2W9QA

Crystal structure of potato multicystatin-p212121
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTICYSTATIN
publication title Characterization of Solanum Tuberosum Multicystatin and its Structural Comparison with Other Cystatins.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w9qA00
1EQKA 5ELJA 3S67A 4LZIA 2KXGA 4CCVA 1FUWA 5A0OB 1IV7A 1MNLA 3QRDA 1CYVA 1GD3A 1N5HA 5LC7A 3LH4A 4N6OB 1CYUA 3MWZA 2OCTA 3L0RA 1N9JA 1MOLA 1N5PA 4ZM8A 1M9GA 3UL6A 3PYJA 1NB3I 3NX0A 1A90A 1ROAA 1LXEA 1DVDA 4N6UA 3UL5A 1YVBI 1A67A 1WNHA 1TIJA 3K9MC 2O9UX 4N6LA 1R4CA 3GAXA 1G96A 1CEWI 2W9PA 1KWIA 3IMAB 1RN7A 3Q2PA 2W9QA 5EQLA 4TX4A 4N6V0 3KSED 1IV9A 2CH9A 4EYCA 4N6NB 5LC6A 1STFI 3SVAA 1GD4A 3KFQC 1DVCA 4N6TA 5ELUA 4IT7A 1NB5I 3PS8A 4N6MA 1FA3A 3PXMA 1PFPA 2BO9B
chains in the Genus database with same CATH superfamily
4OUQA 2KF6A 1FGMA 1B21A 5G1KA 5GSPA 1G02A 1G0TA 3DY5A 1D6YA 1DYUA 3EBYA 3F9SA 4CDLA 1Q42A 3D9RA 2F5MA 1I0XA 1LQMB 1QMAA 3DGOA 3NBRA 1RNBA 2XSOB 5CXOA 1JB5A 1SQWA 4L7KA 4EC6A 2AAEA 2I9WA 1BRJA 1MWSA 3V98A 1K41A 4FMDA 4LGQA 3K0ZA 2E2VA 1X1YA 4I4KA 2W56A 1RGAA 4HOHA 3FG3A 3LH4A 1BU4A 4N6OB 4HM8B 1WMNA 1UUGB 3H51A 4U13A 3L0RA 1IQ8A 1AV4A 3K63A 1VQ53 3I553 4L8OA 3V92A 4HM4B 2FXTA 4N3VA 2KF5A 1MOLA 1W00A 3U97A 1BRNL 1OHOA 4OVMA 3DUKA 1BNIA 5EEOA 4H61A 3MSOA 3EN1B 2CFGA 2GSPA 1NB3I 3CU3A 1BRGA 1IVUA 3BU4A 3F40A 4KZ1A 1W6CA 4HM6B 3BLZA 3KSPA 3CCS3 1LOXA 3OX9A 1KSIA 3MG3A 5IERA 4IIAA 4JRFA 3G4S3 1RSNA 3G16A 5HGRA 1BIRA 1YVBI 3D79A 4XBXA 2HMKB 1K734 3WR2A 2O9UX 1BUQA 1MGRA 1MWUA 1ZGXA 1JN5A 3TDGA 4XB5A 3UB1A 2CFDA 4XM4A 5CF1A 1DETA 1RKYA 3FF0A 5BXQA 1IU7A 3DGLA 3T8UA 1UCJA 1BRIA 1E97A 1FGOA 1OCVA 1YVSA 1UI7A 1YGEA 1FYSA 1G96A 3FF2A 1ISKA 2CIUA 4FR9A 1MWTA 3D3LA 2L4VA 3OWSA 1YHQ3 1JB2A 2ZL8A 1IQXA 5KP4A 3DM8A 3MG1A 1RCKA 4HM1B 3AMOA 3ZG5A 3DZLA 2PZVA 4LSOA 1LRAA 2W9QA 1A2VA 3EQQB 2FGTA 4N6V0 8RNTA 9RNTA 2P38A 2HOHA 1NO3A 5CF2A 1QVG2 1B2SA 1W4NA 1IVVA 1S5AA 2BU4A 2C4BA 1GY5A 1BNJA 1K28A 3B4OA 4WWUC 2IA7A 1O7PB 4EYCA 1IVWA 3CXC2 4XBYA 3A5EA 2BMRB 1OGZA 1QAKA 1GOYA 1JB4A 2K0MA 3Q1CA 1V58A 2OOVA 3CPW2 1TP6A 1A2PA 3ER7A 4HYZA 1IK3A 4MEIA 4FCZA 2CFWA 1GD4A 1AY7A 1Q7HA 3CC23 1VQ93 1BUJA 1RGLA 2OTL3 3BNCA 3CCR3 1B3SA 3OV4A 1FUTA 1VQ73 2SBLA 3EC9A 1BRKA 4DKIA 1QVF2 1VQL3 1AVKA 2W2CA 1W2ZA 3F14A 1RTUA 3B4PA 2QIYA 1DMQA 2KF4A 1WMOA 2W56B 1YJW3 3S67A 1EA2A 1I0VA 1US1A 3E99A 4LZIA 4R9LA 5M1AA 3UJMA 1S723 5BIRA 3PCRA 2FNQA 4JF8A 5DRVA 2CWUA 3A76A 4KFFA 2ZHXB 2D1WA 7STDA 1GMRA 1FGRA 3CC73 3LT8A 4X2OA 3HIIA 3JUNA 4O02B 4WHAA 3GWRA 2W6JH 3UNLA 5AYSC 5A0OB 1KC84 2K54A 1VQ43 1IV7A 3CNMA 3JUMA 2QA43 3I0YA 3SEDA 2XSHB 1N5HA 2BHMA 3URPA 3AGNA 2ML5A 5LC7A 1TFKA 3LOYA 1EKMA 1OACA 4FMBA 1X1WA 1OHSA 3T8NA 4X2HA 2OCTA 7GSPA 3KE7A 1AVLA 1WQLB 2CWTA 3OWUA 1KD14 1Q7Y4 5IW9A 2H0GA 3LT9A 2IUJA 4ILFA 3RDEA 3CPOA 2MF7A 4NHFA 1UGHI 4AKZA 3NXJA 4ZM8A 2F4YA 2SARA 3WHOA 1VQN3 1JN5B 3BIRA 1I2EA 1EUIC 3FSDA 3KN4A 5IG0A 3PYJA 1L5GB 2BMQB 3UL6A 3NX0A 4K61A 4L8PA 4WYKA 1W5ZA 2LYXA 5IG5A 2W0QA 1IDPA 1ROAA 3D5GA 1JZOA 1PYLA 4QWTA 2IMJA 1QALA 1BNSA 3CC43 4HM5B 4O8SA 2JQ5A 1I3FA 1STDA 3AMOB 3UL5A 3WDGB 1N9EA 2CK3H 2RGQA 3MKIA 4FCMA 4EV5A 1M1K4 5BVBA 1TIJA 5IG3A 4BU4A 4MJDA 1M904 1FGTA 1GMPA 1RDSA 4N6LA 1R4CA 3IPTA 1SIHA 4R9KA 3NQYA 2P0MA 3I563 4HKVB 1N8R4 5AIHA 1K9M4 2CG0A 3B7CA 3PCSA 1YJN3 1CEWI 3DGNA 2K3DA 4J5GA 1RRHA 4G1MB 1RRLA 1KWIA 2HMOB 3IMAB 1RN7A 3S5CA 4HM3B 4BIRA 6GSPA 3O8YA 2ML6A 3EX9A 3WOFB 1SPUA 2H0HA 3EF8A 2R4IA 3NHXA 3M8CA 1HYFA 4AEQA 1IT8A 3CMA3 3SLUA 1Q824 1UUWB 4K90B 1BNGA 1TUHA 1GOUA 2L1SA 3BNEA 1Q814 3FGYA 3IJEB 1GS3A 3Q3FA 1PY3A 1OPYA 2XH9A 1X1XA 4N6NB 1U5OA 1WTHA 1B2ZA 1LNIA 1W02A 3FZWA 1RMSA 3HZPA 3LMLA 4MMZB 4AKYA 2RCDA 3EBTA 4XBTA 1WMPA 2HMNB 5STDA 2Z76A 3V99A 3HX8A 1DVCA 2GU3A 2W03A 1Q864 2E2UA 3JUQA 2OWPA 5IG4A 5CLKA 3ROBA 3AHSA 2UUGC 1NB5I 1FA3A 2XFTA 3WODG 1UW1A 2HMJB 1NWWA 1RN4A 1BGSA 5FGOA 5JBSA 2XR8B 1FZUA 1SARA 1Q9EA 3DGYA 1BNFA 1EQKA 5ELJA 1F8NA 1LQGC 1UCIA 3LZAA 5AIGA 1TRPA 1JNQA 2GEXA 1W6YA 1IQYA 3X3ZA 1JJ22 2QGUA 2YFIB 3EHCA 4EBGA 1BNEA 2KXGA 3ECFA 1FUWA 1TRQA 1RGFA 1RGGA 2B1XB 2XFSA 3LTAA 3DGMA 1HKXA 4LEHA 2CKFB 1UGIA 2CC3A 1EG9B 4NPBA 4OK0A 3CCE3 1UCLA 3QRDA 2IYJA 4GL6A 1CYVA 1GD3A 5AEWB 2KAAA 2ZDJA 4CJNA 3AHWA 3LTDA 5CK6A 2GU1A 1I2GA 2ZA4A 3SOAA 1LNHA 2XRXB 5AIIA 1NJI4 1NU3A 2BNGA 4WYKB 5BU4A 3N9HA 5AI1A 4J8TA 4WP5A 3FG4A 3NBBA 2D42A 1CQSA 2RBIA 2J8XB 4MMXB 3OW22 4MMYB 6STDA 3KCHA 3S29A 2JDIH 3DXOA 2WOHA 2GEYA 1RN1A 3EB8A 5EVHA 4FMCA 3U1WA 2CHCA 2IY2A 3GRDA 5KP1A 3OWYA 1M9GA 4J9AA 1TU5A 3MHEA 1Q40A 3X40A 3Q90A 2WGQA 3CME3 3NBJA 1C7HA 1E3VA 1ASKA 1I70A 1SIIA 2Y73A 4HZ9B 5KP3A 4RNYA 4HVNA 1Z1SA 4KVHA 1J2BA 3X41A 5IEOA 3CCM3 1RJOA 4XDVA 1W2B2 1O7WB 4O3VA 2W04A 1IT7A 1OUNA 1GY7A 1OGXA 1UCKA 1ZX2A 5JPUA 2MC8A 5M19A 2C10A 3KZTA 2BT3A 3K7CA 4HM2B 4LMIA 3WA2X 4EW5A 3CCL3 4HJLB 4GHOA 4XDWA 5IF6A 1X1UA 3BNDA 2KCDA 3F8XA 4K1UA 4O2HA 3NV0A 5DREA 1T5YA 3Q2PA 1W7CA 4R80A 1B2MA 2YX9A 1O7GB 3NM2A 4KT3B 1O7NB 2CW9A 2P05A 1BVIA 2XGNA 3N54B 1JKGA 1NDOB 4GSPA 1B20A 5EQLA 3FKAA 1JBRA 2A15A 3LXUX 4TX4A 3GZXB 3KSED 5G2GA 1IV9A 1C54A 3KKGA 4KFDA 2RNTA 3FG1A 4HM0B 2CWVA 3VGNA 1VQM3 2CH9A 1FGQA 2RFRA 2F5WA 2R41A 4RBNA 1RGHA 1CH0A 2H0IA 3NM7A 2E2TA 1T3BA 3CCJ3 4KFEA 1B2UA 1Y4KA 2CX1A 3FH1A 7RNTA 3G0KA 2UGIA 5FW5A 3X42A 1PU4A 5HOHA 1DMMA 1ZS7A 3BB9A 4N6TA 3VSYA 2YFJB 1YJ93 4ORLA 3CNXA 1BSEA 3SX1A 4STDA 2F56A 3G6E3 3K5TA 4EXRA 1JBSA 1BOXA 2Q07A 1PFPA 1BSAA 2BO9B 2WOFA 4WFOA 1OH0A 1R4YA 1OF5A 2GBWB 4HAAA 1W01A 3HK4A 1I8VA 1JRQA 1VQP3 1MWRA 4CCVA 1TJDA 3F7SA 3BNBA 1TFOA 1A2KA 1EEJA 1RCLA 3FLJA 5AYRB 2B24B 1K8A4 3HI7A 5RNTA 4HZBB 3X3XA 2BMOB 3SYUA 2CX0A 1GOVA 2INXA 8CHOA 3CCV3 1VQO3 3EJVA 5I97A 1ZO2A 3HOHA 1D6ZA 4RZMA 3GZYB 5D82A 1MNLA 3S27A 1I2FA 4PEJA 3SOYA 5M18A 2Y74A 1M1XB 2F98A 2PNCA 1BANA 1Q40B 3D5IA 3B8LA 1B27A 2IUKA 3MPHA 3N8BA 3PZWA 3S28A 1CYUA 1O7HB 1DMNA 3MWZA 3CCU3 2AADA 2UX0A 2XGLA 1TTOA 3MYTA 3LYGA 1U8CB 2OOVC 3OXAA 1KQS2 5JPPA 1N9JA 4HM7B 1RNTA 2LQVA 3PGBA 1GY6A 5IENA 3WMDA 4BTXA 1N5PA 3JUOA 1UUVB 2CG1A 3NUVA 3ALAA 3HIGA 3VF1A 2C11A 4FCJA 3RGAA 3WOEB 4BL2A 1JBTA 2QEX3 1AR0A 1LOWA 1A90A 1V57A 1BSCA 1W6GA 1ULJB 2BIRA 2YFLB 4FMAA 4Q53A 3CCQ3 1VQK3 1LXEA 1DVDA 3CD63 1UDII 4N6UA 4RNTA 1FW7A 2STDA 2Z6BA 3NQZA 1YIT3 3NV0B 1GYBA 4I5QA 3KIIA 4LYLB 3AGOA 1YNVX 1OHPA 1UI8A 1A67A 1JZDA 1QAFA 2WGOA 3LTBA 3WA3A 1WNHA 1JKGB 4R1KA 3K9MC 4NREA 1YI23 1YIJ3 4GB5A 2GXFA 1JV2B 4R4KA 1DE3A 5G1LA 1O7MB 4CPKA 2P0XA 1BAOA 1LVNA 2OQEC 2HMLB 3GAXA 3EE1A 4BTYA 5AIFA 2Z77A 1LOVA 1T2HA 2GBXB 2RSXA 1VZZA 2W9PA 1YGWA 1IVXA 1HZ1A 4BL3A 1LOYA 3T0UA 4EV2A 2Z7AA 3MG2A 2O3OA 3G8ZA 3F8HA 1D6UA 1N8QA 1GSPA 2F99A 3J7Yd 1SJWA 1AQZA 3FCSB 5D81A 3G713 1B2XA 1BSDA 1QJGA 1VQQA 2KF3A 3QK9A 1ROVA 1VQ83 4K1VA 3D4AA 4HBRA 5D83A 4RNZA 4BTWA 2M7OA 3RNTA 2XEPA 1HU9A 1ULIB 2CFKA 1RHLA 2WO0A 3X3YA 2HMMB 1T2IA 3GZBA 1GMQA 1VQ63 1RGEA 1FUSA 5LC6A 1OF5B 1NNVA 1STFI 3JUPA 2OQEA 3ZG0A 3SVAA 3JVCA 2OTJ3 3KFQC 1BSBA 1BRHA 1BRSA 2V1LA 4H3UA 4IPBA 3GZRA 1V74A 3H3HA 1MGWA 3STDA 4J5KA 1RGCA 3SXXA 5ELUA 2KRTA 3ZFZA 1E3RA 3DMCA 2XF3A 3DH2A 3GSPA 4IT7A 3PS8A 4N6MA 2P09A 3F7XA 3RGRA 2F86B 3EN8A 3LTCA 5AEUB 6RNTA 5IEPA 1RLSA 1IYYA 1I3IA 3PXMA 2CFLA 1RGKA 1BNRA 5TGNA
chains in the Genus database with same CATH topology
4OUQA 1FGMA 3DY5A 1D6YA 1DYUA 3EBYA 3F9SA 4CDLA 1Q42A 3D9RA 1QMAA 3NBRA 3DGOA 2XSOB 5CXOA 1JB5A 1SQWA 4L7KA 4EC6A 2I9WA 3V98A 1K41A 4FMDA 4LGQA 3K0ZA 2E2VA 4I4KA 2W56A 3FG3A 3LH4A 4N6OB 4HM8B 1WMNA 3H51A 4U13A 3L0RA 1IQ8A 1AV4A 3K63A 1VQ53 3I553 4L8OA 3V92A 4HM4B 2FXTA 4N3VA 1MOLA 1W00A 3U97A 1OHOA 4OVMA 3DUKA 5EEOA 4H61A 3MSOA 3EN1B 2CFGA 1NB3I 3CU3A 1IVUA 3F40A 4KZ1A 1W6CA 4HM6B 3BLZA 3KSPA 3CCS3 1LOXA 3OX9A 1KSIA 3MG3A 5IERA 4IIAA 4JRFA 3G4S3 3G16A 5HGRA 1K734 1YVBI 4XBXA 2HMKB 2O9UX 1BUQA 1JN5A 3TDGA 4XB5A 3UB1A 2CFDA 4XM4A 5CF1A 1RKYA 3FF0A 5BXQA 1IU7A 3DGLA 3T8UA 1E97A 1FGOA 1OCVA 1YGEA 1UI7A 3FF2A 1G96A 1ISKA 2CIUA 4FR9A 3D3LA 2L4VA 3OWSA 1YHQ3 1JB2A 2ZL8A 1IQXA 5KP4A 3DM8A 3MG1A 4HM1B 3AMOA 3DZLA 2PZVA 4LSOA 2W9QA 1A2VA 3EQQB 2FGTA 4N6V0 2P38A 1NO3A 5CF2A 1QVG2 1W4NA 1IVVA 1S5AA 3B4OA 1GY5A 1K28A 4WWUC 4EYCA 2IA7A 1O7PB 3CXC2 1IVWA 1YIT3 4XBYA 2BMRB 1OGZA 1QAKA 1JB4A 2K0MA 3Q1CA 2OOVA 3CPW2 1TP6A 3ER7A 4HYZA 1IK3A 4MEIA 4FCZA 2CFWA 1GD4A 3CC23 1VQ93 2OTL3 3BNCA 3CCR3 3OV4A 1VQ73 2SBLA 3EC9A 1QVF2 1VQL3 1AVKA 2W2CA 1W2ZA 3F14A 3B4PA 2QIYA 1DMQA 2W56B 1WMOA 1YJW3 3S67A 1EA2A 1US1A 3E99A 4LZIA 4R9LA 1S723 3UJMA 3PCRA 2FNQA 4JF8A 5DRVA 2CWUA 3A76A 4KFFA 2D1WA 7STDA 3CC73 1FGRA 3LT8A 4X2OA 3HIIA 3JUNA 4O02B 4WHAA 3GWRA 2W6JH 3UNLA 5AYSC 5A0OB 1KC84 2K54A 1VQ43 1IV7A 3CNMA 3JUMA 2QA43 3I0YA 3SEDA 2XSHB 1N5HA 2BHMA 2ML5A 5LC7A 1TFKA 3LOYA 1EKMA 1OACA 4FMBA 3T8NA 1OHSA 4X2HA 2OCTA 3KE7A 1AVLA 1WQLB 2CWTA 3OWUA 1KD14 1Q7Y4 5IW9A 3LT9A 2IUJA 3RDEA 3CPOA 2MF7A 4NHFA 4AKZA 3NXJA 4ZM8A 1VQN3 1JN5B 3KN4A 5IG0A 3FSDA 3UL6A 1L5GB 3PYJA 2BMQB 3NX0A 4K61A 4L8PA 4WYKA 1W5ZA 2LYXA 5IG5A 2W0QA 1IDPA 1ROAA 4QWTA 2IMJA 1QALA 3CC43 4HM5B 4O8SA 2JQ5A 1STDA 3AMOB 3WDGB 3UL5A 1N9EA 2CK3H 2RGQA 3MKIA 4FCMA 4EV5A 1M1K4 5BVBA 1TIJA 5IG3A 4MJDA 1M904 1FGTA 4N6LA 1R4CA 3IPTA 1SIHA 4R9KA 3NQYA 2P0MA 3I563 4HKVB 1N8R4 5AIHA 1K9M4 2CG0A 3B7CA 3PCSA 1YJN3 1CEWI 3DGNA 1RRHA 4G1MB 1RRLA 1KWIA 2HMOB 3IMAB 1RN7A 3S5CA 4HM3B 3O8YA 2ML6A 3EX9A 3WOFB 1SPUA 3EF8A 2R4IA 3NHXA 3M8CA 4AEQA 1IT8A 3CMA3 3SLUA 1Q824 1UUWB 4K90B 1TUHA 1Q814 3BNEA 3FGYA 3IJEB 1GS3A 1OPYA 2XH9A 4N6NB 1U5OA 1WTHA 1W02A 3FZWA 3LMLA 3HZPA 4MMZB 4AKYA 2RCDA 3EBTA 4XBTA 1WMPA 2HMNB 5STDA 2Z76A 3V99A 3HX8A 1DVCA 2GU3A 2W03A 1Q864 2E2UA 3JUQA 2OWPA 5IG4A 5CLKA 3ROBA 1NB5I 1FA3A 2XFTA 3WODG 1UW1A 2HMJB 1NWWA 5FGOA 5JBSA 2XR8B 1EQKA 5ELJA 1F8NA 3LZAA 5AIGA 1JNQA 2GEXA 1W6YA 1IQYA 3X3ZA 1JJ22 2QGUA 2YFIB 3EHCA 4EBGA 2KXGA 3ECFA 1FUWA 2B1XB 2XFSA 3LTAA 3DGMA 1HKXA 4LEHA 2CKFB 2CC3A 1EG9B 4OK0A 3CCE3 3QRDA 4GL6A 1CYVA 1GD3A 5AEWB 2ZDJA 5CK6A 3LTDA 2GU1A 1NJI4 3SOAA 1LNHA 2XRXB 5AIIA 1NU3A 2BNGA 4WYKB 3N9HA 5AI1A 4J8TA 4WP5A 3FG4A 3NBBA 2D42A 1CQSA 4MMXB 3OW22 4MMYB 6STDA 3S29A 2JDIH 3DXOA 2WOHA 2GEYA 3EB8A 3U1WA 5EVHA 4FMCA 2CHCA 3GRDA 5KP1A 3OWYA 1M9GA 4J9AA 1TU5A 3MHEA 1Q40A 3X40A 3Q90A 2WGQA 3CME3 3NBJA 1C7HA 1E3VA 1ASKA 1SIIA 2Y73A 4HZ9B 5KP3A 4RNYA 4HVNA 1Z1SA 4KVHA 1J2BA 3X41A 5IEOA 3CCM3 1RJOA 4XDVA 1W2B2 1O7WB 4O3VA 2W04A 1IT7A 1OUNA 1GY7A 1OGXA 5JPUA 1ZX2A 2MC8A 2C10A 3KZTA 2BT3A 3K7CA 4HM2B 4LMIA 3WA2X 3CCL3 4HJLB 4XDWA 5IF6A 3BNDA 2KCDA 3F8XA 4K1UA 4O2HA 3NV0A 5DREA 1T5YA 3Q2PA 1W7CA 4R80A 2YX9A 1O7GB 3NM2A 2P05A 1O7NB 2CW9A 2XGNA 3N54B 1JKGA 1NDOB 5EQLA 3FKAA 2A15A 3LXUX 4TX4A 3GZXB 3KSED 5G2GA 1IV9A 3KKGA 4KFDA 3FG1A 4HM0B 2CWVA 3VGNA 1VQM3 2CH9A 1FGQA 2RFRA 4RBNA 3NM7A 2E2TA 3CCJ3 4KFEA 1Y4KA 3FH1A 3G0KA 5FW5A 3X42A 1PU4A 1DMMA 3BB9A 4N6TA 3VSYA 2YFJB 1YJ93 4ORLA 3CNXA 3SX1A 4STDA 3G6E3 3K5TA 4EXRA 2Q07A 1PFPA 2BO9B 2WOFA 4WFOA 1OH0A 1OF5A 2GBWB 1W01A 3HK4A 1JRQA 1VQP3 4CCVA 3F7SA 3BNBA 1TFOA 1A2KA 3FLJA 5AYRB 2B24B 1K8A4 3HI7A 4HZBB 3X3XA 2BMOB 8CHOA 1VQO3 2INXA 3CCV3 3EJVA 5I97A 1ZO2A 1D6ZA 4RZMA 3GZYB 5D82A 1MNLA 3S27A 4PEJA 3SOYA 2Y74A 1M1XB 2F98A 2PNCA 1Q40B 3B8LA 2IUKA 3MPHA 3N8BA 3PZWA 3S28A 1CYUA 1O7HB 1DMNA 3MWZA 3CCU3 2UX0A 2XGLA 3MYTA 3LYGA 1U8CB 2OOVC 3OXAA 1KQS2 5JPPA 1N9JA 4HM7B 2LQVA 3PGBA 1GY6A 5IENA 3WMDA 4BTXA 1N5PA 3JUOA 1UUVB 2CG1A 3NUVA 3ALAA 3HIGA 3VF1A 2C11A 4FCJA 3RGAA 3WOEB 2QEX3 1AR0A 1A90A 1W6GA 1ULJB 2YFLB 4FMAA 4Q53A 3CCQ3 1VQK3 1LXEA 1DVDA 3CD63 4N6UA 2STDA 2Z6BA 3NQZA 3NV0B 1GYBA 3KIIA 1OHPA 1UI8A 1A67A 1QAFA 2WGOA 3LTBA 3WA3A 1WNHA 1JKGB 4R1KA 3K9MC 4NREA 1YI23 1YIJ3 4GB5A 2GXFA 1JV2B 4R4KA 1O7MB 2P0XA 1LVNA 2OQEC 2HMLB 3GAXA 3EE1A 4BTYA 5AIFA 2Z77A 2GBXB 2RSXA 1VZZA 2W9PA 1IVXA 4EV2A 3T0UA 2Z7AA 3MG2A 2O3OA 3G8ZA 3F8HA 1D6UA 1N8QA 2F99A 3J7Yd 1SJWA 3FCSB 5D81A 3G713 1QJGA 3QK9A 1ROVA 1VQ83 4K1VA 4HBRA 5D83A 4RNZA 4BTWA 2M7OA 2XEPA 1HU9A 1ULIB 2CFKA 2WO0A 3X3YA 2HMMB 3GZBA 1VQ63 5LC6A 1OF5B 2OQEA 1STFI 3JUPA 3SVAA 3JVCA 2OTJ3 3KFQC 2V1LA 4H3UA 4IPBA 3GZRA 1V74A 3H3HA 3STDA 3SXXA 5ELUA 2KRTA 1E3RA 3DMCA 2XF3A 4IT7A 3PS8A 4N6MA 2P09A 3F7XA 3RGRA 2F86B 3EN8A 3LTCA 5AEUB 5IEPA 3PXMA 2CFLA 5TGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQK A;  5ELJ A;  3S67 A;  4LZI A;  2KXG A;  4CCV A;  1FUW A;  5A0O B;  1IV7 A;  1MNL A;  3QRD A;  1CYV A;  1GD3 A;  1N5H A;  5LC7 A;  3LH4 A;  4N6O B;  1CYU A;  3MWZ A;  2OCT A;  3L0R A;  1N9J A;  1MOL A;  1N5P A;  4ZM8 A;  1M9G A;  3UL6 A;  3PYJ A;  1NB3 I;  3NX0 A;  1A90 A;  1ROA A;  1LXE A;  1DVD A;  4N6U A;  3UL5 A;  1YVB I;  1A67 A;  1WNH A;  1TIJ A;  3K9M C;  2O9U X;  4N6L A;  1R4C A;  3GAX A;  1G96 A;  1CEW I;  2W9P A;  1KWI A;  3IMA B;  1RN7 A;  3Q2P A;  2W9Q A;  5EQL A;  4TX4 A;  4N6V 0;  3KSE D;  1IV9 A;  2CH9 A;  4EYC A;  4N6N B;  5LC6 A;  1STF I;  3SVA A;  1GD4 A;  3KFQ C;  1DVC A;  4N6T A;  5ELU A;  4IT7 A;  1NB5 I;  3PS8 A;  4N6M A;  1FA3 A;  3PXM A;  1PFP A;  2BO9 B; 
#chains in the Genus database with same CATH topology
 4OUQ A;  2KF6 A;  1FGM A;  1B21 A;  5G1K A;  5GSP A;  1G02 A;  1G0T A;  3DY5 A;  1D6Y A;  1DYU A;  3EBY A;  3F9S A;  4CDL A;  1Q42 A;  3D9R A;  2F5M A;  1I0X A;  1LQM B;  1QMA A;  3DGO A;  3NBR A;  1RNB A;  2XSO B;  5CXO A;  1JB5 A;  1SQW A;  4L7K A;  4EC6 A;  2AAE A;  2I9W A;  1BRJ A;  1MWS A;  3V98 A;  1K41 A;  4FMD A;  4LGQ A;  3K0Z A;  2E2V A;  1X1Y A;  4I4K A;  2W56 A;  1RGA A;  4HOH A;  3FG3 A;  3LH4 A;  1BU4 A;  4N6O B;  4HM8 B;  1WMN A;  1UUG B;  3H51 A;  4U13 A;  3L0R A;  1IQ8 A;  1AV4 A;  3K63 A;  1VQ5 3;  3I55 3;  4L8O A;  3V92 A;  4HM4 B;  2FXT A;  4N3V A;  2KF5 A;  1MOL A;  1W00 A;  3U97 A;  1BRN L;  1OHO A;  4OVM A;  3DUK A;  1BNI A;  5EEO A;  4H61 A;  3MSO A;  3EN1 B;  2CFG A;  2GSP A;  1NB3 I;  3CU3 A;  1BRG A;  1IVU A;  3BU4 A;  3F40 A;  4KZ1 A;  1W6C A;  4HM6 B;  3BLZ A;  3KSP A;  3CCS 3;  1LOX A;  3OX9 A;  1KSI A;  3MG3 A;  5IER A;  4IIA A;  4JRF A;  3G4S 3;  1RSN A;  3G16 A;  5HGR A;  1BIR A;  1YVB I;  3D79 A;  4XBX A;  2HMK B;  1K73 4;  3WR2 A;  2O9U X;  1BUQ A;  1MGR A;  1MWU A;  1ZGX A;  1JN5 A;  3TDG A;  4XB5 A;  3UB1 A;  2CFD A;  4XM4 A;  5CF1 A;  1DET A;  1RKY A;  3FF0 A;  5BXQ A;  1IU7 A;  3DGL A;  3T8U A;  1UCJ A;  1BRI A;  1E97 A;  1FGO A;  1OCV A;  1YVS A;  1UI7 A;  1YGE A;  1FYS A;  1G96 A;  3FF2 A;  1ISK A;  2CIU A;  4FR9 A;  1MWT A;  3D3L A;  2L4V A;  3OWS A;  1YHQ 3;  1JB2 A;  2ZL8 A;  1IQX A;  5KP4 A;  3DM8 A;  3MG1 A;  1RCK A;  4HM1 B;  3AMO A;  3ZG5 A;  3DZL A;  2PZV A;  4LSO A;  1LRA A;  2W9Q A;  1A2V A;  3EQQ B;  2FGT A;  4N6V 0;  8RNT A;  9RNT A;  2P38 A;  2HOH A;  1NO3 A;  5CF2 A;  1QVG 2;  1B2S A;  1W4N A;  1IVV A;  1S5A A;  2BU4 A;  2C4B A;  1GY5 A;  1BNJ A;  1K28 A;  3B4O A;  4WWU C;  2IA7 A;  1O7P B;  4EYC A;  1IVW A;  3CXC 2;  4XBY A;  3A5E A;  2BMR B;  1OGZ A;  1QAK A;  1GOY A;  1JB4 A;  2K0M A;  3Q1C A;  1V58 A;  2OOV A;  3CPW 2;  1TP6 A;  1A2P A;  3ER7 A;  4HYZ A;  1IK3 A;  4MEI A;  4FCZ A;  2CFW A;  1GD4 A;  1AY7 A;  1Q7H A;  3CC2 3;  1VQ9 3;  1BUJ A;  1RGL A;  2OTL 3;  3BNC A;  3CCR 3;  1B3S A;  3OV4 A;  1FUT A;  1VQ7 3;  2SBL A;  3EC9 A;  1BRK A;  4DKI A;  1QVF 2;  1VQL 3;  1AVK A;  2W2C A;  1W2Z A;  3F14 A;  1RTU A;  3B4P A;  2QIY A;  1DMQ A;  2KF4 A;  1WMO A;  2W56 B;  1YJW 3;  3S67 A;  1EA2 A;  1I0V A;  1US1 A;  3E99 A;  4LZI A;  4R9L A;  5M1A A;  3UJM A;  1S72 3;  5BIR A;  3PCR A;  2FNQ A;  4JF8 A;  5DRV A;  2CWU A;  3A76 A;  4KFF A;  2ZHX B;  2D1W A;  7STD A;  1GMR A;  1FGR A;  3CC7 3;  3LT8 A;  4X2O A;  3HII A;  3JUN A;  4O02 B;  4WHA A;  3GWR A;  2W6J H;  3UNL A;  5AYS C;  5A0O B;  1KC8 4;  2K54 A;  1VQ4 3;  1IV7 A;  3CNM A;  3JUM A;  2QA4 3;  3I0Y A;  3SED A;  2XSH B;  1N5H A;  2BHM A;  3URP A;  3AGN A;  2ML5 A;  5LC7 A;  1TFK A;  3LOY A;  1EKM A;  1OAC A;  4FMB A;  1X1W A;  1OHS A;  3T8N A;  4X2H A;  2OCT A;  7GSP A;  3KE7 A;  1AVL A;  1WQL B;  2CWT A;  3OWU A;  1KD1 4;  1Q7Y 4;  5IW9 A;  2H0G A;  3LT9 A;  2IUJ A;  4ILF A;  3RDE A;  3CPO A;  2MF7 A;  4NHF A;  1UGH I;  4AKZ A;  3NXJ A;  4ZM8 A;  2F4Y A;  2SAR A;  3WHO A;  1VQN 3;  1JN5 B;  3BIR A;  1I2E A;  1EUI C;  3FSD A;  3KN4 A;  5IG0 A;  3PYJ A;  1L5G B;  2BMQ B;  3UL6 A;  3NX0 A;  4K61 A;  4L8P A;  4WYK A;  1W5Z A;  2LYX A;  5IG5 A;  2W0Q A;  1IDP A;  1ROA A;  3D5G A;  1JZO A;  1PYL A;  4QWT A;  2IMJ A;  1QAL A;  1BNS A;  3CC4 3;  4HM5 B;  4O8S A;  2JQ5 A;  1I3F A;  1STD A;  3AMO B;  3UL5 A;  3WDG B;  1N9E A;  2CK3 H;  2RGQ A;  3MKI A;  4FCM A;  4EV5 A;  1M1K 4;  5BVB A;  1TIJ A;  5IG3 A;  4BU4 A;  4MJD A;  1M90 4;  1FGT A;  1GMP A;  1RDS A;  4N6L A;  1R4C A;  3IPT A;  1SIH A;  4R9K A;  3NQY A;  2P0M A;  3I56 3;  4HKV B;  1N8R 4;  5AIH A;  1K9M 4;  2CG0 A;  3B7C A;  3PCS A;  1YJN 3;  1CEW I;  3DGN A;  2K3D A;  4J5G A;  1RRH A;  4G1M B;  1RRL A;  1KWI A;  2HMO B;  3IMA B;  1RN7 A;  3S5C A;  4HM3 B;  4BIR A;  6GSP A;  3O8Y A;  2ML6 A;  3EX9 A;  3WOF B;  1SPU A;  2H0H A;  3EF8 A;  2R4I A;  3NHX A;  3M8C A;  1HYF A;  4AEQ A;  1IT8 A;  3CMA 3;  3SLU A;  1Q82 4;  1UUW B;  4K90 B;  1BNG A;  1TUH A;  1GOU A;  2L1S A;  3BNE A;  1Q81 4;  3FGY A;  3IJE B;  1GS3 A;  3Q3F A;  1PY3 A;  1OPY A;  2XH9 A;  1X1X A;  4N6N B;  1U5O A;  1WTH A;  1B2Z A;  1LNI A;  1W02 A;  3FZW A;  1RMS A;  3HZP A;  3LML A;  4MMZ B;  4AKY A;  2RCD A;  3EBT A;  4XBT A;  1WMP A;  2HMN B;  5STD A;  2Z76 A;  3V99 A;  3HX8 A;  1DVC A;  2GU3 A;  2W03 A;  1Q86 4;  2E2U A;  3JUQ A;  2OWP A;  5IG4 A;  5CLK A;  3ROB A;  3AHS A;  2UUG C;  1NB5 I;  1FA3 A;  2XFT A;  3WOD G;  1UW1 A;  2HMJ B;  1NWW A;  1RN4 A;  1BGS A;  5FGO A;  5JBS A;  2XR8 B;  1FZU A;  1SAR A;  1Q9E A;  3DGY A;  1BNF A;  1EQK A;  5ELJ A;  1F8N A;  1LQG C;  1UCI A;  3LZA A;  5AIG A;  1TRP A;  1JNQ A;  2GEX A;  1W6Y A;  1IQY A;  3X3Z A;  1JJ2 2;  2QGU A;  2YFI B;  3EHC A;  4EBG A;  1BNE A;  2KXG A;  3ECF A;  1FUW A;  1TRQ A;  1RGF A;  1RGG A;  2B1X B;  2XFS A;  3LTA A;  3DGM A;  1HKX A;  4LEH A;  2CKF B;  1UGI A;  2CC3 A;  1EG9 B;  4NPB A;  4OK0 A;  3CCE 3;  1UCL A;  3QRD A;  2IYJ A;  4GL6 A;  1CYV A;  1GD3 A;  5AEW B;  2KAA A;  2ZDJ A;  4CJN A;  3AHW A;  3LTD A;  5CK6 A;  2GU1 A;  1I2G A;  2ZA4 A;  3SOA A;  1LNH A;  2XRX B;  5AII A;  1NJI 4;  1NU3 A;  2BNG A;  4WYK B;  5BU4 A;  3N9H A;  5AI1 A;  4J8T A;  4WP5 A;  3FG4 A;  3NBB A;  2D42 A;  1CQS A;  2RBI A;  2J8X B;  4MMX B;  3OW2 2;  4MMY B;  6STD A;  3KCH A;  3S29 A;  2JDI H;  3DXO A;  2WOH A;  2GEY A;  1RN1 A;  3EB8 A;  5EVH A;  4FMC A;  3U1W A;  2CHC A;  2IY2 A;  3GRD A;  5KP1 A;  3OWY A;  1M9G A;  4J9A A;  1TU5 A;  3MHE A;  1Q40 A;  3X40 A;  3Q90 A;  2WGQ A;  3CME 3;  3NBJ A;  1C7H A;  1E3V A;  1ASK A;  1I70 A;  1SII A;  2Y73 A;  4HZ9 B;  5KP3 A;  4RNY A;  4HVN A;  1Z1S A;  4KVH A;  1J2B A;  3X41 A;  5IEO A;  3CCM 3;  1RJO A;  4XDV A;  1W2B 2;  1O7W B;  4O3V A;  2W04 A;  1IT7 A;  1OUN A;  1GY7 A;  1OGX A;  1UCK A;  1ZX2 A;  5JPU A;  2MC8 A;  5M19 A;  2C10 A;  3KZT A;  2BT3 A;  3K7C A;  4HM2 B;  4LMI A;  3WA2 X;  4EW5 A;  3CCL 3;  4HJL B;  4GHO A;  4XDW A;  5IF6 A;  1X1U A;  3BND A;  2KCD A;  3F8X A;  4K1U A;  4O2H A;  3NV0 A;  5DRE A;  1T5Y A;  3Q2P A;  1W7C A;  4R80 A;  1B2M A;  2YX9 A;  1O7G B;  3NM2 A;  4KT3 B;  1O7N B;  2CW9 A;  2P05 A;  1BVI A;  2XGN A;  3N54 B;  1JKG A;  1NDO B;  4GSP A;  1B20 A;  5EQL A;  3FKA A;  1JBR A;  2A15 A;  3LXU X;  4TX4 A;  3GZX B;  3KSE D;  5G2G A;  1IV9 A;  1C54 A;  3KKG A;  4KFD A;  2RNT A;  3FG1 A;  4HM0 B;  2CWV A;  3VGN A;  1VQM 3;  2CH9 A;  1FGQ A;  2RFR A;  2F5W A;  2R41 A;  4RBN A;  1RGH A;  1CH0 A;  2H0I A;  3NM7 A;  2E2T A;  1T3B A;  3CCJ 3;  4KFE A;  1B2U A;  1Y4K A;  2CX1 A;  3FH1 A;  7RNT A;  3G0K A;  2UGI A;  5FW5 A;  3X42 A;  1PU4 A;  5HOH A;  1DMM A;  1ZS7 A;  3BB9 A;  4N6T A;  3VSY A;  2YFJ B;  1YJ9 3;  4ORL A;  3CNX A;  1BSE A;  3SX1 A;  4STD A;  2F56 A;  3G6E 3;  3K5T A;  4EXR A;  1JBS A;  1BOX A;  2Q07 A;  1PFP A;  1BSA A;  2BO9 B;  2WOF A;  4WFO A;  1OH0 A;  1R4Y A;  1OF5 A;  2GBW B;  4HAA A;  1W01 A;  3HK4 A;  1I8V A;  1JRQ A;  1VQP 3;  1MWR A;  4CCV A;  1TJD A;  3F7S A;  3BNB A;  1TFO A;  1A2K A;  1EEJ A;  1RCL A;  3FLJ A;  5AYR B;  2B24 B;  1K8A 4;  3HI7 A;  5RNT A;  4HZB B;  3X3X A;  2BMO B;  3SYU A;  2CX0 A;  1GOV A;  2INX A;  8CHO A;  3CCV 3;  1VQO 3;  3EJV A;  5I97 A;  1ZO2 A;  3HOH A;  1D6Z A;  4RZM A;  3GZY B;  5D82 A;  1MNL A;  3S27 A;  1I2F A;  4PEJ A;  3SOY A;  5M18 A;  2Y74 A;  1M1X B;  2F98 A;  2PNC A;  1BAN A;  1Q40 B;  3D5I A;  3B8L A;  1B27 A;  2IUK A;  3MPH A;  3N8B A;  3PZW A;  3S28 A;  1CYU A;  1O7H B;  1DMN A;  3MWZ A;  3CCU 3;  2AAD A;  2UX0 A;  2XGL A;  1TTO A;  3MYT A;  3LYG A;  1U8C B;  2OOV C;  3OXA A;  1KQS 2;  5JPP A;  1N9J A;  4HM7 B;  1RNT A;  2LQV A;  3PGB A;  1GY6 A;  5IEN A;  3WMD A;  4BTX A;  1N5P A;  3JUO A;  1UUV B;  2CG1 A;  3NUV A;  3ALA A;  3HIG A;  3VF1 A;  2C11 A;  4FCJ A;  3RGA A;  3WOE B;  4BL2 A;  1JBT A;  2QEX 3;  1AR0 A;  1LOW A;  1A90 A;  1V57 A;  1BSC A;  1W6G A;  1ULJ B;  2BIR A;  2YFL B;  4FMA A;  4Q53 A;  3CCQ 3;  1VQK 3;  1LXE A;  1DVD A;  3CD6 3;  1UDI I;  4N6U A;  4RNT A;  1FW7 A;  2STD A;  2Z6B A;  3NQZ A;  1YIT 3;  3NV0 B;  1GYB A;  4I5Q A;  3KII A;  4LYL B;  3AGO A;  1YNV X;  1OHP A;  1UI8 A;  1A67 A;  1JZD A;  1QAF A;  2WGO A;  3LTB A;  3WA3 A;  1WNH A;  1JKG B;  4R1K A;  3K9M C;  4NRE A;  1YI2 3;  1YIJ 3;  4GB5 A;  2GXF A;  1JV2 B;  4R4K A;  1DE3 A;  5G1L A;  1O7M B;  4CPK A;  2P0X A;  1BAO A;  1LVN A;  2OQE C;  2HML B;  3GAX A;  3EE1 A;  4BTY A;  5AIF A;  2Z77 A;  1LOV A;  1T2H A;  2GBX B;  2RSX A;  1VZZ A;  2W9P A;  1YGW A;  1IVX A;  1HZ1 A;  4BL3 A;  1LOY A;  3T0U A;  4EV2 A;  2Z7A A;  3MG2 A;  2O3O A;  3G8Z A;  3F8H A;  1D6U A;  1N8Q A;  1GSP A;  2F99 A;  3J7Y d;  1SJW A;  1AQZ A;  3FCS B;  5D81 A;  3G71 3;  1B2X A;  1BSD A;  1QJG A;  1VQQ A;  2KF3 A;  3QK9 A;  1ROV A;  1VQ8 3;  4K1V A;  3D4A A;  4HBR A;  5D83 A;  4RNZ A;  4BTW A;  2M7O A;  3RNT A;  2XEP A;  1HU9 A;  1ULI B;  2CFK A;  1RHL A;  2WO0 A;  3X3Y A;  2HMM B;  1T2I A;  3GZB A;  1GMQ A;  1VQ6 3;  1RGE A;  1FUS A;  5LC6 A;  1OF5 B;  1NNV A;  1STF I;  3JUP A;  2OQE A;  3ZG0 A;  3SVA A;  3JVC A;  2OTJ 3;  3KFQ C;  1BSB A;  1BRH A;  1BRS A;  2V1L A;  4H3U A;  4IPB A;  3GZR A;  1V74 A;  3H3H A;  1MGW A;  3STD A;  4J5K A;  1RGC A;  3SXX A;  5ELU A;  2KRT A;  3ZFZ A;  1E3R A;  3DMC A;  2XF3 A;  3DH2 A;  3GSP A;  4IT7 A;  3PS8 A;  4N6M A;  2P09 A;  3F7X A;  3RGR A;  2F86 B;  3EN8 A;  3LTC A;  5AEU B;  6RNT A;  5IEP A;  1RLS A;  1IYY A;  1I3I A;  3PXM A;  2CFL A;  1RGK A;  1BNR A;  5TGN A; 
#chains in the Genus database with same CATH homology
 4OUQ A;  1FGM A;  3DY5 A;  1D6Y A;  1DYU A;  3EBY A;  3F9S A;  4CDL A;  1Q42 A;  3D9R A;  1QMA A;  3NBR A;  3DGO A;  2XSO B;  5CXO A;  1JB5 A;  1SQW A;  4L7K A;  4EC6 A;  2I9W A;  3V98 A;  1K41 A;  4FMD A;  4LGQ A;  3K0Z A;  2E2V A;  4I4K A;  2W56 A;  3FG3 A;  3LH4 A;  4N6O B;  4HM8 B;  1WMN A;  3H51 A;  4U13 A;  3L0R A;  1IQ8 A;  1AV4 A;  3K63 A;  1VQ5 3;  3I55 3;  4L8O A;  3V92 A;  4HM4 B;  2FXT A;  4N3V A;  1MOL A;  1W00 A;  3U97 A;  1OHO A;  4OVM A;  3DUK A;  5EEO A;  4H61 A;  3MSO A;  3EN1 B;  2CFG A;  1NB3 I;  3CU3 A;  1IVU A;  3F40 A;  4KZ1 A;  1W6C A;  4HM6 B;  3BLZ A;  3KSP A;  3CCS 3;  1LOX A;  3OX9 A;  1KSI A;  3MG3 A;  5IER A;  4IIA A;  4JRF A;  3G4S 3;  3G16 A;  5HGR A;  1K73 4;  1YVB I;  4XBX A;  2HMK B;  2O9U X;  1BUQ A;  1JN5 A;  3TDG A;  4XB5 A;  3UB1 A;  2CFD A;  4XM4 A;  5CF1 A;  1RKY A;  3FF0 A;  5BXQ A;  1IU7 A;  3DGL A;  3T8U A;  1E97 A;  1FGO A;  1OCV A;  1YGE A;  1UI7 A;  3FF2 A;  1G96 A;  1ISK A;  2CIU A;  4FR9 A;  3D3L A;  2L4V A;  3OWS A;  1YHQ 3;  1JB2 A;  2ZL8 A;  1IQX A;  5KP4 A;  3DM8 A;  3MG1 A;  4HM1 B;  3AMO A;  3DZL A;  2PZV A;  4LSO A;  2W9Q A;  1A2V A;  3EQQ B;  2FGT A;  4N6V 0;  2P38 A;  1NO3 A;  5CF2 A;  1QVG 2;  1W4N A;  1IVV A;  1S5A A;  3B4O A;  1GY5 A;  1K28 A;  4WWU C;  4EYC A;  2IA7 A;  1O7P B;  3CXC 2;  1IVW A;  1YIT 3;  4XBY A;  2BMR B;  1OGZ A;  1QAK A;  1JB4 A;  2K0M A;  3Q1C A;  2OOV A;  3CPW 2;  1TP6 A;  3ER7 A;  4HYZ A;  1IK3 A;  4MEI A;  4FCZ A;  2CFW A;  1GD4 A;  3CC2 3;  1VQ9 3;  2OTL 3;  3BNC A;  3CCR 3;  3OV4 A;  1VQ7 3;  2SBL A;  3EC9 A;  1QVF 2;  1VQL 3;  1AVK A;  2W2C A;  1W2Z A;  3F14 A;  3B4P A;  2QIY A;  1DMQ A;  2W56 B;  1WMO A;  1YJW 3;  3S67 A;  1EA2 A;  1US1 A;  3E99 A;  4LZI A;  4R9L A;  1S72 3;  3UJM A;  3PCR A;  2FNQ A;  4JF8 A;  5DRV A;  2CWU A;  3A76 A;  4KFF A;  2D1W A;  7STD A;  3CC7 3;  1FGR A;  3LT8 A;  4X2O A;  3HII A;  3JUN A;  4O02 B;  4WHA A;  3GWR A;  2W6J H;  3UNL A;  5AYS C;  5A0O B;  1KC8 4;  2K54 A;  1VQ4 3;  1IV7 A;  3CNM A;  3JUM A;  2QA4 3;  3I0Y A;  3SED A;  2XSH B;  1N5H A;  2BHM A;  2ML5 A;  5LC7 A;  1TFK A;  3LOY A;  1EKM A;  1OAC A;  4FMB A;  3T8N A;  1OHS A;  4X2H A;  2OCT A;  3KE7 A;  1AVL A;  1WQL B;  2CWT A;  3OWU A;  1KD1 4;  1Q7Y 4;  5IW9 A;  3LT9 A;  2IUJ A;  3RDE A;  3CPO A;  2MF7 A;  4NHF A;  4AKZ A;  3NXJ A;  4ZM8 A;  1VQN 3;  1JN5 B;  3KN4 A;  5IG0 A;  3FSD A;  3UL6 A;  1L5G B;  3PYJ A;  2BMQ B;  3NX0 A;  4K61 A;  4L8P A;  4WYK A;  1W5Z A;  2LYX A;  5IG5 A;  2W0Q A;  1IDP A;  1ROA A;  4QWT A;  2IMJ A;  1QAL A;  3CC4 3;  4HM5 B;  4O8S A;  2JQ5 A;  1STD A;  3AMO B;  3WDG B;  3UL5 A;  1N9E A;  2CK3 H;  2RGQ A;  3MKI A;  4FCM A;  4EV5 A;  1M1K 4;  5BVB A;  1TIJ A;  5IG3 A;  4MJD A;  1M90 4;  1FGT A;  4N6L A;  1R4C A;  3IPT A;  1SIH A;  4R9K A;  3NQY A;  2P0M A;  3I56 3;  4HKV B;  1N8R 4;  5AIH A;  1K9M 4;  2CG0 A;  3B7C A;  3PCS A;  1YJN 3;  1CEW I;  3DGN A;  1RRH A;  4G1M B;  1RRL A;  1KWI A;  2HMO B;  3IMA B;  1RN7 A;  3S5C A;  4HM3 B;  3O8Y A;  2ML6 A;  3EX9 A;  3WOF B;  1SPU A;  3EF8 A;  2R4I A;  3NHX A;  3M8C A;  4AEQ A;  1IT8 A;  3CMA 3;  3SLU A;  1Q82 4;  1UUW B;  4K90 B;  1TUH A;  1Q81 4;  3BNE A;  3FGY A;  3IJE B;  1GS3 A;  1OPY A;  2XH9 A;  4N6N B;  1U5O A;  1WTH A;  1W02 A;  3FZW A;  3LML A;  3HZP A;  4MMZ B;  4AKY A;  2RCD A;  3EBT A;  4XBT A;  1WMP A;  2HMN B;  5STD A;  2Z76 A;  3V99 A;  3HX8 A;  1DVC A;  2GU3 A;  2W03 A;  1Q86 4;  2E2U A;  3JUQ A;  2OWP A;  5IG4 A;  5CLK A;  3ROB A;  1NB5 I;  1FA3 A;  2XFT A;  3WOD G;  1UW1 A;  2HMJ B;  1NWW A;  5FGO A;  5JBS A;  2XR8 B;  1EQK A;  5ELJ A;  1F8N A;  3LZA A;  5AIG A;  1JNQ A;  2GEX A;  1W6Y A;  1IQY A;  3X3Z A;  1JJ2 2;  2QGU A;  2YFI B;  3EHC A;  4EBG A;  2KXG A;  3ECF A;  1FUW A;  2B1X B;  2XFS A;  3LTA A;  3DGM A;  1HKX A;  4LEH A;  2CKF B;  2CC3 A;  1EG9 B;  4OK0 A;  3CCE 3;  3QRD A;  4GL6 A;  1CYV A;  1GD3 A;  5AEW B;  2ZDJ A;  5CK6 A;  3LTD A;  2GU1 A;  1NJI 4;  3SOA A;  1LNH A;  2XRX B;  5AII A;  1NU3 A;  2BNG A;  4WYK B;  3N9H A;  5AI1 A;  4J8T A;  4WP5 A;  3FG4 A;  3NBB A;  2D42 A;  1CQS A;  4MMX B;  3OW2 2;  4MMY B;  6STD A;  3S29 A;  2JDI H;  3DXO A;  2WOH A;  2GEY A;  3EB8 A;  3U1W A;  5EVH A;  4FMC A;  2CHC A;  3GRD A;  5KP1 A;  3OWY A;  1M9G A;  4J9A A;  1TU5 A;  3MHE A;  1Q40 A;  3X40 A;  3Q90 A;  2WGQ A;  3CME 3;  3NBJ A;  1C7H A;  1E3V A;  1ASK A;  1SII A;  2Y73 A;  4HZ9 B;  5KP3 A;  4RNY A;  4HVN A;  1Z1S A;  4KVH A;  1J2B A;  3X41 A;  5IEO A;  3CCM 3;  1RJO A;  4XDV A;  1W2B 2;  1O7W B;  4O3V A;  2W04 A;  1IT7 A;  1OUN A;  1GY7 A;  1OGX A;  5JPU A;  1ZX2 A;  2MC8 A;  2C10 A;  3KZT A;  2BT3 A;  3K7C A;  4HM2 B;  4LMI A;  3WA2 X;  3CCL 3;  4HJL B;  4XDW A;  5IF6 A;  3BND A;  2KCD A;  3F8X A;  4K1U A;  4O2H A;  3NV0 A;  5DRE A;  1T5Y A;  3Q2P A;  1W7C A;  4R80 A;  2YX9 A;  1O7G B;  3NM2 A;  2P05 A;  1O7N B;  2CW9 A;  2XGN A;  3N54 B;  1JKG A;  1NDO B;  5EQL A;  3FKA A;  2A15 A;  3LXU X;  4TX4 A;  3GZX B;  3KSE D;  5G2G A;  1IV9 A;  3KKG A;  4KFD A;  3FG1 A;  4HM0 B;  2CWV A;  3VGN A;  1VQM 3;  2CH9 A;  1FGQ A;  2RFR A;  4RBN A;  3NM7 A;  2E2T A;  3CCJ 3;  4KFE A;  1Y4K A;  3FH1 A;  3G0K A;  5FW5 A;  3X42 A;  1PU4 A;  1DMM A;  3BB9 A;  4N6T A;  3VSY A;  2YFJ B;  1YJ9 3;  4ORL A;  3CNX A;  3SX1 A;  4STD A;  3G6E 3;  3K5T A;  4EXR A;  2Q07 A;  1PFP A;  2BO9 B;  2WOF A;  4WFO A;  1OH0 A;  1OF5 A;  2GBW B;  1W01 A;  3HK4 A;  1JRQ A;  1VQP 3;  4CCV A;  3F7S A;  3BNB A;  1TFO A;  1A2K A;  3FLJ A;  5AYR B;  2B24 B;  1K8A 4;  3HI7 A;  4HZB B;  3X3X A;  2BMO B;  8CHO A;  1VQO 3;  2INX A;  3CCV 3;  3EJV A;  5I97 A;  1ZO2 A;  1D6Z A;  4RZM A;  3GZY B;  5D82 A;  1MNL A;  3S27 A;  4PEJ A;  3SOY A;  2Y74 A;  1M1X B;  2F98 A;  2PNC A;  1Q40 B;  3B8L A;  2IUK A;  3MPH A;  3N8B A;  3PZW A;  3S28 A;  1CYU A;  1O7H B;  1DMN A;  3MWZ A;  3CCU 3;  2UX0 A;  2XGL A;  3MYT A;  3LYG A;  1U8C B;  2OOV C;  3OXA A;  1KQS 2;  5JPP A;  1N9J A;  4HM7 B;  2LQV A;  3PGB A;  1GY6 A;  5IEN A;  3WMD A;  4BTX A;  1N5P A;  3JUO A;  1UUV B;  2CG1 A;  3NUV A;  3ALA A;  3HIG A;  3VF1 A;  2C11 A;  4FCJ A;  3RGA A;  3WOE B;  2QEX 3;  1AR0 A;  1A90 A;  1W6G A;  1ULJ B;  2YFL B;  4FMA A;  4Q53 A;  3CCQ 3;  1VQK 3;  1LXE A;  1DVD A;  3CD6 3;  4N6U A;  2STD A;  2Z6B A;  3NQZ A;  3NV0 B;  1GYB A;  3KII A;  1OHP A;  1UI8 A;  1A67 A;  1QAF A;  2WGO A;  3LTB A;  3WA3 A;  1WNH A;  1JKG B;  4R1K A;  3K9M C;  4NRE A;  1YI2 3;  1YIJ 3;  4GB5 A;  2GXF A;  1JV2 B;  4R4K A;  1O7M B;  2P0X A;  1LVN A;  2OQE C;  2HML B;  3GAX A;  3EE1 A;  4BTY A;  5AIF A;  2Z77 A;  2GBX B;  2RSX A;  1VZZ A;  2W9P A;  1IVX A;  4EV2 A;  3T0U A;  2Z7A A;  3MG2 A;  2O3O A;  3G8Z A;  3F8H A;  1D6U A;  1N8Q A;  2F99 A;  3J7Y d;  1SJW A;  3FCS B;  5D81 A;  3G71 3;  1QJG A;  3QK9 A;  1ROV A;  1VQ8 3;  4K1V A;  4HBR A;  5D83 A;  4RNZ A;  4BTW A;  2M7O A;  2XEP A;  1HU9 A;  1ULI B;  2CFK A;  2WO0 A;  3X3Y A;  2HMM B;  3GZB A;  1VQ6 3;  5LC6 A;  1OF5 B;  2OQE A;  1STF I;  3JUP A;  3SVA A;  3JVC A;  2OTJ 3;  3KFQ C;  2V1L A;  4H3U A;  4IPB A;  3GZR A;  1V74 A;  3H3H A;  3STD A;  3SXX A;  5ELU A;  2KRT A;  1E3R A;  3DMC A;  2XF3 A;  4IT7 A;  3PS8 A;  4N6M A;  2P09 A;  3F7X A;  3RGR A;  2F86 B;  3EN8 A;  3LTC A;  5AEU B;  5IEP A;  3PXM A;  2CFL A;  5TGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...