2FXTA

Crystal structure of yeast tim44
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
192
Chain Sequence
b'SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Import inner membrane translocase subunit TIM44
publication title Crystal Structure of Yeast Mitochondrial Peripheral Membrane Protein Tim44p C-terminal Domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 45
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2fxtA00
3J7Yd 3QK9A 2CW9A 2FXTA
chains in the Genus database with same CATH superfamily
3JUQA 2YFJB 3X3YA 3JUOA 3F40A 1O7NB 1RMSA 4NPBA 1O7HB 1BNSA 2SBLA 4RNTA 1K41A 1O7PB 1DE3A 5IG4A 3AGNA 1FGMA 3BLZA 1X1XA 4BL3A 3CCV3 1F8NA 2HMLB 1E3VA 1CEWI 1LQGC 3DGOA 1R4CA 2RBIA 1AQZA 3N8BA 1JKGA 3RGAA 1I2GA 4ZM8A 1JB5A 1BUJA 4XBTA 1BUQA 3B4PA 3F8HA 5M1AA 1TU5A 1W5ZA 3CCR3 3K7CA 2XSHB 2BNGA 3B4OA 3FH1A 2XEPA 3K0ZA 3DZLA 2CG1A 3GWRA 5D83A 4HM1B 1N9EA 2Y74A 1LRAA 1RRLA 3EF8A 1DMMA 2IA7A 4R80A 3ER7A 2P0XA 5G1KA 3Q3FA 3KN4A 1BSDA 1RGKA 4EW5A 4HJLB 1UW1A 2F86B 5KP3A 2F56A 2OWPA 2SARA 4MMYB 4TX4A 3X40A 3DGLA 4CPKA 1OH0A 3PYJA 1GOYA 1MWTA 1VQ73 3MKIA 3PGBA 3CCS3 3UL5A 2MF7A 1LOVA 3GZYB 2IY2A 4WWUC 1AVLA 1K28A 1BAOA 1IVWA 2KCDA 3B7CA 1YHQ3 3JVCA 3DGMA 2J8XB 3NX0A 4ILFA 2P09A 2P0MA 1JBRA 1KQS2 2W56A 2KF4A 1I3FA 2CX1A 2IMJA 3ECFA 3HOHA 4KT3B 3JUPA 1UGIA 2XGLA 3KE7A 1EEJA 3Q90A 5IG5A 1VQN3 4OVMA 1WQLB 1ISKA 1Q7HA 3DUKA 4QWTA 4O3VA 1DETA 1TFOA 1ASKA 1N9JA 3KSPA 3NV0A 5RNTA 1J2BA 1PU4A 1T2HA 3VGNA 4L7KA 2A15A 2BO9B 2O9UX 1MGRA 2W03A 4J5GA 4N6MA 3WDGB 3EX9A 4FCJA 1K9M4 3LXUX 2IUJA 1HKXA 1RJOA 2JDIH 1JRQA 4H61A 2W2CA 1BSCA 2RFRA 2CFGA 1TUHA 2E2UA 2HOHA 3FKAA 3LH4A 3CPOA 4FR9A 3FGYA 1JJ22 5AIHA 1UUGB 3D5IA 4FMCA 4G1MB 1RNBA 3NBRA 4HZBB 2Z77A 1KC84 3OWSA 2AADA 3GZRA 1IQXA 4FCMA 1BSBA 2CHCA 3UJMA 3I0YA 4LZIA 1G0TA 2CIUA 1VQP3 1I8VA 1T5YA 3S27A 3STDA 2YFLB 3IMAB 3HZPA 5KP4A 1QVF2 1N8R4 4BTYA 1LVNA 1M9GA 3LTBA 2AAEA 1D6ZA 3TDGA 1IU7A 1TTOA 3LT8A 1RDSA 1BSAA 1RRHA 1WMPA 3WOFB 3FF2A 1MNLA 3IPTA 3ZFZA 1OF5A 1RSNA 3PXMA 1HYFA 2XR8B 4HYZA 3CCE3 5GSPA 1PFPA 1VQ43 1FUTA 3G713 2KF3A 4XDVA 4NHFA 3HIIA 4HM7B 1DVCA 2KRTA 5AYSC 2OTL3 4JRFA 3MSOA 3MPHA 4HOHA 1B27A 2F5MA 1OACA 1Q40A 1SIIA 1IYYA 2D42A 2LYXA 4LSOA 5CK6A 2C4BA 2RNTA 1B2SA 2CWVA 2I9WA 3EE1A 1L5GB 3CXC2 1BNEA 1VQ63 1I70A 3AHWA 1JN5A 2Z76A 4WHAA 2C11A 1W02A 2KF6A 3FF0A 4O2HA 3LT9A 4XM4A 3D5GA 2IUKA 1MWSA 4MEIA 1DYUA 1A90A 3X3XA 3JUNA 3OX9A 2FGTA 2JQ5A 3LTDA 3NXJA 3F9SA 4EXRA 1IDPA 3G6E3 3DGNA 1U5OA 3CC23 3CCQ3 5JBSA 1A2PA 2CW9A 3KCHA 1ULIB 3CPW2 1OHSA 2KXGA 3HI7A 1S5AA 4HM3B 5EVHA 5CF2A 3K9MC 2INXA 4N6OB 1FGRA 2R41A 4MMZB 4R1KA 3NBJA 3WA2X 1RGHA 3MG2A 4RNYA 1O7WB 1OHPA 3K5TA 2K54A 1C54A 1LQMB 1ZS7A 2YFIB 2HMKB 2ZDJA 4K61A 3EJVA 5IG3A 2GSPA 5TGNA 1NB3I 2ML6A 3V98A 3GSPA 1MOLA 4GB5A 1SJWA 2ZA4A 1ZO2A 2CWUA 4HM8B 3MHEA 4HBRA 1G02A 1YJ93 2XGNA 1IVUA 7STDA 5AIFA 2K3DA 4EBGA 4I5QA 3EB8A 3EBYA 2Y73A 3SEDA 1YIT3 2KF5A 5FW5A 5BVBA 1AY7A 1BRSA 1JZOA 1N5PA 2KAAA 3CC43 5IW9A 1GY6A 1V74A 4Q53A 3A76A 4WYKB 2Q07A 3NQZA 4HM5B 3DH2A 1BIRA 3CU3A 5DRVA 5AYRB 1VQ53 4R9LA 5I97A 1YI23 2W04A 3HK4A 4L8OA 4IPBA 3LYGA 3EBTA 3NUVA 4HZ9B 1FA3A 1GOVA 3CCJ3 1GD3A 1V57A 3QRDA 2BU4A 1QMAA 3G8ZA 2PZVA 1WTHA 1I2FA 2F98A 3EC9A 5M18A 1UUWB 4K1VA 3L0RA 1Q864 2XH9A 1W00A 4X2HA 1QAKA 3LTAA 5IEPA 4FMBA 2CG0A 3ZG5A 2HMNB 4CDLA 3CCL3 4STDA 1RKYA 1US1A 4BTWA 1JB2A 3X42A 3U97A 1BRJA 1JB4A 3LTCA 1IQ8A 4J8TA 1TJDA 1BRKA 3AMOA 4OUQA 1STDA 3GAXA 3HX8A 3S67A 3BNCA 1E97A 1YGEA 3PS8A 7GSPA 2CFKA 1DVDA 2OQEC 2XRXB 3PCSA 1BRNL 1FGTA 1LOWA 3BB9A 4RBNA 4K1UA 5A0OB 1AV4A 1RHLA 1RN1A 3VSYA 2WOFA 1K734 1N8QA 5AI1A 1I2EA 1ULJB 1STFI 1UUVB 4KVHA 1O7MB 1PYLA 2MC8A 5ELJA 2WOHA 1JBSA 2L1SA 3BU4A 3U1WA 2R4IA 4OK0A 3B8LA 4BU4A 1AR0A 3K63A 5IG0A 1BVIA 3CME3 2CH9A 1IT8A 4EV2A 4R4KA 1B2XA 4WFOA 5AIIA 3VF1A 1MWRA 5D81A 3UL6A 1VQM3 1RGLA 3JUMA 4L8PA 5AEWB 3N9HA 5D82A 3UB1A 1HZ1A 1MWUA 2OOVC 2IYJA 2P38A 3DMCA 3KSED 1VZZA 3SOYA 3T0UA 3T8UA 2FXTA 3X41A 1NDOB 2CX0A 2OTJ3 5LC7A 1EQKA 1JBTA 1X1WA 2M7OA 5DREA 2Z6BA 3DY5A 1Q9EA 1AVKA 3ROBA 1RN4A 3NQYA 1BRHA 4HVNA 4XB5A 3PCRA 2GXFA 3F7XA 1W4NA 3Q2PA 1OUNA 1IVXA 4FMAA 1BNGA 1RNTA 4BIRA 8RNTA 3SYUA 1RGFA 3NV0B 3SOAA 1TRQA 1D6YA 2HMMB 1GMPA 1WMOA 2HMJB 3KIIA 1IT7A 4IT7A 2W9QA 3GRDA 4GSPA 3URPA 6RNTA 1A2KA 1JNQA 1SARA 2STDA 1EKMA 3MG1A 3LZAA 4KZ1A 3T8NA 2B1XB 3E99A 3D9RA 3OWUA 2OCTA 3MYTA 4FCZA 2F99A 1QALA 1FGQA 1W01A 3ALAA 4KFFA 4AKZA 3FG4A 1NB5I 1VQQA 1ZGXA 2E2VA 5KP1A 4N6LA 1B3SA 1BRIA 1GMQA 1CQSA 4HM6B 1EUIC 5FGOA 2GBXB 2GEXA 1EA2A 3RDEA 3RGRA 3S5CA 1W6YA 1M1K4 4GHOA 3SLUA 1K8A4 2CC3A 1GS3A 4U13A 1PY3A 1UDII 2D1WA 2F5WA 2K0MA 4N6TA 5CXOA 1VQK3 1U8CB 1UCLA 1RCLA 2W6JH 5JPUA 1VQ93 2ZL8A 2BIRA 1OF5B 1GMRA 3OXAA 4ORLA 3NM7A 1GY5A 2QGUA 2LQVA 3IJEB 2XFSA 4LEHA 8CHOA 2RCDA 4KFEA 1CYVA 4HM2B 2ZHXB 5EQLA 3NBBA 3DGYA 1UI8A 4I4KA 5BIRA 5BU4A 1IK3A 1BSEA 2P05A 5STDA 1R4YA 1Q824 1LOYA 1OHOA 1Q40B 3G0KA 3KZTA 3CCU3 3J7Yd 1V58A 3F14A 4XDWA 1FUSA 1YGWA 2C10A 3EHCA 1G96A 1Q7Y4 1DMNA 2QA43 1IVVA 1GD4A 1GY7A 1LXEA 1RTUA 3GZBA 1SQWA 1JN5B 3A5EA 3FZWA 3OWYA 3SXXA 3D4AA 4EC6A 2XF3A 2XSOB 3BNEA 5G2GA 2XFTA 1Q42A 1I3IA 2O3OA 2Z7AA 1BU4A 2WO0A 1RCKA 4MJDA 1IV7A 4HKVB 4BL2A 4NREA 3CD63 2W0QA 3UNLA 3M8CA 2V1LA 2FNQA 3KFQC 3CNMA 1WMNA 3H51A 5HOHA 1VQL3 2B24B 1ZX2A 3WA3A 1X1UA 3V92A 2GU3A 1ROAA 1RGCA 3BNDA 4MMXB 5LC6A 3CMA3 2RSXA 4PEJA 4LGQA 5G1LA 3KKGA 3F8XA 3S29A 1S723 4X2OA 5AIGA 3OW22 4K90B 2GEYA 1BNRA 1GSPA 1I0VA 1SPUA 4N6V0 5CLKA 5CF1A 1YJN3 1A67A 2GU1A 1TIJA 3FCSB 4JF8A 1A2VA 3MG3A 2QEX3 1RGAA 4RNZA 1BRGA 3D79A 1TFKA 1JKGB 1VQO3 1ROVA 4N6UA 4XBXA 1B2MA 1FYSA 3EN1B 2L4VA 4FMDA 3HIGA 4DKIA 1MGWA 4H3UA 2RGQA 1WNHA 1OPYA 1W6CA 1I0XA 4CCVA 1T2IA 2BT3A 1RN7A 2CKFB 2CFLA 2H0IA 1DMQA 2ML5A 2PNCA 1KD14 1TP6A 3EQQB 2UX0A 5HGRA 4R9KA 1TRPA 5M19A 2F4YA 5AEUB 4BTXA 2WGQA 2YX9A 1M1XB 1GYBA 2GBWB 2BMRB 4AEQA 1QVG2 3RNTA 5EEOA 4HAAA 1YJW3 3FSDA 5JPPA 3WODG 1UGHI 4O8SA 2W9PA 3S28A 3G16A 3WOEB 1OGXA 1NO3A 2BHMA 1E3RA 1GOUA 3MWZA 4WP5A 5ELUA 3WR2A 3NM2A 2H0HA 7RNTA 3DXOA 2W56B 2HMOB 1KWIA 4LYLB 4HM4B 2OQEA 4EV5A 3BIRA 1W2ZA 4HM0B 1YVBI 3GZXB 1BNJA 3AGOA 4N6NB 1O7GB 3NHXA 3EN8A 1QAFA 6GSPA 4XBYA 3PZWA 1B2ZA 1T3BA 1BANA 5IERA 5IEOA 1NNVA 2BMOB 1W2B2 1NU3A 5IF6A 3AMOB 3CC73 1B21A 1UCKA 1JZDA 3LOYA 1YIJ3 1BOXA 4N3VA 1CH0A 1RGEA 2UUGC 3FLJA 9RNTA 1IV9A 1CYUA 3V99A 1IQYA 1UCJA 1LNIA 3SVAA 1FW7A 1JV2B 6STDA 1YNVX 2WGOA 3QK9A 4IIAA 1LNHA 1VQ83 1FUWA 1N5HA 1SIHA 1W7CA 3LMLA 1BGSA 2OOVA 3G4S3 1NJI4 1OCVA 3AHSA 1KSIA 4J9AA 4CJNA 3ZG0A 5BXQA 1UCIA 2H0GA 4J5KA 1BNFA 1X1YA 3CCM3 1RLSA 1B2UA 2CFWA 1M904 1EG9B 4WYKA 3WHOA 1FZUA 1Y4KA 2CK3H 4EYCA 3SX1A 1OGZA 1NWWA 1LOXA 1BNIA 3OV4A 3Q1CA 3O8YA 1RGGA 1W6GA 1Q814 4O02B 4AKYA 3I563 3CNXA 3H3HA 1B20A 3BNBA 3I553 1FGOA 4KFDA 4RZMA 2QIYA 3N54B 1YVSA 2UGIA 3DM8A 3X3ZA 4LMIA 1Z1SA 1HU9A 1QJGA 3FG1A 2CFDA 2E2TA 4GL6A 3WMDA 3D3LA 1C7HA 3F7SA 2CWTA 1D6UA 5IENA 1UI7A 3FG3A 2BMQB
chains in the Genus database with same CATH topology
3JUQA 2YFJB 3X3YA 3JUOA 3F40A 1O7NB 1O7HB 2SBLA 1K41A 1O7PB 5IG4A 1FGMA 3BLZA 3CCV3 1F8NA 2HMLB 1E3VA 1CEWI 3DGOA 1R4CA 3N8BA 1JKGA 3RGAA 4ZM8A 1JB5A 4XBTA 1BUQA 3B4PA 3F8HA 1TU5A 1W5ZA 3CCR3 3K7CA 2XSHB 2BNGA 3B4OA 3FH1A 2XEPA 3K0ZA 3DZLA 2CG1A 3GWRA 5D83A 4HM1B 1N9EA 2Y74A 1RRLA 3EF8A 4R80A 1DMMA 2IA7A 3ER7A 2P0XA 3KN4A 4HJLB 1UW1A 2F86B 5KP3A 2OWPA 4MMYB 4TX4A 3X40A 1VQ73 3DGLA 1OH0A 3PYJA 3MKIA 3PGBA 3CCS3 3UL5A 2MF7A 3GZYB 4WWUC 1AVLA 1K28A 3B7CA 1IVWA 2KCDA 1YHQ3 3JVCA 3DGMA 3NX0A 2P09A 2P0MA 1KQS2 2W56A 2IMJA 3ECFA 3JUPA 2XGLA 3KE7A 3Q90A 5IG5A 1VQN3 4OVMA 1WQLB 1ISKA 3DUKA 4QWTA 4O3VA 1TFOA 1ASKA 1N9JA 3KSPA 3NV0A 1J2BA 1PU4A 3VGNA 4L7KA 2A15A 2BO9B 2O9UX 2W03A 3WDGB 4N6MA 3EX9A 4FCJA 1K9M4 3LXUX 2IUJA 1HKXA 1RJOA 2JDIH 1JRQA 4H61A 2W2CA 2RFRA 2CFGA 1TUHA 2E2UA 3FKAA 3LH4A 4FR9A 3CPOA 3FGYA 1JJ22 5AIHA 4FMCA 4G1MB 3NBRA 4HZBB 2Z77A 3OWSA 4FCMA 3GZRA 1IQXA 3UJMA 2CHCA 1VQP3 3I0YA 4LZIA 2CIUA 1T5YA 3STDA 3S27A 2YFLB 3IMAB 3HZPA 5KP4A 1QVF2 1N8R4 4BTYA 1LVNA 1M9GA 3LTBA 3TDGA 1D6ZA 1IU7A 3LT8A 1RRHA 1WMPA 3WOFB 3FF2A 1MNLA 3IPTA 1OF5A 3PXMA 4HYZA 3CCE3 2XR8B 1PFPA 1VQ43 3G713 4XDVA 4NHFA 3HIIA 4HM7B 1DVCA 2KRTA 5AYSC 2OTL3 4JRFA 3MSOA 3MPHA 1OACA 1Q40A 1SIIA 2D42A 2LYXA 4LSOA 5CK6A 2CWVA 2I9WA 3EE1A 1L5GB 3CXC2 1VQ63 1JN5A 2Z76A 4WHAA 2C11A 1W02A 3FF0A 4XM4A 4O2HA 3LT9A 2IUKA 1A90A 4MEIA 1DYUA 3X3XA 3JUNA 3OX9A 2FGTA 2JQ5A 3LTDA 3NXJA 3F9SA 4EXRA 1IDPA 3G6E3 3DGNA 1U5OA 3CC23 3CCQ3 5JBSA 2CW9A 1ULIB 3CPW2 1OHSA 2KXGA 3HI7A 1S5AA 4HM3B 5EVHA 5CF2A 3K9MC 2INXA 4N6OB 1FGRA 4MMZB 4R1KA 3NBJA 3WA2X 3MG2A 4RNYA 1O7WB 1OHPA 3K5TA 2K54A 2YFIB 2HMKB 2ZDJA 4K61A 3EJVA 5IG3A 5TGNA 1NB3I 2ML6A 3V98A 1MOLA 4GB5A 1SJWA 1ZO2A 2CWUA 4HM8B 3MHEA 4HBRA 1YJ93 2XGNA 1IVUA 7STDA 5AIFA 4EBGA 3EB8A 3EBYA 2Y73A 3SEDA 1YIT3 5FW5A 5BVBA 3CC43 1N5PA 5IW9A 1GY6A 1V74A 4Q53A 3A76A 4WYKB 2Q07A 3NQZA 4HM5B 5DRVA 3CU3A 5AYRB 1VQ53 4R9LA 5I97A 1YI23 2W04A 3HK4A 4L8OA 4IPBA 3LYGA 3EBTA 3NUVA 4HZ9B 1FA3A 3CCJ3 1GD3A 3QRDA 3G8ZA 1QMAA 2PZVA 1WTHA 2F98A 3EC9A 1UUWB 4K1VA 3L0RA 1Q864 2XH9A 1W00A 4X2HA 1QAKA 3LTAA 5IEPA 4FMBA 2CG0A 2HMNB 4CDLA 3CCL3 4STDA 1RKYA 1US1A 4BTWA 1JB2A 3X42A 3U97A 1JB4A 3LTCA 1IQ8A 4J8TA 3AMOA 4OUQA 1STDA 3GAXA 3HX8A 3S67A 3BNCA 1E97A 1YGEA 3PS8A 2CFKA 1DVDA 2OQEC 2XRXB 3PCSA 1FGTA 3BB9A 4RBNA 4K1UA 5A0OB 1AV4A 1K734 3VSYA 2WOFA 1N8QA 5AI1A 1ULJB 1STFI 1UUVB 4KVHA 1O7MB 2MC8A 5ELJA 2WOHA 3U1WA 2R4IA 4OK0A 3B8LA 1AR0A 3K63A 5IG0A 3CME3 2CH9A 1IT8A 4EV2A 4R4KA 4WFOA 5AIIA 3VF1A 5D81A 3UL6A 1VQM3 3JUMA 4L8PA 5AEWB 3N9HA 5D82A 3UB1A 2OOVC 2P38A 3DMCA 3KSED 3SOYA 1VZZA 3T0UA 3T8UA 3X41A 2FXTA 1IK3A 1NDOB 1KC84 2OTJ3 5LC7A 1EQKA 2M7OA 5DREA 2Z6BA 3DY5A 1AVKA 3ROBA 3NQYA 4HVNA 4XB5A 3PCRA 2GXFA 3F7XA 1W4NA 3Q2PA 1OUNA 1IVXA 4FMAA 3NV0B 3SOAA 1D6YA 2HMMB 1WMOA 2HMJB 3KIIA 1IT7A 4IT7A 2W9QA 3GRDA 1A2KA 1JNQA 2STDA 1EKMA 3MG1A 3LZAA 4KZ1A 3T8NA 2B1XB 3E99A 3D9RA 3OWUA 2OCTA 3MYTA 4FCZA 2F99A 1QALA 1FGQA 1W01A 3ALAA 4KFFA 4AKZA 3FG4A 1NB5I 2E2VA 5KP1A 4N6LA 1CQSA 4HM6B 5FGOA 2GBXB 2GEXA 1EA2A 3RDEA 3RGRA 3S5CA 1W6YA 1M1K4 3SLUA 1K8A4 2CC3A 1GS3A 4U13A 4N6TA 2D1WA 2K0MA 5CXOA 1VQK3 1U8CB 2W6JH 5JPUA 1VQ93 2ZL8A 1OF5B 3OXAA 4ORLA 3NM7A 1GY5A 2QGUA 2LQVA 3IJEB 2XFSA 4LEHA 8CHOA 2RCDA 4KFEA 1CYVA 4HM2B 5EQLA 3NBBA 1UI8A 4I4KA 2P05A 5STDA 1Q824 1OHOA 1Q40B 3G0KA 3KZTA 3CCU3 3J7Yd 3F14A 4XDWA 2C10A 3EHCA 1G96A 1Q7Y4 1DMNA 2QA43 1IVVA 1LXEA 1GD4A 1GY7A 3GZBA 1SQWA 1JN5B 3FZWA 3OWYA 3SXXA 4EC6A 2XF3A 2XSOB 3BNEA 5G2GA 2XFTA 1Q42A 2O3OA 2Z7AA 2WO0A 4MJDA 1IV7A 4HKVB 4NREA 3CD63 2W0QA 3UNLA 3M8CA 2V1LA 2FNQA 3KFQC 3CNMA 1WMNA 3H51A 1VQL3 2B24B 1ZX2A 3WA3A 3V92A 2GU3A 1ROAA 3BNDA 4MMXB 5LC6A 3CMA3 2RSXA 4PEJA 4LGQA 3KKGA 3F8XA 3S29A 1S723 4X2OA 5AIGA 3OW22 4K90B 2GEYA 1SPUA 1YJN3 4N6V0 5CF1A 5CLKA 1A67A 2GU1A 1TIJA 3FCSB 4JF8A 1A2VA 3MG3A 2QEX3 4RNZA 1TFKA 1JKGB 1VQO3 1ROVA 4N6UA 4XBXA 3EN1B 2L4VA 4FMDA 3HIGA 4H3UA 2RGQA 1WNHA 1OPYA 1W6CA 4CCVA 2BT3A 1RN7A 2CKFB 2CFLA 2ML5A 1DMQA 2PNCA 1KD14 1TP6A 3EQQB 2UX0A 5HGRA 4R9KA 5AEUB 4BTXA 2WGQA 2YX9A 1M1XB 1GYBA 2GBWB 2BMRB 4AEQA 1QVG2 5EEOA 1YJW3 3FSDA 5JPPA 3WODG 4O8SA 2W9PA 3S28A 3G16A 3WOEB 1OGXA 1NO3A 2BHMA 1E3RA 3MWZA 4WP5A 5ELUA 3NM2A 3DXOA 2W56B 2HMOB 1KWIA 4HM4B 2OQEA 4EV5A 1W2ZA 4HM0B 1YVBI 3GZXB 4N6NB 1O7GB 3NHXA 3EN8A 1QAFA 4XBYA 3PZWA 5IERA 5IEOA 2BMOB 1W2B2 1NU3A 5IF6A 3AMOB 3CC73 3LOYA 1YIJ3 4N3VA 3FLJA 1IV9A 1CYUA 3V99A 1IQYA 3SVAA 1JV2B 6STDA 2WGOA 3QK9A 4IIAA 1LNHA 1VQ83 1FUWA 1N5HA 1SIHA 1W7CA 3LMLA 2OOVA 3G4S3 1NJI4 1OCVA 1KSIA 4J9AA 5BXQA 3CCM3 2CFWA 1M904 1EG9B 4WYKA 1Y4KA 2CK3H 4EYCA 3SX1A 1OGZA 1NWWA 1LOXA 3OV4A 3Q1CA 3O8YA 1W6GA 1Q814 4O02B 4AKYA 3I563 3CNXA 3H3HA 3BNBA 3I553 1FGOA 4KFDA 4RZMA 2QIYA 3N54B 3X3ZA 3DM8A 4LMIA 1Z1SA 1HU9A 1QJGA 3FG1A 2CFDA 2E2TA 4GL6A 3WMDA 3D3LA 1C7HA 3F7SA 2CWTA 1D6UA 5IENA 1UI7A 3FG3A 2BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y d;  3QK9 A;  2CW9 A;  2FXT A; 
#chains in the Genus database with same CATH topology
 3JUQ A;  2YFJ B;  3X3Y A;  3JUO A;  3F40 A;  1O7N B;  1RMS A;  4NPB A;  1O7H B;  1BNS A;  2SBL A;  4RNT A;  1K41 A;  1O7P B;  1DE3 A;  5IG4 A;  3AGN A;  1FGM A;  3BLZ A;  1X1X A;  4BL3 A;  3CCV 3;  1F8N A;  2HML B;  1E3V A;  1CEW I;  1LQG C;  3DGO A;  1R4C A;  2RBI A;  1AQZ A;  3N8B A;  1JKG A;  3RGA A;  1I2G A;  4ZM8 A;  1JB5 A;  1BUJ A;  4XBT A;  1BUQ A;  3B4P A;  3F8H A;  5M1A A;  1TU5 A;  1W5Z A;  3CCR 3;  3K7C A;  2XSH B;  2BNG A;  3B4O A;  3FH1 A;  2XEP A;  3K0Z A;  3DZL A;  2CG1 A;  3GWR A;  5D83 A;  4HM1 B;  1N9E A;  2Y74 A;  1LRA A;  1RRL A;  3EF8 A;  1DMM A;  2IA7 A;  4R80 A;  3ER7 A;  2P0X A;  5G1K A;  3Q3F A;  3KN4 A;  1BSD A;  1RGK A;  4EW5 A;  4HJL B;  1UW1 A;  2F86 B;  5KP3 A;  2F56 A;  2OWP A;  2SAR A;  4MMY B;  4TX4 A;  3X40 A;  3DGL A;  4CPK A;  1OH0 A;  3PYJ A;  1GOY A;  1MWT A;  1VQ7 3;  3MKI A;  3PGB A;  3CCS 3;  3UL5 A;  2MF7 A;  1LOV A;  3GZY B;  2IY2 A;  4WWU C;  1AVL A;  1K28 A;  1BAO A;  1IVW A;  2KCD A;  3B7C A;  1YHQ 3;  3JVC A;  3DGM A;  2J8X B;  3NX0 A;  4ILF A;  2P09 A;  2P0M A;  1JBR A;  1KQS 2;  2W56 A;  2KF4 A;  1I3F A;  2CX1 A;  2IMJ A;  3ECF A;  3HOH A;  4KT3 B;  3JUP A;  1UGI A;  2XGL A;  3KE7 A;  1EEJ A;  3Q90 A;  5IG5 A;  1VQN 3;  4OVM A;  1WQL B;  1ISK A;  1Q7H A;  3DUK A;  4QWT A;  4O3V A;  1DET A;  1TFO A;  1ASK A;  1N9J A;  3KSP A;  3NV0 A;  5RNT A;  1J2B A;  1PU4 A;  1T2H A;  3VGN A;  4L7K A;  2A15 A;  2BO9 B;  2O9U X;  1MGR A;  2W03 A;  4J5G A;  4N6M A;  3WDG B;  3EX9 A;  4FCJ A;  1K9M 4;  3LXU X;  2IUJ A;  1HKX A;  1RJO A;  2JDI H;  1JRQ A;  4H61 A;  2W2C A;  1BSC A;  2RFR A;  2CFG A;  1TUH A;  2E2U A;  2HOH A;  3FKA A;  3LH4 A;  3CPO A;  4FR9 A;  3FGY A;  1JJ2 2;  5AIH A;  1UUG B;  3D5I A;  4FMC A;  4G1M B;  1RNB A;  3NBR A;  4HZB B;  2Z77 A;  1KC8 4;  3OWS A;  2AAD A;  3GZR A;  1IQX A;  4FCM A;  1BSB A;  2CHC A;  3UJM A;  3I0Y A;  4LZI A;  1G0T A;  2CIU A;  1VQP 3;  1I8V A;  1T5Y A;  3S27 A;  3STD A;  2YFL B;  3IMA B;  3HZP A;  5KP4 A;  1QVF 2;  1N8R 4;  4BTY A;  1LVN A;  1M9G A;  3LTB A;  2AAE A;  1D6Z A;  3TDG A;  1IU7 A;  1TTO A;  3LT8 A;  1RDS A;  1BSA A;  1RRH A;  1WMP A;  3WOF B;  3FF2 A;  1MNL A;  3IPT A;  3ZFZ A;  1OF5 A;  1RSN A;  3PXM A;  1HYF A;  2XR8 B;  4HYZ A;  3CCE 3;  5GSP A;  1PFP A;  1VQ4 3;  1FUT A;  3G71 3;  2KF3 A;  4XDV A;  4NHF A;  3HII A;  4HM7 B;  1DVC A;  2KRT A;  5AYS C;  2OTL 3;  4JRF A;  3MSO A;  3MPH A;  4HOH A;  1B27 A;  2F5M A;  1OAC A;  1Q40 A;  1SII A;  1IYY A;  2D42 A;  2LYX A;  4LSO A;  5CK6 A;  2C4B A;  2RNT A;  1B2S A;  2CWV A;  2I9W A;  3EE1 A;  1L5G B;  3CXC 2;  1BNE A;  1VQ6 3;  1I70 A;  3AHW A;  1JN5 A;  2Z76 A;  4WHA A;  2C11 A;  1W02 A;  2KF6 A;  3FF0 A;  4O2H A;  3LT9 A;  4XM4 A;  3D5G A;  2IUK A;  1MWS A;  4MEI A;  1DYU A;  1A90 A;  3X3X A;  3JUN A;  3OX9 A;  2FGT A;  2JQ5 A;  3LTD A;  3NXJ A;  3F9S A;  4EXR A;  1IDP A;  3G6E 3;  3DGN A;  1U5O A;  3CC2 3;  3CCQ 3;  5JBS A;  1A2P A;  2CW9 A;  3KCH A;  1ULI B;  3CPW 2;  1OHS A;  2KXG A;  3HI7 A;  1S5A A;  4HM3 B;  5EVH A;  5CF2 A;  3K9M C;  2INX A;  4N6O B;  1FGR A;  2R41 A;  4MMZ B;  4R1K A;  3NBJ A;  3WA2 X;  1RGH A;  3MG2 A;  4RNY A;  1O7W B;  1OHP A;  3K5T A;  2K54 A;  1C54 A;  1LQM B;  1ZS7 A;  2YFI B;  2HMK B;  2ZDJ A;  4K61 A;  3EJV A;  5IG3 A;  2GSP A;  5TGN A;  1NB3 I;  2ML6 A;  3V98 A;  3GSP A;  1MOL A;  4GB5 A;  1SJW A;  2ZA4 A;  1ZO2 A;  2CWU A;  4HM8 B;  3MHE A;  4HBR A;  1G02 A;  1YJ9 3;  2XGN A;  1IVU A;  7STD A;  5AIF A;  2K3D A;  4EBG A;  4I5Q A;  3EB8 A;  3EBY A;  2Y73 A;  3SED A;  1YIT 3;  2KF5 A;  5FW5 A;  5BVB A;  1AY7 A;  1BRS A;  1JZO A;  1N5P A;  2KAA A;  3CC4 3;  5IW9 A;  1GY6 A;  1V74 A;  4Q53 A;  3A76 A;  4WYK B;  2Q07 A;  3NQZ A;  4HM5 B;  3DH2 A;  1BIR A;  3CU3 A;  5DRV A;  5AYR B;  1VQ5 3;  4R9L A;  5I97 A;  1YI2 3;  2W04 A;  3HK4 A;  4L8O A;  4IPB A;  3LYG A;  3EBT A;  3NUV A;  4HZ9 B;  1FA3 A;  1GOV A;  3CCJ 3;  1GD3 A;  1V57 A;  3QRD A;  2BU4 A;  1QMA A;  3G8Z A;  2PZV A;  1WTH A;  1I2F A;  2F98 A;  3EC9 A;  5M18 A;  1UUW B;  4K1V A;  3L0R A;  1Q86 4;  2XH9 A;  1W00 A;  4X2H A;  1QAK A;  3LTA A;  5IEP A;  4FMB A;  2CG0 A;  3ZG5 A;  2HMN B;  4CDL A;  3CCL 3;  4STD A;  1RKY A;  1US1 A;  4BTW A;  1JB2 A;  3X42 A;  3U97 A;  1BRJ A;  1JB4 A;  3LTC A;  1IQ8 A;  4J8T A;  1TJD A;  1BRK A;  3AMO A;  4OUQ A;  1STD A;  3GAX A;  3HX8 A;  3S67 A;  3BNC A;  1E97 A;  1YGE A;  3PS8 A;  7GSP A;  2CFK A;  1DVD A;  2OQE C;  2XRX B;  3PCS A;  1BRN L;  1FGT A;  1LOW A;  3BB9 A;  4RBN A;  4K1U A;  5A0O B;  1AV4 A;  1RHL A;  1RN1 A;  3VSY A;  2WOF A;  1K73 4;  1N8Q A;  5AI1 A;  1I2E A;  1ULJ B;  1STF I;  1UUV B;  4KVH A;  1O7M B;  1PYL A;  2MC8 A;  5ELJ A;  2WOH A;  1JBS A;  2L1S A;  3BU4 A;  3U1W A;  2R4I A;  4OK0 A;  3B8L A;  4BU4 A;  1AR0 A;  3K63 A;  5IG0 A;  1BVI A;  3CME 3;  2CH9 A;  1IT8 A;  4EV2 A;  4R4K A;  1B2X A;  4WFO A;  5AII A;  3VF1 A;  1MWR A;  5D81 A;  3UL6 A;  1VQM 3;  1RGL A;  3JUM A;  4L8P A;  5AEW B;  3N9H A;  5D82 A;  3UB1 A;  1HZ1 A;  1MWU A;  2OOV C;  2IYJ A;  2P38 A;  3DMC A;  3KSE D;  1VZZ A;  3SOY A;  3T0U A;  3T8U A;  2FXT A;  3X41 A;  1NDO B;  2CX0 A;  2OTJ 3;  5LC7 A;  1EQK A;  1JBT A;  1X1W A;  2M7O A;  5DRE A;  2Z6B A;  3DY5 A;  1Q9E A;  1AVK A;  3ROB A;  1RN4 A;  3NQY A;  1BRH A;  4HVN A;  4XB5 A;  3PCR A;  2GXF A;  3F7X A;  1W4N A;  3Q2P A;  1OUN A;  1IVX A;  4FMA A;  1BNG A;  1RNT A;  4BIR A;  8RNT A;  3SYU A;  1RGF A;  3NV0 B;  3SOA A;  1TRQ A;  1D6Y A;  2HMM B;  1GMP A;  1WMO A;  2HMJ B;  3KII A;  1IT7 A;  4IT7 A;  2W9Q A;  3GRD A;  4GSP A;  3URP A;  6RNT A;  1A2K A;  1JNQ A;  1SAR A;  2STD A;  1EKM A;  3MG1 A;  3LZA A;  4KZ1 A;  3T8N A;  2B1X B;  3E99 A;  3D9R A;  3OWU A;  2OCT A;  3MYT A;  4FCZ A;  2F99 A;  1QAL A;  1FGQ A;  1W01 A;  3ALA A;  4KFF A;  4AKZ A;  3FG4 A;  1NB5 I;  1VQQ A;  1ZGX A;  2E2V A;  5KP1 A;  4N6L A;  1B3S A;  1BRI A;  1GMQ A;  1CQS A;  4HM6 B;  1EUI C;  5FGO A;  2GBX B;  2GEX A;  1EA2 A;  3RDE A;  3RGR A;  3S5C A;  1W6Y A;  1M1K 4;  4GHO A;  3SLU A;  1K8A 4;  2CC3 A;  1GS3 A;  4U13 A;  1PY3 A;  1UDI I;  2D1W A;  2F5W A;  2K0M A;  4N6T A;  5CXO A;  1VQK 3;  1U8C B;  1UCL A;  1RCL A;  2W6J H;  5JPU A;  1VQ9 3;  2ZL8 A;  2BIR A;  1OF5 B;  1GMR A;  3OXA A;  4ORL A;  3NM7 A;  1GY5 A;  2QGU A;  2LQV A;  3IJE B;  2XFS A;  4LEH A;  8CHO A;  2RCD A;  4KFE A;  1CYV A;  4HM2 B;  2ZHX B;  5EQL A;  3NBB A;  3DGY A;  1UI8 A;  4I4K A;  5BIR A;  5BU4 A;  1IK3 A;  1BSE A;  2P05 A;  5STD A;  1R4Y A;  1Q82 4;  1LOY A;  1OHO A;  1Q40 B;  3G0K A;  3KZT A;  3CCU 3;  3J7Y d;  1V58 A;  3F14 A;  4XDW A;  1FUS A;  1YGW A;  2C10 A;  3EHC A;  1G96 A;  1Q7Y 4;  1DMN A;  2QA4 3;  1IVV A;  1GD4 A;  1GY7 A;  1LXE A;  1RTU A;  3GZB A;  1SQW A;  1JN5 B;  3A5E A;  3FZW A;  3OWY A;  3SXX A;  3D4A A;  4EC6 A;  2XF3 A;  2XSO B;  3BNE A;  5G2G A;  2XFT A;  1Q42 A;  1I3I A;  2O3O A;  2Z7A A;  1BU4 A;  2WO0 A;  1RCK A;  4MJD A;  1IV7 A;  4HKV B;  4BL2 A;  4NRE A;  3CD6 3;  2W0Q A;  3UNL A;  3M8C A;  2V1L A;  2FNQ A;  3KFQ C;  3CNM A;  1WMN A;  3H51 A;  5HOH A;  1VQL 3;  2B24 B;  1ZX2 A;  3WA3 A;  1X1U A;  3V92 A;  2GU3 A;  1ROA A;  1RGC A;  3BND A;  4MMX B;  5LC6 A;  3CMA 3;  2RSX A;  4PEJ A;  4LGQ A;  5G1L A;  3KKG A;  3F8X A;  3S29 A;  1S72 3;  4X2O A;  5AIG A;  3OW2 2;  4K90 B;  2GEY A;  1BNR A;  1GSP A;  1I0V A;  1SPU A;  4N6V 0;  5CLK A;  5CF1 A;  1YJN 3;  1A67 A;  2GU1 A;  1TIJ A;  3FCS B;  4JF8 A;  1A2V A;  3MG3 A;  2QEX 3;  1RGA A;  4RNZ A;  1BRG A;  3D79 A;  1TFK A;  1JKG B;  1VQO 3;  1ROV A;  4N6U A;  4XBX A;  1B2M A;  1FYS A;  3EN1 B;  2L4V A;  4FMD A;  3HIG A;  4DKI A;  1MGW A;  4H3U A;  2RGQ A;  1WNH A;  1OPY A;  1W6C A;  1I0X A;  4CCV A;  1T2I A;  2BT3 A;  1RN7 A;  2CKF B;  2CFL A;  2H0I A;  1DMQ A;  2ML5 A;  2PNC A;  1KD1 4;  1TP6 A;  3EQQ B;  2UX0 A;  5HGR A;  4R9K A;  1TRP A;  5M19 A;  2F4Y A;  5AEU B;  4BTX A;  2WGQ A;  2YX9 A;  1M1X B;  1GYB A;  2GBW B;  2BMR B;  4AEQ A;  1QVG 2;  3RNT A;  5EEO A;  4HAA A;  1YJW 3;  3FSD A;  5JPP A;  3WOD G;  1UGH I;  4O8S A;  2W9P A;  3S28 A;  3G16 A;  3WOE B;  1OGX A;  1NO3 A;  2BHM A;  1E3R A;  1GOU A;  3MWZ A;  4WP5 A;  5ELU A;  3WR2 A;  3NM2 A;  2H0H A;  7RNT A;  3DXO A;  2W56 B;  2HMO B;  1KWI A;  4LYL B;  4HM4 B;  2OQE A;  4EV5 A;  3BIR A;  1W2Z A;  4HM0 B;  1YVB I;  3GZX B;  1BNJ A;  3AGO A;  4N6N B;  1O7G B;  3NHX A;  3EN8 A;  1QAF A;  6GSP A;  4XBY A;  3PZW A;  1B2Z A;  1T3B A;  1BAN A;  5IER A;  5IEO A;  1NNV A;  2BMO B;  1W2B 2;  1NU3 A;  5IF6 A;  3AMO B;  3CC7 3;  1B21 A;  1UCK A;  1JZD A;  3LOY A;  1YIJ 3;  1BOX A;  4N3V A;  1CH0 A;  1RGE A;  2UUG C;  3FLJ A;  9RNT A;  1IV9 A;  1CYU A;  3V99 A;  1IQY A;  1UCJ A;  1LNI A;  3SVA A;  1FW7 A;  1JV2 B;  6STD A;  1YNV X;  2WGO A;  3QK9 A;  4IIA A;  1LNH A;  1VQ8 3;  1FUW A;  1N5H A;  1SIH A;  1W7C A;  3LML A;  1BGS A;  2OOV A;  3G4S 3;  1NJI 4;  1OCV A;  3AHS A;  1KSI A;  4J9A A;  4CJN A;  3ZG0 A;  5BXQ A;  1UCI A;  2H0G A;  4J5K A;  1BNF A;  1X1Y A;  3CCM 3;  1RLS A;  1B2U A;  2CFW A;  1M90 4;  1EG9 B;  4WYK A;  3WHO A;  1FZU A;  1Y4K A;  2CK3 H;  4EYC A;  3SX1 A;  1OGZ A;  1NWW A;  1LOX A;  1BNI A;  3OV4 A;  3Q1C A;  3O8Y A;  1RGG A;  1W6G A;  1Q81 4;  4O02 B;  4AKY A;  3I56 3;  3CNX A;  3H3H A;  1B20 A;  3BNB A;  3I55 3;  1FGO A;  4KFD A;  4RZM A;  2QIY A;  3N54 B;  1YVS A;  2UGI A;  3DM8 A;  3X3Z A;  4LMI A;  1Z1S A;  1HU9 A;  1QJG A;  3FG1 A;  2CFD A;  2E2T A;  4GL6 A;  3WMD A;  3D3L A;  1C7H A;  3F7S A;  2CWT A;  1D6U A;  5IEN A;  1UI7 A;  3FG3 A;  2BMQ B; 
#chains in the Genus database with same CATH homology
 3JUQ A;  2YFJ B;  3X3Y A;  3JUO A;  3F40 A;  1O7N B;  1O7H B;  2SBL A;  1K41 A;  1O7P B;  5IG4 A;  1FGM A;  3BLZ A;  3CCV 3;  1F8N A;  2HML B;  1E3V A;  1CEW I;  3DGO A;  1R4C A;  3N8B A;  1JKG A;  3RGA A;  4ZM8 A;  1JB5 A;  4XBT A;  1BUQ A;  3B4P A;  3F8H A;  1TU5 A;  1W5Z A;  3CCR 3;  3K7C A;  2XSH B;  2BNG A;  3B4O A;  3FH1 A;  2XEP A;  3K0Z A;  3DZL A;  2CG1 A;  3GWR A;  5D83 A;  4HM1 B;  1N9E A;  2Y74 A;  1RRL A;  3EF8 A;  4R80 A;  1DMM A;  2IA7 A;  3ER7 A;  2P0X A;  3KN4 A;  4HJL B;  1UW1 A;  2F86 B;  5KP3 A;  2OWP A;  4MMY B;  4TX4 A;  3X40 A;  1VQ7 3;  3DGL A;  1OH0 A;  3PYJ A;  3MKI A;  3PGB A;  3CCS 3;  3UL5 A;  2MF7 A;  3GZY B;  4WWU C;  1AVL A;  1K28 A;  3B7C A;  1IVW A;  2KCD A;  1YHQ 3;  3JVC A;  3DGM A;  3NX0 A;  2P09 A;  2P0M A;  1KQS 2;  2W56 A;  2IMJ A;  3ECF A;  3JUP A;  2XGL A;  3KE7 A;  3Q90 A;  5IG5 A;  1VQN 3;  4OVM A;  1WQL B;  1ISK A;  3DUK A;  4QWT A;  4O3V A;  1TFO A;  1ASK A;  1N9J A;  3KSP A;  3NV0 A;  1J2B A;  1PU4 A;  3VGN A;  4L7K A;  2A15 A;  2BO9 B;  2O9U X;  2W03 A;  3WDG B;  4N6M A;  3EX9 A;  4FCJ A;  1K9M 4;  3LXU X;  2IUJ A;  1HKX A;  1RJO A;  2JDI H;  1JRQ A;  4H61 A;  2W2C A;  2RFR A;  2CFG A;  1TUH A;  2E2U A;  3FKA A;  3LH4 A;  4FR9 A;  3CPO A;  3FGY A;  1JJ2 2;  5AIH A;  4FMC A;  4G1M B;  3NBR A;  4HZB B;  2Z77 A;  3OWS A;  4FCM A;  3GZR A;  1IQX A;  3UJM A;  2CHC A;  1VQP 3;  3I0Y A;  4LZI A;  2CIU A;  1T5Y A;  3STD A;  3S27 A;  2YFL B;  3IMA B;  3HZP A;  5KP4 A;  1QVF 2;  1N8R 4;  4BTY A;  1LVN A;  1M9G A;  3LTB A;  3TDG A;  1D6Z A;  1IU7 A;  3LT8 A;  1RRH A;  1WMP A;  3WOF B;  3FF2 A;  1MNL A;  3IPT A;  1OF5 A;  3PXM A;  4HYZ A;  3CCE 3;  2XR8 B;  1PFP A;  1VQ4 3;  3G71 3;  4XDV A;  4NHF A;  3HII A;  4HM7 B;  1DVC A;  2KRT A;  5AYS C;  2OTL 3;  4JRF A;  3MSO A;  3MPH A;  1OAC A;  1Q40 A;  1SII A;  2D42 A;  2LYX A;  4LSO A;  5CK6 A;  2CWV A;  2I9W A;  3EE1 A;  1L5G B;  3CXC 2;  1VQ6 3;  1JN5 A;  2Z76 A;  4WHA A;  2C11 A;  1W02 A;  3FF0 A;  4XM4 A;  4O2H A;  3LT9 A;  2IUK A;  1A90 A;  4MEI A;  1DYU A;  3X3X A;  3JUN A;  3OX9 A;  2FGT A;  2JQ5 A;  3LTD A;  3NXJ A;  3F9S A;  4EXR A;  1IDP A;  3G6E 3;  3DGN A;  1U5O A;  3CC2 3;  3CCQ 3;  5JBS A;  2CW9 A;  1ULI B;  3CPW 2;  1OHS A;  2KXG A;  3HI7 A;  1S5A A;  4HM3 B;  5EVH A;  5CF2 A;  3K9M C;  2INX A;  4N6O B;  1FGR A;  4MMZ B;  4R1K A;  3NBJ A;  3WA2 X;  3MG2 A;  4RNY A;  1O7W B;  1OHP A;  3K5T A;  2K54 A;  2YFI B;  2HMK B;  2ZDJ A;  4K61 A;  3EJV A;  5IG3 A;  5TGN A;  1NB3 I;  2ML6 A;  3V98 A;  1MOL A;  4GB5 A;  1SJW A;  1ZO2 A;  2CWU A;  4HM8 B;  3MHE A;  4HBR A;  1YJ9 3;  2XGN A;  1IVU A;  7STD A;  5AIF A;  4EBG A;  3EB8 A;  3EBY A;  2Y73 A;  3SED A;  1YIT 3;  5FW5 A;  5BVB A;  3CC4 3;  1N5P A;  5IW9 A;  1GY6 A;  1V74 A;  4Q53 A;  3A76 A;  4WYK B;  2Q07 A;  3NQZ A;  4HM5 B;  5DRV A;  3CU3 A;  5AYR B;  1VQ5 3;  4R9L A;  5I97 A;  1YI2 3;  2W04 A;  3HK4 A;  4L8O A;  4IPB A;  3LYG A;  3EBT A;  3NUV A;  4HZ9 B;  1FA3 A;  3CCJ 3;  1GD3 A;  3QRD A;  3G8Z A;  1QMA A;  2PZV A;  1WTH A;  2F98 A;  3EC9 A;  1UUW B;  4K1V A;  3L0R A;  1Q86 4;  2XH9 A;  1W00 A;  4X2H A;  1QAK A;  3LTA A;  5IEP A;  4FMB A;  2CG0 A;  2HMN B;  4CDL A;  3CCL 3;  4STD A;  1RKY A;  1US1 A;  4BTW A;  1JB2 A;  3X42 A;  3U97 A;  1JB4 A;  3LTC A;  1IQ8 A;  4J8T A;  3AMO A;  4OUQ A;  1STD A;  3GAX A;  3HX8 A;  3S67 A;  3BNC A;  1E97 A;  1YGE A;  3PS8 A;  2CFK A;  1DVD A;  2OQE C;  2XRX B;  3PCS A;  1FGT A;  3BB9 A;  4RBN A;  4K1U A;  5A0O B;  1AV4 A;  1K73 4;  3VSY A;  2WOF A;  1N8Q A;  5AI1 A;  1ULJ B;  1STF I;  1UUV B;  4KVH A;  1O7M B;  2MC8 A;  5ELJ A;  2WOH A;  3U1W A;  2R4I A;  4OK0 A;  3B8L A;  1AR0 A;  3K63 A;  5IG0 A;  3CME 3;  2CH9 A;  1IT8 A;  4EV2 A;  4R4K A;  4WFO A;  5AII A;  3VF1 A;  5D81 A;  3UL6 A;  1VQM 3;  3JUM A;  4L8P A;  5AEW B;  3N9H A;  5D82 A;  3UB1 A;  2OOV C;  2P38 A;  3DMC A;  3KSE D;  3SOY A;  1VZZ A;  3T0U A;  3T8U A;  3X41 A;  2FXT A;  1IK3 A;  1NDO B;  1KC8 4;  2OTJ 3;  5LC7 A;  1EQK A;  2M7O A;  5DRE A;  2Z6B A;  3DY5 A;  1AVK A;  3ROB A;  3NQY A;  4HVN A;  4XB5 A;  3PCR A;  2GXF A;  3F7X A;  1W4N A;  3Q2P A;  1OUN A;  1IVX A;  4FMA A;  3NV0 B;  3SOA A;  1D6Y A;  2HMM B;  1WMO A;  2HMJ B;  3KII A;  1IT7 A;  4IT7 A;  2W9Q A;  3GRD A;  1A2K A;  1JNQ A;  2STD A;  1EKM A;  3MG1 A;  3LZA A;  4KZ1 A;  3T8N A;  2B1X B;  3E99 A;  3D9R A;  3OWU A;  2OCT A;  3MYT A;  4FCZ A;  2F99 A;  1QAL A;  1FGQ A;  1W01 A;  3ALA A;  4KFF A;  4AKZ A;  3FG4 A;  1NB5 I;  2E2V A;  5KP1 A;  4N6L A;  1CQS A;  4HM6 B;  5FGO A;  2GBX B;  2GEX A;  1EA2 A;  3RDE A;  3RGR A;  3S5C A;  1W6Y A;  1M1K 4;  3SLU A;  1K8A 4;  2CC3 A;  1GS3 A;  4U13 A;  4N6T A;  2D1W A;  2K0M A;  5CXO A;  1VQK 3;  1U8C B;  2W6J H;  5JPU A;  1VQ9 3;  2ZL8 A;  1OF5 B;  3OXA A;  4ORL A;  3NM7 A;  1GY5 A;  2QGU A;  2LQV A;  3IJE B;  2XFS A;  4LEH A;  8CHO A;  2RCD A;  4KFE A;  1CYV A;  4HM2 B;  5EQL A;  3NBB A;  1UI8 A;  4I4K A;  2P05 A;  5STD A;  1Q82 4;  1OHO A;  1Q40 B;  3G0K A;  3KZT A;  3CCU 3;  3J7Y d;  3F14 A;  4XDW A;  2C10 A;  3EHC A;  1G96 A;  1Q7Y 4;  1DMN A;  2QA4 3;  1IVV A;  1LXE A;  1GD4 A;  1GY7 A;  3GZB A;  1SQW A;  1JN5 B;  3FZW A;  3OWY A;  3SXX A;  4EC6 A;  2XF3 A;  2XSO B;  3BNE A;  5G2G A;  2XFT A;  1Q42 A;  2O3O A;  2Z7A A;  2WO0 A;  4MJD A;  1IV7 A;  4HKV B;  4NRE A;  3CD6 3;  2W0Q A;  3UNL A;  3M8C A;  2V1L A;  2FNQ A;  3KFQ C;  3CNM A;  1WMN A;  3H51 A;  1VQL 3;  2B24 B;  1ZX2 A;  3WA3 A;  3V92 A;  2GU3 A;  1ROA A;  3BND A;  4MMX B;  5LC6 A;  3CMA 3;  2RSX A;  4PEJ A;  4LGQ A;  3KKG A;  3F8X A;  3S29 A;  1S72 3;  4X2O A;  5AIG A;  3OW2 2;  4K90 B;  2GEY A;  1SPU A;  1YJN 3;  4N6V 0;  5CF1 A;  5CLK A;  1A67 A;  2GU1 A;  1TIJ A;  3FCS B;  4JF8 A;  1A2V A;  3MG3 A;  2QEX 3;  4RNZ A;  1TFK A;  1JKG B;  1VQO 3;  1ROV A;  4N6U A;  4XBX A;  3EN1 B;  2L4V A;  4FMD A;  3HIG A;  4H3U A;  2RGQ A;  1WNH A;  1OPY A;  1W6C A;  4CCV A;  2BT3 A;  1RN7 A;  2CKF B;  2CFL A;  2ML5 A;  1DMQ A;  2PNC A;  1KD1 4;  1TP6 A;  3EQQ B;  2UX0 A;  5HGR A;  4R9K A;  5AEU B;  4BTX A;  2WGQ A;  2YX9 A;  1M1X B;  1GYB A;  2GBW B;  2BMR B;  4AEQ A;  1QVG 2;  5EEO A;  1YJW 3;  3FSD A;  5JPP A;  3WOD G;  4O8S A;  2W9P A;  3S28 A;  3G16 A;  3WOE B;  1OGX A;  1NO3 A;  2BHM A;  1E3R A;  3MWZ A;  4WP5 A;  5ELU A;  3NM2 A;  3DXO A;  2W56 B;  2HMO B;  1KWI A;  4HM4 B;  2OQE A;  4EV5 A;  1W2Z A;  4HM0 B;  1YVB I;  3GZX B;  4N6N B;  1O7G B;  3NHX A;  3EN8 A;  1QAF A;  4XBY A;  3PZW A;  5IER A;  5IEO A;  2BMO B;  1W2B 2;  1NU3 A;  5IF6 A;  3AMO B;  3CC7 3;  3LOY A;  1YIJ 3;  4N3V A;  3FLJ A;  1IV9 A;  1CYU A;  3V99 A;  1IQY A;  3SVA A;  1JV2 B;  6STD A;  2WGO A;  3QK9 A;  4IIA A;  1LNH A;  1VQ8 3;  1FUW A;  1N5H A;  1SIH A;  1W7C A;  3LML A;  2OOV A;  3G4S 3;  1NJI 4;  1OCV A;  1KSI A;  4J9A A;  5BXQ A;  3CCM 3;  2CFW A;  1M90 4;  1EG9 B;  4WYK A;  1Y4K A;  2CK3 H;  4EYC A;  3SX1 A;  1OGZ A;  1NWW A;  1LOX A;  3OV4 A;  3Q1C A;  3O8Y A;  1W6G A;  1Q81 4;  4O02 B;  4AKY A;  3I56 3;  3CNX A;  3H3H A;  3BNB A;  3I55 3;  1FGO A;  4KFD A;  4RZM A;  2QIY A;  3N54 B;  3X3Z A;  3DM8 A;  4LMI A;  1Z1S A;  1HU9 A;  1QJG A;  3FG1 A;  2CFD A;  2E2T A;  4GL6 A;  3WMD A;  3D3L A;  1C7H A;  3F7S A;  2CWT A;  1D6U A;  5IEN A;  1UI7 A;  3FG3 A;  2BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...