4HZ9B

Crystal structure of the type vi native effector-immunity complex tae3-tai3 from ralstonia pickettii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
QNSPEAAAISFYTWFIQHDSDQTYPLSEPDIERYVATDTVGRLRNDYAHAGPPNGVDYFLKVQDYDSRDWLAHIQVQRALMLGDVAVVPVSFGSQDPVHVLVFLKRVDATWKIIKIDDTWEYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Hydrolase
molecule keywords Putative cytoplasmic protein
total genus 38
structure length 123
sequence length 123
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12883 DUF3828 Protein of unknown function (DUF3828)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hz9B00
3NV0A 3MSOA 4X2HA 4X2OA 3EBTA 1JB4A 3DMCA 1O7MB 5G2GA 3KZTA 3ER7A 4XBYA 1W02A 2BNGA 2I9WA 1NU3A 3KKGA 3FZWA 1JN5A 1GYBA 1HKXA 3NM2A 1O7NB 1OGXA 2Z76A 3K0ZA 1OCVA 1W6YA 4HM6B 4STDA 5CXOA 5HGRA 3E99A 3EN8A 1ZX2A 3ECFA 3FF0A 3CPOA 3Q90A 3B8LA 3NHXA 1A2KA 4I4KA 4OUQA 5D81A 2GXFA 1Q40B 1UUVB 3FKAA 3UJMA 3DXOA 3JUOA 4PEJA 2XR8B 1NWWA 7STDA 1Z1SA 5KP3A 4LEHA 6STDA 4J8TA 2RFRA 2HMLB 4CDLA 1STDA 1OF5A 5AIGA 2GEYA 1WQLB 1ZO2A 3CNXA 3K7CA 4HZ9B 3H3HA 3S5CA 3GRDA 3GZRA 4HM7B 1O7HB 2F99A 3SEDA 2STDA 4L8PA 3OWYA 1ULIB 3MG3A 4K1VA 1IDPA 5D83A 2RGQA 1EG9B 5AIIA 4IIAA 2GBWB 4HJLB 2BMQB 4J9AA 5JPPA 2UX0A 4WYKB 1Q42A 4HZBB 1JN5B 3NV0B 3BB9A 2XSOB 4WWUC 1OF5B 1QJGA 4R9LA 3FF2A 1OHSA 4XBXA 2XSHB 5CF2A 3F40A 4L8OA 3OWSA 1GY5A 1TP6A 4H3UA 1OH0A 2BMOB 3F7XA 3G16A 2B24B 3KE7A 4L7KA 3VSYA 2K54A 5AEUB 3GZYB 1SJWA 1ISKA 1U5OA 1NDOB 3EBYA 3EHCA 5BXQA 3BLZA 4WP5A 3HX8A 2CHCA 1ULJB 2F98A 2F86B 3G8ZA 3T8UA 4HVNA 5IENA 3I0YA 4FCJA 1VZZA 5D82A 3ROBA 3FSDA 4XB5A 2HMOB 3NXJA 3EC9A 3M8CA 3STDA 2YFLB 1AR0A 1OHOA 1E3VA 3F9SA 4FCMA 4HM5B 3JUNA 3MKIA 4U13A 5AIFA 3D9RA 2HMKB 1C7HA 2PZVA 3B7CA 3IPTA 1GY7A 4HKVB 5IEOA 1W00A 3SOAA 1OHPA 2IMJA 2W2CA 2QIYA 3EJVA 8CHOA 3A76A 5CLKA 4WYKA 5DRVA 1K41A 3GWRA 3VGNA 3GZBA 5IEPA 3UNLA 1BUQA 1ASKA 1S5AA 4HM1B 3F8XA 5EVHA 5IG0A 2GEXA 3OXAA 5JPUA 4LGQA 2QGUA 3F14A 3LYGA 2BMRB 4ORLA 2R4IA 3FLJA 2HMNB 3MHEA 5BVBA 3RGRA 3RGAA 3F7SA 1OUNA 1DMMA 3KSPA 1E97A 2YFIB 4R9KA 1JKGA 5DREA 3HK4A 5FW5A 3FH1A 4N3VA 1JB2A 4OVMA 1W01A 1OPYA 4HM2B 3EQQB 5STDA 2JQ5A 4GB5A 1DMNA 1EA2A 3SOYA 2YFJB 3FGYA 5TGNA 3JUQA 1GY6A 2RCDA 3WMDA 1GS3A 3B4PA 4RZMA 1Q40A 3T8NA 5IF6A 4HM0B 4XBTA 4K1UA 2GBXB 3OX9A 1OGZA 3MG2A 4KVHA 4HM3B 5IG3A 5IERA 1O7GB 2XRXB 3OWUA 1CQSA 3EF8A 3LZAA 3NBRA 1DMQA 4LMIA 5AEWB 3MG1A 1E3RA 3EN1B 3G0KA 3GZXB 3HZPA 1JKGB 2B1XB 2Z77A 3JUPA 3DZLA 2CKFB 2A15A 2INXA 3B4OA 3JUMA 4HM4B 4MJDA 5AI1A 5CF1A 5IG4A 3F8HA 4R1KA 1TUHA 2OWPA 5AIHA 3CU3A 3H51A 1UUWB 3EX9A 1O7PB 3MYTA 5IG5A 4HM8B 3DM8A 4XM4A 2HMJB 3DUKA 3OV4A 4XDVA 5CK6A 2Z7AA 2HMMB 1O7WB 3CNMA 1QMAA 3NUVA 4Q53A 5KP4A 1JB5A 4XDWA 5KP1A
chains in the Genus database with same CATH superfamily
1Q7HA 1RGFA 1IK3A 3FCSB 1NJI4 3DMCA 1G0TA 4XBYA 5G2GA 2BNGA 2I9WA 3NM2A 3FZWA 3K63A 3WOEB 1FGRA 5CXOA 1RN7A 2F4YA 4BL3A 4TX4A 1IYYA 1A2PA 1EEJA 3Q90A 4I4KA 1PU4A 1UUVB 1PY3A 1D6YA 2GSPA 1I2EA 4PEJA 7STDA 4KFDA 1I70A 1T2HA 1Z1SA 5KP3A 6STDA 3DY5A 1UW1A 3S28A 2FXTA 3PZWA 5AIGA 5AYRB 2WOFA 3LTCA 2PNCA 2UGIA 3S5CA 1ZGXA 3CPW2 2Z6BA 3SEDA 4AEQA 2E2VA 1RJOA 2RGQA 5BU4A 1A2VA 4J9AA 2LQVA 4LSOA 1WNHA 3NX0A 1JN5B 3NV0B 2SBLA 4H61A 4NPBA 2XSOB 1C54A 1Q824 1UCJA 1QJGA 1T2IA 2HOHA 2W03A 4R9LA 4FMAA 2CWTA 2XSHB 1UGHI 4L8OA 3HIIA 3Q2PA 4QWTA 3OWSA 4I5QA 1FUSA 1TU5A 3CCS3 4H3UA 1OH0A 2OQEA 2W04A 3GZYB 1I2GA 1M9GA 3SVAA 1WMNA 2IY2A 1RGAA 1N5PA 1UUGB 4AKYA 5D82A 2IA7A 1BSCA 2MC8A 3ROBA 1LOVA 2HMOB 2Q07A 2P05A 4KZ1A 4HM5B 1AR0A 1UI7A 1KSIA 1V58A 4U13A 1VQ43 1IVUA 2FGTA 3D9RA 8RNTA 4MMZB 3SOAA 1GMQA 1GY7A 1YVSA 5IEOA 1QAKA 3OW22 2IMJA 1HU9A 3K5TA 2QIYA 4MMXB 3ZFZA 4RBNA 3A5EA 1GMRA 1B3SA 3A76A 3UNLA 3L0RA 4HM1B 5G1KA 5IG0A 2F56A 4GHOA 4N6OB 2M7OA 3ZG0A 4FR9A 2R4IA 3FLJA 3LTDA 3PS8A 3MHEA 2AAEA 4K61A 1CEWI 4BTWA 1OUNA 1DMMA 3CCR3 1WMOA 1YIJ3 3FH1A 2L4VA 1JB2A 4N3VA 1OPYA 3GAXA 2YX9A 5STDA 2CX0A 2JQ5A 3HOHA 5RNTA 1DMNA 1EKMA 1R4YA 5TGNA 1GOVA 3WMDA 2RCDA 2GU3A 3B4PA 1RKYA 3AHSA 1VQN3 1N9JA 1N8QA 3CME3 4XBTA 5M19A 1Q814 1JBSA 1MGRA 2GBXB 4KVHA 2BO9B 1BRIA 3OWUA 1BSBA 3LZAA 2KRTA 3BIRA 2O3OA 1JNQA 2F5WA 3KCHA 1UI8A 1BNIA 2LYXA 3NXJA 1BVIA 3CMA3 1N5HA 2A15A 4MJDA 3BNBA 1FGMA 5CF1A 3NM7A 1VQK3 1ROAA 3H51A 1RNTA 1VQ73 4HM8B 2W9PA 4XM4A 2HMJB 3S67A 3DUKA 3SXXA 1FUTA 1SQWA 2UUGC 4FMDA 2OCTA 1Q864 1LNHA 4CPKA 3AHWA 1BNRA 1ZS7A 3MSOA 4X2HA 1RTUA 1JB4A 3EBTA 3JVCA 2W6JH 1Q9EA 2ML5A 1DVCA 3K9MC 1NU3A 3KKGA 2V1LA 1SIHA 1O7NB 1OCVA 1W6YA 5HGRA 2ZDJA 3WR2A 3ECFA 4AKZA 1JBTA 3X3YA 1BNEA 3B8LA 1A2KA 1GOYA 5D81A 3D4AA 1DE3A 2GXFA 3FKAA 1LRAA 4BTYA 1YGWA 1RN4A 5LC6A 2WOHA 2RNTA 3N8BA 4CDLA 2ZL8A 1OF5A 1W4NA 3EB8A 3NQYA 1VQL3 1GSPA 1NB3I 2MF7A 2OQEC 3CNXA 3H3HA 4HZ9B 1JRQA 2WGQA 2XF3A 1O7HB 4OK0A 2IUJA 3OWYA 1MWUA 1ULIB 3MG3A 2CK3H 4K1VA 4EV5A 3CCE3 4HYZA 1BIRA 2BMQB 5JPPA 3I563 1VQ63 4EW5A 1FGQA 1G02A 3LTBA 1QVF2 4NHFA 1OF5B 1F8NA 1X1YA 3FF2A 2CIUA 5BIRA 1I3IA 3F40A 1YVBI 2XEPA 1B2XA 4N6UA 3KE7A 3F7XA 3VSYA 4L7KA 1MWSA 3J7Yd 1MWTA 1JBRA 3EBYA 3U97A 3BLZA 5ELUA 1AVLA 3AMOA 3HX8A 2F98A 3DGOA 1X1XA 1TRPA 2K3DA 1VZZA 4FCJA 3UB1A 2BHMA 4XB5A 2Y74A 1S723 4FCMA 4KFFA 1X1WA 3JUNA 6RNTA 3TDGA 5AIFA 3S29A 3X3XA 2HMKB 1C7HA 3B7CA 1RNBA 1I0VA 1W00A 2KF6A 1OHPA 1YGEA 2P0MA 1V74A 5CLKA 3UL5A 4WYKA 5DRVA 3DGLA 3VGNA 3WA3A 2C4BA 1BANA 2CFWA 5EVHA 2GEXA 1A90A 3KN4A 1JZOA 3CCU3 1BUJA 7RNTA 1YI23 1EUIC 1OACA 1UCIA 5G1LA 3RGAA 3F7SA 1RCLA 1EQKA 2JDIH 5GSPA 4KFEA 2H0HA 1N9EA 1LOWA 4J5KA 1W01A 2BT3A 5IW9A 5JBSA 1K9M4 5M1AA 2YFJB 3FGYA 2P09A 4DKIA 5ELJA 1GY6A 1WMPA 3Q3FA 5M18A 3MWZA 4HBRA 3CCQ3 3OX9A 1LVNA 3WA2X 1YNVX 5A0OB 2D42A 3NBRA 3SYUA 5AEWB 2OTL3 2OOVC 1BRKA 1QALA 1IQXA 3JUPA 1FW7A 3DZLA 1BRJA 2INXA 3JUMA 3PGBA 4HM4B 4N6NB 1M1XB 1RN1A 1IQYA 5AI1A 2OOVA 5IG4A 2OWPA 3ALAA 3S27A 3MYTA 1SARA 4BL2A 1G96A 1O7PB 5HOHA 2OTJ3 4KT3B 4FCZA 2SARA 1VQ93 3CNMA 4Q53A 4WFOA 3MPHA 2GU1A 2CFKA 2AADA 2C11A 3ER7A 1JN5A 3NV0A 1PFPA 4EBGA 4EYCA 1OGXA 4STDA 1LQMB 3EN8A 1KD14 1ZX2A 3IJEB 2RBIA 1DYUA 3PYJA 4OUQA 1Q40B 3D79A 3JUOA 1FUWA 2XR8B 1NWWA 1B20A 4RNZA 1IVXA 4LEHA 4O8SA 2HMLB 3X41A 1YIT3 1BAOA 1STDA 2CW9A 1WQLB 2CC3A 2KF4A 1TJDA 2P38A 4HOHA 3GZRA 3FG3A 3D3LA 1BRGA 4CCVA 1EG9B 4ILFA 1N8R4 4IIAA 2GBWB 4HJLB 3LT8A 2UX0A 2CX1A 3DGNA 1BGSA 3PCSA 2KF5A 1Y4KA 2BIRA 1CYVA 3BB9A 4WHAA 1D6UA 3V92A 2ML6A 3KFQC 3LT9A 1IV7A 1HYFA 1ROVA 4FMBA 3G4S3 3N54B 1VQ53 2CH9A 3FG4A 1B2UA 3X3ZA 1GY5A 2CFGA 1TP6A 3WDGB 3G16A 1STFI 2W56A 1FA3A 1GMPA 1JV2B 1SJWA 1DETA 2CHCA 1IVVA 1ULJB 2KAAA 2F86B 3T8UA 5IG5A 4HVNA 1YHQ3 1D6ZA 1I3FA 3PCRA 4FMCA 3M8CA 1KWIA 2YFLB 1RRLA 1IQ8A 1UCKA 4R4KA 3MKIA 3N9HA 3WODG 3Q1CA 1I8VA 1LOYA 1RGGA 3IPTA 3NBBA 4HKVB 2J8XB 2W2CA 3EJVA 3LXUX 5IEPA 1BRHA 2H0IA 2W56B 1K41A 2O9UX 1V57A 4G1MB 1W7CA 3VF1A 5JPUA 1NB5I 3F14A 3LYGA 1FYSA 4BIRA 1J2BA 3QK9A 3BNCA 2HMNB 4GSPA 4EXRA 2BU4A 3KSPA 1E97A 1RGLA 2YFIB 3X40A 5DREA 1FGOA 3EQQB 4O02B 1LNIA 4GB5A 1EA2A 3BNDA 3JUQA 3CD63 4HAAA 2CG1A 1A67A 4HM0B 1HZ1A 4GL6A 4LYLB 3QRDA 5IERA 6GSPA 1O7GB 3AGNA 3NQZA 1KC84 1BNSA 1DMQA 3MG1A 3CCM3 1IVWA 1CH0A 1E3RA 2R41A 3G0KA 1AY7A 3HZPA 2CFDA 1L5GB 3UL6A 3G6E3 2CKFB 1GOUA 3B4OA 3CC43 3URPA 1LXEA 3F8HA 2WGOA 4R1KA 4JRFA 4K90B 1AQZA 1YJN3 1TFOA 1M904 1UDII 2E2TA 3OV4A 5CK6A 2Z7AA 4MMYB 1BOXA 1O7WB 4EV2A 5KP4A 1QVG2 2XGLA 1JB5A 2XFTA 2CWVA 5KP1A 1CYUA 1VQQA 4X2OA 3V99A 1O7MB 3KZTA 1W02A 4L8PA 5I97A 1GYBA 1HKXA 1QAFA 2RSXA 2Z76A 1I2FA 3BNEA 3K0ZA 1NO3A 4HM6B 4EC6A 1M1K4 3E99A 3D5IA 1BSAA 3FF0A 3LH4A 1FGTA 1RGHA 2XH9A 3CPOA 3NHXA 3LOYA 2L1SA 3CCV3 2C10A 1TRQA 3UJMA 3DXOA 3LMLA 3AMOB 4IPBA 1BNFA 1TTOA 1GD4A 1Q7Y4 5AYSC 3KIIA 2RFRA 4J8TA 4N6V0 1W2B2 2KXGA 1RSNA 5LC7A 2GEYA 1ZO2A 3K7CA 2D1WA 2WO0A 3G713 4LZIA 4CJNA 3CC73 1GD3A 3GRDA 3GSPA 4HM7B 1PYLA 1BRNL 2F99A 2STDA 1NNVA 1IDPA 1TIJA 5D83A 3BU4A 1LQGC 2XGNA 1K8A4 3PXMA 5AIIA 1I0XA 2XFSA 2KCDA 3AGOA 4WYKB 1YJW3 1MOLA 1Q42A 4HZBB 4MEIA 3WOFB 1RCKA 4WWUC 3ZG5A 1R4CA 1WTHA 1B2MA 1KQS2 1FZUA 1RGEA 1OHSA 1IU7A 4XBXA 1BNJA 1RMSA 4RNYA 5CF2A 4JF8A 2W9QA 1SIIA 2BMOB 1IT8A 3EE1A 1W6CA 2B24B 4R80A 5AEUB 2K54A 1ISKA 1LOXA 1VQM3 1RGKA 1NDOB 1RLSA 1U5OA 2F5MA 3EHCA 5BXQA 1B2ZA 4WP5A 3G8ZA 4O3VA 5IENA 3CCL3 3I0YA 1BNGA 2P0XA 3HI7A 1SPUA 1UCLA 3FSDA 4O2HA 3RDEA 3EC9A 3RNTA 3STDA 1YJ93 1OHOA 1E3VA 1RRHA 3F9SA 5IF6A 3SX1A 2IUKA 3LTAA 1RGCA 1RDSA 2PZVA 4RNTA 3I553 1JJ22 3D5GA 4ZM8A 3DGMA 1JZDA 8CHOA 3GWRA 5FGOA 3WHOA 3GZBA 1BUQA 2FNQA 3DGYA 1ASKA 1S5AA 3F8XA 3OXAA 4LGQA 2QGUA 4ORLA 1T5YA 2BMRB 4BTXA 1IT7A 2E2UA 5BVBA 3RGRA 4IT7A 1B2SA 3FG1A 5FW5A 4R9KA 1JKGA 3X42A 3HK4A 2W0QA 5EQLA 2ZHXB 2IYJA 1BU4A 1W5ZA 4OVMA 1W2ZA 4HM2B 2CFLA 3NBJA 1MNLA 3SOYA 3CXC2 1BSEA 1GS3A 1K28A 1RHLA 1Q40A 2ZA4A 1W6GA 3KSED 4RZMA 5EEOA 3T8NA 4K1UA 4N6MA 3O8YA 1AV4A 1OGZA 3MG2A 4HM3B 4NREA 1IV9A 5IG3A 2XRXB 2QA43 1VQO3 1VQ83 1CQSA 3DH2A 3EF8A 1MGWA 1T3BA 4LMIA 3U1WA 1BRSA 1UGIA 3CCJ3 1B21A 2Y73A 3CC23 3EN1B 3GZXB 1K734 1JKGB 1MWRA 1X1UA 2B1XB 2K0MA 2Z77A 3SLUA 3V98A 1DVDA 1VQP3 2CWUA 2KF3A 1B27A 1TFKA 1TUHA 4N6LA 5AIHA 2QEX3 3CU3A 4N6TA 1UUWB 3EX9A 1U8CB 3IMAB 9RNTA 2H0GA 3DM8A 1BSDA 1AVKA 4J5GA 4XDVA 3T0UA 7GSPA 2HMMB 3HIGA 1QMAA 3NUVA 2CG0A 1US1A 4BU4A 4XDWA
chains in the Genus database with same CATH topology
1IK3A 1NJI4 3FCSB 3DMCA 5G2GA 4XBYA 2BNGA 2I9WA 3NM2A 3FZWA 3K63A 3WOEB 1FGRA 5CXOA 1RN7A 4TX4A 3Q90A 4I4KA 1PU4A 1UUVB 1D6YA 4PEJA 7STDA 4KFDA 1Z1SA 5KP3A 6STDA 3DY5A 1UW1A 3S28A 2FXTA 3PZWA 5AIGA 5AYRB 2WOFA 3LTCA 2PNCA 3S5CA 3CPW2 2Z6BA 3SEDA 4AEQA 2E2VA 1RJOA 2RGQA 1A2VA 4J9AA 2LQVA 4LSOA 1WNHA 3NX0A 1JN5B 3NV0B 2SBLA 4H61A 2XSOB 1Q824 2W03A 1QJGA 4R9LA 4FMAA 2CWTA 2XSHB 4L8OA 3HIIA 3Q2PA 4QWTA 3OWSA 1TU5A 3CCS3 4H3UA 1OH0A 2OQEA 2W04A 3GZYB 1M9GA 3SVAA 1WMNA 1N5PA 4AKYA 5D82A 2IA7A 2MC8A 3ROBA 2Q07A 2HMOB 2P05A 4KZ1A 4HM5B 1AR0A 1UI7A 1KSIA 4U13A 1VQ43 1IVUA 2FGTA 3D9RA 4MMZB 3SOAA 1GY7A 5IEOA 1QAKA 3OW22 2IMJA 1HU9A 3K5TA 2QIYA 4MMXB 4RBNA 3A76A 3UNLA 3L0RA 4HM1B 5IG0A 4N6OB 2M7OA 4FR9A 2R4IA 3FLJA 3LTDA 3PS8A 3MHEA 4K61A 1CEWI 4BTWA 1OUNA 1DMMA 3CCR3 1WMOA 1YIJ3 3FH1A 2L4VA 1JB2A 4N3VA 1OPYA 3GAXA 2YX9A 5STDA 2JQ5A 1DMNA 1EKMA 5TGNA 3WMDA 2RCDA 2GU3A 3B4PA 1RKYA 1VQN3 1N9JA 1N8QA 3CME3 4XBTA 1Q814 2GBXB 4KVHA 2BO9B 3OWUA 3LZAA 2KRTA 2O3OA 1JNQA 1UI8A 2LYXA 3NXJA 3CMA3 1N5HA 2A15A 4MJDA 3BNBA 1FGMA 5CF1A 3NM7A 1VQK3 1ROAA 3H51A 1VQ73 4HM8B 2W9PA 4XM4A 2HMJB 3S67A 3DUKA 3SXXA 1SQWA 4FMDA 2OCTA 1Q864 1LNHA 3MSOA 4X2HA 3EBTA 1JB4A 3JVCA 2W6JH 2ML5A 1DVCA 3K9MC 1NU3A 3KKGA 2V1LA 1SIHA 1O7NB 1OCVA 1W6YA 5HGRA 2ZDJA 4AKZA 3ECFA 3X3YA 3B8LA 1A2KA 5D81A 2GXFA 3FKAA 4BTYA 5LC6A 2WOHA 3N8BA 4CDLA 2ZL8A 1OF5A 1W4NA 3EB8A 3NQYA 1VQL3 1NB3I 2MF7A 2OQEC 3CNXA 3H3HA 4HZ9B 1JRQA 2WGQA 2XF3A 1O7HB 4OK0A 2IUJA 3OWYA 1ULIB 3MG3A 2CK3H 4K1VA 4EV5A 3CCE3 4HYZA 2BMQB 5JPPA 3I563 1VQ63 1FGQA 3LTBA 1QVF2 4NHFA 1OF5B 1F8NA 3FF2A 2CIUA 3F40A 1YVBI 2XEPA 4N6UA 3KE7A 3F7XA 3VSYA 4L7KA 3J7Yd 3EBYA 3U97A 3BLZA 5ELUA 1AVLA 3AMOA 3HX8A 2F98A 3DGOA 3UB1A 4FCJA 1VZZA 2BHMA 4XB5A 2Y74A 1S723 4FCMA 4KFFA 3JUNA 3TDGA 5AIFA 3S29A 3X3XA 2HMKB 1C7HA 3B7CA 1W00A 1OHPA 1YGEA 2P0MA 1V74A 5CLKA 3UL5A 4WYKA 5DRVA 3DGLA 3VGNA 3WA3A 2CFWA 5EVHA 2GEXA 1A90A 3KN4A 3CCU3 1YI23 1OACA 3RGAA 3F7SA 1EQKA 2JDIH 4KFEA 1N9EA 1W01A 2BT3A 5IW9A 5JBSA 1K9M4 2YFJB 3FGYA 2P09A 5ELJA 1GY6A 1WMPA 3MWZA 4HBRA 3CCQ3 3OX9A 1LVNA 3WA2X 5A0OB 2D42A 3NBRA 5AEWB 2OTL3 2OOVC 1QALA 1IQXA 3JUPA 3DZLA 4N6NB 2INXA 3JUMA 3PGBA 4HM4B 5AI1A 1M1XB 2OOVA 1IQYA 5IG4A 2OWPA 3ALAA 3S27A 3MYTA 1G96A 1O7PB 2OTJ3 4FCZA 1VQ93 3CNMA 4Q53A 4WFOA 3MPHA 2GU1A 2CFKA 2C11A 3ER7A 1JN5A 3NV0A 1PFPA 4EBGA 4EYCA 1OGXA 4STDA 3EN8A 1KD14 1ZX2A 3IJEB 1DYUA 3PYJA 4OUQA 1Q40B 3JUOA 1FUWA 2XR8B 1NWWA 4RNZA 1IVXA 4LEHA 4O8SA 2HMLB 3X41A 1YIT3 1STDA 2CW9A 1WQLB 2CC3A 2P38A 3GZRA 3FG3A 3D3LA 4CCVA 1EG9B 1N8R4 4IIAA 2GBWB 4HJLB 3LT8A 2UX0A 3DGNA 3PCSA 1Y4KA 1CYVA 3BB9A 4WHAA 1D6UA 3V92A 2ML6A 3KFQC 3LT9A 1IV7A 1ROVA 4FMBA 3G4S3 3N54B 1VQ53 2CH9A 3FG4A 3X3ZA 1GY5A 2CFGA 1TP6A 3WDGB 3G16A 1STFI 2W56A 1FA3A 1SJWA 1JV2B 2CHCA 1IVVA 1ULJB 5IG5A 2F86B 3T8UA 4HVNA 1YHQ3 1D6ZA 4FMCA 3PCRA 3M8CA 1KWIA 2YFLB 1RRLA 1IQ8A 4R4KA 3MKIA 3N9HA 3WODG 3Q1CA 3IPTA 4HKVB 3NBBA 2W2CA 3EJVA 3LXUX 5IEPA 2W56B 1K41A 2O9UX 4G1MB 1W7CA 3VF1A 5JPUA 1NB5I 3F14A 3LYGA 1J2BA 3QK9A 3BNCA 2HMNB 4EXRA 3KSPA 1E97A 2YFIB 3X40A 5DREA 1FGOA 3EQQB 4O02B 4GB5A 1EA2A 3BNDA 3JUQA 3CD63 2CG1A 1A67A 4HM0B 4GL6A 3QRDA 5IERA 1O7GB 3NQZA 1KC84 1DMQA 3MG1A 3CCM3 1IVWA 1E3RA 3UL6A 3G0KA 3HZPA 2CFDA 1L5GB 2CKFB 3B4OA 3CC43 1LXEA 3F8HA 2WGOA 4R1KA 4JRFA 4K90B 1YJN3 1TFOA 1M904 2E2TA 3OV4A 5CK6A 2Z7AA 4MMYB 1O7WB 4EV2A 5KP4A 1QVG2 2XGLA 1JB5A 2XFTA 2CWVA 5KP1A 1CYUA 4X2OA 3V99A 1O7MB 3KZTA 1W02A 4L8PA 5I97A 1GYBA 1HKXA 1QAFA 2RSXA 2Z76A 3BNEA 3K0ZA 4HM6B 1NO3A 4EC6A 1M1K4 3E99A 3FF0A 3LH4A 1FGTA 3CPOA 2XH9A 3NHXA 3LOYA 3CCV3 2C10A 3UJMA 3DXOA 3LMLA 3AMOB 4IPBA 1Q7Y4 1GD4A 5AYSC 3KIIA 2RFRA 4J8TA 4N6V0 1W2B2 2KXGA 5LC7A 2GEYA 1ZO2A 3K7CA 2D1WA 2WO0A 3G713 4LZIA 3CC73 1GD3A 3GRDA 4HM7B 2F99A 2STDA 1IDPA 1TIJA 5D83A 2XGNA 1K8A4 3PXMA 5AIIA 2XFSA 2KCDA 4WYKB 1YJW3 1MOLA 1Q42A 4HZBB 4MEIA 3WOFB 4WWUC 1R4CA 1WTHA 1KQS2 1OHSA 1IU7A 4XBXA 4RNYA 5CF2A 4JF8A 2W9QA 1SIIA 2BMOB 1IT8A 3EE1A 1W6CA 2B24B 4R80A 5AEUB 2K54A 1ISKA 1LOXA 1VQM3 1U5OA 1NDOB 3EHCA 5BXQA 4WP5A 3G8ZA 4O3VA 5IENA 3CCL3 3I0YA 2P0XA 3HI7A 1SPUA 3FSDA 4O2HA 3RDEA 3EC9A 3STDA 1YJ93 1OHOA 1E3VA 1RRHA 3F9SA 3SX1A 2IUKA 3LTAA 2PZVA 3I553 1JJ22 4ZM8A 3DGMA 8CHOA 3GWRA 5FGOA 1BUQA 3GZBA 2FNQA 1ASKA 1S5AA 3F8XA 3OXAA 4LGQA 2QGUA 4ORLA 1T5YA 2BMRB 4BTXA 1IT7A 2E2UA 5BVBA 3RGRA 4IT7A 3FG1A 5FW5A 4R9KA 1JKGA 3X42A 3HK4A 2W0QA 5EQLA 1W5ZA 4OVMA 1W2ZA 4HM2B 2CFLA 3NBJA 1MNLA 3SOYA 3CXC2 1K28A 1GS3A 4RZMA 3KSED 1Q40A 3T8NA 1W6GA 5IF6A 3G6E3 5EEOA 4K1UA 4N6MA 3O8YA 1AV4A 1OGZA 3MG2A 4HM3B 4NREA 1IV9A 5IG3A 2XRXB 2QA43 1VQO3 1VQ83 1CQSA 3EF8A 4LMIA 3U1WA 3CCJ3 2Y73A 3CC23 1K734 3EN1B 3GZXB 1JKGB 2B1XB 2K0MA 2Z77A 3SLUA 3V98A 1DVDA 1VQP3 2CWUA 1TFKA 1TUHA 4N6LA 5AIHA 2QEX3 3CU3A 4N6TA 1UUWB 3EX9A 1U8CB 3IMAB 3DM8A 1AVKA 4XDVA 3T0UA 2HMMB 3HIGA 1QMAA 3NUVA 2CG0A 1US1A 4XDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NV0 A;  3MSO A;  4X2H A;  4X2O A;  3EBT A;  1JB4 A;  3DMC A;  1O7M B;  5G2G A;  3KZT A;  3ER7 A;  4XBY A;  1W02 A;  2BNG A;  2I9W A;  1NU3 A;  3KKG A;  3FZW A;  1JN5 A;  1GYB A;  1HKX A;  3NM2 A;  1O7N B;  1OGX A;  2Z76 A;  3K0Z A;  1OCV A;  1W6Y A;  4HM6 B;  4STD A;  5CXO A;  5HGR A;  3E99 A;  3EN8 A;  1ZX2 A;  3ECF A;  3FF0 A;  3CPO A;  3Q90 A;  3B8L A;  3NHX A;  1A2K A;  4I4K A;  4OUQ A;  5D81 A;  2GXF A;  1Q40 B;  1UUV B;  3FKA A;  3UJM A;  3DXO A;  3JUO A;  4PEJ A;  2XR8 B;  1NWW A;  7STD A;  1Z1S A;  5KP3 A;  4LEH A;  6STD A;  4J8T A;  2RFR A;  2HML B;  4CDL A;  1STD A;  1OF5 A;  5AIG A;  2GEY A;  1WQL B;  1ZO2 A;  3CNX A;  3K7C A;  4HZ9 B;  3H3H A;  3S5C A;  3GRD A;  3GZR A;  4HM7 B;  1O7H B;  2F99 A;  3SED A;  2STD A;  4L8P A;  3OWY A;  1ULI B;  3MG3 A;  4K1V A;  1IDP A;  5D83 A;  2RGQ A;  1EG9 B;  5AII A;  4IIA A;  2GBW B;  4HJL B;  2BMQ B;  4J9A A;  5JPP A;  2UX0 A;  4WYK B;  1Q42 A;  4HZB B;  1JN5 B;  3NV0 B;  3BB9 A;  2XSO B;  4WWU C;  1OF5 B;  1QJG A;  4R9L A;  3FF2 A;  1OHS A;  4XBX A;  2XSH B;  5CF2 A;  3F40 A;  4L8O A;  3OWS A;  1GY5 A;  1TP6 A;  4H3U A;  1OH0 A;  2BMO B;  3F7X A;  3G16 A;  2B24 B;  3KE7 A;  4L7K A;  3VSY A;  2K54 A;  5AEU B;  3GZY B;  1SJW A;  1ISK A;  1U5O A;  1NDO B;  3EBY A;  3EHC A;  5BXQ A;  3BLZ A;  4WP5 A;  3HX8 A;  2CHC A;  1ULJ B;  2F98 A;  2F86 B;  3G8Z A;  3T8U A;  4HVN A;  5IEN A;  3I0Y A;  4FCJ A;  1VZZ A;  5D82 A;  3ROB A;  3FSD A;  4XB5 A;  2HMO B;  3NXJ A;  3EC9 A;  3M8C A;  3STD A;  2YFL B;  1AR0 A;  1OHO A;  1E3V A;  3F9S A;  4FCM A;  4HM5 B;  3JUN A;  3MKI A;  4U13 A;  5AIF A;  3D9R A;  2HMK B;  1C7H A;  2PZV A;  3B7C A;  3IPT A;  1GY7 A;  4HKV B;  5IEO A;  1W00 A;  3SOA A;  1OHP A;  2IMJ A;  2W2C A;  2QIY A;  3EJV A;  8CHO A;  3A76 A;  5CLK A;  4WYK A;  5DRV A;  1K41 A;  3GWR A;  3VGN A;  3GZB A;  5IEP A;  3UNL A;  1BUQ A;  1ASK A;  1S5A A;  4HM1 B;  3F8X A;  5EVH A;  5IG0 A;  2GEX A;  3OXA A;  5JPU A;  4LGQ A;  2QGU A;  3F14 A;  3LYG A;  2BMR B;  4ORL A;  2R4I A;  3FLJ A;  2HMN B;  3MHE A;  5BVB A;  3RGR A;  3RGA A;  3F7S A;  1OUN A;  1DMM A;  3KSP A;  1E97 A;  2YFI B;  4R9K A;  1JKG A;  5DRE A;  3HK4 A;  5FW5 A;  3FH1 A;  4N3V A;  1JB2 A;  4OVM A;  1W01 A;  1OPY A;  4HM2 B;  3EQQ B;  5STD A;  2JQ5 A;  4GB5 A;  1DMN A;  1EA2 A;  3SOY A;  2YFJ B;  3FGY A;  5TGN A;  3JUQ A;  1GY6 A;  2RCD A;  3WMD A;  1GS3 A;  3B4P A;  4RZM A;  1Q40 A;  3T8N A;  5IF6 A;  4HM0 B;  4XBT A;  4K1U A;  2GBX B;  3OX9 A;  1OGZ A;  3MG2 A;  4KVH A;  4HM3 B;  5IG3 A;  5IER A;  1O7G B;  2XRX B;  3OWU A;  1CQS A;  3EF8 A;  3LZA A;  3NBR A;  1DMQ A;  4LMI A;  5AEW B;  3MG1 A;  1E3R A;  3EN1 B;  3G0K A;  3GZX B;  3HZP A;  1JKG B;  2B1X B;  2Z77 A;  3JUP A;  3DZL A;  2CKF B;  2A15 A;  2INX A;  3B4O A;  3JUM A;  4HM4 B;  4MJD A;  5AI1 A;  5CF1 A;  5IG4 A;  3F8H A;  4R1K A;  1TUH A;  2OWP A;  5AIH A;  3CU3 A;  3H51 A;  1UUW B;  3EX9 A;  1O7P B;  3MYT A;  5IG5 A;  4HM8 B;  3DM8 A;  4XM4 A;  2HMJ B;  3DUK A;  3OV4 A;  4XDV A;  5CK6 A;  2Z7A A;  2HMM B;  1O7W B;  3CNM A;  1QMA A;  3NUV A;  4Q53 A;  5KP4 A;  1JB5 A;  4XDW A;  5KP1 A; 
#chains in the Genus database with same CATH topology
 1Q7H A;  1RGF A;  1IK3 A;  3FCS B;  1NJI 4;  3DMC A;  1G0T A;  4XBY A;  5G2G A;  2BNG A;  2I9W A;  3NM2 A;  3FZW A;  3K63 A;  3WOE B;  1FGR A;  5CXO A;  1RN7 A;  2F4Y A;  4BL3 A;  4TX4 A;  1IYY A;  1A2P A;  1EEJ A;  3Q90 A;  4I4K A;  1PU4 A;  1UUV B;  1PY3 A;  1D6Y A;  2GSP A;  1I2E A;  4PEJ A;  7STD A;  4KFD A;  1I70 A;  1T2H A;  1Z1S A;  5KP3 A;  6STD A;  3DY5 A;  1UW1 A;  3S28 A;  2FXT A;  3PZW A;  5AIG A;  5AYR B;  2WOF A;  3LTC A;  2PNC A;  2UGI A;  3S5C A;  1ZGX A;  3CPW 2;  2Z6B A;  3SED A;  4AEQ A;  2E2V A;  1RJO A;  2RGQ A;  5BU4 A;  1A2V A;  4J9A A;  2LQV A;  4LSO A;  1WNH A;  3NX0 A;  1JN5 B;  3NV0 B;  2SBL A;  4H61 A;  4NPB A;  2XSO B;  1C54 A;  1Q82 4;  1UCJ A;  1QJG A;  1T2I A;  2HOH A;  2W03 A;  4R9L A;  4FMA A;  2CWT A;  2XSH B;  1UGH I;  4L8O A;  3HII A;  3Q2P A;  4QWT A;  3OWS A;  4I5Q A;  1FUS A;  1TU5 A;  3CCS 3;  4H3U A;  1OH0 A;  2OQE A;  2W04 A;  3GZY B;  1I2G A;  1M9G A;  3SVA A;  1WMN A;  2IY2 A;  1RGA A;  1N5P A;  1UUG B;  4AKY A;  5D82 A;  2IA7 A;  1BSC A;  2MC8 A;  3ROB A;  1LOV A;  2HMO B;  2Q07 A;  2P05 A;  4KZ1 A;  4HM5 B;  1AR0 A;  1UI7 A;  1KSI A;  1V58 A;  4U13 A;  1VQ4 3;  1IVU A;  2FGT A;  3D9R A;  8RNT A;  4MMZ B;  3SOA A;  1GMQ A;  1GY7 A;  1YVS A;  5IEO A;  1QAK A;  3OW2 2;  2IMJ A;  1HU9 A;  3K5T A;  2QIY A;  4MMX B;  3ZFZ A;  4RBN A;  3A5E A;  1GMR A;  1B3S A;  3A76 A;  3UNL A;  3L0R A;  4HM1 B;  5G1K A;  5IG0 A;  2F56 A;  4GHO A;  4N6O B;  2M7O A;  3ZG0 A;  4FR9 A;  2R4I A;  3FLJ A;  3LTD A;  3PS8 A;  3MHE A;  2AAE A;  4K61 A;  1CEW I;  4BTW A;  1OUN A;  1DMM A;  3CCR 3;  1WMO A;  1YIJ 3;  3FH1 A;  2L4V A;  1JB2 A;  4N3V A;  1OPY A;  3GAX A;  2YX9 A;  5STD A;  2CX0 A;  2JQ5 A;  3HOH A;  5RNT A;  1DMN A;  1EKM A;  1R4Y A;  5TGN A;  1GOV A;  3WMD A;  2RCD A;  2GU3 A;  3B4P A;  1RKY A;  3AHS A;  1VQN 3;  1N9J A;  1N8Q A;  3CME 3;  4XBT A;  5M19 A;  1Q81 4;  1JBS A;  1MGR A;  2GBX B;  4KVH A;  2BO9 B;  1BRI A;  3OWU A;  1BSB A;  3LZA A;  2KRT A;  3BIR A;  2O3O A;  1JNQ A;  2F5W A;  3KCH A;  1UI8 A;  1BNI A;  2LYX A;  3NXJ A;  1BVI A;  3CMA 3;  1N5H A;  2A15 A;  4MJD A;  3BNB A;  1FGM A;  5CF1 A;  3NM7 A;  1VQK 3;  1ROA A;  3H51 A;  1RNT A;  1VQ7 3;  4HM8 B;  2W9P A;  4XM4 A;  2HMJ B;  3S67 A;  3DUK A;  3SXX A;  1FUT A;  1SQW A;  2UUG C;  4FMD A;  2OCT A;  1Q86 4;  1LNH A;  4CPK A;  3AHW A;  1BNR A;  1ZS7 A;  3MSO A;  4X2H A;  1RTU A;  1JB4 A;  3EBT A;  3JVC A;  2W6J H;  1Q9E A;  2ML5 A;  1DVC A;  3K9M C;  1NU3 A;  3KKG A;  2V1L A;  1SIH A;  1O7N B;  1OCV A;  1W6Y A;  5HGR A;  2ZDJ A;  3WR2 A;  3ECF A;  4AKZ A;  1JBT A;  3X3Y A;  1BNE A;  3B8L A;  1A2K A;  1GOY A;  5D81 A;  3D4A A;  1DE3 A;  2GXF A;  3FKA A;  1LRA A;  4BTY A;  1YGW A;  1RN4 A;  5LC6 A;  2WOH A;  2RNT A;  3N8B A;  4CDL A;  2ZL8 A;  1OF5 A;  1W4N A;  3EB8 A;  3NQY A;  1VQL 3;  1GSP A;  1NB3 I;  2MF7 A;  2OQE C;  3CNX A;  3H3H A;  4HZ9 B;  1JRQ A;  2WGQ A;  2XF3 A;  1O7H B;  4OK0 A;  2IUJ A;  3OWY A;  1MWU A;  1ULI B;  3MG3 A;  2CK3 H;  4K1V A;  4EV5 A;  3CCE 3;  4HYZ A;  1BIR A;  2BMQ B;  5JPP A;  3I56 3;  1VQ6 3;  4EW5 A;  1FGQ A;  1G02 A;  3LTB A;  1QVF 2;  4NHF A;  1OF5 B;  1F8N A;  1X1Y A;  3FF2 A;  2CIU A;  5BIR A;  1I3I A;  3F40 A;  1YVB I;  2XEP A;  1B2X A;  4N6U A;  3KE7 A;  3F7X A;  3VSY A;  4L7K A;  1MWS A;  3J7Y d;  1MWT A;  1JBR A;  3EBY A;  3U97 A;  3BLZ A;  5ELU A;  1AVL A;  3AMO A;  3HX8 A;  2F98 A;  3DGO A;  1X1X A;  1TRP A;  2K3D A;  1VZZ A;  4FCJ A;  3UB1 A;  2BHM A;  4XB5 A;  2Y74 A;  1S72 3;  4FCM A;  4KFF A;  1X1W A;  3JUN A;  6RNT A;  3TDG A;  5AIF A;  3S29 A;  3X3X A;  2HMK B;  1C7H A;  3B7C A;  1RNB A;  1I0V A;  1W00 A;  2KF6 A;  1OHP A;  1YGE A;  2P0M A;  1V74 A;  5CLK A;  3UL5 A;  4WYK A;  5DRV A;  3DGL A;  3VGN A;  3WA3 A;  2C4B A;  1BAN A;  2CFW A;  5EVH A;  2GEX A;  1A90 A;  3KN4 A;  1JZO A;  3CCU 3;  1BUJ A;  7RNT A;  1YI2 3;  1EUI C;  1OAC A;  1UCI A;  5G1L A;  3RGA A;  3F7S A;  1RCL A;  1EQK A;  2JDI H;  5GSP A;  4KFE A;  2H0H A;  1N9E A;  1LOW A;  4J5K A;  1W01 A;  2BT3 A;  5IW9 A;  5JBS A;  1K9M 4;  5M1A A;  2YFJ B;  3FGY A;  2P09 A;  4DKI A;  5ELJ A;  1GY6 A;  1WMP A;  3Q3F A;  5M18 A;  3MWZ A;  4HBR A;  3CCQ 3;  3OX9 A;  1LVN A;  3WA2 X;  1YNV X;  5A0O B;  2D42 A;  3NBR A;  3SYU A;  5AEW B;  2OTL 3;  2OOV C;  1BRK A;  1QAL A;  1IQX A;  3JUP A;  1FW7 A;  3DZL A;  1BRJ A;  2INX A;  3JUM A;  3PGB A;  4HM4 B;  4N6N B;  1M1X B;  1RN1 A;  1IQY A;  5AI1 A;  2OOV A;  5IG4 A;  2OWP A;  3ALA A;  3S27 A;  3MYT A;  1SAR A;  4BL2 A;  1G96 A;  1O7P B;  5HOH A;  2OTJ 3;  4KT3 B;  4FCZ A;  2SAR A;  1VQ9 3;  3CNM A;  4Q53 A;  4WFO A;  3MPH A;  2GU1 A;  2CFK A;  2AAD A;  2C11 A;  3ER7 A;  1JN5 A;  3NV0 A;  1PFP A;  4EBG A;  4EYC A;  1OGX A;  4STD A;  1LQM B;  3EN8 A;  1KD1 4;  1ZX2 A;  3IJE B;  2RBI A;  1DYU A;  3PYJ A;  4OUQ A;  1Q40 B;  3D79 A;  3JUO A;  1FUW A;  2XR8 B;  1NWW A;  1B20 A;  4RNZ A;  1IVX A;  4LEH A;  4O8S A;  2HML B;  3X41 A;  1YIT 3;  1BAO A;  1STD A;  2CW9 A;  1WQL B;  2CC3 A;  2KF4 A;  1TJD A;  2P38 A;  4HOH A;  3GZR A;  3FG3 A;  3D3L A;  1BRG A;  4CCV A;  1EG9 B;  4ILF A;  1N8R 4;  4IIA A;  2GBW B;  4HJL B;  3LT8 A;  2UX0 A;  2CX1 A;  3DGN A;  1BGS A;  3PCS A;  2KF5 A;  1Y4K A;  2BIR A;  1CYV A;  3BB9 A;  4WHA A;  1D6U A;  3V92 A;  2ML6 A;  3KFQ C;  3LT9 A;  1IV7 A;  1HYF A;  1ROV A;  4FMB A;  3G4S 3;  3N54 B;  1VQ5 3;  2CH9 A;  3FG4 A;  1B2U A;  3X3Z A;  1GY5 A;  2CFG A;  1TP6 A;  3WDG B;  3G16 A;  1STF I;  2W56 A;  1FA3 A;  1GMP A;  1JV2 B;  1SJW A;  1DET A;  2CHC A;  1IVV A;  1ULJ B;  2KAA A;  2F86 B;  3T8U A;  5IG5 A;  4HVN A;  1YHQ 3;  1D6Z A;  1I3F A;  3PCR A;  4FMC A;  3M8C A;  1KWI A;  2YFL B;  1RRL A;  1IQ8 A;  1UCK A;  4R4K A;  3MKI A;  3N9H A;  3WOD G;  3Q1C A;  1I8V A;  1LOY A;  1RGG A;  3IPT A;  3NBB A;  4HKV B;  2J8X B;  2W2C A;  3EJV A;  3LXU X;  5IEP A;  1BRH A;  2H0I A;  2W56 B;  1K41 A;  2O9U X;  1V57 A;  4G1M B;  1W7C A;  3VF1 A;  5JPU A;  1NB5 I;  3F14 A;  3LYG A;  1FYS A;  4BIR A;  1J2B A;  3QK9 A;  3BNC A;  2HMN B;  4GSP A;  4EXR A;  2BU4 A;  3KSP A;  1E97 A;  1RGL A;  2YFI B;  3X40 A;  5DRE A;  1FGO A;  3EQQ B;  4O02 B;  1LNI A;  4GB5 A;  1EA2 A;  3BND A;  3JUQ A;  3CD6 3;  4HAA A;  2CG1 A;  1A67 A;  4HM0 B;  1HZ1 A;  4GL6 A;  4LYL B;  3QRD A;  5IER A;  6GSP A;  1O7G B;  3AGN A;  3NQZ A;  1KC8 4;  1BNS A;  1DMQ A;  3MG1 A;  3CCM 3;  1IVW A;  1CH0 A;  1E3R A;  2R41 A;  3G0K A;  1AY7 A;  3HZP A;  2CFD A;  1L5G B;  3UL6 A;  3G6E 3;  2CKF B;  1GOU A;  3B4O A;  3CC4 3;  3URP A;  1LXE A;  3F8H A;  2WGO A;  4R1K A;  4JRF A;  4K90 B;  1AQZ A;  1YJN 3;  1TFO A;  1M90 4;  1UDI I;  2E2T A;  3OV4 A;  5CK6 A;  2Z7A A;  4MMY B;  1BOX A;  1O7W B;  4EV2 A;  5KP4 A;  1QVG 2;  2XGL A;  1JB5 A;  2XFT A;  2CWV A;  5KP1 A;  1CYU A;  1VQQ A;  4X2O A;  3V99 A;  1O7M B;  3KZT A;  1W02 A;  4L8P A;  5I97 A;  1GYB A;  1HKX A;  1QAF A;  2RSX A;  2Z76 A;  1I2F A;  3BNE A;  3K0Z A;  1NO3 A;  4HM6 B;  4EC6 A;  1M1K 4;  3E99 A;  3D5I A;  1BSA A;  3FF0 A;  3LH4 A;  1FGT A;  1RGH A;  2XH9 A;  3CPO A;  3NHX A;  3LOY A;  2L1S A;  3CCV 3;  2C10 A;  1TRQ A;  3UJM A;  3DXO A;  3LML A;  3AMO B;  4IPB A;  1BNF A;  1TTO A;  1GD4 A;  1Q7Y 4;  5AYS C;  3KII A;  2RFR A;  4J8T A;  4N6V 0;  1W2B 2;  2KXG A;  1RSN A;  5LC7 A;  2GEY A;  1ZO2 A;  3K7C A;  2D1W A;  2WO0 A;  3G71 3;  4LZI A;  4CJN A;  3CC7 3;  1GD3 A;  3GRD A;  3GSP A;  4HM7 B;  1PYL A;  1BRN L;  2F99 A;  2STD A;  1NNV A;  1IDP A;  1TIJ A;  5D83 A;  3BU4 A;  1LQG C;  2XGN A;  1K8A 4;  3PXM A;  5AII A;  1I0X A;  2XFS A;  2KCD A;  3AGO A;  4WYK B;  1YJW 3;  1MOL A;  1Q42 A;  4HZB B;  4MEI A;  3WOF B;  1RCK A;  4WWU C;  3ZG5 A;  1R4C A;  1WTH A;  1B2M A;  1KQS 2;  1FZU A;  1RGE A;  1OHS A;  1IU7 A;  4XBX A;  1BNJ A;  1RMS A;  4RNY A;  5CF2 A;  4JF8 A;  2W9Q A;  1SII A;  2BMO B;  1IT8 A;  3EE1 A;  1W6C A;  2B24 B;  4R80 A;  5AEU B;  2K54 A;  1ISK A;  1LOX A;  1VQM 3;  1RGK A;  1NDO B;  1RLS A;  1U5O A;  2F5M A;  3EHC A;  5BXQ A;  1B2Z A;  4WP5 A;  3G8Z A;  4O3V A;  5IEN A;  3CCL 3;  3I0Y A;  1BNG A;  2P0X A;  3HI7 A;  1SPU A;  1UCL A;  3FSD A;  4O2H A;  3RDE A;  3EC9 A;  3RNT A;  3STD A;  1YJ9 3;  1OHO A;  1E3V A;  1RRH A;  3F9S A;  5IF6 A;  3SX1 A;  2IUK A;  3LTA A;  1RGC A;  1RDS A;  2PZV A;  4RNT A;  3I55 3;  1JJ2 2;  3D5G A;  4ZM8 A;  3DGM A;  1JZD A;  8CHO A;  3GWR A;  5FGO A;  3WHO A;  3GZB A;  1BUQ A;  2FNQ A;  3DGY A;  1ASK A;  1S5A A;  3F8X A;  3OXA A;  4LGQ A;  2QGU A;  4ORL A;  1T5Y A;  2BMR B;  4BTX A;  1IT7 A;  2E2U A;  5BVB A;  3RGR A;  4IT7 A;  1B2S A;  3FG1 A;  5FW5 A;  4R9K A;  1JKG A;  3X42 A;  3HK4 A;  2W0Q A;  5EQL A;  2ZHX B;  2IYJ A;  1BU4 A;  1W5Z A;  4OVM A;  1W2Z A;  4HM2 B;  2CFL A;  3NBJ A;  1MNL A;  3SOY A;  3CXC 2;  1BSE A;  1GS3 A;  1K28 A;  1RHL A;  1Q40 A;  2ZA4 A;  1W6G A;  3KSE D;  4RZM A;  5EEO A;  3T8N A;  4K1U A;  4N6M A;  3O8Y A;  1AV4 A;  1OGZ A;  3MG2 A;  4HM3 B;  4NRE A;  1IV9 A;  5IG3 A;  2XRX B;  2QA4 3;  1VQO 3;  1VQ8 3;  1CQS A;  3DH2 A;  3EF8 A;  1MGW A;  1T3B A;  4LMI A;  3U1W A;  1BRS A;  1UGI A;  3CCJ 3;  1B21 A;  2Y73 A;  3CC2 3;  3EN1 B;  3GZX B;  1K73 4;  1JKG B;  1MWR A;  1X1U A;  2B1X B;  2K0M A;  2Z77 A;  3SLU A;  3V98 A;  1DVD A;  1VQP 3;  2CWU A;  2KF3 A;  1B27 A;  1TFK A;  1TUH A;  4N6L A;  5AIH A;  2QEX 3;  3CU3 A;  4N6T A;  1UUW B;  3EX9 A;  1U8C B;  3IMA B;  9RNT A;  2H0G A;  3DM8 A;  1BSD A;  1AVK A;  4J5G A;  4XDV A;  3T0U A;  7GSP A;  2HMM B;  3HIG A;  1QMA A;  3NUV A;  2CG0 A;  1US1 A;  4BU4 A;  4XDW A; 
#chains in the Genus database with same CATH homology
 1IK3 A;  1NJI 4;  3FCS B;  3DMC A;  5G2G A;  4XBY A;  2BNG A;  2I9W A;  3NM2 A;  3FZW A;  3K63 A;  3WOE B;  1FGR A;  5CXO A;  1RN7 A;  4TX4 A;  3Q90 A;  4I4K A;  1PU4 A;  1UUV B;  1D6Y A;  4PEJ A;  7STD A;  4KFD A;  1Z1S A;  5KP3 A;  6STD A;  3DY5 A;  1UW1 A;  3S28 A;  2FXT A;  3PZW A;  5AIG A;  5AYR B;  2WOF A;  3LTC A;  2PNC A;  3S5C A;  3CPW 2;  2Z6B A;  3SED A;  4AEQ A;  2E2V A;  1RJO A;  2RGQ A;  1A2V A;  4J9A A;  2LQV A;  4LSO A;  1WNH A;  3NX0 A;  1JN5 B;  3NV0 B;  2SBL A;  4H61 A;  2XSO B;  1Q82 4;  2W03 A;  1QJG A;  4R9L A;  4FMA A;  2CWT A;  2XSH B;  4L8O A;  3HII A;  3Q2P A;  4QWT A;  3OWS A;  1TU5 A;  3CCS 3;  4H3U A;  1OH0 A;  2OQE A;  2W04 A;  3GZY B;  1M9G A;  3SVA A;  1WMN A;  1N5P A;  4AKY A;  5D82 A;  2IA7 A;  2MC8 A;  3ROB A;  2Q07 A;  2HMO B;  2P05 A;  4KZ1 A;  4HM5 B;  1AR0 A;  1UI7 A;  1KSI A;  4U13 A;  1VQ4 3;  1IVU A;  2FGT A;  3D9R A;  4MMZ B;  3SOA A;  1GY7 A;  5IEO A;  1QAK A;  3OW2 2;  2IMJ A;  1HU9 A;  3K5T A;  2QIY A;  4MMX B;  4RBN A;  3A76 A;  3UNL A;  3L0R A;  4HM1 B;  5IG0 A;  4N6O B;  2M7O A;  4FR9 A;  2R4I A;  3FLJ A;  3LTD A;  3PS8 A;  3MHE A;  4K61 A;  1CEW I;  4BTW A;  1OUN A;  1DMM A;  3CCR 3;  1WMO A;  1YIJ 3;  3FH1 A;  2L4V A;  1JB2 A;  4N3V A;  1OPY A;  3GAX A;  2YX9 A;  5STD A;  2JQ5 A;  1DMN A;  1EKM A;  5TGN A;  3WMD A;  2RCD A;  2GU3 A;  3B4P A;  1RKY A;  1VQN 3;  1N9J A;  1N8Q A;  3CME 3;  4XBT A;  1Q81 4;  2GBX B;  4KVH A;  2BO9 B;  3OWU A;  3LZA A;  2KRT A;  2O3O A;  1JNQ A;  1UI8 A;  2LYX A;  3NXJ A;  3CMA 3;  1N5H A;  2A15 A;  4MJD A;  3BNB A;  1FGM A;  5CF1 A;  3NM7 A;  1VQK 3;  1ROA A;  3H51 A;  1VQ7 3;  4HM8 B;  2W9P A;  4XM4 A;  2HMJ B;  3S67 A;  3DUK A;  3SXX A;  1SQW A;  4FMD A;  2OCT A;  1Q86 4;  1LNH A;  3MSO A;  4X2H A;  3EBT A;  1JB4 A;  3JVC A;  2W6J H;  2ML5 A;  1DVC A;  3K9M C;  1NU3 A;  3KKG A;  2V1L A;  1SIH A;  1O7N B;  1OCV A;  1W6Y A;  5HGR A;  2ZDJ A;  4AKZ A;  3ECF A;  3X3Y A;  3B8L A;  1A2K A;  5D81 A;  2GXF A;  3FKA A;  4BTY A;  5LC6 A;  2WOH A;  3N8B A;  4CDL A;  2ZL8 A;  1OF5 A;  1W4N A;  3EB8 A;  3NQY A;  1VQL 3;  1NB3 I;  2MF7 A;  2OQE C;  3CNX A;  3H3H A;  4HZ9 B;  1JRQ A;  2WGQ A;  2XF3 A;  1O7H B;  4OK0 A;  2IUJ A;  3OWY A;  1ULI B;  3MG3 A;  2CK3 H;  4K1V A;  4EV5 A;  3CCE 3;  4HYZ A;  2BMQ B;  5JPP A;  3I56 3;  1VQ6 3;  1FGQ A;  3LTB A;  1QVF 2;  4NHF A;  1OF5 B;  1F8N A;  3FF2 A;  2CIU A;  3F40 A;  1YVB I;  2XEP A;  4N6U A;  3KE7 A;  3F7X A;  3VSY A;  4L7K A;  3J7Y d;  3EBY A;  3U97 A;  3BLZ A;  5ELU A;  1AVL A;  3AMO A;  3HX8 A;  2F98 A;  3DGO A;  3UB1 A;  4FCJ A;  1VZZ A;  2BHM A;  4XB5 A;  2Y74 A;  1S72 3;  4FCM A;  4KFF A;  3JUN A;  3TDG A;  5AIF A;  3S29 A;  3X3X A;  2HMK B;  1C7H A;  3B7C A;  1W00 A;  1OHP A;  1YGE A;  2P0M A;  1V74 A;  5CLK A;  3UL5 A;  4WYK A;  5DRV A;  3DGL A;  3VGN A;  3WA3 A;  2CFW A;  5EVH A;  2GEX A;  1A90 A;  3KN4 A;  3CCU 3;  1YI2 3;  1OAC A;  3RGA A;  3F7S A;  1EQK A;  2JDI H;  4KFE A;  1N9E A;  1W01 A;  2BT3 A;  5IW9 A;  5JBS A;  1K9M 4;  2YFJ B;  3FGY A;  2P09 A;  5ELJ A;  1GY6 A;  1WMP A;  3MWZ A;  4HBR A;  3CCQ 3;  3OX9 A;  1LVN A;  3WA2 X;  5A0O B;  2D42 A;  3NBR A;  5AEW B;  2OTL 3;  2OOV C;  1QAL A;  1IQX A;  3JUP A;  3DZL A;  4N6N B;  2INX A;  3JUM A;  3PGB A;  4HM4 B;  5AI1 A;  1M1X B;  2OOV A;  1IQY A;  5IG4 A;  2OWP A;  3ALA A;  3S27 A;  3MYT A;  1G96 A;  1O7P B;  2OTJ 3;  4FCZ A;  1VQ9 3;  3CNM A;  4Q53 A;  4WFO A;  3MPH A;  2GU1 A;  2CFK A;  2C11 A;  3ER7 A;  1JN5 A;  3NV0 A;  1PFP A;  4EBG A;  4EYC A;  1OGX A;  4STD A;  3EN8 A;  1KD1 4;  1ZX2 A;  3IJE B;  1DYU A;  3PYJ A;  4OUQ A;  1Q40 B;  3JUO A;  1FUW A;  2XR8 B;  1NWW A;  4RNZ A;  1IVX A;  4LEH A;  4O8S A;  2HML B;  3X41 A;  1YIT 3;  1STD A;  2CW9 A;  1WQL B;  2CC3 A;  2P38 A;  3GZR A;  3FG3 A;  3D3L A;  4CCV A;  1EG9 B;  1N8R 4;  4IIA A;  2GBW B;  4HJL B;  3LT8 A;  2UX0 A;  3DGN A;  3PCS A;  1Y4K A;  1CYV A;  3BB9 A;  4WHA A;  1D6U A;  3V92 A;  2ML6 A;  3KFQ C;  3LT9 A;  1IV7 A;  1ROV A;  4FMB A;  3G4S 3;  3N54 B;  1VQ5 3;  2CH9 A;  3FG4 A;  3X3Z A;  1GY5 A;  2CFG A;  1TP6 A;  3WDG B;  3G16 A;  1STF I;  2W56 A;  1FA3 A;  1SJW A;  1JV2 B;  2CHC A;  1IVV A;  1ULJ B;  5IG5 A;  2F86 B;  3T8U A;  4HVN A;  1YHQ 3;  1D6Z A;  4FMC A;  3PCR A;  3M8C A;  1KWI A;  2YFL B;  1RRL A;  1IQ8 A;  4R4K A;  3MKI A;  3N9H A;  3WOD G;  3Q1C A;  3IPT A;  4HKV B;  3NBB A;  2W2C A;  3EJV A;  3LXU X;  5IEP A;  2W56 B;  1K41 A;  2O9U X;  4G1M B;  1W7C A;  3VF1 A;  5JPU A;  1NB5 I;  3F14 A;  3LYG A;  1J2B A;  3QK9 A;  3BNC A;  2HMN B;  4EXR A;  3KSP A;  1E97 A;  2YFI B;  3X40 A;  5DRE A;  1FGO A;  3EQQ B;  4O02 B;  4GB5 A;  1EA2 A;  3BND A;  3JUQ A;  3CD6 3;  2CG1 A;  1A67 A;  4HM0 B;  4GL6 A;  3QRD A;  5IER A;  1O7G B;  3NQZ A;  1KC8 4;  1DMQ A;  3MG1 A;  3CCM 3;  1IVW A;  1E3R A;  3UL6 A;  3G0K A;  3HZP A;  2CFD A;  1L5G B;  2CKF B;  3B4O A;  3CC4 3;  1LXE A;  3F8H A;  2WGO A;  4R1K A;  4JRF A;  4K90 B;  1YJN 3;  1TFO A;  1M90 4;  2E2T A;  3OV4 A;  5CK6 A;  2Z7A A;  4MMY B;  1O7W B;  4EV2 A;  5KP4 A;  1QVG 2;  2XGL A;  1JB5 A;  2XFT A;  2CWV A;  5KP1 A;  1CYU A;  4X2O A;  3V99 A;  1O7M B;  3KZT A;  1W02 A;  4L8P A;  5I97 A;  1GYB A;  1HKX A;  1QAF A;  2RSX A;  2Z76 A;  3BNE A;  3K0Z A;  4HM6 B;  1NO3 A;  4EC6 A;  1M1K 4;  3E99 A;  3FF0 A;  3LH4 A;  1FGT A;  3CPO A;  2XH9 A;  3NHX A;  3LOY A;  3CCV 3;  2C10 A;  3UJM A;  3DXO A;  3LML A;  3AMO B;  4IPB A;  1Q7Y 4;  1GD4 A;  5AYS C;  3KII A;  2RFR A;  4J8T A;  4N6V 0;  1W2B 2;  2KXG A;  5LC7 A;  2GEY A;  1ZO2 A;  3K7C A;  2D1W A;  2WO0 A;  3G71 3;  4LZI A;  3CC7 3;  1GD3 A;  3GRD A;  4HM7 B;  2F99 A;  2STD A;  1IDP A;  1TIJ A;  5D83 A;  2XGN A;  1K8A 4;  3PXM A;  5AII A;  2XFS A;  2KCD A;  4WYK B;  1YJW 3;  1MOL A;  1Q42 A;  4HZB B;  4MEI A;  3WOF B;  4WWU C;  1R4C A;  1WTH A;  1KQS 2;  1OHS A;  1IU7 A;  4XBX A;  4RNY A;  5CF2 A;  4JF8 A;  2W9Q A;  1SII A;  2BMO B;  1IT8 A;  3EE1 A;  1W6C A;  2B24 B;  4R80 A;  5AEU B;  2K54 A;  1ISK A;  1LOX A;  1VQM 3;  1U5O A;  1NDO B;  3EHC A;  5BXQ A;  4WP5 A;  3G8Z A;  4O3V A;  5IEN A;  3CCL 3;  3I0Y A;  2P0X A;  3HI7 A;  1SPU A;  3FSD A;  4O2H A;  3RDE A;  3EC9 A;  3STD A;  1YJ9 3;  1OHO A;  1E3V A;  1RRH A;  3F9S A;  3SX1 A;  2IUK A;  3LTA A;  2PZV A;  3I55 3;  1JJ2 2;  4ZM8 A;  3DGM A;  8CHO A;  3GWR A;  5FGO A;  1BUQ A;  3GZB A;  2FNQ A;  1ASK A;  1S5A A;  3F8X A;  3OXA A;  4LGQ A;  2QGU A;  4ORL A;  1T5Y A;  2BMR B;  4BTX A;  1IT7 A;  2E2U A;  5BVB A;  3RGR A;  4IT7 A;  3FG1 A;  5FW5 A;  4R9K A;  1JKG A;  3X42 A;  3HK4 A;  2W0Q A;  5EQL A;  1W5Z A;  4OVM A;  1W2Z A;  4HM2 B;  2CFL A;  3NBJ A;  1MNL A;  3SOY A;  3CXC 2;  1K28 A;  1GS3 A;  4RZM A;  3KSE D;  1Q40 A;  3T8N A;  1W6G A;  5IF6 A;  3G6E 3;  5EEO A;  4K1U A;  4N6M A;  3O8Y A;  1AV4 A;  1OGZ A;  3MG2 A;  4HM3 B;  4NRE A;  1IV9 A;  5IG3 A;  2XRX B;  2QA4 3;  1VQO 3;  1VQ8 3;  1CQS A;  3EF8 A;  4LMI A;  3U1W A;  3CCJ 3;  2Y73 A;  3CC2 3;  1K73 4;  3EN1 B;  3GZX B;  1JKG B;  2B1X B;  2K0M A;  2Z77 A;  3SLU A;  3V98 A;  1DVD A;  1VQP 3;  2CWU A;  1TFK A;  1TUH A;  4N6L A;  5AIH A;  2QEX 3;  3CU3 A;  4N6T A;  1UUW B;  3EX9 A;  1U8C B;  3IMA B;  3DM8 A;  1AVK A;  4XDV A;  3T0U A;  2HMM B;  3HIG A;  1QMA A;  3NUV A;  2CG0 A;  1US1 A;  4XDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...