2W9QA

Crystal structure of potato multicystatin-p212121
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Solanum Tuberosum Multicystatin and its Structural Comparison with Other Cystatins.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase inhibitor
molecule keywords MULTICYSTATIN
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w9qA00
5A0OB 4N6MA 5ELJA 1WNHA 1R4CA 3KSED 3Q2PA 4N6LA 4N6TA 1KWIA 2KXGA 1CEWI 1DVCA 2CH9A 1GD4A 2O9UX 3PS8A 1N5HA 3UL6A 1FUWA 1M9GA 1DVDA 1NB5I 1A90A 3NX0A 2W9QA 1EQKA 1PFPA 1TIJA 3MWZA 4N6V0 1GD3A 3K9MC 3QRDA 1G96A 4N6OB 1MNLA 3SVAA 3LH4A 1YVBI 4N6UA 4EYCA 2OCTA 1IV7A 1CYVA 3PYJA 1IV9A 3IMAB 1ROAA 5EQLA 3GAXA 5ELUA 1NB3I 1A67A 1RN7A 1LXEA 1N9JA 3UL5A 2W9PA 3S67A 3KFQC 1N5PA 2BO9B 5LC7A 4LZIA 4N6NB 3L0RA 5LC6A 4ZM8A 3PXMA 1STFI 4IT7A 4CCVA 1FA3A 1CYUA 4TX4A 1MOLA
chains in the Genus database with same CATH superfamily
1B3SA 3NV0A 3WR2A 5A0OB 1YGWA 2B24B 1WNHA 3BLZA 5KP1A 4HM3B 1FGMA 4BTWA 1RNBA 3CCS3 1BRIA 2R41A 3LTBA 4IPBA 4LEHA 1NO3A 1D6ZA 4FMBA 1O7NB 3X3ZA 3DGLA 1ZO2A 4MEIA 6STDA 4J5KA 3EB8A 3OWYA 3CMA3 1QAKA 1IT8A 2P09A 1MGRA 1BU4A 4EXRA 2FNQA 3DMCA 3S67A 1JB4A 1YI23 4MJDA 1RCKA 3WODG 4L8PA 2F98A 2SARA 3F8HA 1FGTA 1OF5A 3GZRA 2GBWB 1JRQA 3CNXA 4K1VA 1CH0A 3LXUX 2W56B 1BSAA 2CH9A 2O9UX 2W0QA 2OWPA 2R4IA 1N5HA 3CPOA 3G8ZA 5TGNA 3V99A 3X41A 1EA2A 1GOVA 1GD3A 3QK9A 4R80A 1T5YA 5AEWB 1VQ63 4WHAA 2PNCA 4KFFA 1D6YA 1SPUA 4PEJA 5CK6A 3GZBA 2H0HA 2OQEC 4BL3A 5EEOA 5M19A 2XGNA 1ROVA 1B2ZA 1IQXA 4XBXA 1DMNA 3LOYA 2KF3A 2RSXA 1EG9B 1FGOA 1ZS7A 1LNIA 4RBNA 2MC8A 3FF2A 1JBRA 3KKGA 3KSED 1R4CA 3F40A 3BB9A 1Q7Y4 2KXGA 3HI7A 4EC6A 1VZZA 1W6YA 1GD4A 1E3VA 3CCQ3 1M1K4 1RJOA 4XB5A 3KZTA 1OGXA 3FF0A 1W6GA 5KP4A 3K7CA 3G713 1TU5A 5BVBA 2CFGA 1KD14 5JPUA 2XSOB 1GMPA 1FZUA 1TTOA 1UGHI 3J7Yd 3ZG5A 3UB1A 1JNQA 4LSOA 3N8BA 1WTHA 3EN8A 5CF1A 2IUJA 1VQO3 2K3DA 2LYXA 2XH9A 5LC7A 1OACA 1BRNL 1YIT3 4HKVB 4HM7B 1BGSA 5HOHA 2E2TA 1BNFA 3NQZA 4TX4A 3CCE3 1UUWB 3CNMA 7GSPA 3AMOB 3JVCA 1C7HA 1A2VA 1RGLA 1UUGB 3PS8A 3CXC2 1A2PA 1BSEA 3A5EA 1A90A 4HM1B 5IG4A 4LGQA 4WYKB 1VQ73 1UI7A 1TIJA 3MWZA 3SOAA 1RMSA 4HM2B 3CCL3 1Z1SA 3D9RA 2C4BA 1G96A 1RGCA 3HX8A 4N6OB 3LH4A 3CCR3 1AR0A 4OVMA 1JB5A 3EJVA 3FKAA 2YFIB 4KZ1A 2GSPA 1OCVA 2INXA 3DGOA 1I70A 5IG3A 1QAFA 3BNEA 1W6CA 1QJGA 3FZWA 3UL5A 3KFQC 3F7XA 4KVHA 2W04A 1IVWA 3OWSA 3NUVA 3SLUA 4QWTA 1NU3A 2A15A 4KFEA 1U5OA 2WOFA 1UI8A 2KAAA 3BNBA 5CLKA 1GYBA 2H0GA 3AHWA 4R9LA 1NDOB 5D83A 3OW22 1X1YA 3SX1A 3NM2A 2WGOA 5IG5A 2FXTA 3MKIA 1WMOA 1W2ZA 3PGBA 3OXAA 3LT8A 4FMAA 3UNLA 8CHOA 1JB2A 1LVNA 1MGWA 1PFPA 3K9MC 3QRDA 4NPBA 1K734 4RZMA 2D1WA 3MHEA 5AYRB 5IEPA 2Z76A 2ML5A 1RLSA 2BT3A 3WMDA 2OQEA 1B20A 3WA3A 3JUQA 4HM5B 2GEXA 3FG1A 1D6UA 1RRHA 2HMKB 1E3RA 3JUMA 1BNIA 2M7OA 1VQL3 1IT7A 2BO9B 2V1LA 3T8UA 1S723 1W02A 1B2XA 2W56A 1UCLA 1B27A 3CD63 1JV2B 1RGKA 1K41A 1STFI 4GB5A 3STDA 2RNTA 2WO0A 3SEDA 1YJ93 1B2SA 1LOVA 1FUSA 4G1MB 4NREA 1N9EA 5ELJA 5AYSC 1I2EA 2D42A 4FR9A 1K9M4 2CWTA 2OOVA 4R1KA 1UGIA 1PU4A 1YJW3 5D82A 4O3VA 1JZDA 3EX9A 3K63A 3CCU3 3ALAA 3Q90A 8RNTA 1T2HA 2ZA4A 1I3IA 1WQLB 1EUIC 1Q7HA 3EHCA 2CC3A 2XGLA 1TFKA 1ZGXA 1FGQA 1O7GB 1F8NA 1QMAA 3ZFZA 2KF5A 1LQMB 2E2VA 3FLJA 2YX9A 3IMAB 5G1KA 3ECFA 2BIRA 1JBSA 1X1WA 4RNZA 3VSYA 1UCIA 3GAXA 1BSBA 1JN5A 1Q40A 3AGNA 3LTDA 2CX1A 2L4VA 3D5IA 4N6NB 4BIRA 1HYFA 3FH1A 1HKXA 4Q53A 2C11A 3D3LA 1ULJB 1I0XA 1L5GB 3HOHA 1E97A 4DKIA 4BL2A 3EF8A 1BRHA 2STDA 1GY5A 2IY2A 4O2HA 4X2HA 1AVKA 1RGEA 2W03A 1QALA 2JQ5A 1QVG2 2HMOB 1M904 2BNGA 1BNJA 5JBSA 1YVBI 3VF1A 2E2UA 2SBLA 3KE7A 2OCTA 5AIFA 1IV7A 5BIRA 1BRGA 4XBYA 1YNVX 4HJLB 2K54A 1W01A 2OTL3 1B2UA 1RHLA 1N9JA 2IMJA 3U1WA 3EC9A 1YHQ3 1N8R4 1SIHA 1Y4KA 3WHOA 3T0UA 3EBTA 4LZIA 1I0VA 4EBGA 3LTAA 6RNTA 3KSPA 1OHOA 1RGAA 2Z6BA 4EV2A 4ZM8A 3CC23 2AAEA 1BAOA 4O02B 5AIGA 5DRVA 1T2IA 1W7CA 2CG1A 1NNVA 3A76A 3EN1B 1ASKA 1AVLA 3B4OA 3B4PA 1BSCA 3CC43 3EE1A 5G1LA 3CC73 1BANA 2J8XB 3PCRA 1NJI4 2OTJ3 2GBXB 1TJDA 2XRXB 4N6V0 1Q864 1SJWA 2ZDJA 4L8OA 1YGEA 1PYLA 2KRTA 2XF3A 1GY6A 3NBJA 1W5ZA 3CPW2 4EW5A 1DMQA 3G16A 4X2OA 2CFLA 3N54B 3MG3A 3TDGA 2P0XA 3DGMA 1UCKA 2YFJB 4HOHA 4FCZA 1G02A 3B7CA 1VQ83 3KIIA 4HZBB 1S5AA 4N6MA 3MG1A 4FCMA 3JUPA 1Q9EA 1BUQA 5M18A 5FW5A 3CCV3 4K90B 3NX0A 2OOVC 2W9QA 2HMNB 2XFSA 3FG3A 5AIHA 3V92A 1V58A 5IERA 1KSIA 2QIYA 4R9KA 1SIIA 3M8CA 3U97A 5JPPA 3FGYA 2F99A 1OGZA 1GOYA 3G0KA 3WOEB 1GMRA 1ROAA 3JUOA 3F9SA 4XM4A 1RCLA 2CKFB 1BVIA 1X1UA 1BRSA 5CXOA 3LMLA 3PCSA 5AI1A 1W2B2 3RNTA 3K0ZA 4K1UA 4RNTA 1R4YA 1JKGB 1BNGA 3PXMA 3LYGA 1LOYA 1OH0A 1OHSA 1CQSA 1M1XB 1RTUA 4LMIA 3G6E3 3CCJ3 3CCM3 1JBTA 1W00A 1KC84 2CWVA 3SYUA 2I9WA 5GSPA 2RCDA 3LT9A 3LZAA 3S5CA 1I2GA 1RNTA 1V57A 3FSDA 3OV4A 1B2MA 2RGQA 1K8A4 2BMQB 1VQP3 1JZOA 4WWUC 4JF8A 2Y74A 1JN5B 4OUQA 3AMOA 3BU4A 4N6UA 1JJ22 2AADA 3GZYB 2KF6A 2ML6A 1Q814 4EV5A 2KF4A 2Q07A 3DUKA 4MMXB 9RNTA 2CK3H 1MWSA 2IYJA 3GSPA 1GS3A 5EVHA 2ZL8A 2JDIH 1GY7A 4BU4A 2CW9A 3DH2A 4HBRA 1CYUA 5FGOA 3ZG0A 2P38A 4HZ9B 3URPA 2IUKA 3NXJA 4N6LA 2IA7A 3DGYA 1N8QA 4ORLA 1IYYA 3HZPA 1JKGA 3MG2A 3BNDA 3ER7A 4AEQA 3D4AA 3FG4A 3OWUA 1X1XA 2KCDA 2K0MA 1Q40B 1IQ8A 3AGOA 4OK0A 3X3XA 1FYSA 1O7MB 2MF7A 4LYLB 1OF5B 1AQZA 1TFOA 2H0IA 1CYVA 3BIRA 3NM7A 3NQYA 3S28A 4GHOA 4MMZB 2HMJB 3RDEA 5RNTA 1SQWA 1NB3I 4BTXA 1IVVA 1AY7A 1TRQA 4NHFA 2QEX3 2YFLB 1A67A 1BRJA 1HZ1A 1OUNA 1B21A 1RN1A 1RRLA 2W6JH 4FMCA 3S29A 1VQN3 2BU4A 4HAAA 3K5TA 2Z77A 1O7HB 4HM4B 3HIGA 1VQM3 1FA3A 4HM0B 1OHPA 2CFWA 1BOXA 1MOLA 1VQQA 1BNEA 2CFKA 3I0YA 4J5GA 1UDII 1UUVB 2FGTA 1DETA 3Q2PA 1CEWI 3PZWA 1M9GA 1NWWA 1SARA 2CHCA 4N3VA 4H61A 2F4YA 5G2GA 1ISKA 5AEUB 4HYZA 2F5MA 3Q1CA 4L7KA 2F56A 1WMPA 3SVAA 2XSHB 7RNTA 1O7PB 2Y73A 2UX0A 3X40A 3Q3FA 1UCJA 3DY5A 5IEOA 3WDGB 1VQ53 3AHSA 1A2KA 4I4KA 2RBIA 1VQ43 5CF2A 5HGRA 2CIUA 4CCVA 4J8TA 5AIIA 2QGUA 2GEYA 4XDWA 4BTYA 4MMYB 4WFOA 5BU4A 2CFDA 3H3HA 3EQQB 3IJEB 2P05A 2O3OA 3UL6A 1BNRA 5IF6A 4WYKA 3V98A 4CDLA 3WOFB 1RGFA 2CG0A 3DZLA 2WGQA 1IQYA 2QA43 1EQKA 1LNHA 1GOUA 2GXFA 3NV0B 1I2FA 3KN4A 3IPTA 3SXXA 6GSPA 3PYJA 1MWTA 3GRDA 5BXQA 4J9AA 4HM8B 1LXEA 1QVF2 3F14A 1DYUA 2LQVA 4FMDA 1IU7A 3L0RA 5DREA 1MWRA 1PY3A 3E99A 3D79A 7STDA 1ULIB 3CU3A 3HK4A 1AV4A 3DGNA 4JRFA 1BNSA 1UW1A 4N6TA 4U13A 1C54A 2CWUA 4STDA 1U8CB 1Q42A 2B1XB 3KCHA 1FW7A 3MYTA 1EKMA 2XR8B 2WOHA 3NBRA 1YVSA 3HIIA 4AKYA 4XBTA 2BMOB 4CJNA 1RGGA 3JUNA 4H3UA 2Z7AA 3NHXA 1VQK3 1TUHA 1IV9A 4GL6A 5IW9A 1FGRA 1RDSA 1T3BA 1RN4A 1RGHA 2UGIA 2W2CA 3DM8A 1IVUA 4XDVA 3B8LA 1YJN3 1VQ93 3N9HA 1N5PA 4HVNA 1GSPA 2BMRB 1TP6A 3G4S3 3MSOA 3SOYA 2P0MA 5D81A 3T8NA 1RSNA 2CX0A 1V74A 3X42A 2BHMA 1OPYA 3D5GA 3O8YA 4KT3B 4HM6B 3GZXB 3RGRA 1DVDA 3BNCA 2F86B 4GSPA 4I5QA 3DXOA 4AKZA 1STDA 4IIAA 3H51A 3MPHA 1LQGC 1K28A 2ZHXB 1EEJA 4EYCA 3S27A 2L1SA 4RNYA 2GU1A 3X3YA 1KQS2 3GWRA 1W4NA 1I3FA 4WP5A 3RGAA 1Q824 5M1AA 2HOHA 5IENA 1BUJA 1YIJ3 4ILFA 1RKYA 3F8XA 2XFTA 2HMMB 1BSDA 4R4KA 4O8SA 1DMMA 4K61A 1FUTA 5I97A 1LOWA 1BRKA 2GU3A 3NBBA 3I563 1G0TA 1KWIA 1IVXA 1DVCA 5KP3A 3UJMA 3WA2X 1FUWA 3CME3 1LOXA 1HU9A 1ZX2A 4FCJA 2UUGC 4KFDA 1NB5I 1BIRA 1I8VA 1MWUA 2RFRA 5IG0A 3I553 3LTCA 1MNLA 5STDA 1IK3A 1LRAA 3FCSB 1O7WB 3OX9A 1J2BA 5EQLA 1DE3A 5ELUA 1TRPA 2C10A 1RN7A 2W9PA 1IDPA 2PZVA 1GMQA 2HMLB 3F7SA 2F5WA 3ROBA 3VGNA 1WMNA 5LC6A 4CPKA 1US1A 2XEPA 3EBYA 4IT7A
chains in the Genus database with same CATH topology
3NV0A 5A0OB 2B24B 3BLZA 1WNHA 5KP1A 4HM3B 1FGMA 4BTWA 3CCS3 3LTBA 4IPBA 4LEHA 1NO3A 1D6ZA 4FMBA 1O7NB 3X3ZA 3DGLA 1ZO2A 4MEIA 6STDA 3EB8A 3OWYA 3CMA3 1QAKA 1IT8A 2P09A 4EXRA 2FNQA 3DMCA 3S67A 1JB4A 1YI23 4MJDA 3WODG 4L8PA 2F98A 3F8HA 1FGTA 1OF5A 3GZRA 2GBWB 1JRQA 3CNXA 4K1VA 3LXUX 2W56B 2CH9A 2O9UX 2W0QA 2OWPA 2R4IA 1N5HA 3CPOA 3G8ZA 5TGNA 3V99A 3X41A 1EA2A 1GD3A 3QK9A 4R80A 1T5YA 5AEWB 1VQ63 4WHAA 2PNCA 4KFFA 1D6YA 1SPUA 4PEJA 5CK6A 3GZBA 2OQEC 5EEOA 2XGNA 1ROVA 1IQXA 4XBXA 1DMNA 3LOYA 2RSXA 1FGOA 1EG9B 4RBNA 2MC8A 3FF2A 3KKGA 3KSED 1R4CA 3F40A 3BB9A 1Q7Y4 2KXGA 3HI7A 4EC6A 1VZZA 1W6YA 1GD4A 1E3VA 3CCQ3 1M1K4 1RJOA 4XB5A 3KZTA 1OGXA 3FF0A 1W6GA 5KP4A 3K7CA 3G713 1TU5A 5BVBA 2CFGA 1KD14 5JPUA 2XSOB 3J7Yd 3UB1A 1JNQA 4LSOA 3N8BA 1WTHA 3EN8A 5CF1A 2IUJA 1VQO3 2LYXA 2XH9A 5LC7A 1OACA 1YIT3 4HKVB 4HM7B 2E2TA 3NQZA 4TX4A 3CCE3 1UUWB 3CNMA 3AMOB 3JVCA 1C7HA 1A2VA 3PS8A 3CXC2 1A90A 4HM1B 5IG4A 4LGQA 4WYKB 1VQ73 1UI7A 1TIJA 3MWZA 3SOAA 4HM2B 3CCL3 1Z1SA 3D9RA 3HX8A 1G96A 4N6OB 3LH4A 3CCR3 1AR0A 4OVMA 1JB5A 3EJVA 3FKAA 2YFIB 4KZ1A 1OCVA 2INXA 3DGOA 5IG3A 1QAFA 3BNEA 1W6CA 1QJGA 3FZWA 3UL5A 3KFQC 3F7XA 4KVHA 2W04A 1IVWA 3OWSA 3NUVA 3SLUA 4QWTA 1NU3A 2A15A 4KFEA 1U5OA 2WOFA 1UI8A 3BNBA 5CLKA 1GYBA 5D83A 4R9LA 1NDOB 3OW22 5IG5A 3SX1A 3NM2A 2WGOA 2FXTA 3MKIA 1WMOA 1W2ZA 3PGBA 3OXAA 3LT8A 4FMAA 3UNLA 8CHOA 1JB2A 1LVNA 1PFPA 3K9MC 3QRDA 1K734 4RZMA 2D1WA 3MHEA 5AYRB 5IEPA 2Z76A 2ML5A 2BT3A 3WMDA 2OQEA 3WA3A 3JUQA 4HM5B 2GEXA 3FG1A 1D6UA 1RRHA 2HMKB 1E3RA 3JUMA 1VQL3 2M7OA 1IT7A 2BO9B 2V1LA 3T8UA 1S723 1W02A 2W56A 3CD63 1JV2B 1K41A 1STFI 4GB5A 3STDA 3SEDA 2WO0A 1YJ93 4G1MB 4NREA 1N9EA 5ELJA 5AYSC 2D42A 4FR9A 1K9M4 2CWTA 2OOVA 4R1KA 1PU4A 1YJW3 5D82A 4O3VA 3EX9A 3K63A 3CCU3 3ALAA 3Q90A 1WQLB 3EHCA 2CC3A 2XGLA 1TFKA 1FGQA 1O7GB 1F8NA 1QMAA 2E2VA 3FLJA 2YX9A 3IMAB 3ECFA 4RNZA 3VSYA 3GAXA 1JN5A 1Q40A 3LTDA 2L4VA 4N6NB 3FH1A 1HKXA 4Q53A 2C11A 3D3LA 1ULJB 1L5GB 1E97A 3EF8A 2STDA 1GY5A 4O2HA 4X2HA 1AVKA 2W03A 1QVG2 1QALA 2JQ5A 1M904 2HMOB 2BNGA 5JBSA 1YVBI 3VF1A 2E2UA 2SBLA 3KE7A 2OCTA 5AIFA 1IV7A 4XBYA 4HJLB 2K54A 1W01A 2OTL3 1N9JA 2IMJA 3U1WA 3EC9A 1YHQ3 1N8R4 1SIHA 1Y4KA 3T0UA 3EBTA 4LZIA 4EBGA 3LTAA 3KSPA 1OHOA 4ZM8A 2Z6BA 4EV2A 3CC23 4O02B 5AIGA 5DRVA 1W7CA 2CG1A 3A76A 3EN1B 1AVLA 1ASKA 3B4OA 3B4PA 3CC43 3EE1A 3CC73 2OTJ3 3PCRA 1NJI4 2GBXB 4N6V0 2XRXB 1Q864 1SJWA 2ZDJA 4L8OA 1YGEA 2KRTA 2XF3A 1GY6A 3NBJA 1W5ZA 3CPW2 1DMQA 3G16A 4X2OA 2CFLA 3N54B 3MG3A 3TDGA 2P0XA 3DGMA 2YFJB 4FCZA 3B7CA 1VQ83 3KIIA 4HZBB 1S5AA 4N6MA 3MG1A 4FCMA 3JUPA 1BUQA 5FW5A 3CCV3 4K90B 3NX0A 2OOVC 2W9QA 2HMNB 2XFSA 3FG3A 5AIHA 3V92A 5IERA 1KSIA 2QIYA 4R9KA 1SIIA 3M8CA 3U97A 5JPPA 3FGYA 2F99A 1OGZA 3G0KA 3WOEB 1ROAA 3JUOA 3F9SA 4XM4A 2CKFB 5CXOA 3LMLA 3PCSA 5AI1A 1W2B2 3K0ZA 4K1UA 3PXMA 1JKGB 3LYGA 1OH0A 1OHSA 1M1XB 1CQSA 4LMIA 3G6E3 3CCM3 3CCJ3 1W00A 1KC84 2CWVA 2I9WA 2RCDA 3LT9A 3LZAA 3S5CA 3FSDA 3OV4A 2RGQA 1K8A4 2BMQB 1VQP3 4WWUC 4JF8A 2Y74A 1JN5B 4OUQA 3AMOA 4N6UA 3GZYB 2ML6A 1Q814 4EV5A 4MMXB 2Q07A 3DUKA 2CK3H 1GS3A 5EVHA 2ZL8A 2JDIH 1GY7A 2CW9A 4HBRA 1CYUA 5FGOA 2P38A 4HZ9B 2IUKA 3NXJA 4N6LA 2IA7A 1N8QA 4ORLA 3HZPA 1JKGA 3MG2A 3BNDA 3ER7A 4AEQA 3FG4A 3OWUA 2KCDA 2K0MA 1Q40B 1IQ8A 4OK0A 3X3XA 1O7MB 2MF7A 1OF5B 1TFOA 3NM7A 3NQYA 1CYVA 3S28A 4MMZB 2HMJB 3RDEA 1SQWA 1NB3I 4BTXA 1IVVA 1A67A 4NHFA 2QEX3 2YFLB 1OUNA 4FMCA 1RRLA 2W6JH 3S29A 1VQN3 3K5TA 2Z77A 1O7HB 4HM4B 3HIGA 1VQM3 1FA3A 4HM0B 1OHPA 2CFKA 1MOLA 2CFWA 3I0YA 1UUVB 2FGTA 3Q2PA 1CEWI 3PZWA 1M9GA 1NWWA 2CHCA 4N3VA 4H61A 5G2GA 1ISKA 5AEUB 4HYZA 3Q1CA 4L7KA 1WMPA 3SVAA 2XSHB 1O7PB 2Y73A 2UX0A 3X40A 3DY5A 5IEOA 3WDGB 1VQ53 1A2KA 4I4KA 1VQ43 5CF2A 5HGRA 2CIUA 4CCVA 4J8TA 5AIIA 2QGUA 2GEYA 4XDWA 4BTYA 4MMYB 4WFOA 2CFDA 3H3HA 3EQQB 3IJEB 2P05A 2O3OA 3UL6A 5IF6A 4WYKA 3V98A 4CDLA 3WOFB 2CG0A 3DZLA 2WGQA 1IQYA 2QA43 1EQKA 1LNHA 2GXFA 3NV0B 3KN4A 3IPTA 3SXXA 3PYJA 3GRDA 5BXQA 4J9AA 4HM8B 1LXEA 1QVF2 3F14A 1DYUA 2LQVA 4FMDA 1IU7A 3L0RA 5DREA 3E99A 7STDA 1ULIB 3CU3A 3HK4A 1AV4A 3DGNA 4JRFA 1UW1A 4N6TA 4U13A 2CWUA 4STDA 1U8CB 1Q42A 2B1XB 3MYTA 1EKMA 2XR8B 2WOHA 3NBRA 3HIIA 4AKYA 4XBTA 2BMOB 3JUNA 4H3UA 2Z7AA 3NHXA 1VQK3 1TUHA 1IV9A 4GL6A 5IW9A 1FGRA 1JJ22 4XDVA 1YJN3 2W2CA 3DM8A 1IVUA 3B8LA 1VQ93 3N9HA 1N5PA 4HVNA 2BMRB 1TP6A 3G4S3 3MSOA 3SOYA 2P0MA 5D81A 3T8NA 1V74A 3X42A 2BHMA 1OPYA 3O8YA 4HM6B 3GZXB 3RGRA 1DVDA 3BNCA 2F86B 3DXOA 4AKZA 1STDA 4IIAA 3H51A 3MPHA 1K28A 4EYCA 3S27A 4RNYA 2GU1A 3X3YA 1KQS2 3GWRA 1W4NA 4WP5A 3RGAA 1Q824 5IENA 1YIJ3 1RKYA 3F8XA 2XFTA 2HMMB 4R4KA 4O8SA 1DMMA 4K61A 5I97A 2GU3A 3NBBA 3I563 1KWIA 1IVXA 1DVCA 5KP3A 3UJMA 3WA2X 1FUWA 3CME3 1LOXA 1HU9A 1ZX2A 4FCJA 1NB5I 4KFDA 2RFRA 5IG0A 3I553 3LTCA 1MNLA 5STDA 1IK3A 3FCSB 1O7WB 3OX9A 1J2BA 5EQLA 5ELUA 2C10A 1RN7A 2W9PA 1IDPA 2PZVA 3ROBA 2HMLB 3F7SA 3VGNA 1WMNA 5LC6A 1US1A 2XEPA 3EBYA 4IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0O B;  4N6M A;  5ELJ A;  1WNH A;  1R4C A;  3KSE D;  3Q2P A;  4N6L A;  4N6T A;  1KWI A;  2KXG A;  1CEW I;  1DVC A;  2CH9 A;  1GD4 A;  2O9U X;  3PS8 A;  1N5H A;  3UL6 A;  1FUW A;  1M9G A;  1DVD A;  1NB5 I;  1A90 A;  3NX0 A;  2W9Q A;  1EQK A;  1PFP A;  1TIJ A;  3MWZ A;  4N6V 0;  1GD3 A;  3K9M C;  3QRD A;  1G96 A;  4N6O B;  1MNL A;  3SVA A;  3LH4 A;  1YVB I;  4N6U A;  4EYC A;  2OCT A;  1IV7 A;  1CYV A;  3PYJ A;  1IV9 A;  3IMA B;  1ROA A;  5EQL A;  3GAX A;  5ELU A;  1NB3 I;  1A67 A;  1RN7 A;  1LXE A;  1N9J A;  3UL5 A;  2W9P A;  3S67 A;  3KFQ C;  1N5P A;  2BO9 B;  5LC7 A;  4LZI A;  4N6N B;  3L0R A;  5LC6 A;  4ZM8 A;  3PXM A;  1STF I;  4IT7 A;  4CCV A;  1FA3 A;  1CYU A;  4TX4 A;  1MOL A; 
#chains in the Genus database with same CATH topology
 1B3S A;  3NV0 A;  3WR2 A;  5A0O B;  1YGW A;  2B24 B;  1WNH A;  3BLZ A;  5KP1 A;  4HM3 B;  1FGM A;  4BTW A;  1RNB A;  3CCS 3;  1BRI A;  2R41 A;  3LTB A;  4IPB A;  4LEH A;  1NO3 A;  1D6Z A;  4FMB A;  1O7N B;  3X3Z A;  3DGL A;  1ZO2 A;  4MEI A;  6STD A;  4J5K A;  3EB8 A;  3OWY A;  3CMA 3;  1QAK A;  1IT8 A;  2P09 A;  1MGR A;  1BU4 A;  4EXR A;  2FNQ A;  3DMC A;  3S67 A;  1JB4 A;  1YI2 3;  4MJD A;  1RCK A;  3WOD G;  4L8P A;  2F98 A;  2SAR A;  3F8H A;  1FGT A;  1OF5 A;  3GZR A;  2GBW B;  1JRQ A;  3CNX A;  4K1V A;  1CH0 A;  3LXU X;  2W56 B;  1BSA A;  2CH9 A;  2O9U X;  2W0Q A;  2OWP A;  2R4I A;  1N5H A;  3CPO A;  3G8Z A;  5TGN A;  3V99 A;  3X41 A;  1EA2 A;  1GOV A;  1GD3 A;  3QK9 A;  4R80 A;  1T5Y A;  5AEW B;  1VQ6 3;  4WHA A;  2PNC A;  4KFF A;  1D6Y A;  1SPU A;  4PEJ A;  5CK6 A;  3GZB A;  2H0H A;  2OQE C;  4BL3 A;  5EEO A;  5M19 A;  2XGN A;  1ROV A;  1B2Z A;  1IQX A;  4XBX A;  1DMN A;  3LOY A;  2KF3 A;  2RSX A;  1EG9 B;  1FGO A;  1ZS7 A;  1LNI A;  4RBN A;  2MC8 A;  3FF2 A;  1JBR A;  3KKG A;  3KSE D;  1R4C A;  3F40 A;  3BB9 A;  1Q7Y 4;  2KXG A;  3HI7 A;  4EC6 A;  1VZZ A;  1W6Y A;  1GD4 A;  1E3V A;  3CCQ 3;  1M1K 4;  1RJO A;  4XB5 A;  3KZT A;  1OGX A;  3FF0 A;  1W6G A;  5KP4 A;  3K7C A;  3G71 3;  1TU5 A;  5BVB A;  2CFG A;  1KD1 4;  5JPU A;  2XSO B;  1GMP A;  1FZU A;  1TTO A;  1UGH I;  3J7Y d;  3ZG5 A;  3UB1 A;  1JNQ A;  4LSO A;  3N8B A;  1WTH A;  3EN8 A;  5CF1 A;  2IUJ A;  1VQO 3;  2K3D A;  2LYX A;  2XH9 A;  5LC7 A;  1OAC A;  1BRN L;  1YIT 3;  4HKV B;  4HM7 B;  1BGS A;  5HOH A;  2E2T A;  1BNF A;  3NQZ A;  4TX4 A;  3CCE 3;  1UUW B;  3CNM A;  7GSP A;  3AMO B;  3JVC A;  1C7H A;  1A2V A;  1RGL A;  1UUG B;  3PS8 A;  3CXC 2;  1A2P A;  1BSE A;  3A5E A;  1A90 A;  4HM1 B;  5IG4 A;  4LGQ A;  4WYK B;  1VQ7 3;  1UI7 A;  1TIJ A;  3MWZ A;  3SOA A;  1RMS A;  4HM2 B;  3CCL 3;  1Z1S A;  3D9R A;  2C4B A;  1G96 A;  1RGC A;  3HX8 A;  4N6O B;  3LH4 A;  3CCR 3;  1AR0 A;  4OVM A;  1JB5 A;  3EJV A;  3FKA A;  2YFI B;  4KZ1 A;  2GSP A;  1OCV A;  2INX A;  3DGO A;  1I70 A;  5IG3 A;  1QAF A;  3BNE A;  1W6C A;  1QJG A;  3FZW A;  3UL5 A;  3KFQ C;  3F7X A;  4KVH A;  2W04 A;  1IVW A;  3OWS A;  3NUV A;  3SLU A;  4QWT A;  1NU3 A;  2A15 A;  4KFE A;  1U5O A;  2WOF A;  1UI8 A;  2KAA A;  3BNB A;  5CLK A;  1GYB A;  2H0G A;  3AHW A;  4R9L A;  1NDO B;  5D83 A;  3OW2 2;  1X1Y A;  3SX1 A;  3NM2 A;  2WGO A;  5IG5 A;  2FXT A;  3MKI A;  1WMO A;  1W2Z A;  3PGB A;  3OXA A;  3LT8 A;  4FMA A;  3UNL A;  8CHO A;  1JB2 A;  1LVN A;  1MGW A;  1PFP A;  3K9M C;  3QRD A;  4NPB A;  1K73 4;  4RZM A;  2D1W A;  3MHE A;  5AYR B;  5IEP A;  2Z76 A;  2ML5 A;  1RLS A;  2BT3 A;  3WMD A;  2OQE A;  1B20 A;  3WA3 A;  3JUQ A;  4HM5 B;  2GEX A;  3FG1 A;  1D6U A;  1RRH A;  2HMK B;  1E3R A;  3JUM A;  1BNI A;  2M7O A;  1VQL 3;  1IT7 A;  2BO9 B;  2V1L A;  3T8U A;  1S72 3;  1W02 A;  1B2X A;  2W56 A;  1UCL A;  1B27 A;  3CD6 3;  1JV2 B;  1RGK A;  1K41 A;  1STF I;  4GB5 A;  3STD A;  2RNT A;  2WO0 A;  3SED A;  1YJ9 3;  1B2S A;  1LOV A;  1FUS A;  4G1M B;  4NRE A;  1N9E A;  5ELJ A;  5AYS C;  1I2E A;  2D42 A;  4FR9 A;  1K9M 4;  2CWT A;  2OOV A;  4R1K A;  1UGI A;  1PU4 A;  1YJW 3;  5D82 A;  4O3V A;  1JZD A;  3EX9 A;  3K63 A;  3CCU 3;  3ALA A;  3Q90 A;  8RNT A;  1T2H A;  2ZA4 A;  1I3I A;  1WQL B;  1EUI C;  1Q7H A;  3EHC A;  2CC3 A;  2XGL A;  1TFK A;  1ZGX A;  1FGQ A;  1O7G B;  1F8N A;  1QMA A;  3ZFZ A;  2KF5 A;  1LQM B;  2E2V A;  3FLJ A;  2YX9 A;  3IMA B;  5G1K A;  3ECF A;  2BIR A;  1JBS A;  1X1W A;  4RNZ A;  3VSY A;  1UCI A;  3GAX A;  1BSB A;  1JN5 A;  1Q40 A;  3AGN A;  3LTD A;  2CX1 A;  2L4V A;  3D5I A;  4N6N B;  4BIR A;  1HYF A;  3FH1 A;  1HKX A;  4Q53 A;  2C11 A;  3D3L A;  1ULJ B;  1I0X A;  1L5G B;  3HOH A;  1E97 A;  4DKI A;  4BL2 A;  3EF8 A;  1BRH A;  2STD A;  1GY5 A;  2IY2 A;  4O2H A;  4X2H A;  1AVK A;  1RGE A;  2W03 A;  1QAL A;  2JQ5 A;  1QVG 2;  2HMO B;  1M90 4;  2BNG A;  1BNJ A;  5JBS A;  1YVB I;  3VF1 A;  2E2U A;  2SBL A;  3KE7 A;  2OCT A;  5AIF A;  1IV7 A;  5BIR A;  1BRG A;  4XBY A;  1YNV X;  4HJL B;  2K54 A;  1W01 A;  2OTL 3;  1B2U A;  1RHL A;  1N9J A;  2IMJ A;  3U1W A;  3EC9 A;  1YHQ 3;  1N8R 4;  1SIH A;  1Y4K A;  3WHO A;  3T0U A;  3EBT A;  4LZI A;  1I0V A;  4EBG A;  3LTA A;  6RNT A;  3KSP A;  1OHO A;  1RGA A;  2Z6B A;  4EV2 A;  4ZM8 A;  3CC2 3;  2AAE A;  1BAO A;  4O02 B;  5AIG A;  5DRV A;  1T2I A;  1W7C A;  2CG1 A;  1NNV A;  3A76 A;  3EN1 B;  1ASK A;  1AVL A;  3B4O A;  3B4P A;  1BSC A;  3CC4 3;  3EE1 A;  5G1L A;  3CC7 3;  1BAN A;  2J8X B;  3PCR A;  1NJI 4;  2OTJ 3;  2GBX B;  1TJD A;  2XRX B;  4N6V 0;  1Q86 4;  1SJW A;  2ZDJ A;  4L8O A;  1YGE A;  1PYL A;  2KRT A;  2XF3 A;  1GY6 A;  3NBJ A;  1W5Z A;  3CPW 2;  4EW5 A;  1DMQ A;  3G16 A;  4X2O A;  2CFL A;  3N54 B;  3MG3 A;  3TDG A;  2P0X A;  3DGM A;  1UCK A;  2YFJ B;  4HOH A;  4FCZ A;  1G02 A;  3B7C A;  1VQ8 3;  3KII A;  4HZB B;  1S5A A;  4N6M A;  3MG1 A;  4FCM A;  3JUP A;  1Q9E A;  1BUQ A;  5M18 A;  5FW5 A;  3CCV 3;  4K90 B;  3NX0 A;  2OOV C;  2W9Q A;  2HMN B;  2XFS A;  3FG3 A;  5AIH A;  3V92 A;  1V58 A;  5IER A;  1KSI A;  2QIY A;  4R9K A;  1SII A;  3M8C A;  3U97 A;  5JPP A;  3FGY A;  2F99 A;  1OGZ A;  1GOY A;  3G0K A;  3WOE B;  1GMR A;  1ROA A;  3JUO A;  3F9S A;  4XM4 A;  1RCL A;  2CKF B;  1BVI A;  1X1U A;  1BRS A;  5CXO A;  3LML A;  3PCS A;  5AI1 A;  1W2B 2;  3RNT A;  3K0Z A;  4K1U A;  4RNT A;  1R4Y A;  1JKG B;  1BNG A;  3PXM A;  3LYG A;  1LOY A;  1OH0 A;  1OHS A;  1CQS A;  1M1X B;  1RTU A;  4LMI A;  3G6E 3;  3CCJ 3;  3CCM 3;  1JBT A;  1W00 A;  1KC8 4;  2CWV A;  3SYU A;  2I9W A;  5GSP A;  2RCD A;  3LT9 A;  3LZA A;  3S5C A;  1I2G A;  1RNT A;  1V57 A;  3FSD A;  3OV4 A;  1B2M A;  2RGQ A;  1K8A 4;  2BMQ B;  1VQP 3;  1JZO A;  4WWU C;  4JF8 A;  2Y74 A;  1JN5 B;  4OUQ A;  3AMO A;  3BU4 A;  4N6U A;  1JJ2 2;  2AAD A;  3GZY B;  2KF6 A;  2ML6 A;  1Q81 4;  4EV5 A;  2KF4 A;  2Q07 A;  3DUK A;  4MMX B;  9RNT A;  2CK3 H;  1MWS A;  2IYJ A;  3GSP A;  1GS3 A;  5EVH A;  2ZL8 A;  2JDI H;  1GY7 A;  4BU4 A;  2CW9 A;  3DH2 A;  4HBR A;  1CYU A;  5FGO A;  3ZG0 A;  2P38 A;  4HZ9 B;  3URP A;  2IUK A;  3NXJ A;  4N6L A;  2IA7 A;  3DGY A;  1N8Q A;  4ORL A;  1IYY A;  3HZP A;  1JKG A;  3MG2 A;  3BND A;  3ER7 A;  4AEQ A;  3D4A A;  3FG4 A;  3OWU A;  1X1X A;  2KCD A;  2K0M A;  1Q40 B;  1IQ8 A;  3AGO A;  4OK0 A;  3X3X A;  1FYS A;  1O7M B;  2MF7 A;  4LYL B;  1OF5 B;  1AQZ A;  1TFO A;  2H0I A;  1CYV A;  3BIR A;  3NM7 A;  3NQY A;  3S28 A;  4GHO A;  4MMZ B;  2HMJ B;  3RDE A;  5RNT A;  1SQW A;  1NB3 I;  4BTX A;  1IVV A;  1AY7 A;  1TRQ A;  4NHF A;  2QEX 3;  2YFL B;  1A67 A;  1BRJ A;  1HZ1 A;  1OUN A;  1B21 A;  1RN1 A;  1RRL A;  2W6J H;  4FMC A;  3S29 A;  1VQN 3;  2BU4 A;  4HAA A;  3K5T A;  2Z77 A;  1O7H B;  4HM4 B;  3HIG A;  1VQM 3;  1FA3 A;  4HM0 B;  1OHP A;  2CFW A;  1BOX A;  1MOL A;  1VQQ A;  1BNE A;  2CFK A;  3I0Y A;  4J5G A;  1UDI I;  1UUV B;  2FGT A;  1DET A;  3Q2P A;  1CEW I;  3PZW A;  1M9G A;  1NWW A;  1SAR A;  2CHC A;  4N3V A;  4H61 A;  2F4Y A;  5G2G A;  1ISK A;  5AEU B;  4HYZ A;  2F5M A;  3Q1C A;  4L7K A;  2F56 A;  1WMP A;  3SVA A;  2XSH B;  7RNT A;  1O7P B;  2Y73 A;  2UX0 A;  3X40 A;  3Q3F A;  1UCJ A;  3DY5 A;  5IEO A;  3WDG B;  1VQ5 3;  3AHS A;  1A2K A;  4I4K A;  2RBI A;  1VQ4 3;  5CF2 A;  5HGR A;  2CIU A;  4CCV A;  4J8T A;  5AII A;  2QGU A;  2GEY A;  4XDW A;  4BTY A;  4MMY B;  4WFO A;  5BU4 A;  2CFD A;  3H3H A;  3EQQ B;  3IJE B;  2P05 A;  2O3O A;  3UL6 A;  1BNR A;  5IF6 A;  4WYK A;  3V98 A;  4CDL A;  3WOF B;  1RGF A;  2CG0 A;  3DZL A;  2WGQ A;  1IQY A;  2QA4 3;  1EQK A;  1LNH A;  1GOU A;  2GXF A;  3NV0 B;  1I2F A;  3KN4 A;  3IPT A;  3SXX A;  6GSP A;  3PYJ A;  1MWT A;  3GRD A;  5BXQ A;  4J9A A;  4HM8 B;  1LXE A;  1QVF 2;  3F14 A;  1DYU A;  2LQV A;  4FMD A;  1IU7 A;  3L0R A;  5DRE A;  1MWR A;  1PY3 A;  3E99 A;  3D79 A;  7STD A;  1ULI B;  3CU3 A;  3HK4 A;  1AV4 A;  3DGN A;  4JRF A;  1BNS A;  1UW1 A;  4N6T A;  4U13 A;  1C54 A;  2CWU A;  4STD A;  1U8C B;  1Q42 A;  2B1X B;  3KCH A;  1FW7 A;  3MYT A;  1EKM A;  2XR8 B;  2WOH A;  3NBR A;  1YVS A;  3HII A;  4AKY A;  4XBT A;  2BMO B;  4CJN A;  1RGG A;  3JUN A;  4H3U A;  2Z7A A;  3NHX A;  1VQK 3;  1TUH A;  1IV9 A;  4GL6 A;  5IW9 A;  1FGR A;  1RDS A;  1T3B A;  1RN4 A;  1RGH A;  2UGI A;  2W2C A;  3DM8 A;  1IVU A;  4XDV A;  3B8L A;  1YJN 3;  1VQ9 3;  3N9H A;  1N5P A;  4HVN A;  1GSP A;  2BMR B;  1TP6 A;  3G4S 3;  3MSO A;  3SOY A;  2P0M A;  5D81 A;  3T8N A;  1RSN A;  2CX0 A;  1V74 A;  3X42 A;  2BHM A;  1OPY A;  3D5G A;  3O8Y A;  4KT3 B;  4HM6 B;  3GZX B;  3RGR A;  1DVD A;  3BNC A;  2F86 B;  4GSP A;  4I5Q A;  3DXO A;  4AKZ A;  1STD A;  4IIA A;  3H51 A;  3MPH A;  1LQG C;  1K28 A;  2ZHX B;  1EEJ A;  4EYC A;  3S27 A;  2L1S A;  4RNY A;  2GU1 A;  3X3Y A;  1KQS 2;  3GWR A;  1W4N A;  1I3F A;  4WP5 A;  3RGA A;  1Q82 4;  5M1A A;  2HOH A;  5IEN A;  1BUJ A;  1YIJ 3;  4ILF A;  1RKY A;  3F8X A;  2XFT A;  2HMM B;  1BSD A;  4R4K A;  4O8S A;  1DMM A;  4K61 A;  1FUT A;  5I97 A;  1LOW A;  1BRK A;  2GU3 A;  3NBB A;  3I56 3;  1G0T A;  1KWI A;  1IVX A;  1DVC A;  5KP3 A;  3UJM A;  3WA2 X;  1FUW A;  3CME 3;  1LOX A;  1HU9 A;  1ZX2 A;  4FCJ A;  2UUG C;  4KFD A;  1NB5 I;  1BIR A;  1I8V A;  1MWU A;  2RFR A;  5IG0 A;  3I55 3;  3LTC A;  1MNL A;  5STD A;  1IK3 A;  1LRA A;  3FCS B;  1O7W B;  3OX9 A;  1J2B A;  5EQL A;  1DE3 A;  5ELU A;  1TRP A;  2C10 A;  1RN7 A;  2W9P A;  1IDP A;  2PZV A;  1GMQ A;  2HML B;  3F7S A;  2F5W A;  3ROB A;  3VGN A;  1WMN A;  5LC6 A;  4CPK A;  1US1 A;  2XEP A;  3EBY A;  4IT7 A; 
#chains in the Genus database with same CATH homology
 3NV0 A;  5A0O B;  2B24 B;  3BLZ A;  1WNH A;  5KP1 A;  4HM3 B;  1FGM A;  4BTW A;  3CCS 3;  3LTB A;  4IPB A;  4LEH A;  1NO3 A;  1D6Z A;  4FMB A;  1O7N B;  3X3Z A;  3DGL A;  1ZO2 A;  4MEI A;  6STD A;  3EB8 A;  3OWY A;  3CMA 3;  1QAK A;  1IT8 A;  2P09 A;  4EXR A;  2FNQ A;  3DMC A;  3S67 A;  1JB4 A;  1YI2 3;  4MJD A;  3WOD G;  4L8P A;  2F98 A;  3F8H A;  1FGT A;  1OF5 A;  3GZR A;  2GBW B;  1JRQ A;  3CNX A;  4K1V A;  3LXU X;  2W56 B;  2CH9 A;  2O9U X;  2W0Q A;  2OWP A;  2R4I A;  1N5H A;  3CPO A;  3G8Z A;  5TGN A;  3V99 A;  3X41 A;  1EA2 A;  1GD3 A;  3QK9 A;  4R80 A;  1T5Y A;  5AEW B;  1VQ6 3;  4WHA A;  2PNC A;  4KFF A;  1D6Y A;  1SPU A;  4PEJ A;  5CK6 A;  3GZB A;  2OQE C;  5EEO A;  2XGN A;  1ROV A;  1IQX A;  4XBX A;  1DMN A;  3LOY A;  2RSX A;  1FGO A;  1EG9 B;  4RBN A;  2MC8 A;  3FF2 A;  3KKG A;  3KSE D;  1R4C A;  3F40 A;  3BB9 A;  1Q7Y 4;  2KXG A;  3HI7 A;  4EC6 A;  1VZZ A;  1W6Y A;  1GD4 A;  1E3V A;  3CCQ 3;  1M1K 4;  1RJO A;  4XB5 A;  3KZT A;  1OGX A;  3FF0 A;  1W6G A;  5KP4 A;  3K7C A;  3G71 3;  1TU5 A;  5BVB A;  2CFG A;  1KD1 4;  5JPU A;  2XSO B;  3J7Y d;  3UB1 A;  1JNQ A;  4LSO A;  3N8B A;  1WTH A;  3EN8 A;  5CF1 A;  2IUJ A;  1VQO 3;  2LYX A;  2XH9 A;  5LC7 A;  1OAC A;  1YIT 3;  4HKV B;  4HM7 B;  2E2T A;  3NQZ A;  4TX4 A;  3CCE 3;  1UUW B;  3CNM A;  3AMO B;  3JVC A;  1C7H A;  1A2V A;  3PS8 A;  3CXC 2;  1A90 A;  4HM1 B;  5IG4 A;  4LGQ A;  4WYK B;  1VQ7 3;  1UI7 A;  1TIJ A;  3MWZ A;  3SOA A;  4HM2 B;  3CCL 3;  1Z1S A;  3D9R A;  3HX8 A;  1G96 A;  4N6O B;  3LH4 A;  3CCR 3;  1AR0 A;  4OVM A;  1JB5 A;  3EJV A;  3FKA A;  2YFI B;  4KZ1 A;  1OCV A;  2INX A;  3DGO A;  5IG3 A;  1QAF A;  3BNE A;  1W6C A;  1QJG A;  3FZW A;  3UL5 A;  3KFQ C;  3F7X A;  4KVH A;  2W04 A;  1IVW A;  3OWS A;  3NUV A;  3SLU A;  4QWT A;  1NU3 A;  2A15 A;  4KFE A;  1U5O A;  2WOF A;  1UI8 A;  3BNB A;  5CLK A;  1GYB A;  5D83 A;  4R9L A;  1NDO B;  3OW2 2;  5IG5 A;  3SX1 A;  3NM2 A;  2WGO A;  2FXT A;  3MKI A;  1WMO A;  1W2Z A;  3PGB A;  3OXA A;  3LT8 A;  4FMA A;  3UNL A;  8CHO A;  1JB2 A;  1LVN A;  1PFP A;  3K9M C;  3QRD A;  1K73 4;  4RZM A;  2D1W A;  3MHE A;  5AYR B;  5IEP A;  2Z76 A;  2ML5 A;  2BT3 A;  3WMD A;  2OQE A;  3WA3 A;  3JUQ A;  4HM5 B;  2GEX A;  3FG1 A;  1D6U A;  1RRH A;  2HMK B;  1E3R A;  3JUM A;  1VQL 3;  2M7O A;  1IT7 A;  2BO9 B;  2V1L A;  3T8U A;  1S72 3;  1W02 A;  2W56 A;  3CD6 3;  1JV2 B;  1K41 A;  1STF I;  4GB5 A;  3STD A;  3SED A;  2WO0 A;  1YJ9 3;  4G1M B;  4NRE A;  1N9E A;  5ELJ A;  5AYS C;  2D42 A;  4FR9 A;  1K9M 4;  2CWT A;  2OOV A;  4R1K A;  1PU4 A;  1YJW 3;  5D82 A;  4O3V A;  3EX9 A;  3K63 A;  3CCU 3;  3ALA A;  3Q90 A;  1WQL B;  3EHC A;  2CC3 A;  2XGL A;  1TFK A;  1FGQ A;  1O7G B;  1F8N A;  1QMA A;  2E2V A;  3FLJ A;  2YX9 A;  3IMA B;  3ECF A;  4RNZ A;  3VSY A;  3GAX A;  1JN5 A;  1Q40 A;  3LTD A;  2L4V A;  4N6N B;  3FH1 A;  1HKX A;  4Q53 A;  2C11 A;  3D3L A;  1ULJ B;  1L5G B;  1E97 A;  3EF8 A;  2STD A;  1GY5 A;  4O2H A;  4X2H A;  1AVK A;  2W03 A;  1QVG 2;  1QAL A;  2JQ5 A;  1M90 4;  2HMO B;  2BNG A;  5JBS A;  1YVB I;  3VF1 A;  2E2U A;  2SBL A;  3KE7 A;  2OCT A;  5AIF A;  1IV7 A;  4XBY A;  4HJL B;  2K54 A;  1W01 A;  2OTL 3;  1N9J A;  2IMJ A;  3U1W A;  3EC9 A;  1YHQ 3;  1N8R 4;  1SIH A;  1Y4K A;  3T0U A;  3EBT A;  4LZI A;  4EBG A;  3LTA A;  3KSP A;  1OHO A;  4ZM8 A;  2Z6B A;  4EV2 A;  3CC2 3;  4O02 B;  5AIG A;  5DRV A;  1W7C A;  2CG1 A;  3A76 A;  3EN1 B;  1AVL A;  1ASK A;  3B4O A;  3B4P A;  3CC4 3;  3EE1 A;  3CC7 3;  2OTJ 3;  3PCR A;  1NJI 4;  2GBX B;  4N6V 0;  2XRX B;  1Q86 4;  1SJW A;  2ZDJ A;  4L8O A;  1YGE A;  2KRT A;  2XF3 A;  1GY6 A;  3NBJ A;  1W5Z A;  3CPW 2;  1DMQ A;  3G16 A;  4X2O A;  2CFL A;  3N54 B;  3MG3 A;  3TDG A;  2P0X A;  3DGM A;  2YFJ B;  4FCZ A;  3B7C A;  1VQ8 3;  3KII A;  4HZB B;  1S5A A;  4N6M A;  3MG1 A;  4FCM A;  3JUP A;  1BUQ A;  5FW5 A;  3CCV 3;  4K90 B;  3NX0 A;  2OOV C;  2W9Q A;  2HMN B;  2XFS A;  3FG3 A;  5AIH A;  3V92 A;  5IER A;  1KSI A;  2QIY A;  4R9K A;  1SII A;  3M8C A;  3U97 A;  5JPP A;  3FGY A;  2F99 A;  1OGZ A;  3G0K A;  3WOE B;  1ROA A;  3JUO A;  3F9S A;  4XM4 A;  2CKF B;  5CXO A;  3LML A;  3PCS A;  5AI1 A;  1W2B 2;  3K0Z A;  4K1U A;  3PXM A;  1JKG B;  3LYG A;  1OH0 A;  1OHS A;  1M1X B;  1CQS A;  4LMI A;  3G6E 3;  3CCM 3;  3CCJ 3;  1W00 A;  1KC8 4;  2CWV A;  2I9W A;  2RCD A;  3LT9 A;  3LZA A;  3S5C A;  3FSD A;  3OV4 A;  2RGQ A;  1K8A 4;  2BMQ B;  1VQP 3;  4WWU C;  4JF8 A;  2Y74 A;  1JN5 B;  4OUQ A;  3AMO A;  4N6U A;  3GZY B;  2ML6 A;  1Q81 4;  4EV5 A;  4MMX B;  2Q07 A;  3DUK A;  2CK3 H;  1GS3 A;  5EVH A;  2ZL8 A;  2JDI H;  1GY7 A;  2CW9 A;  4HBR A;  1CYU A;  5FGO A;  2P38 A;  4HZ9 B;  2IUK A;  3NXJ A;  4N6L A;  2IA7 A;  1N8Q A;  4ORL A;  3HZP A;  1JKG A;  3MG2 A;  3BND A;  3ER7 A;  4AEQ A;  3FG4 A;  3OWU A;  2KCD A;  2K0M A;  1Q40 B;  1IQ8 A;  4OK0 A;  3X3X A;  1O7M B;  2MF7 A;  1OF5 B;  1TFO A;  3NM7 A;  3NQY A;  1CYV A;  3S28 A;  4MMZ B;  2HMJ B;  3RDE A;  1SQW A;  1NB3 I;  4BTX A;  1IVV A;  1A67 A;  4NHF A;  2QEX 3;  2YFL B;  1OUN A;  4FMC A;  1RRL A;  2W6J H;  3S29 A;  1VQN 3;  3K5T A;  2Z77 A;  1O7H B;  4HM4 B;  3HIG A;  1VQM 3;  1FA3 A;  4HM0 B;  1OHP A;  2CFK A;  1MOL A;  2CFW A;  3I0Y A;  1UUV B;  2FGT A;  3Q2P A;  1CEW I;  3PZW A;  1M9G A;  1NWW A;  2CHC A;  4N3V A;  4H61 A;  5G2G A;  1ISK A;  5AEU B;  4HYZ A;  3Q1C A;  4L7K A;  1WMP A;  3SVA A;  2XSH B;  1O7P B;  2Y73 A;  2UX0 A;  3X40 A;  3DY5 A;  5IEO A;  3WDG B;  1VQ5 3;  1A2K A;  4I4K A;  1VQ4 3;  5CF2 A;  5HGR A;  2CIU A;  4CCV A;  4J8T A;  5AII A;  2QGU A;  2GEY A;  4XDW A;  4BTY A;  4MMY B;  4WFO A;  2CFD A;  3H3H A;  3EQQ B;  3IJE B;  2P05 A;  2O3O A;  3UL6 A;  5IF6 A;  4WYK A;  3V98 A;  4CDL A;  3WOF B;  2CG0 A;  3DZL A;  2WGQ A;  1IQY A;  2QA4 3;  1EQK A;  1LNH A;  2GXF A;  3NV0 B;  3KN4 A;  3IPT A;  3SXX A;  3PYJ A;  3GRD A;  5BXQ A;  4J9A A;  4HM8 B;  1LXE A;  1QVF 2;  3F14 A;  1DYU A;  2LQV A;  4FMD A;  1IU7 A;  3L0R A;  5DRE A;  3E99 A;  7STD A;  1ULI B;  3CU3 A;  3HK4 A;  1AV4 A;  3DGN A;  4JRF A;  1UW1 A;  4N6T A;  4U13 A;  2CWU A;  4STD A;  1U8C B;  1Q42 A;  2B1X B;  3MYT A;  1EKM A;  2XR8 B;  2WOH A;  3NBR A;  3HII A;  4AKY A;  4XBT A;  2BMO B;  3JUN A;  4H3U A;  2Z7A A;  3NHX A;  1VQK 3;  1TUH A;  1IV9 A;  4GL6 A;  5IW9 A;  1FGR A;  1JJ2 2;  4XDV A;  1YJN 3;  2W2C A;  3DM8 A;  1IVU A;  3B8L A;  1VQ9 3;  3N9H A;  1N5P A;  4HVN A;  2BMR B;  1TP6 A;  3G4S 3;  3MSO A;  3SOY A;  2P0M A;  5D81 A;  3T8N A;  1V74 A;  3X42 A;  2BHM A;  1OPY A;  3O8Y A;  4HM6 B;  3GZX B;  3RGR A;  1DVD A;  3BNC A;  2F86 B;  3DXO A;  4AKZ A;  1STD A;  4IIA A;  3H51 A;  3MPH A;  1K28 A;  4EYC A;  3S27 A;  4RNY A;  2GU1 A;  3X3Y A;  1KQS 2;  3GWR A;  1W4N A;  4WP5 A;  3RGA A;  1Q82 4;  5IEN A;  1YIJ 3;  1RKY A;  3F8X A;  2XFT A;  2HMM B;  4R4K A;  4O8S A;  1DMM A;  4K61 A;  5I97 A;  2GU3 A;  3NBB A;  3I56 3;  1KWI A;  1IVX A;  1DVC A;  5KP3 A;  3UJM A;  3WA2 X;  1FUW A;  3CME 3;  1LOX A;  1HU9 A;  1ZX2 A;  4FCJ A;  1NB5 I;  4KFD A;  2RFR A;  5IG0 A;  3I55 3;  3LTC A;  1MNL A;  5STD A;  1IK3 A;  3FCS B;  1O7W B;  3OX9 A;  1J2B A;  5EQL A;  5ELU A;  2C10 A;  1RN7 A;  2W9P A;  1IDP A;  2PZV A;  3ROB A;  2HML B;  3F7S A;  3VGN A;  1WMN A;  5LC6 A;  1US1 A;  2XEP A;  3EBY A;  4IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...