2FXTA

Crystal structure of yeast tim44
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
192
Chain Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Import inner membrane translocase subunit TIM44
publication title Crystal Structure of Yeast Mitochondrial Peripheral Membrane Protein Tim44p C-terminal Domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2fxtA00
2CW9A 2FXTA 3J7Yd 3QK9A
chains in the Genus database with same CATH superfamily
1BUJA 1O7WB 2XR8B 4STDA 2CWUA 1M904 4WYKB 1W6YA 3CCL3 2CFKA 3DGNA 3BNEA 1BU4A 3UL6A 3CNXA 2F99A 1Y4KA 4EYCA 1TRPA 3N9HA 4Q53A 3QK9A 1HZ1A 3I563 1BRSA 2Y73A 1KQS2 1TIJA 1JKGA 1Q864 3SEDA 3CNMA 2MC8A 4XDWA 4RNYA 3ER7A 2CW9A 4GL6A 5ELJA 4KFFA 1EA2A 1QALA 1GMPA 2F4YA 2ML5A 4O3VA 3EC9A 4AKZA 3FG4A 1IT7A 2Z77A 1VQO3 3KZTA 3DGOA 1G96A 1A90A 1BRIA 1RGGA 1UUVB 1IVXA 1GD3A 3DGMA 2HMNB 3Q1CA 5AYSC 1BVIA 3B4OA 3BLZA 4IIAA 3F7SA 3G16A 1VQM3 1F8NA 1VQL3 4LMIA 3EHCA 3UB1A 1YGWA 1W4NA 4EBGA 1JB4A 3NX0A 4I4KA 3EJVA 4N6UA 5G1KA 2XRXB 1UI8A 4HBRA 5BXQA 4XBXA 1C54A 2ZL8A 1Q40A 4IPBA 5IF6A 3T8UA 3EB8A 2RBIA 2YX9A 1EKMA 2ZHXB 4K90B 3I553 3SXXA 4J5KA 2IUJA 3WA2X 3UJMA 1UCLA 3LH4A 5EQLA 1OF5A 3LZAA 1QVF2 1RGEA 3PGBA 1IV7A 3PS8A 4BTYA 5EVHA 3ROBA 1X1WA 3GZYB 3NQZA 2CFWA 1RLSA 3SYUA 3OWSA 4KFEA 2W0QA 1T5YA 2KAAA 3MG2A 5IENA 3CMA3 4KT3B 3OW22 1ROVA 3S27A 3T0UA 1BSCA 5IG5A 2KCDA 4OVMA 3CCE3 1Q824 1O7PB 3GSPA 2HMJB 4HM5B 1HU9A 1I70A 2D1WA 1RKYA 2CFGA 3MHEA 4HM8B 1U5OA 1SPUA 3F8XA 1DVCA 2INXA 3GAXA 1IVWA 3VSYA 1S723 4BTWA 1UDII 2OQEC 2BMQB 2WOHA 3F9SA 1OGXA 3L0RA 4LEHA 4G1MB 3V92A 3RGRA 1NB3I 1EQKA 1N5HA 1ZO2A 1RGLA 5KP3A 1S5AA 2HOHA 2ZDJA 1FZUA 3HOHA 5IG0A 3KE7A 2CWTA 3BNBA 2K54A 3F40A 1OHPA 1FUSA 4MMZB 1I0XA 1JKGB 1UCJA 4HAAA 1D6ZA 1Q7HA 1DMMA 3WOEB 1LOYA 2P05A 1JN5A 5M18A 1ZS7A 1YIJ3 4FMCA 1VQN3 9RNTA 7GSPA 1PYLA 3KSPA 3GWRA 4EW5A 1EEJA 1W6GA 1VQQA 1OGZA 1I3FA 2QEX3 3LOYA 2CH9A 1FGOA 1WQLB 1DETA 1GMQA 1OH0A 1YGEA 5AIIA 3VGNA 1K28A 5KP4A 1Q814 2H0GA 4JF8A 1MWUA 3G713 2XEPA 4N6V0 1NB5I 3SVAA 1D6YA 3D9RA 4BL2A 5AIGA 1Q7Y4 4R9KA 1VQ73 1W01A 3SX1A 3K0ZA 1G0TA 1GOYA 2XGNA 2ZA4A 3D3LA 3F8HA 1J2BA 1HYFA 1BNRA 2CFLA 2HMMB 1YIT3 1K9M4 1ROAA 1B2ZA 1X1UA 2E2UA 4WP5A 3NHXA 1BRNL 1ULIB 1VQK3 1RN1A 3HZPA 4HYZA 3BB9A 3G0KA 1GY5A 2BMRB 1KSIA 5AEWB 4LSOA 1D6UA 3D4AA 1PY3A 1LVNA 2UX0A 3F14A 3QRDA 1Q40B 3WR2A 1DE3A 1VZZA 4CPKA 1I2FA 1KD14 1QMAA 2I9WA 1BRGA 2CKFB 1OCVA 4HM1B 2C10A 3M8CA 3LYGA 1SIHA 1AV4A 4BTXA 1Q42A 1K41A 2K0MA 3X3YA 1WNHA 2GU3A 1RGFA 3H51A 1FGQA 1OF5B 1B2UA 3N54B 2PZVA 3UNLA 1FUWA 1NDOB 3DY5A 1SQWA 4FCZA 1BRKA 2KF6A 2XGLA 3H3HA 1PFPA 3ALAA 4HZBB 5I97A 1IVUA 4MJDA 3NQYA 2KF4A 1M1K4 2W04A 1VQ53 1O7MB 4CDLA 3DGLA 4WHAA 1STDA 1NJI4 1RHLA 2GSPA 2OCTA 3KKGA 4X2HA 5G1LA 1UCKA 3D5IA 4LZIA 3SOYA 4JRFA 4XM4A 1MWSA 5LC6A 1LXEA 1E97A 5AEUB 1VQ63 2OOVA 1IDPA 5G2GA 3UL5A 4ILFA 1RJOA 4N6NB 5JPPA 1K8A4 1V58A 3A5EA 3EBTA 1RCKA 3LMLA 1LOVA 3NV0B 5BVBA 2B1XB 3EX9A 3FGYA 4TX4A 1W7CA 2OTL3 4RBNA 3OWUA 4WFOA 3AMOA 2CIUA 4N6MA 2OQEA 1FYSA 4OK0A 4XBYA 4ZM8A 1BSBA 1WMPA 1AY7A 3KSED 1BNJA 2E2VA 3JUQA 5JPUA 1RMSA 4R9LA 3U1WA 1T2IA 3WHOA 1JN5B 1US1A 1JBTA 1FGMA 1UW1A 4MMXB 3DUKA 2GEYA 2F5MA 2WGOA 4RZMA 5HOHA 3CCQ3 3BIRA 3ZFZA 1RGHA 1CEWI 1OUNA 1UCIA 2JDIH 4EV5A 1ISKA 5ELUA 5LC7A 4FMAA 4XB5A 1W5ZA 2UGIA 3V99A 4O2HA 1BNFA 4N3VA 2YFLB 1NU3A 4QWTA 1TTOA 3CPOA 3CME3 1TUHA 4FCMA 2YFJB 3Q3FA 1B27A 1BRJA 1BSEA 4O8SA 3S5CA 1AR0A 4EXRA 1GY6A 1BUQA 1CH0A 3PCSA 3G8ZA 1NO3A 2OOVC 1LQGC 3D79A 1BANA 4KFDA 2CG0A 1I2EA 1MGWA 2BNGA 1KWIA 1SJWA 3LT8A 5DRVA 5AI1A 1E3VA 3V98A 3CCR3 1ULJB 1YVSA 3DXOA 4I5QA 1LOWA 2K3DA 2GU1A 3N8BA 1RRLA 4XBTA 2RSXA 2KRTA 2CFDA 3NBRA 2BU4A 3DM8A 2FNQA 3FSDA 2GEXA 2WOFA 3ECFA 3NV0A 5FW5A 4RNTA 6STDA 1LOXA 1V57A 4R1KA 4U13A 3WODG 2P0XA 2W9QA 3FZWA 1NNVA 4NPBA 3U97A 1T2HA 1BNSA 1LNHA 1RDSA 2IUKA 3MG1A 3KIIA 5FGOA 1ZX2A 1QVG2 2XFSA 1E3RA 1BNGA 3LTCA 2AADA 2FGTA 3X42A 1M1XB 5DREA 3CCU3 4HJLB 3CPW2 4EC6A 3GRDA 3G6E3 1VQ83 3DGYA 3GZXB 4CCVA 2GXFA 5IERA 1JZOA 3OXAA 4XDVA 5CXOA 5KP1A 1CYVA 1I2GA 4N6OB 1Q9EA 3S67A 1A2VA 4N6TA 1OHOA 2F56A 1BNIA 1IYYA 4L8PA 2Q07A 1O7NB 1VQ93 5AIHA 3MG3A 2Z6BA 3NM7A 3AMOB 2C11A 1AQZA 2FXTA 2QA43 3WMDA 3MYTA 1IQYA 3PCRA 4K1VA 5IEPA 1RGCA 3FF2A 4BU4A 2QIYA 1RSNA 2J8XB 3EBYA 3K5TA 2H0HA 1PU4A 1N5PA 1O7HB 1BNEA 5D82A 3AHSA 5AIFA 4NREA 1JRQA 3FF0A 3NUVA 3EF8A 4FMBA 2O9UX 2CX1A 1K734 4BL3A 1RCLA 2SARA 5IG4A 1QAKA 1RGKA 2R4IA 1YJW3 4BIRA 1FGTA 2YFIB 4CJNA 3KN4A 3HX8A 2OTJ3 1BIRA 2F98A 1EUIC 4J5GA 2CX0A 2KF5A 4LYLB 3CC43 1WMOA 3HK4A 1MNLA 2AAEA 2IA7A 1N9JA 3JUNA 4HM0B 4DKIA 3EQQB 1BRHA 4PEJA 3KFQC 3K63A 4WWUC 3WDGB 3LTBA 2Y74A 1UI7A 2CG1A 1MWTA 7STDA 1RN7A 1DMQA 2MF7A 4O02B 1YI23 2GBWB 2CHCA 4ORLA 3AGOA 1GY7A 4HOHA 3AHWA 3CC23 4MMYB 1ASKA 3S29A 1EG9B 1IT8A 1T3BA 3F7XA 3PYJA 3G4S3 2XF3A 1WTHA 3A76A 1IK3A 3K9MC 5TGNA 3J7Yd 3IMAB 3HIGA 1W00A 1B21A 1A2PA 1FGRA 1TP6A 1UUGB 4H61A 2GBXB 4FCJA 4HM3B 2LYXA 1WMNA 3SLUA 4HKVB 2XSOB 3OWYA 5BU4A 5EEOA 1YJ93 1SIIA 3DMCA 1N8QA 3B8LA 3NBJA 1KC84 3JUMA 2KF3A 1OACA 1L5GB 1TJDA 1UGHI 5AYRB 4R4KA 2CK3H 1GOUA 1FUTA 1GYBA 2IYJA 1AVLA 2RCDA 1B2XA 1IV9A 2W03A 1QJGA 3STDA 2RNTA 3PZWA 3KCHA 4FMDA 4KZ1A 7RNTA 2BHMA 2BT3A 2L4VA 1I8VA 1LQMB 2Z76A 3LT9A 4LGQA 3WA3A 5IW9A 2W6JH 1LNIA 3RNTA 1A2KA 1IVVA 1CQSA 2RGQA 2F86B 3NM2A 4AEQA 1U8CB 2CWVA 2HMKB 3OX9A 1BGSA 3I0YA 3B7CA 5BIRA 3CD63 4GB5A 5IEOA 3RGAA 2HMLB 4NHFA 8RNTA 3CCJ3 3JUPA 1DYUA 1AVKA 4K61A 1X1XA 1JBRA 1MWRA 2O3OA 2PNCA 2W56A 2QGUA 1ZGXA 2M7OA 1RNBA 2W2CA 3MSOA 3FG3A 3ZG5A 1DMNA 8CHOA 1FA3A 5M1AA 2XH9A 4EV2A 3NXJA 3FCSB 1JB2A 3MPHA 3CXC2 4R80A 1B2MA 3NBBA 1B3SA 1FW7A 1BAOA 1W6CA 3EN1B 1Z1SA 1O7GB 5CLKA 2JQ5A 4KVHA 2ML6A 4HM6B 4WYKA 1UGIA 5CF2A 5M19A 1VQP3 3DH2A 1JJ22 2C4BA 1I3IA 4L7KA 4GSPA 5D81A 2W9PA 2IY2A 3PXMA 1TFKA 3D5GA 2P0MA 3HIIA 3Q90A 5HGRA 3MWZA 2RFRA 5IG3A 2D42A 3CCM3 2A15A 1BSDA 2IMJA 1IU7A 1JBSA 6RNTA 3FKAA 2P09A 5STDA 3CC73 4HM7B 3S28A 3WOFB 3X41A 2F5WA 3JUOA 2XSHB 2CC3A 2LQVA 3OV4A 1N9EA 2STDA 1YVBI 1GS3A 1RTUA 3FH1A 1IQXA 3Q2PA 4HM4B 5GSPA 1YJN3 3K7CA 5CF1A 3B4PA 2WO0A 1GSPA 3URPA 1YNVX 1G02A 6GSPA 1M9GA 2XFTA 1W2B2 1W2ZA 1N8R4 5RNTA 1R4YA 1DVDA 1JNQA 1QAFA 3CU3A 3MKIA 3X3XA 4GHOA 2Z7AA 4IT7A 1VQ43 1TFOA 2H0IA 3EN8A 2B24B 2KXGA 3BNDA 4HVNA 5CK6A 4L8OA 1A67A 2L1SA 2R41A 3BNCA 3X3ZA 2OWPA 4J9AA 4HZ9B 1B2SA 1JB5A 3GZRA 3FG1A 1R4CA 3JVCA 2BMOB 3LXUX 4J8TA 3GZBA 1CYUA 3T8NA 1OHSA 1V74A 4OUQA 1JZDA 1X1YA 2P38A 3ZG0A 3BU4A 3HI7A 1TRQA 5A0OB 3EE1A 3LTAA 4RNZA 3VF1A 1B20A 2BO9B 1MOLA 4H3UA 1GMRA 2BIRA 3RDEA 1RN4A 2E2TA 3DZLA 1YHQ3 1I0VA 1RGAA 2V1LA 3IPTA 1C7HA 1NWWA 4HM2B 3CCS3 1IQ8A 1GD4A 1BSAA 4AKYA 1RNTA 2W56B 2WGQA 1JV2B 4MEIA 3SOAA 3TDGA 5JBSA 3X40A 1HKXA 3AGNA 3E99A 4K1UA 1LRAA 1STFI 3IJEB 1SARA 4N6LA 3FLJA 2UUGC 3LTDA 4X2OA 1W02A 4FR9A 3O8YA 2SBLA 1BOXA 1MGRA 1TU5A 5D83A 1OPYA 2HMOB 1RRHA 1GOVA 1UUWB 3CCV3
chains in the Genus database with same CATH topology
1O7WB 2XR8B 4STDA 2CWUA 1M904 4WYKB 1W6YA 3CCL3 2CFKA 3DGNA 3BNEA 3UL6A 4EYCA 3CNXA 2F99A 1Y4KA 3N9HA 4Q53A 3QK9A 3I563 2Y73A 1KQS2 1TIJA 1JKGA 1Q864 3SEDA 3CNMA 2MC8A 4XDWA 4RNYA 3ER7A 2CW9A 4GL6A 5ELJA 4KFFA 1EA2A 1QALA 2ML5A 4O3VA 3EC9A 4AKZA 3FG4A 1IT7A 2Z77A 1VQO3 3KZTA 3DGOA 1G96A 1A90A 1UUVB 1IVXA 1GD3A 3DGMA 2HMNB 3Q1CA 5AYSC 3B4OA 3BLZA 4IIAA 3F7SA 3G16A 1VQM3 1F8NA 1VQL3 4LMIA 3EHCA 3UB1A 1W4NA 4EBGA 1JB4A 3NX0A 4I4KA 3EJVA 4N6UA 5BXQA 2XRXB 1UI8A 4HBRA 4XBXA 2ZL8A 1Q40A 4IPBA 5IF6A 3T8UA 3EB8A 2YX9A 1EKMA 4K90B 3I553 3SXXA 2IUJA 3WA2X 3LH4A 5EQLA 1OF5A 3LZAA 1QVF2 3PGBA 1IV7A 3PS8A 4BTYA 5EVHA 3ROBA 3GZYB 3NQZA 2CFWA 3OWSA 4KFEA 2W0QA 1T5YA 3MG2A 5IENA 3CMA3 3OW22 1ROVA 3S27A 3T0UA 5IG5A 2KCDA 4OVMA 3CCE3 1Q824 1O7PB 4HM5B 2HMJB 1HU9A 2D1WA 1RKYA 2CFGA 3MHEA 4HM8B 1U5OA 1SPUA 3F8XA 1DVCA 2INXA 3GAXA 1IVWA 3VSYA 1S723 4BTWA 2OQEC 2BMQB 2WOHA 3F9SA 1OGXA 3L0RA 4LEHA 4G1MB 3V92A 3RGRA 1NB3I 1EQKA 1N5HA 1ZO2A 5KP3A 1S5AA 2ZDJA 5IG0A 3KE7A 2CWTA 3BNBA 2K54A 3F40A 1OHPA 4MMZB 1JKGB 1D6ZA 3WOEB 1DMMA 1YIJ3 1DVDA 2P05A 1JN5A 1VQN3 4FMCA 3KSPA 3GWRA 1W6GA 1OGZA 2QEX3 3LOYA 2CH9A 1FGOA 1WQLB 1YGEA 5AIIA 1OH0A 3VGNA 5KP4A 1Q814 1K28A 4JF8A 3G713 2XEPA 4N6V0 1NB5I 3SVAA 1D6YA 3D9RA 5AIGA 1Q7Y4 4R9KA 1VQ73 1W01A 3SX1A 3K0ZA 2XGNA 3F8HA 1J2BA 3D3LA 2CFLA 2HMMB 1YIT3 1K9M4 1ROAA 4WP5A 2E2UA 3NHXA 1ULIB 1VQK3 3HZPA 4HYZA 3BB9A 3G0KA 1GY5A 2BMRB 1KSIA 5AEWB 4LSOA 1D6UA 1LVNA 2UX0A 3F14A 3QRDA 1Q40B 1VZZA 1KD14 1QMAA 2I9WA 2CKFB 1OCVA 4HM1B 2C10A 3M8CA 3LYGA 1SIHA 1AV4A 4BTXA 1Q42A 1K41A 2K0MA 3X3YA 1WNHA 2GU3A 3H51A 1FGQA 1OF5B 3N54B 2PZVA 3UNLA 1FUWA 1NDOB 3DY5A 1SQWA 4FCZA 2XGLA 3H3HA 4HZBB 3UJMA 1PFPA 3ALAA 5I97A 1IVUA 4MJDA 3NQYA 1M1K4 1VQ53 2W04A 1O7MB 4CDLA 3DGLA 4WHAA 1STDA 1NJI4 3KKGA 2OCTA 4X2HA 3SOYA 4LZIA 4JRFA 4XM4A 5LC6A 1LXEA 1E97A 5AEUB 1VQ63 2OOVA 1IDPA 5G2GA 3UL5A 1RJOA 4N6NB 5JPPA 1K8A4 3EBTA 3LMLA 3NV0B 5BVBA 2B1XB 3EX9A 3FGYA 4TX4A 1W7CA 2OTL3 4RBNA 3OWUA 4WFOA 3AMOA 2CIUA 4N6MA 2OQEA 4OK0A 4XBYA 4ZM8A 1WMPA 3KSED 2E2VA 3JUQA 5JPUA 4R9LA 3U1WA 1JN5B 1US1A 1FGMA 1UW1A 4MMXB 3DUKA 2GEYA 2WGOA 4RZMA 3CCQ3 1CEWI 1OUNA 2JDIH 4EV5A 1ISKA 5ELUA 5LC7A 4FMAA 4XB5A 1W5ZA 3V99A 4O2HA 4N3VA 2YFLB 1NU3A 4QWTA 3CPOA 3CME3 1TUHA 4FCMA 2YFJB 4O8SA 3S5CA 1AR0A 4EXRA 1GY6A 1BUQA 3PCSA 3G8ZA 1NO3A 2OOVC 4KFDA 2CG0A 2BNGA 1KWIA 1SJWA 3LT8A 5DRVA 5AI1A 1E3VA 3V98A 3CCR3 1ULJB 3DXOA 2GU1A 3N8BA 1RRLA 4XBTA 2RSXA 3NBRA 2CFDA 3DM8A 2FNQA 3FSDA 2GEXA 2WOFA 3ECFA 3NV0A 5FW5A 6STDA 1LOXA 4R1KA 4U13A 3WODG 2P0XA 2W9QA 3FZWA 3U97A 1LNHA 2IUKA 3MG1A 3KIIA 5FGOA 1ZX2A 1QVG2 2XFSA 1E3RA 3LTCA 2FGTA 3X42A 1M1XB 5DREA 3CCU3 4HJLB 3CPW2 4EC6A 3GRDA 3G6E3 1VQ83 3GZXB 4CCVA 2GXFA 5IERA 5CXOA 3OXAA 4XDVA 5KP1A 1CYVA 4N6OB 3S67A 1A2VA 4N6TA 1OHOA 4L8PA 2Q07A 1O7NB 1VQ93 5AIHA 3MG3A 2Z6BA 3NM7A 3AMOB 2C11A 2FXTA 2QA43 3WMDA 3MYTA 1IQYA 3PCRA 4K1VA 5IEPA 3FF2A 2QIYA 3EBYA 3K5TA 1PU4A 1N5PA 1O7HB 5D82A 5AIFA 4NREA 1JRQA 3FF0A 3NUVA 3EF8A 4FMBA 2O9UX 1K734 5IG4A 1QAKA 2R4IA 1YJW3 1FGTA 2YFIB 3KN4A 3HX8A 2OTJ3 2F98A 3CC43 1WMOA 3HK4A 1MNLA 2IA7A 1N9JA 3JUNA 4HM0B 3EQQB 4PEJA 3KFQC 3K63A 4WWUC 3WDGB 3LTBA 2Y74A 1UI7A 2CG1A 7STDA 1RN7A 1DMQA 2MF7A 4O02B 1YI23 2GBWB 2CHCA 4ORLA 1GY7A 3CC23 4MMYB 1ASKA 3S29A 1EG9B 1IT8A 3F7XA 3G4S3 3PYJA 2XF3A 1WTHA 3A76A 1IK3A 3K9MC 5TGNA 3J7Yd 3IMAB 3HIGA 1W00A 1TP6A 1FGRA 4H61A 2GBXB 4FCJA 4HM3B 2LYXA 1WMNA 3SLUA 4HKVB 2XSOB 3OWYA 5EEOA 1YJ93 1SIIA 3DMCA 1N8QA 3B8LA 3NBJA 1KC84 3JUMA 1OACA 1L5GB 5AYRB 4R4KA 2CK3H 1GYBA 1AVLA 2RCDA 2W03A 1IV9A 1QJGA 3STDA 3PZWA 4KZ1A 4FMDA 2BT3A 2BHMA 2L4VA 4LGQA 2Z76A 3LT9A 3WA3A 5IW9A 2W6JH 1A2KA 1IVVA 1CQSA 2RGQA 2F86B 3NM2A 4AEQA 1U8CB 2CWVA 2HMKB 3OX9A 3I0YA 3CD63 3B7CA 4GB5A 5IEOA 3RGAA 2HMLB 4NHFA 3CCJ3 3JUPA 1AVKA 1DYUA 4K61A 2O3OA 2PNCA 2W56A 2QGUA 2M7OA 2W2CA 3MSOA 3FG3A 1DMNA 8CHOA 1FA3A 2XH9A 4EV2A 3NXJA 3FCSB 1JB2A 3MPHA 3CXC2 4R80A 3NBBA 1W6CA 3EN1B 1Z1SA 1O7GB 5CLKA 2JQ5A 4KVHA 2ML6A 4HM6B 4WYKA 1VQP3 5CF2A 1JJ22 4L7KA 5D81A 2W9PA 3PXMA 1TFKA 2P0MA 3HIIA 3Q90A 5HGRA 3MWZA 2RFRA 5IG3A 2D42A 3CCM3 2A15A 2IMJA 1IU7A 3FKAA 2P09A 5STDA 3CC73 4HM7B 3S28A 3WOFB 3X41A 3JUOA 2XSHB 2CC3A 2LQVA 3OV4A 1N9EA 2STDA 1YVBI 1GS3A 3FH1A 1IQXA 3Q2PA 4HM4B 1YJN3 3K7CA 5CF1A 3B4PA 2WO0A 1M9GA 2XFTA 1W2B2 1W2ZA 1N8R4 1JNQA 1QAFA 3CU3A 3MKIA 3X3XA 2Z7AA 4IT7A 1VQ43 1TFOA 3EN8A 2B24B 2KXGA 3BNDA 4HVNA 5CK6A 4L8OA 1A67A 3BNCA 3X3ZA 2OWPA 4J9AA 4HZ9B 1JB5A 3GZRA 3FG1A 1R4CA 3JVCA 2BMOB 3LXUX 4J8TA 3GZBA 1CYUA 3T8NA 1OHSA 1V74A 4OUQA 2P38A 3HI7A 5A0OB 3EE1A 3LTAA 4RNZA 3VF1A 2BO9B 1MOLA 4H3UA 3RDEA 2E2TA 3DZLA 1YHQ3 2V1LA 3IPTA 1C7HA 1NWWA 4HM2B 3CCS3 1IQ8A 1GD4A 4AKYA 2W56B 2WGQA 1JV2B 4MEIA 3SOAA 3TDGA 5JBSA 3X40A 1HKXA 3E99A 4K1UA 1STFI 3IJEB 4N6LA 3FLJA 3LTDA 4X2OA 1W02A 4FR9A 3O8YA 2SBLA 1TU5A 5D83A 1OPYA 2HMOB 1RRHA 2KRTA 1UUWB 3CCV3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW9 A;  2FXT A;  3J7Y d;  3QK9 A; 
#chains in the Genus database with same CATH topology
 1BUJ A;  1O7W B;  2XR8 B;  4STD A;  2CWU A;  1M90 4;  4WYK B;  1W6Y A;  3CCL 3;  2CFK A;  3DGN A;  3BNE A;  1BU4 A;  3UL6 A;  3CNX A;  2F99 A;  1Y4K A;  4EYC A;  1TRP A;  3N9H A;  4Q53 A;  3QK9 A;  1HZ1 A;  3I56 3;  1BRS A;  2Y73 A;  1KQS 2;  1TIJ A;  1JKG A;  1Q86 4;  3SED A;  3CNM A;  2MC8 A;  4XDW A;  4RNY A;  3ER7 A;  2CW9 A;  4GL6 A;  5ELJ A;  4KFF A;  1EA2 A;  1QAL A;  1GMP A;  2F4Y A;  2ML5 A;  4O3V A;  3EC9 A;  4AKZ A;  3FG4 A;  1IT7 A;  2Z77 A;  1VQO 3;  3KZT A;  3DGO A;  1G96 A;  1A90 A;  1BRI A;  1RGG A;  1UUV B;  1IVX A;  1GD3 A;  3DGM A;  2HMN B;  3Q1C A;  5AYS C;  1BVI A;  3B4O A;  3BLZ A;  4IIA A;  3F7S A;  3G16 A;  1VQM 3;  1F8N A;  1VQL 3;  4LMI A;  3EHC A;  3UB1 A;  1YGW A;  1W4N A;  4EBG A;  1JB4 A;  3NX0 A;  4I4K A;  3EJV A;  4N6U A;  5G1K A;  2XRX B;  1UI8 A;  4HBR A;  5BXQ A;  4XBX A;  1C54 A;  2ZL8 A;  1Q40 A;  4IPB A;  5IF6 A;  3T8U A;  3EB8 A;  2RBI A;  2YX9 A;  1EKM A;  2ZHX B;  4K90 B;  3I55 3;  3SXX A;  4J5K A;  2IUJ A;  3WA2 X;  3UJM A;  1UCL A;  3LH4 A;  5EQL A;  1OF5 A;  3LZA A;  1QVF 2;  1RGE A;  3PGB A;  1IV7 A;  3PS8 A;  4BTY A;  5EVH A;  3ROB A;  1X1W A;  3GZY B;  3NQZ A;  2CFW A;  1RLS A;  3SYU A;  3OWS A;  4KFE A;  2W0Q A;  1T5Y A;  2KAA A;  3MG2 A;  5IEN A;  3CMA 3;  4KT3 B;  3OW2 2;  1ROV A;  3S27 A;  3T0U A;  1BSC A;  5IG5 A;  2KCD A;  4OVM A;  3CCE 3;  1Q82 4;  1O7P B;  3GSP A;  2HMJ B;  4HM5 B;  1HU9 A;  1I70 A;  2D1W A;  1RKY A;  2CFG A;  3MHE A;  4HM8 B;  1U5O A;  1SPU A;  3F8X A;  1DVC A;  2INX A;  3GAX A;  1IVW A;  3VSY A;  1S72 3;  4BTW A;  1UDI I;  2OQE C;  2BMQ B;  2WOH A;  3F9S A;  1OGX A;  3L0R A;  4LEH A;  4G1M B;  3V92 A;  3RGR A;  1NB3 I;  1EQK A;  1N5H A;  1ZO2 A;  1RGL A;  5KP3 A;  1S5A A;  2HOH A;  2ZDJ A;  1FZU A;  3HOH A;  5IG0 A;  3KE7 A;  2CWT A;  3BNB A;  2K54 A;  3F40 A;  1OHP A;  1FUS A;  4MMZ B;  1I0X A;  1JKG B;  1UCJ A;  4HAA A;  1D6Z A;  1Q7H A;  1DMM A;  3WOE B;  1LOY A;  2P05 A;  1JN5 A;  5M18 A;  1ZS7 A;  1YIJ 3;  4FMC A;  1VQN 3;  9RNT A;  7GSP A;  1PYL A;  3KSP A;  3GWR A;  4EW5 A;  1EEJ A;  1W6G A;  1VQQ A;  1OGZ A;  1I3F A;  2QEX 3;  3LOY A;  2CH9 A;  1FGO A;  1WQL B;  1DET A;  1GMQ A;  1OH0 A;  1YGE A;  5AII A;  3VGN A;  1K28 A;  5KP4 A;  1Q81 4;  2H0G A;  4JF8 A;  1MWU A;  3G71 3;  2XEP A;  4N6V 0;  1NB5 I;  3SVA A;  1D6Y A;  3D9R A;  4BL2 A;  5AIG A;  1Q7Y 4;  4R9K A;  1VQ7 3;  1W01 A;  3SX1 A;  3K0Z A;  1G0T A;  1GOY A;  2XGN A;  2ZA4 A;  3D3L A;  3F8H A;  1J2B A;  1HYF A;  1BNR A;  2CFL A;  2HMM B;  1YIT 3;  1K9M 4;  1ROA A;  1B2Z A;  1X1U A;  2E2U A;  4WP5 A;  3NHX A;  1BRN L;  1ULI B;  1VQK 3;  1RN1 A;  3HZP A;  4HYZ A;  3BB9 A;  3G0K A;  1GY5 A;  2BMR B;  1KSI A;  5AEW B;  4LSO A;  1D6U A;  3D4A A;  1PY3 A;  1LVN A;  2UX0 A;  3F14 A;  3QRD A;  1Q40 B;  3WR2 A;  1DE3 A;  1VZZ A;  4CPK A;  1I2F A;  1KD1 4;  1QMA A;  2I9W A;  1BRG A;  2CKF B;  1OCV A;  4HM1 B;  2C10 A;  3M8C A;  3LYG A;  1SIH A;  1AV4 A;  4BTX A;  1Q42 A;  1K41 A;  2K0M A;  3X3Y A;  1WNH A;  2GU3 A;  1RGF A;  3H51 A;  1FGQ A;  1OF5 B;  1B2U A;  3N54 B;  2PZV A;  3UNL A;  1FUW A;  1NDO B;  3DY5 A;  1SQW A;  4FCZ A;  1BRK A;  2KF6 A;  2XGL A;  3H3H A;  1PFP A;  3ALA A;  4HZB B;  5I97 A;  1IVU A;  4MJD A;  3NQY A;  2KF4 A;  1M1K 4;  2W04 A;  1VQ5 3;  1O7M B;  4CDL A;  3DGL A;  4WHA A;  1STD A;  1NJI 4;  1RHL A;  2GSP A;  2OCT A;  3KKG A;  4X2H A;  5G1L A;  1UCK A;  3D5I A;  4LZI A;  3SOY A;  4JRF A;  4XM4 A;  1MWS A;  5LC6 A;  1LXE A;  1E97 A;  5AEU B;  1VQ6 3;  2OOV A;  1IDP A;  5G2G A;  3UL5 A;  4ILF A;  1RJO A;  4N6N B;  5JPP A;  1K8A 4;  1V58 A;  3A5E A;  3EBT A;  1RCK A;  3LML A;  1LOV A;  3NV0 B;  5BVB A;  2B1X B;  3EX9 A;  3FGY A;  4TX4 A;  1W7C A;  2OTL 3;  4RBN A;  3OWU A;  4WFO A;  3AMO A;  2CIU A;  4N6M A;  2OQE A;  1FYS A;  4OK0 A;  4XBY A;  4ZM8 A;  1BSB A;  1WMP A;  1AY7 A;  3KSE D;  1BNJ A;  2E2V A;  3JUQ A;  5JPU A;  1RMS A;  4R9L A;  3U1W A;  1T2I A;  3WHO A;  1JN5 B;  1US1 A;  1JBT A;  1FGM A;  1UW1 A;  4MMX B;  3DUK A;  2GEY A;  2F5M A;  2WGO A;  4RZM A;  5HOH A;  3CCQ 3;  3BIR A;  3ZFZ A;  1RGH A;  1CEW I;  1OUN A;  1UCI A;  2JDI H;  4EV5 A;  1ISK A;  5ELU A;  5LC7 A;  4FMA A;  4XB5 A;  1W5Z A;  2UGI A;  3V99 A;  4O2H A;  1BNF A;  4N3V A;  2YFL B;  1NU3 A;  4QWT A;  1TTO A;  3CPO A;  3CME 3;  1TUH A;  4FCM A;  2YFJ B;  3Q3F A;  1B27 A;  1BRJ A;  1BSE A;  4O8S A;  3S5C A;  1AR0 A;  4EXR A;  1GY6 A;  1BUQ A;  1CH0 A;  3PCS A;  3G8Z A;  1NO3 A;  2OOV C;  1LQG C;  3D79 A;  1BAN A;  4KFD A;  2CG0 A;  1I2E A;  1MGW A;  2BNG A;  1KWI A;  1SJW A;  3LT8 A;  5DRV A;  5AI1 A;  1E3V A;  3V98 A;  3CCR 3;  1ULJ B;  1YVS A;  3DXO A;  4I5Q A;  1LOW A;  2K3D A;  2GU1 A;  3N8B A;  1RRL A;  4XBT A;  2RSX A;  2KRT A;  2CFD A;  3NBR A;  2BU4 A;  3DM8 A;  2FNQ A;  3FSD A;  2GEX A;  2WOF A;  3ECF A;  3NV0 A;  5FW5 A;  4RNT A;  6STD A;  1LOX A;  1V57 A;  4R1K A;  4U13 A;  3WOD G;  2P0X A;  2W9Q A;  3FZW A;  1NNV A;  4NPB A;  3U97 A;  1T2H A;  1BNS A;  1LNH A;  1RDS A;  2IUK A;  3MG1 A;  3KII A;  5FGO A;  1ZX2 A;  1QVG 2;  2XFS A;  1E3R A;  1BNG A;  3LTC A;  2AAD A;  2FGT A;  3X42 A;  1M1X B;  5DRE A;  3CCU 3;  4HJL B;  3CPW 2;  4EC6 A;  3GRD A;  3G6E 3;  1VQ8 3;  3DGY A;  3GZX B;  4CCV A;  2GXF A;  5IER A;  1JZO A;  3OXA A;  4XDV A;  5CXO A;  5KP1 A;  1CYV A;  1I2G A;  4N6O B;  1Q9E A;  3S67 A;  1A2V A;  4N6T A;  1OHO A;  2F56 A;  1BNI A;  1IYY A;  4L8P A;  2Q07 A;  1O7N B;  1VQ9 3;  5AIH A;  3MG3 A;  2Z6B A;  3NM7 A;  3AMO B;  2C11 A;  1AQZ A;  2FXT A;  2QA4 3;  3WMD A;  3MYT A;  1IQY A;  3PCR A;  4K1V A;  5IEP A;  1RGC A;  3FF2 A;  4BU4 A;  2QIY A;  1RSN A;  2J8X B;  3EBY A;  3K5T A;  2H0H A;  1PU4 A;  1N5P A;  1O7H B;  1BNE A;  5D82 A;  3AHS A;  5AIF A;  4NRE A;  1JRQ A;  3FF0 A;  3NUV A;  3EF8 A;  4FMB A;  2O9U X;  2CX1 A;  1K73 4;  4BL3 A;  1RCL A;  2SAR A;  5IG4 A;  1QAK A;  1RGK A;  2R4I A;  1YJW 3;  4BIR A;  1FGT A;  2YFI B;  4CJN A;  3KN4 A;  3HX8 A;  2OTJ 3;  1BIR A;  2F98 A;  1EUI C;  4J5G A;  2CX0 A;  2KF5 A;  4LYL B;  3CC4 3;  1WMO A;  3HK4 A;  1MNL A;  2AAE A;  2IA7 A;  1N9J A;  3JUN A;  4HM0 B;  4DKI A;  3EQQ B;  1BRH A;  4PEJ A;  3KFQ C;  3K63 A;  4WWU C;  3WDG B;  3LTB A;  2Y74 A;  1UI7 A;  2CG1 A;  1MWT A;  7STD A;  1RN7 A;  1DMQ A;  2MF7 A;  4O02 B;  1YI2 3;  2GBW B;  2CHC A;  4ORL A;  3AGO A;  1GY7 A;  4HOH A;  3AHW A;  3CC2 3;  4MMY B;  1ASK A;  3S29 A;  1EG9 B;  1IT8 A;  1T3B A;  3F7X A;  3PYJ A;  3G4S 3;  2XF3 A;  1WTH A;  3A76 A;  1IK3 A;  3K9M C;  5TGN A;  3J7Y d;  3IMA B;  3HIG A;  1W00 A;  1B21 A;  1A2P A;  1FGR A;  1TP6 A;  1UUG B;  4H61 A;  2GBX B;  4FCJ A;  4HM3 B;  2LYX A;  1WMN A;  3SLU A;  4HKV B;  2XSO B;  3OWY A;  5BU4 A;  5EEO A;  1YJ9 3;  1SII A;  3DMC A;  1N8Q A;  3B8L A;  3NBJ A;  1KC8 4;  3JUM A;  2KF3 A;  1OAC A;  1L5G B;  1TJD A;  1UGH I;  5AYR B;  4R4K A;  2CK3 H;  1GOU A;  1FUT A;  1GYB A;  2IYJ A;  1AVL A;  2RCD A;  1B2X A;  1IV9 A;  2W03 A;  1QJG A;  3STD A;  2RNT A;  3PZW A;  3KCH A;  4FMD A;  4KZ1 A;  7RNT A;  2BHM A;  2BT3 A;  2L4V A;  1I8V A;  1LQM B;  2Z76 A;  3LT9 A;  4LGQ A;  3WA3 A;  5IW9 A;  2W6J H;  1LNI A;  3RNT A;  1A2K A;  1IVV A;  1CQS A;  2RGQ A;  2F86 B;  3NM2 A;  4AEQ A;  1U8C B;  2CWV A;  2HMK B;  3OX9 A;  1BGS A;  3I0Y A;  3B7C A;  5BIR A;  3CD6 3;  4GB5 A;  5IEO A;  3RGA A;  2HML B;  4NHF A;  8RNT A;  3CCJ 3;  3JUP A;  1DYU A;  1AVK A;  4K61 A;  1X1X A;  1JBR A;  1MWR A;  2O3O A;  2PNC A;  2W56 A;  2QGU A;  1ZGX A;  2M7O A;  1RNB A;  2W2C A;  3MSO A;  3FG3 A;  3ZG5 A;  1DMN A;  8CHO A;  1FA3 A;  5M1A A;  2XH9 A;  4EV2 A;  3NXJ A;  3FCS B;  1JB2 A;  3MPH A;  3CXC 2;  4R80 A;  1B2M A;  3NBB A;  1B3S A;  1FW7 A;  1BAO A;  1W6C A;  3EN1 B;  1Z1S A;  1O7G B;  5CLK A;  2JQ5 A;  4KVH A;  2ML6 A;  4HM6 B;  4WYK A;  1UGI A;  5CF2 A;  5M19 A;  1VQP 3;  3DH2 A;  1JJ2 2;  2C4B A;  1I3I A;  4L7K A;  4GSP A;  5D81 A;  2W9P A;  2IY2 A;  3PXM A;  1TFK A;  3D5G A;  2P0M A;  3HII A;  3Q90 A;  5HGR A;  3MWZ A;  2RFR A;  5IG3 A;  2D42 A;  3CCM 3;  2A15 A;  1BSD A;  2IMJ A;  1IU7 A;  1JBS A;  6RNT A;  3FKA A;  2P09 A;  5STD A;  3CC7 3;  4HM7 B;  3S28 A;  3WOF B;  3X41 A;  2F5W A;  3JUO A;  2XSH B;  2CC3 A;  2LQV A;  3OV4 A;  1N9E A;  2STD A;  1YVB I;  1GS3 A;  1RTU A;  3FH1 A;  1IQX A;  3Q2P A;  4HM4 B;  5GSP A;  1YJN 3;  3K7C A;  5CF1 A;  3B4P A;  2WO0 A;  1GSP A;  3URP A;  1YNV X;  1G02 A;  6GSP A;  1M9G A;  2XFT A;  1W2B 2;  1W2Z A;  1N8R 4;  5RNT A;  1R4Y A;  1DVD A;  1JNQ A;  1QAF A;  3CU3 A;  3MKI A;  3X3X A;  4GHO A;  2Z7A A;  4IT7 A;  1VQ4 3;  1TFO A;  2H0I A;  3EN8 A;  2B24 B;  2KXG A;  3BND A;  4HVN A;  5CK6 A;  4L8O A;  1A67 A;  2L1S A;  2R41 A;  3BNC A;  3X3Z A;  2OWP A;  4J9A A;  4HZ9 B;  1B2S A;  1JB5 A;  3GZR A;  3FG1 A;  1R4C A;  3JVC A;  2BMO B;  3LXU X;  4J8T A;  3GZB A;  1CYU A;  3T8N A;  1OHS A;  1V74 A;  4OUQ A;  1JZD A;  1X1Y A;  2P38 A;  3ZG0 A;  3BU4 A;  3HI7 A;  1TRQ A;  5A0O B;  3EE1 A;  3LTA A;  4RNZ A;  3VF1 A;  1B20 A;  2BO9 B;  1MOL A;  4H3U A;  1GMR A;  2BIR A;  3RDE A;  1RN4 A;  2E2T A;  3DZL A;  1YHQ 3;  1I0V A;  1RGA A;  2V1L A;  3IPT A;  1C7H A;  1NWW A;  4HM2 B;  3CCS 3;  1IQ8 A;  1GD4 A;  1BSA A;  4AKY A;  1RNT A;  2W56 B;  2WGQ A;  1JV2 B;  4MEI A;  3SOA A;  3TDG A;  5JBS A;  3X40 A;  1HKX A;  3AGN A;  3E99 A;  4K1U A;  1LRA A;  1STF I;  3IJE B;  1SAR A;  4N6L A;  3FLJ A;  2UUG C;  3LTD A;  4X2O A;  1W02 A;  4FR9 A;  3O8Y A;  2SBL A;  1BOX A;  1MGR A;  1TU5 A;  5D83 A;  1OPY A;  2HMO B;  1RRH A;  1GOV A;  1UUW B;  3CCV 3; 
#chains in the Genus database with same CATH homology
 1O7W B;  2XR8 B;  4STD A;  2CWU A;  1M90 4;  4WYK B;  1W6Y A;  3CCL 3;  2CFK A;  3DGN A;  3BNE A;  3UL6 A;  4EYC A;  3CNX A;  2F99 A;  1Y4K A;  3N9H A;  4Q53 A;  3QK9 A;  3I56 3;  2Y73 A;  1KQS 2;  1TIJ A;  1JKG A;  1Q86 4;  3SED A;  3CNM A;  2MC8 A;  4XDW A;  4RNY A;  3ER7 A;  2CW9 A;  4GL6 A;  5ELJ A;  4KFF A;  1EA2 A;  1QAL A;  2ML5 A;  4O3V A;  3EC9 A;  4AKZ A;  3FG4 A;  1IT7 A;  2Z77 A;  1VQO 3;  3KZT A;  3DGO A;  1G96 A;  1A90 A;  1UUV B;  1IVX A;  1GD3 A;  3DGM A;  2HMN B;  3Q1C A;  5AYS C;  3B4O A;  3BLZ A;  4IIA A;  3F7S A;  3G16 A;  1VQM 3;  1F8N A;  1VQL 3;  4LMI A;  3EHC A;  3UB1 A;  1W4N A;  4EBG A;  1JB4 A;  3NX0 A;  4I4K A;  3EJV A;  4N6U A;  5BXQ A;  2XRX B;  1UI8 A;  4HBR A;  4XBX A;  2ZL8 A;  1Q40 A;  4IPB A;  5IF6 A;  3T8U A;  3EB8 A;  2YX9 A;  1EKM A;  4K90 B;  3I55 3;  3SXX A;  2IUJ A;  3WA2 X;  3LH4 A;  5EQL A;  1OF5 A;  3LZA A;  1QVF 2;  3PGB A;  1IV7 A;  3PS8 A;  4BTY A;  5EVH A;  3ROB A;  3GZY B;  3NQZ A;  2CFW A;  3OWS A;  4KFE A;  2W0Q A;  1T5Y A;  3MG2 A;  5IEN A;  3CMA 3;  3OW2 2;  1ROV A;  3S27 A;  3T0U A;  5IG5 A;  2KCD A;  4OVM A;  3CCE 3;  1Q82 4;  1O7P B;  4HM5 B;  2HMJ B;  1HU9 A;  2D1W A;  1RKY A;  2CFG A;  3MHE A;  4HM8 B;  1U5O A;  1SPU A;  3F8X A;  1DVC A;  2INX A;  3GAX A;  1IVW A;  3VSY A;  1S72 3;  4BTW A;  2OQE C;  2BMQ B;  2WOH A;  3F9S A;  1OGX A;  3L0R A;  4LEH A;  4G1M B;  3V92 A;  3RGR A;  1NB3 I;  1EQK A;  1N5H A;  1ZO2 A;  5KP3 A;  1S5A A;  2ZDJ A;  5IG0 A;  3KE7 A;  2CWT A;  3BNB A;  2K54 A;  3F40 A;  1OHP A;  4MMZ B;  1JKG B;  1D6Z A;  3WOE B;  1DMM A;  1YIJ 3;  1DVD A;  2P05 A;  1JN5 A;  1VQN 3;  4FMC A;  3KSP A;  3GWR A;  1W6G A;  1OGZ A;  2QEX 3;  3LOY A;  2CH9 A;  1FGO A;  1WQL B;  1YGE A;  5AII A;  1OH0 A;  3VGN A;  5KP4 A;  1Q81 4;  1K28 A;  4JF8 A;  3G71 3;  2XEP A;  4N6V 0;  1NB5 I;  3SVA A;  1D6Y A;  3D9R A;  5AIG A;  1Q7Y 4;  4R9K A;  1VQ7 3;  1W01 A;  3SX1 A;  3K0Z A;  2XGN A;  3F8H A;  1J2B A;  3D3L A;  2CFL A;  2HMM B;  1YIT 3;  1K9M 4;  1ROA A;  4WP5 A;  2E2U A;  3NHX A;  1ULI B;  1VQK 3;  3HZP A;  4HYZ A;  3BB9 A;  3G0K A;  1GY5 A;  2BMR B;  1KSI A;  5AEW B;  4LSO A;  1D6U A;  1LVN A;  2UX0 A;  3F14 A;  3QRD A;  1Q40 B;  1VZZ A;  1KD1 4;  1QMA A;  2I9W A;  2CKF B;  1OCV A;  4HM1 B;  2C10 A;  3M8C A;  3LYG A;  1SIH A;  1AV4 A;  4BTX A;  1Q42 A;  1K41 A;  2K0M A;  3X3Y A;  1WNH A;  2GU3 A;  3H51 A;  1FGQ A;  1OF5 B;  3N54 B;  2PZV A;  3UNL A;  1FUW A;  1NDO B;  3DY5 A;  1SQW A;  4FCZ A;  2XGL A;  3H3H A;  4HZB B;  3UJM A;  1PFP A;  3ALA A;  5I97 A;  1IVU A;  4MJD A;  3NQY A;  1M1K 4;  1VQ5 3;  2W04 A;  1O7M B;  4CDL A;  3DGL A;  4WHA A;  1STD A;  1NJI 4;  3KKG A;  2OCT A;  4X2H A;  3SOY A;  4LZI A;  4JRF A;  4XM4 A;  5LC6 A;  1LXE A;  1E97 A;  5AEU B;  1VQ6 3;  2OOV A;  1IDP A;  5G2G A;  3UL5 A;  1RJO A;  4N6N B;  5JPP A;  1K8A 4;  3EBT A;  3LML A;  3NV0 B;  5BVB A;  2B1X B;  3EX9 A;  3FGY A;  4TX4 A;  1W7C A;  2OTL 3;  4RBN A;  3OWU A;  4WFO A;  3AMO A;  2CIU A;  4N6M A;  2OQE A;  4OK0 A;  4XBY A;  4ZM8 A;  1WMP A;  3KSE D;  2E2V A;  3JUQ A;  5JPU A;  4R9L A;  3U1W A;  1JN5 B;  1US1 A;  1FGM A;  1UW1 A;  4MMX B;  3DUK A;  2GEY A;  2WGO A;  4RZM A;  3CCQ 3;  1CEW I;  1OUN A;  2JDI H;  4EV5 A;  1ISK A;  5ELU A;  5LC7 A;  4FMA A;  4XB5 A;  1W5Z A;  3V99 A;  4O2H A;  4N3V A;  2YFL B;  1NU3 A;  4QWT A;  3CPO A;  3CME 3;  1TUH A;  4FCM A;  2YFJ B;  4O8S A;  3S5C A;  1AR0 A;  4EXR A;  1GY6 A;  1BUQ A;  3PCS A;  3G8Z A;  1NO3 A;  2OOV C;  4KFD A;  2CG0 A;  2BNG A;  1KWI A;  1SJW A;  3LT8 A;  5DRV A;  5AI1 A;  1E3V A;  3V98 A;  3CCR 3;  1ULJ B;  3DXO A;  2GU1 A;  3N8B A;  1RRL A;  4XBT A;  2RSX A;  3NBR A;  2CFD A;  3DM8 A;  2FNQ A;  3FSD A;  2GEX A;  2WOF A;  3ECF A;  3NV0 A;  5FW5 A;  6STD A;  1LOX A;  4R1K A;  4U13 A;  3WOD G;  2P0X A;  2W9Q A;  3FZW A;  3U97 A;  1LNH A;  2IUK A;  3MG1 A;  3KII A;  5FGO A;  1ZX2 A;  1QVG 2;  2XFS A;  1E3R A;  3LTC A;  2FGT A;  3X42 A;  1M1X B;  5DRE A;  3CCU 3;  4HJL B;  3CPW 2;  4EC6 A;  3GRD A;  3G6E 3;  1VQ8 3;  3GZX B;  4CCV A;  2GXF A;  5IER A;  5CXO A;  3OXA A;  4XDV A;  5KP1 A;  1CYV A;  4N6O B;  3S67 A;  1A2V A;  4N6T A;  1OHO A;  4L8P A;  2Q07 A;  1O7N B;  1VQ9 3;  5AIH A;  3MG3 A;  2Z6B A;  3NM7 A;  3AMO B;  2C11 A;  2FXT A;  2QA4 3;  3WMD A;  3MYT A;  1IQY A;  3PCR A;  4K1V A;  5IEP A;  3FF2 A;  2QIY A;  3EBY A;  3K5T A;  1PU4 A;  1N5P A;  1O7H B;  5D82 A;  5AIF A;  4NRE A;  1JRQ A;  3FF0 A;  3NUV A;  3EF8 A;  4FMB A;  2O9U X;  1K73 4;  5IG4 A;  1QAK A;  2R4I A;  1YJW 3;  1FGT A;  2YFI B;  3KN4 A;  3HX8 A;  2OTJ 3;  2F98 A;  3CC4 3;  1WMO A;  3HK4 A;  1MNL A;  2IA7 A;  1N9J A;  3JUN A;  4HM0 B;  3EQQ B;  4PEJ A;  3KFQ C;  3K63 A;  4WWU C;  3WDG B;  3LTB A;  2Y74 A;  1UI7 A;  2CG1 A;  7STD A;  1RN7 A;  1DMQ A;  2MF7 A;  4O02 B;  1YI2 3;  2GBW B;  2CHC A;  4ORL A;  1GY7 A;  3CC2 3;  4MMY B;  1ASK A;  3S29 A;  1EG9 B;  1IT8 A;  3F7X A;  3G4S 3;  3PYJ A;  2XF3 A;  1WTH A;  3A76 A;  1IK3 A;  3K9M C;  5TGN A;  3J7Y d;  3IMA B;  3HIG A;  1W00 A;  1TP6 A;  1FGR A;  4H61 A;  2GBX B;  4FCJ A;  4HM3 B;  2LYX A;  1WMN A;  3SLU A;  4HKV B;  2XSO B;  3OWY A;  5EEO A;  1YJ9 3;  1SII A;  3DMC A;  1N8Q A;  3B8L A;  3NBJ A;  1KC8 4;  3JUM A;  1OAC A;  1L5G B;  5AYR B;  4R4K A;  2CK3 H;  1GYB A;  1AVL A;  2RCD A;  2W03 A;  1IV9 A;  1QJG A;  3STD A;  3PZW A;  4KZ1 A;  4FMD A;  2BT3 A;  2BHM A;  2L4V A;  4LGQ A;  2Z76 A;  3LT9 A;  3WA3 A;  5IW9 A;  2W6J H;  1A2K A;  1IVV A;  1CQS A;  2RGQ A;  2F86 B;  3NM2 A;  4AEQ A;  1U8C B;  2CWV A;  2HMK B;  3OX9 A;  3I0Y A;  3CD6 3;  3B7C A;  4GB5 A;  5IEO A;  3RGA A;  2HML B;  4NHF A;  3CCJ 3;  3JUP A;  1AVK A;  1DYU A;  4K61 A;  2O3O A;  2PNC A;  2W56 A;  2QGU A;  2M7O A;  2W2C A;  3MSO A;  3FG3 A;  1DMN A;  8CHO A;  1FA3 A;  2XH9 A;  4EV2 A;  3NXJ A;  3FCS B;  1JB2 A;  3MPH A;  3CXC 2;  4R80 A;  3NBB A;  1W6C A;  3EN1 B;  1Z1S A;  1O7G B;  5CLK A;  2JQ5 A;  4KVH A;  2ML6 A;  4HM6 B;  4WYK A;  1VQP 3;  5CF2 A;  1JJ2 2;  4L7K A;  5D81 A;  2W9P A;  3PXM A;  1TFK A;  2P0M A;  3HII A;  3Q90 A;  5HGR A;  3MWZ A;  2RFR A;  5IG3 A;  2D42 A;  3CCM 3;  2A15 A;  2IMJ A;  1IU7 A;  3FKA A;  2P09 A;  5STD A;  3CC7 3;  4HM7 B;  3S28 A;  3WOF B;  3X41 A;  3JUO A;  2XSH B;  2CC3 A;  2LQV A;  3OV4 A;  1N9E A;  2STD A;  1YVB I;  1GS3 A;  3FH1 A;  1IQX A;  3Q2P A;  4HM4 B;  1YJN 3;  3K7C A;  5CF1 A;  3B4P A;  2WO0 A;  1M9G A;  2XFT A;  1W2B 2;  1W2Z A;  1N8R 4;  1JNQ A;  1QAF A;  3CU3 A;  3MKI A;  3X3X A;  2Z7A A;  4IT7 A;  1VQ4 3;  1TFO A;  3EN8 A;  2B24 B;  2KXG A;  3BND A;  4HVN A;  5CK6 A;  4L8O A;  1A67 A;  3BNC A;  3X3Z A;  2OWP A;  4J9A A;  4HZ9 B;  1JB5 A;  3GZR A;  3FG1 A;  1R4C A;  3JVC A;  2BMO B;  3LXU X;  4J8T A;  3GZB A;  1CYU A;  3T8N A;  1OHS A;  1V74 A;  4OUQ A;  2P38 A;  3HI7 A;  5A0O B;  3EE1 A;  3LTA A;  4RNZ A;  3VF1 A;  2BO9 B;  1MOL A;  4H3U A;  3RDE A;  2E2T A;  3DZL A;  1YHQ 3;  2V1L A;  3IPT A;  1C7H A;  1NWW A;  4HM2 B;  3CCS 3;  1IQ8 A;  1GD4 A;  4AKY A;  2W56 B;  2WGQ A;  1JV2 B;  4MEI A;  3SOA A;  3TDG A;  5JBS A;  3X40 A;  1HKX A;  3E99 A;  4K1U A;  1STF I;  3IJE B;  4N6L A;  3FLJ A;  3LTD A;  4X2O A;  1W02 A;  4FR9 A;  3O8Y A;  2SBL A;  1TU5 A;  5D83 A;  1OPY A;  2HMO B;  1RRH A;  2KRT A;  1UUW B;  3CCV 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...