4GL6 A;  4R1K A;  1YHQ 3;  4WYK A;  1YJ9 3;  5EEO A;  1OH0 A;  3EJV A;  2OCT A;  2CIU A;  2W04 A;  3LH4 A;  1VQK 3;  2KCD A;  1NJI 4;  1DMQ A;  2BNG A;  1ZX2 A;  3SXX A;  4HJL B;  2W9Q A;  4K61 A;  4N6N B;  3F7S A;  1EG9 B;  3FG4 A;  2YFL B;  5D83 A;  1OF5 B;  3CCU 3;  1JB2 A;  1OGX A;  3GAX A;  3WA2 X;  1S5A A;  3WDG B;  1Y4K A;  2Y73 A;  3DY5 A;  3N8B A;  3D9R A;  3JUO A;  4XM4 A;  1OPY A;  1VQ7 3;  3I55 3;  4FCM A;  3LTC A;  3WOD G;  4HM5 B;  4XBY A;  4H61 A;  3EE1 A;  3CCS 3;  3AMO A;  2GEX A;  4X2O A;  3JUP A;  4J9A A;  3BNB A;  2JDI H;  1ZO2 A;  2E2T A;  3T8N A;  1WNH A;  1N9J A;  1OAC A;  1DMN A;  1PFP A;  2CKF B;  1QAL A;  1Z1S A;  2ZDJ A;  3B7C A;  3UL6 A;  3OV4 A;  3IJE B;  4Q53 A;  4WP5 A;  2GBW B;  3CC4 3;  1YGE A;  3B4O A;  1SIH A;  2W03 A;  3N9H A;  3CCQ 3;  1MOL A;  1W5Z A;  4AKZ A;  3ER7 A;  3CCE 3;  4J8T A;  1KC8 4;  1FGO A;  3NV0 A;  4HVN A;  2YX9 A;  3ECF A;  2JQ5 A;  1VQM 3;  2XR8 B;  3KFQ C;  3OX9 A;  3T0U A;  5JPU A;  1VZZ A;  5ELU A;  2MC8 A;  3CPO A;  2CWT A;  2V1L A;  2W2C A;  3KII A;  5DRE A;  3PXM A;  3FF0 A;  3Q1C A;  1TFO A;  2O9U X;  4FMB A;  4EC6 A;  1WMP A;  4IPB A;  2CFL A;  4TX4 A;  2XGL A;  4L8P A;  3SLU A;  1IVV A;  2OTL 3;  1OCV A;  1F8N A;  4MJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...