2W9QA

Crystal structure of potato multicystatin-p212121
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
GIVNVPNPNNTKFQELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords MULTICYSTATIN
publication title Characterization of Solanum Tuberosum Multicystatin and its Structural Comparison with Other Cystatins.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 19
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2w9qA00
2W9PA 3NX0A 1CYUA 1A67A 3SVAA 5ELJA 3S67A 1RN7A 1STFI 3KFQC 5A0OB 1MOLA 3LH4A 1CYVA 2CH9A 2KXGA 1TIJA 3Q2PA 4N6OB 3QRDA 3PS8A 4N6V0 1N5HA 4N6NB 1N5PA 4LZIA 1LXEA 4N6MA 3K9MC 1NB3I 3UL6A 1PFPA 3PYJA 3KSED 3IMAB 4N6UA 3MWZA 1GD3A 3GAXA 4EYCA 1IV9A 1M9GA 1KWIA 3PXMA 2OCTA 1YVBI 1A90A 1R4CA 2W9QA 1ROAA 5ELUA 4TX4A 4IT7A 1FA3A 2BO9B 5LC6A 1N9JA 1G96A 1IV7A 1FUWA 2O9UX 1DVCA 1GD4A 1MNLA 1EQKA 4N6TA 1CEWI 4N6LA 4CCVA 1WNHA 4ZM8A 3L0RA 3UL5A 5LC7A 5EQLA 1DVDA 1NB5I
chains in the Genus database with same CATH superfamily
1I2GA 1GSPA 4N3VA 3S27A 1A2KA 6STDA 3CCQ3 2CIUA 2K3DA 3NX0A 1RDSA 3NXJA 4BL3A 3WDGB 1FGTA 4WHAA 2CG0A 3H51A 1A2VA 5DREA 2KF5A 3N9HA 3CCU3 1BNJA 5M1AA 1GOVA 1NU3A 2CFLA 5ELJA 3CXC2 1I2EA 1HZ1A 2PNCA 3I0YA 4XB5A 3EN1B 2F5WA 1UUVB 2OTL3 1DE3A 4RNTA 1STFI 3NM2A 2Q07A 4XBYA 4HM7B 5KP1A 1OCVA 2Z77A 4J5KA 3FF0A 3WOEB 3DZLA 2V1LA 1IVUA 2W0QA 3EX9A 2M7OA 1EEJA 3URPA 1W2B2 1TIJA 3DXOA 2BU4A 4XM4A 3JUQA 1W2ZA 3EN8A 3KSPA 2D42A 4L7KA 1W02A 1O7HB 1B2ZA 2ZHXB 3NQZA 1B27A 1RGCA 4N6V0 2OQEC 7RNTA 1E3VA 1TFOA 1MGRA 3MKIA 4EXRA 2W04A 1LXEA 7GSPA 1WQLB 1I0VA 3D3LA 1RKYA 3LTAA 2P0XA 4FMBA 7STDA 1NB3I 1VQ63 3DMCA 1JZOA 1MWUA 3N8BA 3D9RA 3PYJA 1V74A 1IVWA 2CFWA 3DM8A 1ASKA 3IMAB 2BNGA 2B24B 3G16A 1TP6A 1YGWA 2CC3A 1YGEA 4MMYB 2RNTA 1UGIA 1Q40A 3ECFA 1GD3A 3F8HA 3B7CA 3B4OA 3A5EA 1QMAA 1TJDA 2CFKA 1M9GA 2FGTA 2HMMB 1TRQA 3CU3A 3ER7A 4IPBA 4WYKB 3WR2A 1BRSA 4BU4A 1O7GB 1WTHA 2OCTA 1YVBI 3FG4A 3EBTA 1Q40B 4O8SA 2IA7A 3DGNA 5BXQA 1JZDA 1IQXA 1RN4A 1WMPA 2RBIA 3NHXA 3DH2A 4MMZB 4FMDA 4CJNA 1YJN3 1R4CA 3PCRA 2GBXB 4XBTA 4TX4A 4NPBA 5ELUA 1Q864 1Q42A 2CFGA 1JN5B 3CCE3 5AIHA 2GBWB 3MG2A 2RGQA 1VQP3 1JBTA 1FZUA 1VQN3 1WMNA 1RGAA 3N54B 2RFRA 3BIRA 4K61A 1RGLA 3RNTA 3B4PA 1GD4A 1BSBA 2XGNA 1UI7A 3H3HA 1CQSA 5BU4A 3EHCA 2GU1A 2WGQA 3LOYA 2ML5A 3WHOA 1EKMA 2P09A 4N6LA 1JV2B 3MPHA 3X3XA 4CCVA 3S29A 4EBGA 1W5ZA 1X1XA 1WNHA 4L8OA 3KKGA 4O3VA 5G1KA 1B2MA 1SQWA 1FGOA 3DY5A 4ZM8A 1RN1A 3AMOA 3UL5A 1OH0A 2K0MA 1C7HA 3FG1A 2JDIH 5I97A 1MWRA 1I2FA 1NB5I 1BU4A 4HM5B 3SLUA 4EC6A 2ZL8A 1BOXA 3LT8A 3LZAA 1BUQA 4AKZA 1DYUA 3Q90A 1GMRA 2R41A 3FGYA 1Q814 1A67A 2C10A 1S723 1B3SA 1BAOA 2QIYA 3NBJA 2WOHA 1JB2A 4K1UA 3G4S3 1UW1A 3X40A 1K9M4 1LOWA 2CW9A 1FW7A 4EV2A 1RN7A 1N9EA 9RNTA 5IW9A 4OVMA 3VSYA 1BSDA 1KC84 1ULIB 2GU3A 2FXTA 3LXUX 4MEIA 2Y73A 1MOLA 3BU4A 1IVXA 1DMNA 4I5QA 1U5OA 1G0TA 1CYVA 1LOYA 1RSNA 2CWVA 2C4BA 1RMSA 3FLJA 5CK6A 5JPPA 1OHOA 2AADA 2KXGA 2HMOB 1QVG2 4FMCA 3Q2PA 3MSOA 3RGAA 5EVHA 2GSPA 2HOHA 1AVLA 2STDA 2UGIA 3PS8A 4O2HA 3I553 3HIIA 2AAEA 2F86B 5HOHA 2CWTA 1LQGC 1N5HA 3AHWA 3PGBA 3HX8A 1LRAA 1GY6A 3PZWA 1N5PA 1ULJB 2HMLB 2BHMA 4LZIA 2K54A 1E97A 2P0MA 1HYFA 3SEDA 4GL6A 3V92A 1MWTA 1PFPA 2RCDA 4FCJA 4KFFA 5AEUB 1GOUA 4FMAA 1I8VA 3K7CA 4KT3B 1YIJ3 3KE7A 2XH9A 5IENA 4RZMA 1W00A 2QA43 1SPUA 1BANA 5KP3A 1KD14 1W6YA 3LTBA 4R1KA 3KZTA 1T3BA 3STDA 1GOYA 2KF3A 3MWZA 4N6UA 3GAXA 4EYCA 1MGWA 1W01A 3HIGA 1K28A 2F4YA 3D5IA 1LQMB 1IV9A 3FH1A 3F40A 4HM8B 4GHOA 3UB1A 1FGMA 3F7XA 4XBXA 1BUJA 4OK0A 2LYXA 4FCZA 1VQL3 3FF2A 3CC73 4J9AA 1TU5A 1C54A 2XR8B 1PYLA 4EV5A 4R4KA 1U8CB 1OHSA 2W9QA 1YJ93 4I4KA 3O8YA 4ORLA 1ROAA 2GXFA 1ROVA 1YI23 5D81A 4X2HA 5G2GA 3IJEB 1FA3A 2QGUA 4KVHA 2BO9B 1STDA 3EB8A 3V99A 8RNTA 3Q3FA 1RCKA 1BSAA 2F5MA 4WYKA 1N9JA 1YHQ3 2SBLA 2CX0A 2BMOB 2O9UX 3GZRA 3K63A 2L4VA 1Z1SA 1DVCA 4HAAA 3LTDA 1FGRA 1UCIA 2IY2A 3B8LA 4IIAA 4H3UA 1O7MB 1SJWA 1EQKA 3ZFZA 3CCS3 1WMOA 2OOVA 2CG1A 3PCSA 5AI1A 1CEWI 1UGHI 1M904 3OX9A 3OV4A 3FSDA 5DRVA 3K5TA 1B2UA 1JN5A 4R80A 1Q7Y4 4HJLB 3MHEA 3S28A 1BNGA 3NBRA 1SIHA 3ZG0A 3CCR3 3L0RA 3NV0B 4QWTA 3AHSA 1RGEA 1DVDA 2Z6BA 4KFEA 1BNSA 1QAKA 4STDA 1T2HA 4LYLB 4LSOA 1CYUA 2OWPA 1UDII 1K734 5TGNA 3GZYB 3E99A 4XDWA 3GZXB 3SVAA 3DUKA 1FUSA 3CME3 5CLKA 5IERA 3RGRA 1RHLA 1RGFA 3LTCA 4RNZA 2H0GA 3D5GA 4Q53A 3RDEA 1YVSA 1TUHA 1NWWA 1VQK3 1FUTA 2XSOB 1TRPA 2BMQB 1RCLA 2IMJA 4GSPA 1T5YA 3CD63 1JNQA 3UJMA 1JKGB 3KN4A 2L1SA 2XRXB 3NUVA 2YX9A 1K41A 5A0OB 1B20A 1EA2A 1N8QA 2Y74A 5IG4A 3G713 1AVKA 1DETA 2D1WA 3F7SA 5AIGA 4XDVA 3WODG 5BVBA 1ZS7A 5RNTA 3JVCA 1BRHA 2CH9A 2XFSA 2ZDJA 1OGZA 4WP5A 1M1XB 2QEX3 1HKXA 4WFOA 1IT8A 4HM6B 2J8XB 1G02A 1UUGB 1BNIA 1PU4A 1PY3A 3HK4A 1BRNL 1LVNA 4AEQA 3JUMA 1I70A 4K1VA 3WA3A 5AIIA 4HYZA 1LOXA 2F98A 1QAFA 2XGLA 3EC9A 3F8XA 4L8PA 4N6MA 1D6UA 1SIIA 4H61A 3DGOA 4MJDA 5D83A 3J7Yd 3K9MC 1GY5A 3KCHA 3SX1A 3G6E3 4BTXA 1GMPA 3TDGA 3KIIA 3UNLA 1A2PA 4JF8A 4LMIA 4HKVB 3SYUA 1QVF2 3KSED 3EE1A 4R9KA 1KSIA 3BNCA 2XEPA 4EW5A 1YIT3 1GY7A 4BTYA 2P38A 3IPTA 1UCLA 1JB4A 3GWRA 2BMRB 1O7PB 1W7CA 2IYJA 4LGQA 4HZBB 1KWIA 1E3RA 3WA2X 1GMQA 1DMQA 1OGXA 1X1YA 5STDA 1A90A 1BGSA 3CMA3 3CCJ3 1LOVA 2GEYA 1V57A 1AQZA 2WGOA 1F8NA 3EF8A 3MG1A 3OXAA 1V58A 4HZ9B 1VQ53 2RSXA 3VGNA 5LC6A 3WOFB 5CXOA 1G96A 3HZPA 1NJI4 3BNEA 1RRHA 1RTUA 1CH0A 2F56A 3AGNA 4LEHA 1HU9A 3CNXA 1OF5B 2W6JH 1JJ22 1MWSA 3G8ZA 1FGQA 1M1K4 1W6CA 6RNTA 4GB5A 2ML6A 4HM0B 1SARA 4BIRA 2H0IA 1GS3A 2IUKA 3T8UA 2WOFA 2OQEA 3ZG5A 1BRIA 2CFDA 1VQ83 1I3FA 4ILFA 1T2IA 4HVNA 3X3ZA 4J5GA 1VZZA 1FYSA 2W56A 2KCDA 2MF7A 5IEOA 1S5AA 5AEWB 1LNIA 1ISKA 3U97A 2E2TA 5IF6A 2UX0A 3JUNA 3DGLA 5EQLA 2MC8A 2WO0A 4JRFA 1JRQA 1IQYA 1NNVA 3F9SA 2HMKB 2CWUA 4FCMA 1IQ8A 1I0XA 4K90B 2W9PA 2BIRA 1GYBA 2GEXA 3CPOA 3MYTA 1UCKA 3OWUA 3GZBA 8CHOA 5M18A 2W56B 3CPW2 5M19A 1QJGA 5EEOA 2HMJB 3LMLA 1B2SA 1IU7A 3NBBA 1BNEA 1B21A 1AY7A 3F14A 4MMXB 2XF3A 3BLZA 2BT3A 2E2UA 2CK3H 1ZGXA 2FNQA 1BSEA 1OHPA 2I9WA 4O02B 5AIFA 1IT7A 3S67A 3X42A 3ALAA 4HBRA 1IDPA 3NV0A 4J8TA 5D82A 1RJOA 5HGRA 1X1UA 1UI8A 2OTJ3 3BNDA 1Q9EA 1TFKA 2XFTA 3KFQC 3X41A 2C11A 5CF1A 1RNBA 3AGOA 1JBSA 1O7WB 3T0UA 2F99A 4AKYA 1O7NB 3GSPA 4KZ1A 3LH4A 4HM4B 2LQVA 4PEJA 3CC43 4HM2B 3ROBA 3K0ZA 2B1XB 4NREA 1VQ73 1YNVX 2R4IA 1R4YA 4HOHA 1OPYA 5IEPA 3FZWA 1BRJA 2CKFB 2OOVC 2H0HA 2INXA 4NHFA 1NDOB 3CNMA 4N6OB 1VQO3 1IVVA 3QRDA 2YFLB 3S5CA 5BIRA 1VQM3 5FGOA 2KAAA 2KF6A 1D6YA 2O3OA 2KRTA 3EQQB 3GRDA 4G1MB 1JKGA 3G0KA 4N6NB 1RRLA 3OWSA 3SOYA 2XSHB 1VQ93 3T8NA 5G1LA 1OUNA 1BSCA 4BTWA 5GSPA 3QK9A 1KQS2 3UL6A 4BL2A 1B2XA 5CF2A 5IG5A 5KP4A 2E2VA 3BB9A 5AYRB 4CPKA 1VQQA 2KF4A 3I563 3HI7A 2W2CA 2IUJA 3MG3A 3NM7A 1W6GA 1UCJA 2HMNB 3U1WA 2SARA 1BIRA 4DKIA 3FCSB 1BNFA 1I3IA 1W4NA 4RBNA 3OWYA 4KFDA 1BRKA 3A76A 4WWUC 4U13A 3D4AA 3X3YA 1LNHA 3PXMA 1RGHA 5IG0A 4CDLA 1IK3A 4OUQA 1J2BA 3NQYA 3LYGA 4X2OA 1N8R4 2P05A 1BRGA 2UUGC 1TTOA 2JQ5A 4FR9A 1YJW3 1RLSA 4IT7A 2Z7AA 1Q7HA 2PZVA 1EG9B 1ZO2A 1NO3A 2A15A 3BNBA 1US1A 1K8A4 1IYYA 3SOAA 5FW5A 3FKAA 2Z76A 1EUIC 6GSPA 1RGKA 3CCL3 1D6ZA 1IV7A 3JUPA 3V98A 3CCV3 1FUWA 1BNRA 2YFIB 3AMOB 2YFJB 3M8CA 3D79A 4RNYA 1MNLA 1Q824 3OW22 3FG3A 5JBSA 2CX1A 4HM3B 1QALA 4N6TA 3CCM3 3EJVA 1Y4KA 3EBYA 3JUOA 3VF1A 1JBRA 5AYSC 1JB5A 1X1WA 4R9LA 1UUWB 1VQ43 4HM1B 1AV4A 2W03A 3DGYA 5IG3A 3SXXA 1RGGA 1AR0A 3Q1CA 3WMDA 1L5GB 2CHCA 2ZA4A 3LT9A 1RNTA 1DMMA 5LC7A 5JPUA 3CC23 1OF5A 1ZX2A 1OACA 1BVIA 3HOHA 3DGMA
chains in the Genus database with same CATH topology
4N3VA 3S27A 1A2KA 6STDA 3CCQ3 2CIUA 3NX0A 3NXJA 3WDGB 1FGTA 4WHAA 2CG0A 3H51A 1A2VA 5DREA 3N9HA 3CCU3 3CXC2 1NU3A 2CFLA 5ELJA 2PNCA 3I0YA 4XB5A 3EN1B 1UUVB 2OTL3 1STFI 3NM2A 2Q07A 4XBYA 4HM7B 5KP1A 1OCVA 2Z77A 3FF0A 3WOEB 3DZLA 2V1LA 1IVUA 2W0QA 3EX9A 2M7OA 1W2B2 1TIJA 3DXOA 4XM4A 3JUQA 1W2ZA 3EN8A 3KSPA 2D42A 4L7KA 1W02A 1O7HB 3NQZA 4N6V0 2OQEC 1E3VA 1TFOA 3MKIA 4EXRA 2W04A 1LXEA 1WQLB 3D3LA 1RKYA 3LTAA 2P0XA 4FMBA 1NB3I 1VQ63 3DMCA 3N8BA 3D9RA 3PYJA 1V74A 1IVWA 2CFWA 3DM8A 1ASKA 3IMAB 2BNGA 2B24B 3G16A 1TP6A 2CC3A 1YGEA 4MMYB 3ECFA 1Q40A 1GD3A 3F8HA 3B7CA 3B4OA 1QMAA 2HMMB 2CFKA 1M9GA 2FGTA 4IPBA 3CU3A 3ER7A 4WYKB 1O7GB 1WTHA 2OCTA 1YVBI 3FG4A 3EBTA 1Q40B 4O8SA 2IA7A 3DGNA 5BXQA 1IQXA 4MMZB 1WMPA 1YJN3 3NHXA 4FMDA 1R4CA 3PCRA 2GBXB 4XBTA 4TX4A 5ELUA 1Q864 1Q42A 2CFGA 1JN5B 3CCE3 5AIHA 2GBWB 3MG2A 2RGQA 1VQP3 1VQN3 1WMNA 3N54B 2RFRA 4K61A 3B4PA 1GD4A 2XGNA 1UI7A 3H3HA 1CQSA 3EHCA 2GU1A 2WGQA 3LOYA 2ML5A 1EKMA 2P09A 4N6LA 1JV2B 3MPHA 3X3XA 4CCVA 3S29A 4EBGA 1W5ZA 1WNHA 4L8OA 3KKGA 4O3VA 1SQWA 1FGOA 3DY5A 4ZM8A 3AMOA 3UL5A 1OH0A 2K0MA 1C7HA 3FG1A 2JDIH 5I97A 1NB5I 4HM5B 3SLUA 4EC6A 2ZL8A 3LT8A 3LZAA 4AKZA 1DYUA 3Q90A 3FGYA 1Q814 1A67A 2C10A 1S723 2QIYA 3NBJA 2WOHA 1JB2A 4K1UA 3G4S3 1UW1A 3X40A 1K9M4 2CW9A 4EV2A 1RN7A 1N9EA 5IW9A 4OVMA 3VSYA 1KC84 1ULIB 2GU3A 2FXTA 3LXUX 4MEIA 2Y73A 1MOLA 1IVXA 1DMNA 1U5OA 1CYVA 2CWVA 5CK6A 3FLJA 5JPPA 1OHOA 2KXGA 2HMOB 1QVG2 4FMCA 3Q2PA 3MSOA 3RGAA 5EVHA 2STDA 1AVLA 3PS8A 4O2HA 3I553 3HIIA 2F86B 2CWTA 1N5HA 3PGBA 3HX8A 1GY6A 3PZWA 1N5PA 1ULJB 2HMLB 2BHMA 4LZIA 2K54A 1E97A 2P0MA 3SEDA 4GL6A 3V92A 1PFPA 2RCDA 4FCJA 4KFFA 5AEUB 4FMAA 3K7CA 1YIJ3 3KE7A 2XH9A 5IENA 4RZMA 1W00A 2QA43 1SPUA 5KP3A 1KD14 1W6YA 3LTBA 4R1KA 3KZTA 3STDA 4N6UA 3MWZA 3GAXA 4EYCA 1W01A 3HIGA 1K28A 1IV9A 3FH1A 3F40A 4HM8B 3UB1A 1FGMA 3F7XA 4XBXA 4OK0A 2LYXA 4FCZA 1VQL3 3FF2A 3CC73 4J9AA 2XR8B 4EV5A 4R4KA 1U8CB 1OHSA 2W9QA 1YJ93 4I4KA 3O8YA 4ORLA 1ROAA 2GXFA 1ROVA 1YI23 5D81A 4X2HA 5G2GA 3IJEB 1FA3A 2QGUA 4KVHA 2BO9B 1STDA 3EB8A 3V99A 4WYKA 1YHQ3 1N9JA 2SBLA 2BMOB 2O9UX 3GZRA 3K63A 2L4VA 1Z1SA 1DVCA 3LTDA 1FGRA 3B8LA 4IIAA 4H3UA 1O7MB 1SJWA 1EQKA 3CCS3 1WMOA 2OOVA 2CG1A 3PCSA 5AI1A 1CEWI 1M904 3OX9A 3OV4A 3FSDA 5DRVA 3K5TA 1JN5A 4R80A 1Q7Y4 4HJLB 3MHEA 3S28A 3NBRA 1SIHA 3CCR3 3L0RA 3NV0B 4QWTA 1DVDA 2Z6BA 4KFEA 4STDA 1QAKA 4LSOA 1CYUA 2OWPA 1K734 5TGNA 3GZYB 3E99A 4XDWA 3GZXB 3SVAA 3DUKA 3CME3 5CLKA 5IERA 3RGRA 3LTCA 4RNZA 4Q53A 3RDEA 1TUHA 1NWWA 1VQK3 2XSOB 2BMQB 2IMJA 1T5YA 3CD63 1JNQA 3UJMA 1JKGB 3KN4A 3NUVA 2XRXB 2YX9A 1K41A 5A0OB 1EA2A 1N8QA 2Y74A 5IG4A 3G713 1AVKA 2D1WA 3F7SA 5AIGA 4XDVA 3WODG 5BVBA 3JVCA 4WP5A 2CH9A 2XFSA 2ZDJA 1OGZA 2QEX3 1M1XB 1HKXA 4WFOA 1IT8A 4HM6B 1PU4A 3HK4A 1LVNA 4AEQA 3JUMA 4K1VA 3WA3A 5AIIA 4HYZA 1LOXA 2F98A 1QAFA 2XGLA 3EC9A 3F8XA 4L8PA 4N6MA 1D6UA 1SIIA 4H61A 3DGOA 4MJDA 5D83A 3J7Yd 3K9MC 1GY5A 3SX1A 3G6E3 4BTXA 3TDGA 3KIIA 3UNLA 4JF8A 4LMIA 1QVF2 4HKVB 3KSED 3EE1A 4R9KA 1KSIA 3BNCA 2XEPA 1YIT3 1GY7A 4BTYA 2P38A 3IPTA 1JB4A 3GWRA 2BMRB 1O7PB 1W7CA 4LGQA 4HZBB 1KWIA 1E3RA 3WA2X 1DMQA 1OGXA 5STDA 1A90A 3CMA3 3CCJ3 2GEYA 2WGOA 1F8NA 3EF8A 3MG1A 3OXAA 4HZ9B 1VQ53 2RSXA 3VGNA 5LC6A 3WOFB 5CXOA 1G96A 3HZPA 1NJI4 3BNEA 1RRHA 4LEHA 1HU9A 3CNXA 1OF5B 2W6JH 1JJ22 3G8ZA 1FGQA 1M1K4 1W6CA 4GB5A 2ML6A 4HM0B 1GS3A 2IUKA 3T8UA 2WOFA 2OQEA 2CFDA 1VQ83 4HVNA 3X3ZA 1VZZA 2W56A 2KCDA 2MF7A 5IEOA 1S5AA 5AEWB 1ISKA 3U97A 2E2TA 5IF6A 2UX0A 3JUNA 3DGLA 5EQLA 2MC8A 2WO0A 4JRFA 1JRQA 1IQYA 3F9SA 1TU5A 2HMKB 2CWUA 4FCMA 1IQ8A 5IG0A 4K90B 2W9PA 1BUQA 1GYBA 2GEXA 3CPOA 3MYTA 3OWUA 8CHOA 3GZBA 2W56B 3CPW2 1QJGA 5EEOA 2HMJB 3LMLA 1IU7A 3NBBA 3F14A 7STDA 4MMXB 2XF3A 3BLZA 2BT3A 2E2UA 2CK3H 2I9WA 2FNQA 1OHPA 4O02B 5AIFA 3S67A 1IT7A 3X42A 3ALAA 4HBRA 1IDPA 3NV0A 4J8TA 5D82A 1RJOA 5HGRA 1UI8A 2OTJ3 3BNDA 3X41A 1TFKA 2XFTA 3KFQC 5CF1A 2C11A 1O7WB 3T0UA 2F99A 4AKYA 1O7NB 4KZ1A 3LH4A 4HM4B 2LQVA 4PEJA 3CC43 4HM2B 3ROBA 3K0ZA 2B1XB 4NREA 1VQ73 2R4IA 5IEPA 1OPYA 3FZWA 2CKFB 2OOVC 4NHFA 2INXA 1NDOB 3CNMA 4N6OB 1VQO3 1IVVA 3QRDA 2YFLB 3S5CA 1VQM3 5FGOA 3GRDA 2O3OA 1D6YA 2KRTA 3EQQB 4G1MB 1JKGA 3G0KA 4N6NB 1RRLA 3OWSA 3SOYA 2XSHB 1VQ93 3T8NA 1OUNA 4BTWA 3QK9A 1KQS2 3UL6A 5CF2A 5IG5A 5KP4A 2E2VA 3BB9A 5AYRB 3I563 3HI7A 2W2CA 2IUJA 3MG3A 3NM7A 1W6GA 2HMNB 3U1WA 3FCSB 4RBNA 1W4NA 3OWYA 4KFDA 3A76A 4WWUC 4U13A 3X3YA 1LNHA 3PXMA 4CDLA 1IK3A 4OUQA 1J2BA 3NQYA 3LYGA 4X2OA 1N8R4 2P05A 2JQ5A 4FR9A 1YJW3 4IT7A 2Z7AA 2PZVA 1EG9B 1ZO2A 1NO3A 2A15A 3BNBA 1US1A 1K8A4 3SOAA 5FW5A 3FKAA 2Z76A 3CCL3 1D6ZA 1IV7A 3JUPA 3V98A 3CCV3 1FUWA 2YFIB 3AMOB 2YFJB 3M8CA 4RNYA 1MNLA 1Q824 3OW22 3FG3A 5JBSA 4HM3B 1QALA 4N6TA 3CCM3 3EJVA 1Y4KA 3EBYA 3JUOA 3VF1A 5AYSC 1JB5A 4R9LA 1UUWB 1VQ43 4HM1B 1AV4A 2W03A 5IG3A 3SXXA 1AR0A 3Q1CA 3WMDA 1L5GB 2CHCA 3LT9A 1DMMA 5LC7A 5JPUA 3CC23 1OF5A 1ZX2A 1OACA 3DGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9P A;  3NX0 A;  1CYU A;  1A67 A;  3SVA A;  5ELJ A;  3S67 A;  1RN7 A;  1STF I;  3KFQ C;  5A0O B;  1MOL A;  3LH4 A;  1CYV A;  2CH9 A;  2KXG A;  1TIJ A;  3Q2P A;  4N6O B;  3QRD A;  3PS8 A;  4N6V 0;  1N5H A;  4N6N B;  1N5P A;  4LZI A;  1LXE A;  4N6M A;  3K9M C;  1NB3 I;  3UL6 A;  1PFP A;  3PYJ A;  3KSE D;  3IMA B;  4N6U A;  3MWZ A;  1GD3 A;  3GAX A;  4EYC A;  1IV9 A;  1M9G A;  1KWI A;  3PXM A;  2OCT A;  1YVB I;  1A90 A;  1R4C A;  2W9Q A;  1ROA A;  5ELU A;  4TX4 A;  4IT7 A;  1FA3 A;  2BO9 B;  5LC6 A;  1N9J A;  1G96 A;  1IV7 A;  1FUW A;  2O9U X;  1DVC A;  1GD4 A;  1MNL A;  1EQK A;  4N6T A;  1CEW I;  4N6L A;  4CCV A;  1WNH A;  4ZM8 A;  3L0R A;  3UL5 A;  5LC7 A;  5EQL A;  1DVD A;  1NB5 I; 
#chains in the Genus database with same CATH topology
 1I2G A;  1GSP A;  4N3V A;  3S27 A;  1A2K A;  6STD A;  3CCQ 3;  2CIU A;  2K3D A;  3NX0 A;  1RDS A;  3NXJ A;  4BL3 A;  3WDG B;  1FGT A;  4WHA A;  2CG0 A;  3H51 A;  1A2V A;  5DRE A;  2KF5 A;  3N9H A;  3CCU 3;  1BNJ A;  5M1A A;  1GOV A;  1NU3 A;  2CFL A;  5ELJ A;  3CXC 2;  1I2E A;  1HZ1 A;  2PNC A;  3I0Y A;  4XB5 A;  3EN1 B;  2F5W A;  1UUV B;  2OTL 3;  1DE3 A;  4RNT A;  1STF I;  3NM2 A;  2Q07 A;  4XBY A;  4HM7 B;  5KP1 A;  1OCV A;  2Z77 A;  4J5K A;  3FF0 A;  3WOE B;  3DZL A;  2V1L A;  1IVU A;  2W0Q A;  3EX9 A;  2M7O A;  1EEJ A;  3URP A;  1W2B 2;  1TIJ A;  3DXO A;  2BU4 A;  4XM4 A;  3JUQ A;  1W2Z A;  3EN8 A;  3KSP A;  2D42 A;  4L7K A;  1W02 A;  1O7H B;  1B2Z A;  2ZHX B;  3NQZ A;  1B27 A;  1RGC A;  4N6V 0;  2OQE C;  7RNT A;  1E3V A;  1TFO A;  1MGR A;  3MKI A;  4EXR A;  2W04 A;  1LXE A;  7GSP A;  1WQL B;  1I0V A;  3D3L A;  1RKY A;  3LTA A;  2P0X A;  4FMB A;  7STD A;  1NB3 I;  1VQ6 3;  3DMC A;  1JZO A;  1MWU A;  3N8B A;  3D9R A;  3PYJ A;  1V74 A;  1IVW A;  2CFW A;  3DM8 A;  1ASK A;  3IMA B;  2BNG A;  2B24 B;  3G16 A;  1TP6 A;  1YGW A;  2CC3 A;  1YGE A;  4MMY B;  2RNT A;  1UGI A;  1Q40 A;  3ECF A;  1GD3 A;  3F8H A;  3B7C A;  3B4O A;  3A5E A;  1QMA A;  1TJD A;  2CFK A;  1M9G A;  2FGT A;  2HMM B;  1TRQ A;  3CU3 A;  3ER7 A;  4IPB A;  4WYK B;  3WR2 A;  1BRS A;  4BU4 A;  1O7G B;  1WTH A;  2OCT A;  1YVB I;  3FG4 A;  3EBT A;  1Q40 B;  4O8S A;  2IA7 A;  3DGN A;  5BXQ A;  1JZD A;  1IQX A;  1RN4 A;  1WMP A;  2RBI A;  3NHX A;  3DH2 A;  4MMZ B;  4FMD A;  4CJN A;  1YJN 3;  1R4C A;  3PCR A;  2GBX B;  4XBT A;  4TX4 A;  4NPB A;  5ELU A;  1Q86 4;  1Q42 A;  2CFG A;  1JN5 B;  3CCE 3;  5AIH A;  2GBW B;  3MG2 A;  2RGQ A;  1VQP 3;  1JBT A;  1FZU A;  1VQN 3;  1WMN A;  1RGA A;  3N54 B;  2RFR A;  3BIR A;  4K61 A;  1RGL A;  3RNT A;  3B4P A;  1GD4 A;  1BSB A;  2XGN A;  1UI7 A;  3H3H A;  1CQS A;  5BU4 A;  3EHC A;  2GU1 A;  2WGQ A;  3LOY A;  2ML5 A;  3WHO A;  1EKM A;  2P09 A;  4N6L A;  1JV2 B;  3MPH A;  3X3X A;  4CCV A;  3S29 A;  4EBG A;  1W5Z A;  1X1X A;  1WNH A;  4L8O A;  3KKG A;  4O3V A;  5G1K A;  1B2M A;  1SQW A;  1FGO A;  3DY5 A;  4ZM8 A;  1RN1 A;  3AMO A;  3UL5 A;  1OH0 A;  2K0M A;  1C7H A;  3FG1 A;  2JDI H;  5I97 A;  1MWR A;  1I2F A;  1NB5 I;  1BU4 A;  4HM5 B;  3SLU A;  4EC6 A;  2ZL8 A;  1BOX A;  3LT8 A;  3LZA A;  1BUQ A;  4AKZ A;  1DYU A;  3Q90 A;  1GMR A;  2R41 A;  3FGY A;  1Q81 4;  1A67 A;  2C10 A;  1S72 3;  1B3S A;  1BAO A;  2QIY A;  3NBJ A;  2WOH A;  1JB2 A;  4K1U A;  3G4S 3;  1UW1 A;  3X40 A;  1K9M 4;  1LOW A;  2CW9 A;  1FW7 A;  4EV2 A;  1RN7 A;  1N9E A;  9RNT A;  5IW9 A;  4OVM A;  3VSY A;  1BSD A;  1KC8 4;  1ULI B;  2GU3 A;  2FXT A;  3LXU X;  4MEI A;  2Y73 A;  1MOL A;  3BU4 A;  1IVX A;  1DMN A;  4I5Q A;  1U5O A;  1G0T A;  1CYV A;  1LOY A;  1RSN A;  2CWV A;  2C4B A;  1RMS A;  3FLJ A;  5CK6 A;  5JPP A;  1OHO A;  2AAD A;  2KXG A;  2HMO B;  1QVG 2;  4FMC A;  3Q2P A;  3MSO A;  3RGA A;  5EVH A;  2GSP A;  2HOH A;  1AVL A;  2STD A;  2UGI A;  3PS8 A;  4O2H A;  3I55 3;  3HII A;  2AAE A;  2F86 B;  5HOH A;  2CWT A;  1LQG C;  1N5H A;  3AHW A;  3PGB A;  3HX8 A;  1LRA A;  1GY6 A;  3PZW A;  1N5P A;  1ULJ B;  2HML B;  2BHM A;  4LZI A;  2K54 A;  1E97 A;  2P0M A;  1HYF A;  3SED A;  4GL6 A;  3V92 A;  1MWT A;  1PFP A;  2RCD A;  4FCJ A;  4KFF A;  5AEU B;  1GOU A;  4FMA A;  1I8V A;  3K7C A;  4KT3 B;  1YIJ 3;  3KE7 A;  2XH9 A;  5IEN A;  4RZM A;  1W00 A;  2QA4 3;  1SPU A;  1BAN A;  5KP3 A;  1KD1 4;  1W6Y A;  3LTB A;  4R1K A;  3KZT A;  1T3B A;  3STD A;  1GOY A;  2KF3 A;  3MWZ A;  4N6U A;  3GAX A;  4EYC A;  1MGW A;  1W01 A;  3HIG A;  1K28 A;  2F4Y A;  3D5I A;  1LQM B;  1IV9 A;  3FH1 A;  3F40 A;  4HM8 B;  4GHO A;  3UB1 A;  1FGM A;  3F7X A;  4XBX A;  1BUJ A;  4OK0 A;  2LYX A;  4FCZ A;  1VQL 3;  3FF2 A;  3CC7 3;  4J9A A;  1TU5 A;  1C54 A;  2XR8 B;  1PYL A;  4EV5 A;  4R4K A;  1U8C B;  1OHS A;  2W9Q A;  1YJ9 3;  4I4K A;  3O8Y A;  4ORL A;  1ROA A;  2GXF A;  1ROV A;  1YI2 3;  5D81 A;  4X2H A;  5G2G A;  3IJE B;  1FA3 A;  2QGU A;  4KVH A;  2BO9 B;  1STD A;  3EB8 A;  3V99 A;  8RNT A;  3Q3F A;  1RCK A;  1BSA A;  2F5M A;  4WYK A;  1N9J A;  1YHQ 3;  2SBL A;  2CX0 A;  2BMO B;  2O9U X;  3GZR A;  3K63 A;  2L4V A;  1Z1S A;  1DVC A;  4HAA A;  3LTD A;  1FGR A;  1UCI A;  2IY2 A;  3B8L A;  4IIA A;  4H3U A;  1O7M B;  1SJW A;  1EQK A;  3ZFZ A;  3CCS 3;  1WMO A;  2OOV A;  2CG1 A;  3PCS A;  5AI1 A;  1CEW I;  1UGH I;  1M90 4;  3OX9 A;  3OV4 A;  3FSD A;  5DRV A;  3K5T A;  1B2U A;  1JN5 A;  4R80 A;  1Q7Y 4;  4HJL B;  3MHE A;  3S28 A;  1BNG A;  3NBR A;  1SIH A;  3ZG0 A;  3CCR 3;  3L0R A;  3NV0 B;  4QWT A;  3AHS A;  1RGE A;  1DVD A;  2Z6B A;  4KFE A;  1BNS A;  1QAK A;  4STD A;  1T2H A;  4LYL B;  4LSO A;  1CYU A;  2OWP A;  1UDI I;  1K73 4;  5TGN A;  3GZY B;  3E99 A;  4XDW A;  3GZX B;  3SVA A;  3DUK A;  1FUS A;  3CME 3;  5CLK A;  5IER A;  3RGR A;  1RHL A;  1RGF A;  3LTC A;  4RNZ A;  2H0G A;  3D5G A;  4Q53 A;  3RDE A;  1YVS A;  1TUH A;  1NWW A;  1VQK 3;  1FUT A;  2XSO B;  1TRP A;  2BMQ B;  1RCL A;  2IMJ A;  4GSP A;  1T5Y A;  3CD6 3;  1JNQ A;  3UJM A;  1JKG B;  3KN4 A;  2L1S A;  2XRX B;  3NUV A;  2YX9 A;  1K41 A;  5A0O B;  1B20 A;  1EA2 A;  1N8Q A;  2Y74 A;  5IG4 A;  3G71 3;  1AVK A;  1DET A;  2D1W A;  3F7S A;  5AIG A;  4XDV A;  3WOD G;  5BVB A;  1ZS7 A;  5RNT A;  3JVC A;  1BRH A;  2CH9 A;  2XFS A;  2ZDJ A;  1OGZ A;  4WP5 A;  1M1X B;  2QEX 3;  1HKX A;  4WFO A;  1IT8 A;  4HM6 B;  2J8X B;  1G02 A;  1UUG B;  1BNI A;  1PU4 A;  1PY3 A;  3HK4 A;  1BRN L;  1LVN A;  4AEQ A;  3JUM A;  1I70 A;  4K1V A;  3WA3 A;  5AII A;  4HYZ A;  1LOX A;  2F98 A;  1QAF A;  2XGL A;  3EC9 A;  3F8X A;  4L8P A;  4N6M A;  1D6U A;  1SII A;  4H61 A;  3DGO A;  4MJD A;  5D83 A;  3J7Y d;  3K9M C;  1GY5 A;  3KCH A;  3SX1 A;  3G6E 3;  4BTX A;  1GMP A;  3TDG A;  3KII A;  3UNL A;  1A2P A;  4JF8 A;  4LMI A;  4HKV B;  3SYU A;  1QVF 2;  3KSE D;  3EE1 A;  4R9K A;  1KSI A;  3BNC A;  2XEP A;  4EW5 A;  1YIT 3;  1GY7 A;  4BTY A;  2P38 A;  3IPT A;  1UCL A;  1JB4 A;  3GWR A;  2BMR B;  1O7P B;  1W7C A;  2IYJ A;  4LGQ A;  4HZB B;  1KWI A;  1E3R A;  3WA2 X;  1GMQ A;  1DMQ A;  1OGX A;  1X1Y A;  5STD A;  1A90 A;  1BGS A;  3CMA 3;  3CCJ 3;  1LOV A;  2GEY A;  1V57 A;  1AQZ A;  2WGO A;  1F8N A;  3EF8 A;  3MG1 A;  3OXA A;  1V58 A;  4HZ9 B;  1VQ5 3;  2RSX A;  3VGN A;  5LC6 A;  3WOF B;  5CXO A;  1G96 A;  3HZP A;  1NJI 4;  3BNE A;  1RRH A;  1RTU A;  1CH0 A;  2F56 A;  3AGN A;  4LEH A;  1HU9 A;  3CNX A;  1OF5 B;  2W6J H;  1JJ2 2;  1MWS A;  3G8Z A;  1FGQ A;  1M1K 4;  1W6C A;  6RNT A;  4GB5 A;  2ML6 A;  4HM0 B;  1SAR A;  4BIR A;  2H0I A;  1GS3 A;  2IUK A;  3T8U A;  2WOF A;  2OQE A;  3ZG5 A;  1BRI A;  2CFD A;  1VQ8 3;  1I3F A;  4ILF A;  1T2I A;  4HVN A;  3X3Z A;  4J5G A;  1VZZ A;  1FYS A;  2W56 A;  2KCD A;  2MF7 A;  5IEO A;  1S5A A;  5AEW B;  1LNI A;  1ISK A;  3U97 A;  2E2T A;  5IF6 A;  2UX0 A;  3JUN A;  3DGL A;  5EQL A;  2MC8 A;  2WO0 A;  4JRF A;  1JRQ A;  1IQY A;  1NNV A;  3F9S A;  2HMK B;  2CWU A;  4FCM A;  1IQ8 A;  1I0X A;  4K90 B;  2W9P A;  2BIR A;  1GYB A;  2GEX A;  3CPO A;  3MYT A;  1UCK A;  3OWU A;  3GZB A;  8CHO A;  5M18 A;  2W56 B;  3CPW 2;  5M19 A;  1QJG A;  5EEO A;  2HMJ B;  3LML A;  1B2S A;  1IU7 A;  3NBB A;  1BNE A;  1B21 A;  1AY7 A;  3F14 A;  4MMX B;  2XF3 A;  3BLZ A;  2BT3 A;  2E2U A;  2CK3 H;  1ZGX A;  2FNQ A;  1BSE A;  1OHP A;  2I9W A;  4O02 B;  5AIF A;  1IT7 A;  3S67 A;  3X42 A;  3ALA A;  4HBR A;  1IDP A;  3NV0 A;  4J8T A;  5D82 A;  1RJO A;  5HGR A;  1X1U A;  1UI8 A;  2OTJ 3;  3BND A;  1Q9E A;  1TFK A;  2XFT A;  3KFQ C;  3X41 A;  2C11 A;  5CF1 A;  1RNB A;  3AGO A;  1JBS A;  1O7W B;  3T0U A;  2F99 A;  4AKY A;  1O7N B;  3GSP A;  4KZ1 A;  3LH4 A;  4HM4 B;  2LQV A;  4PEJ A;  3CC4 3;  4HM2 B;  3ROB A;  3K0Z A;  2B1X B;  4NRE A;  1VQ7 3;  1YNV X;  2R4I A;  1R4Y A;  4HOH A;  1OPY A;  5IEP A;  3FZW A;  1BRJ A;  2CKF B;  2OOV C;  2H0H A;  2INX A;  4NHF A;  1NDO B;  3CNM A;  4N6O B;  1VQO 3;  1IVV A;  3QRD A;  2YFL B;  3S5C A;  5BIR A;  1VQM 3;  5FGO A;  2KAA A;  2KF6 A;  1D6Y A;  2O3O A;  2KRT A;  3EQQ B;  3GRD A;  4G1M B;  1JKG A;  3G0K A;  4N6N B;  1RRL A;  3OWS A;  3SOY A;  2XSH B;  1VQ9 3;  3T8N A;  5G1L A;  1OUN A;  1BSC A;  4BTW A;  5GSP A;  3QK9 A;  1KQS 2;  3UL6 A;  4BL2 A;  1B2X A;  5CF2 A;  5IG5 A;  5KP4 A;  2E2V A;  3BB9 A;  5AYR B;  4CPK A;  1VQQ A;  2KF4 A;  3I56 3;  3HI7 A;  2W2C A;  2IUJ A;  3MG3 A;  3NM7 A;  1W6G A;  1UCJ A;  2HMN B;  3U1W A;  2SAR A;  1BIR A;  4DKI A;  3FCS B;  1BNF A;  1I3I A;  1W4N A;  4RBN A;  3OWY A;  4KFD A;  1BRK A;  3A76 A;  4WWU C;  4U13 A;  3D4A A;  3X3Y A;  1LNH A;  3PXM A;  1RGH A;  5IG0 A;  4CDL A;  1IK3 A;  4OUQ A;  1J2B A;  3NQY A;  3LYG A;  4X2O A;  1N8R 4;  2P05 A;  1BRG A;  2UUG C;  1TTO A;  2JQ5 A;  4FR9 A;  1YJW 3;  1RLS A;  4IT7 A;  2Z7A A;  1Q7H A;  2PZV A;  1EG9 B;  1ZO2 A;  1NO3 A;  2A15 A;  3BNB A;  1US1 A;  1K8A 4;  1IYY A;  3SOA A;  5FW5 A;  3FKA A;  2Z76 A;  1EUI C;  6GSP A;  1RGK A;  3CCL 3;  1D6Z A;  1IV7 A;  3JUP A;  3V98 A;  3CCV 3;  1FUW A;  1BNR A;  2YFI B;  3AMO B;  2YFJ B;  3M8C A;  3D79 A;  4RNY A;  1MNL A;  1Q82 4;  3OW2 2;  3FG3 A;  5JBS A;  2CX1 A;  4HM3 B;  1QAL A;  4N6T A;  3CCM 3;  3EJV A;  1Y4K A;  3EBY A;  3JUO A;  3VF1 A;  1JBR A;  5AYS C;  1JB5 A;  1X1W A;  4R9L A;  1UUW B;  1VQ4 3;  4HM1 B;  1AV4 A;  2W03 A;  3DGY A;  5IG3 A;  3SXX A;  1RGG A;  1AR0 A;  3Q1C A;  3WMD A;  1L5G B;  2CHC A;  2ZA4 A;  3LT9 A;  1RNT A;  1DMM A;  5LC7 A;  5JPU A;  3CC2 3;  1OF5 A;  1ZX2 A;  1OAC A;  1BVI A;  3HOH A;  3DGM A; 
#chains in the Genus database with same CATH homology
 4N3V A;  3S27 A;  1A2K A;  6STD A;  3CCQ 3;  2CIU A;  3NX0 A;  3NXJ A;  3WDG B;  1FGT A;  4WHA A;  2CG0 A;  3H51 A;  1A2V A;  5DRE A;  3N9H A;  3CCU 3;  3CXC 2;  1NU3 A;  2CFL A;  5ELJ A;  2PNC A;  3I0Y A;  4XB5 A;  3EN1 B;  1UUV B;  2OTL 3;  1STF I;  3NM2 A;  2Q07 A;  4XBY A;  4HM7 B;  5KP1 A;  1OCV A;  2Z77 A;  3FF0 A;  3WOE B;  3DZL A;  2V1L A;  1IVU A;  2W0Q A;  3EX9 A;  2M7O A;  1W2B 2;  1TIJ A;  3DXO A;  4XM4 A;  3JUQ A;  1W2Z A;  3EN8 A;  3KSP A;  2D42 A;  4L7K A;  1W02 A;  1O7H B;  3NQZ A;  4N6V 0;  2OQE C;  1E3V A;  1TFO A;  3MKI A;  4EXR A;  2W04 A;  1LXE A;  1WQL B;  3D3L A;  1RKY A;  3LTA A;  2P0X A;  4FMB A;  1NB3 I;  1VQ6 3;  3DMC A;  3N8B A;  3D9R A;  3PYJ A;  1V74 A;  1IVW A;  2CFW A;  3DM8 A;  1ASK A;  3IMA B;  2BNG A;  2B24 B;  3G16 A;  1TP6 A;  2CC3 A;  1YGE A;  4MMY B;  3ECF A;  1Q40 A;  1GD3 A;  3F8H A;  3B7C A;  3B4O A;  1QMA A;  2HMM B;  2CFK A;  1M9G A;  2FGT A;  4IPB A;  3CU3 A;  3ER7 A;  4WYK B;  1O7G B;  1WTH A;  2OCT A;  1YVB I;  3FG4 A;  3EBT A;  1Q40 B;  4O8S A;  2IA7 A;  3DGN A;  5BXQ A;  1IQX A;  4MMZ B;  1WMP A;  1YJN 3;  3NHX A;  4FMD A;  1R4C A;  3PCR A;  2GBX B;  4XBT A;  4TX4 A;  5ELU A;  1Q86 4;  1Q42 A;  2CFG A;  1JN5 B;  3CCE 3;  5AIH A;  2GBW B;  3MG2 A;  2RGQ A;  1VQP 3;  1VQN 3;  1WMN A;  3N54 B;  2RFR A;  4K61 A;  3B4P A;  1GD4 A;  2XGN A;  1UI7 A;  3H3H A;  1CQS A;  3EHC A;  2GU1 A;  2WGQ A;  3LOY A;  2ML5 A;  1EKM A;  2P09 A;  4N6L A;  1JV2 B;  3MPH A;  3X3X A;  4CCV A;  3S29 A;  4EBG A;  1W5Z A;  1WNH A;  4L8O A;  3KKG A;  4O3V A;  1SQW A;  1FGO A;  3DY5 A;  4ZM8 A;  3AMO A;  3UL5 A;  1OH0 A;  2K0M A;  1C7H A;  3FG1 A;  2JDI H;  5I97 A;  1NB5 I;  4HM5 B;  3SLU A;  4EC6 A;  2ZL8 A;  3LT8 A;  3LZA A;  4AKZ A;  1DYU A;  3Q90 A;  3FGY A;  1Q81 4;  1A67 A;  2C10 A;  1S72 3;  2QIY A;  3NBJ A;  2WOH A;  1JB2 A;  4K1U A;  3G4S 3;  1UW1 A;  3X40 A;  1K9M 4;  2CW9 A;  4EV2 A;  1RN7 A;  1N9E A;  5IW9 A;  4OVM A;  3VSY A;  1KC8 4;  1ULI B;  2GU3 A;  2FXT A;  3LXU X;  4MEI A;  2Y73 A;  1MOL A;  1IVX A;  1DMN A;  1U5O A;  1CYV A;  2CWV A;  5CK6 A;  3FLJ A;  5JPP A;  1OHO A;  2KXG A;  2HMO B;  1QVG 2;  4FMC A;  3Q2P A;  3MSO A;  3RGA A;  5EVH A;  2STD A;  1AVL A;  3PS8 A;  4O2H A;  3I55 3;  3HII A;  2F86 B;  2CWT A;  1N5H A;  3PGB A;  3HX8 A;  1GY6 A;  3PZW A;  1N5P A;  1ULJ B;  2HML B;  2BHM A;  4LZI A;  2K54 A;  1E97 A;  2P0M A;  3SED A;  4GL6 A;  3V92 A;  1PFP A;  2RCD A;  4FCJ A;  4KFF A;  5AEU B;  4FMA A;  3K7C A;  1YIJ 3;  3KE7 A;  2XH9 A;  5IEN A;  4RZM A;  1W00 A;  2QA4 3;  1SPU A;  5KP3 A;  1KD1 4;  1W6Y A;  3LTB A;  4R1K A;  3KZT A;  3STD A;  4N6U A;  3MWZ A;  3GAX A;  4EYC A;  1W01 A;  3HIG A;  1K28 A;  1IV9 A;  3FH1 A;  3F40 A;  4HM8 B;  3UB1 A;  1FGM A;  3F7X A;  4XBX A;  4OK0 A;  2LYX A;  4FCZ A;  1VQL 3;  3FF2 A;  3CC7 3;  4J9A A;  2XR8 B;  4EV5 A;  4R4K A;  1U8C B;  1OHS A;  2W9Q A;  1YJ9 3;  4I4K A;  3O8Y A;  4ORL A;  1ROA A;  2GXF A;  1ROV A;  1YI2 3;  5D81 A;  4X2H A;  5G2G A;  3IJE B;  1FA3 A;  2QGU A;  4KVH A;  2BO9 B;  1STD A;  3EB8 A;  3V99 A;  4WYK A;  1YHQ 3;  1N9J A;  2SBL A;  2BMO B;  2O9U X;  3GZR A;  3K63 A;  2L4V A;  1Z1S A;  1DVC A;  3LTD A;  1FGR A;  3B8L A;  4IIA A;  4H3U A;  1O7M B;  1SJW A;  1EQK A;  3CCS 3;  1WMO A;  2OOV A;  2CG1 A;  3PCS A;  5AI1 A;  1CEW I;  1M90 4;  3OX9 A;  3OV4 A;  3FSD A;  5DRV A;  3K5T A;  1JN5 A;  4R80 A;  1Q7Y 4;  4HJL B;  3MHE A;  3S28 A;  3NBR A;  1SIH A;  3CCR 3;  3L0R A;  3NV0 B;  4QWT A;  1DVD A;  2Z6B A;  4KFE A;  4STD A;  1QAK A;  4LSO A;  1CYU A;  2OWP A;  1K73 4;  5TGN A;  3GZY B;  3E99 A;  4XDW A;  3GZX B;  3SVA A;  3DUK A;  3CME 3;  5CLK A;  5IER A;  3RGR A;  3LTC A;  4RNZ A;  4Q53 A;  3RDE A;  1TUH A;  1NWW A;  1VQK 3;  2XSO B;  2BMQ B;  2IMJ A;  1T5Y A;  3CD6 3;  1JNQ A;  3UJM A;  1JKG B;  3KN4 A;  3NUV A;  2XRX B;  2YX9 A;  1K41 A;  5A0O B;  1EA2 A;  1N8Q A;  2Y74 A;  5IG4 A;  3G71 3;  1AVK A;  2D1W A;  3F7S A;  5AIG A;  4XDV A;  3WOD G;  5BVB A;  3JVC A;  4WP5 A;  2CH9 A;  2XFS A;  2ZDJ A;  1OGZ A;  2QEX 3;  1M1X B;  1HKX A;  4WFO A;  1IT8 A;  4HM6 B;  1PU4 A;  3HK4 A;  1LVN A;  4AEQ A;  3JUM A;  4K1V A;  3WA3 A;  5AII A;  4HYZ A;  1LOX A;  2F98 A;  1QAF A;  2XGL A;  3EC9 A;  3F8X A;  4L8P A;  4N6M A;  1D6U A;  1SII A;  4H61 A;  3DGO A;  4MJD A;  5D83 A;  3J7Y d;  3K9M C;  1GY5 A;  3SX1 A;  3G6E 3;  4BTX A;  3TDG A;  3KII A;  3UNL A;  4JF8 A;  4LMI A;  1QVF 2;  4HKV B;  3KSE D;  3EE1 A;  4R9K A;  1KSI A;  3BNC A;  2XEP A;  1YIT 3;  1GY7 A;  4BTY A;  2P38 A;  3IPT A;  1JB4 A;  3GWR A;  2BMR B;  1O7P B;  1W7C A;  4LGQ A;  4HZB B;  1KWI A;  1E3R A;  3WA2 X;  1DMQ A;  1OGX A;  5STD A;  1A90 A;  3CMA 3;  3CCJ 3;  2GEY A;  2WGO A;  1F8N A;  3EF8 A;  3MG1 A;  3OXA A;  4HZ9 B;  1VQ5 3;  2RSX A;  3VGN A;  5LC6 A;  3WOF B;  5CXO A;  1G96 A;  3HZP A;  1NJI 4;  3BNE A;  1RRH A;  4LEH A;  1HU9 A;  3CNX A;  1OF5 B;  2W6J H;  1JJ2 2;  3G8Z A;  1FGQ A;  1M1K 4;  1W6C A;  4GB5 A;  2ML6 A;  4HM0 B;  1GS3 A;  2IUK A;  3T8U A;  2WOF A;  2OQE A;  2CFD A;  1VQ8 3;  4HVN A;  3X3Z A;  1VZZ A;  2W56 A;  2KCD A;  2MF7 A;  5IEO A;  1S5A A;  5AEW B;  1ISK A;  3U97 A;  2E2T A;  5IF6 A;  2UX0 A;  3JUN A;  3DGL A;  5EQL A;  2MC8 A;  2WO0 A;  4JRF A;  1JRQ A;  1IQY A;  3F9S A;  1TU5 A;  2HMK B;  2CWU A;  4FCM A;  1IQ8 A;  5IG0 A;  4K90 B;  2W9P A;  1BUQ A;  1GYB A;  2GEX A;  3CPO A;  3MYT A;  3OWU A;  8CHO A;  3GZB A;  2W56 B;  3CPW 2;  1QJG A;  5EEO A;  2HMJ B;  3LML A;  1IU7 A;  3NBB A;  3F14 A;  7STD A;  4MMX B;  2XF3 A;  3BLZ A;  2BT3 A;  2E2U A;  2CK3 H;  2I9W A;  2FNQ A;  1OHP A;  4O02 B;  5AIF A;  3S67 A;  1IT7 A;  3X42 A;  3ALA A;  4HBR A;  1IDP A;  3NV0 A;  4J8T A;  5D82 A;  1RJO A;  5HGR A;  1UI8 A;  2OTJ 3;  3BND A;  3X41 A;  1TFK A;  2XFT A;  3KFQ C;  5CF1 A;  2C11 A;  1O7W B;  3T0U A;  2F99 A;  4AKY A;  1O7N B;  4KZ1 A;  3LH4 A;  4HM4 B;  2LQV A;  4PEJ A;  3CC4 3;  4HM2 B;  3ROB A;  3K0Z A;  2B1X B;  4NRE A;  1VQ7 3;  2R4I A;  5IEP A;  1OPY A;  3FZW A;  2CKF B;  2OOV C;  4NHF A;  2INX A;  1NDO B;  3CNM A;  4N6O B;  1VQO 3;  1IVV A;  3QRD A;  2YFL B;  3S5C A;  1VQM 3;  5FGO A;  3GRD A;  2O3O A;  1D6Y A;  2KRT A;  3EQQ B;  4G1M B;  1JKG A;  3G0K A;  4N6N B;  1RRL A;  3OWS A;  3SOY A;  2XSH B;  1VQ9 3;  3T8N A;  1OUN A;  4BTW A;  3QK9 A;  1KQS 2;  3UL6 A;  5CF2 A;  5IG5 A;  5KP4 A;  2E2V A;  3BB9 A;  5AYR B;  3I56 3;  3HI7 A;  2W2C A;  2IUJ A;  3MG3 A;  3NM7 A;  1W6G A;  2HMN B;  3U1W A;  3FCS B;  4RBN A;  1W4N A;  3OWY A;  4KFD A;  3A76 A;  4WWU C;  4U13 A;  3X3Y A;  1LNH A;  3PXM A;  4CDL A;  1IK3 A;  4OUQ A;  1J2B A;  3NQY A;  3LYG A;  4X2O A;  1N8R 4;  2P05 A;  2JQ5 A;  4FR9 A;  1YJW 3;  4IT7 A;  2Z7A A;  2PZV A;  1EG9 B;  1ZO2 A;  1NO3 A;  2A15 A;  3BNB A;  1US1 A;  1K8A 4;  3SOA A;  5FW5 A;  3FKA A;  2Z76 A;  3CCL 3;  1D6Z A;  1IV7 A;  3JUP A;  3V98 A;  3CCV 3;  1FUW A;  2YFI B;  3AMO B;  2YFJ B;  3M8C A;  4RNY A;  1MNL A;  1Q82 4;  3OW2 2;  3FG3 A;  5JBS A;  4HM3 B;  1QAL A;  4N6T A;  3CCM 3;  3EJV A;  1Y4K A;  3EBY A;  3JUO A;  3VF1 A;  5AYS C;  1JB5 A;  4R9L A;  1UUW B;  1VQ4 3;  4HM1 B;  1AV4 A;  2W03 A;  5IG3 A;  3SXX A;  1AR0 A;  3Q1C A;  3WMD A;  1L5G B;  2CHC A;  3LT9 A;  1DMM A;  5LC7 A;  5JPU A;  3CC2 3;  1OF5 A;  1ZX2 A;  1OAC A;  3DGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...