2FXTA

Crystal structure of yeast tim44
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
192
structure length
192
Chain Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Import inner membrane translocase subunit TIM44
publication title Crystal Structure of Yeast Mitochondrial Peripheral Membrane Protein Tim44p C-terminal Domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 45
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04280 Tim44 Tim44-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.240 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2fxtA00
2CW9A 3J7Yd 2FXTA 3QK9A
chains in the Genus database with same CATH superfamily
1RGFA 1W6YA 3F8HA 3PS8A 3CCM3 2CFKA 3K63A 3SLUA 3ER7A 3ECFA 3K9MC 4RNTA 1BANA 2J8XB 1LOYA 1BUJA 1V57A 1GY7A 2W04A 3D79A 3X40A 2XGLA 3KIIA 1AVKA 1W7CA 2HMKB 4CJNA 1KD14 1IVXA 2HMNB 3CD63 4HM7B 1VQK3 2OTJ3 1B2SA 1ROAA 3D9RA 1GD4A 1GMPA 4R9LA 1FGRA 1B2UA 2P05A 3F7SA 2F4YA 4WFOA 1WMOA 3B7CA 5IG3A 3J7Yd 2M7OA 3BNCA 4FMDA 3FG3A 3I0YA 1W2ZA 3S29A 1RN7A 3AMOB 2O9UX 1VQQA 2C10A 5EEOA 3NQZA 4LEHA 3WR2A 1JB5A 4K61A 1E97A 4DKIA 1S5AA 1UGHI 1LOWA 4FR9A 4O2HA 1FYSA 2KF6A 1YVBI 2CK3H 3CC43 2ML6A 2ZL8A 3BIRA 1FGTA 3FG1A 3RNTA 1IVWA 3V99A 1LOXA 8CHOA 1BNIA 1VQ53 4G1MB 3WA2X 1OHSA 3OW22 3KE7A 2A15A 4R9KA 4RZMA 1N5HA 2W56B 4GHOA 1Q42A 1RCKA 5STDA 1UCIA 1BRJA 1YVSA 3DY5A 3LTAA 5G2GA 4R80A 4CPKA 2CWVA 2R4IA 3ZG5A 3EBTA 1YIJ3 2P0XA 5IG4A 3G8ZA 2GU3A 3GRDA 3CU3A 1STFI 1STDA 3JUMA 1SIIA 3CPOA 3MG1A 4KFFA 4EXRA 4J9AA 5M18A 2RFRA 1OF5A 2E2UA 4NREA 5M19A 2F98A 1W4NA 1IV9A 3LT9A 3WMDA 3CC23 1UCKA 3PGBA 1VQ43 2IMJA 1DVCA 1BGSA 2YFIB 2HMMB 3NM2A 3FZWA 3EN1B 1VQN3 2O3OA 3SX1A 2WOFA 3RGAA 5BVBA 3SOYA 3AGNA 1BSDA 1BVIA 1L5GB 1NNVA 3V92A 1PFPA 3MSOA 1JBTA 2CFWA 3KCHA 1I3IA 1SJWA 1UUGB 1GMQA 1RGAA 1AVLA 1VQ93 1BSAA 3MG2A 3NQYA 4EV2A 3N54B 3CXC2 1DMNA 4GL6A 3FCSB 2H0GA 1W5ZA 4HBRA 5JBSA 1B2ZA 2IA7A 3L0RA 4AKYA 2GSPA 2XR8B 5M1AA 1N8R4 2SBLA 4HZ9B 3F7XA 5AIHA 1I70A 1VQP3 2CW9A 2LQVA 1HZ1A 3EF8A 1O7PB 2WGQA 3JUPA 3LZAA 3MHEA 1O7MB 1CQSA 1RGKA 4XB5A 3PCSA 4N6V0 1NB3I 1MGWA 1OCVA 1LOVA 4FMCA 1GOVA 4KT3B 1W01A 4XDVA 1NJI4 1EG9B 4K90B 3T0UA 3K0ZA 1OF5B 3CCV3 1FUTA 2H0IA 2XH9A 3JUNA 1ZS7A 1UI7A 5IG0A 5IG5A 1A2KA 1QAFA 4JF8A 2GBXB 5CXOA 4XM4A 1PYLA 3X3ZA 4WYKA 1RMSA 2XF3A 3G4S3 4XBYA 2RSXA 3T8UA 1GOUA 1K28A 1BNJA 3B4OA 1OGXA 3VSYA 3T8NA 2GU1A 1JRQA 3DUKA 1G02A 5KP4A 3CCR3 3X3XA 1BSEA 1BRGA 2W6JH 1NO3A 1E3VA 4GB5A 2ZDJA 1FUSA 2OOVC 2C11A 3SOAA 3ALAA 1LNIA 1DYUA 1IT8A 4QWTA 3STDA 6STDA 2GEXA 1FA3A 2RGQA 2KCDA 5G1LA 2Z77A 4HM8B 4CCVA 1D6YA 1CYUA 1B21A 3LYGA 4N3VA 1FW7A 1JBSA 1SARA 2XSHB 1I2GA 3F8XA 5IW9A 3LMLA 2P0MA 3I563 3CCU3 3DGYA 1BSCA 2FNQA 1NB5I 1DVDA 1TP6A 3BNDA 3S28A 2OCTA 4MMYB 4FCJA 2W56A 1Q7Y4 4WHAA 1RGEA 1G0TA 2P38A 3X42A 4HAAA 4WYKB 2AADA 2CHCA 3B8LA 1UW1A 2INXA 1YNVX 4KVHA 4ILFA 1YGWA 4LZIA 1YJW3 1VQ63 1ROVA 2K3DA 2CH9A 4R4KA 4IPBA 1C54A 2B24B 3NBJA 2KAAA 3QRDA 4MEIA 1MNLA 1G96A 1O7HB 4BIRA 2OOVA 5IF6A 5JPUA 1WQLB 2JQ5A 4O02B 4XBTA 3CCQ3 3PXMA 1ZX2A 7STDA 1UCJA 2D42A 1RGCA 4MMXB 5DRVA 2HMOB 3HIIA 1GD3A 3LT8A 1UUWB 2C4BA 1K734 3HK4A 9RNTA 5D82A 4H3UA 1KC84 5CF2A 4XDWA 5GSPA 2PZVA 1LNHA 1X1XA 3O8YA 3GZBA 1I0XA 2CFGA 5IEOA 1YHQ3 3OWSA 1IQ8A 2GXFA 3CC73 2FGTA 1I3FA 1US1A 2BT3A 1U5OA 1WNHA 4FMBA 1Q824 2XRXB 1F8NA 4CDLA 2W03A 1OACA 2HMJB 3DM8A 1SIHA 3S27A 4X2OA 2UX0A 1RTUA 1W00A 3VF1A 2W2CA 3TDGA 1JZOA 3IMAB 3NXJA 1Q864 3Q2PA 1BOXA 7RNTA 3EC9A 1RN1A 1A2PA 4MMZB 5D83A 1GS3A 3DZLA 1BNSA 2CFDA 2Y74A 1MWTA 1UGIA 3JVCA 1RKYA 1EQKA 1X1WA 3UL5A 2XFSA 1O7NB 3X41A 1JZDA 3SEDA 2IUJA 4MJDA 2W0QA 3ROBA 4OVMA 1RRHA 1GMRA 2KRTA 4J5KA 3CPW2 1M1K4 2E2VA 4EW5A 2F5MA 2OQEC 4HM6B 3CCJ3 4HYZA 1GSPA 2BMRB 1BRIA 1IU7A 4X2HA 5G1KA 1EA2A 1RRLA 4LYLB 2CG1A 1JB4A 5AEUB 4N6LA 4K1UA 1M904 1B2XA 2WGOA 4BTWA 1LQGC 4N6NB 1KQS2 1BRKA 3HI7A 2JDIH 1OH0A 8RNTA 1BNGA 3WOFB 1FUWA 3FGYA 5KP1A 1FZUA 5ELJA 1N5PA 2Z76A 2IY2A 5CLKA 1YJN3 1A90A 3GAXA 1TRPA 3DMCA 3Q3FA 2YFLB 3N9HA 1PY3A 3G713 1T3BA 4WP5A 3WODG 3OXAA 3F40A 5KP3A 1UDII 1O7GB 3PYJA 4BL3A 1KSIA 1JV2B 2GBWB 1T2IA 2BO9B 2E2TA 1WTHA 5ELUA 2ZHXB 1JKGA 1O7WB 3S67A 4L8OA 3LTCA 2UUGC 1SPUA 2XGNA 1IDPA 1VZZA 2MC8A 1LQMB 1HKXA 3D5IA 2H0HA 1VQL3 1M1XB 1ISKA 3NM7A 4L7KA 3WOEB 2UGIA 2OQEA 3G16A 5AYRB 3DGLA 3F9SA 4EV5A 4EYCA 1QAKA 4N6UA 4OUQA 2ML5A 1PU4A 2ZA4A 1W2B2 2I9WA 4WWUC 4OK0A 3MWZA 1LRAA 2LYXA 5FW5A 1J2BA 1E3RA 3EBYA 1NDOB 3KKGA 3NV0A 3GZYB 2IYJA 4HM5B 1FGMA 1Z1SA 4XBXA 3GZXB 2XFTA 3RGRA 1N9JA 2F86B 1IQXA 3I553 3IJEB 3NBBA 2CWTA 4HM3B 3K5TA 1S723 3UJMA 1YI23 3URPA 4BTYA 4L8PA 1QVF2 6RNTA 1NWWA 1BU4A 5LC6A 1RGLA 2R41A 2W9QA 3AHWA 1TJDA 1ZO2A 4N6MA 1U8CB 5I97A 1X1UA 1R4CA 4HM0B 4HOHA 2QIYA 3FLJA 4HM4B 5D81A 4O8SA 5CF1A 2BMOB 5IENA 1JKGB 1HU9A 1KWIA 3GZRA 2D1WA 2KF4A 2CFLA 3LXUX 1YIT3 3BNEA 2YFJB 4NPBA 3HIGA 1NU3A 4ORLA 1T2HA 3CNMA 5DREA 3CMA3 3MPHA 3U97A 4RBNA 1BNRA 4J8TA 3PZWA 2STDA 1MWSA 1X1YA 1VQ73 2HMLB 1RDSA 5HGRA 3HZPA 2CX0A 2KF5A 2BNGA 3CNXA 4IIAA 1K9M4 4FMAA 5TGNA 1Q40A 3NUVA 3UNLA 3CCE3 3CCS3 4NHFA 4LGQA 3WHOA 3NBRA 1OUNA 3HX8A 1AV4A 1A2VA 1Q9EA 5AIFA 1IYYA 4N6TA 4ZM8A 1GYBA 1TRQA 1OGZA 1SQWA 1ZGXA 1D6ZA 3NV0B 1Y4KA 5AIGA 2BMQB 4TX4A 3OV4A 4Q53A 1K8A4 1RLSA 4I4KA 4RNZA 3M8CA 3SVAA 1I2EA 1MWUA 4K1VA 3JUQA 1CYVA 1CEWI 2CG0A 1T5YA 3SYUA 1IT7A 6GSPA 3QK9A 4H61A 1D6UA 1RSNA 1BIRA 2IUKA 3ZFZA 1ASKA 3N8BA 1LVNA 2Q07A 3NHXA 5BXQA 1DMQA 1IVVA 2Z6BA 3FSDA 1OHPA 3D3LA 1DMMA 3FH1A 4IT7A 5LC7A 3CCL3 2B1XB 1I2FA 1A67A 1BNEA 1OHOA 3ZG0A 1B3SA 3KSED 4HM1B 1B27A 3EE1A 1RNTA 3IPTA 3LTBA 3MG3A 4HKVB 1W6CA 3PCRA 3AHSA 1B2MA 1B20A 3NX0A 1MWRA 3KFQC 4FCZA 1GY5A 3OWUA 2KF3A 1N8QA 1K41A 3G0KA 1Q40B 5CK6A 5AI1A 1QMAA 4EC6A 3BU4A 1MOLA 3RDEA 1M9GA 4J5GA 2BHMA 5AIIA 1WMNA 2XSOB 2RCDA 1RJOA 2F56A 4GSPA 1BRHA 3LOYA 1OPYA 1W6GA 2F5WA 4LSOA 4STDA 3U1WA 1RGHA 1N9EA 1BSBA 1TFOA 3E99A 2L1SA 3BLZA 4FCMA 3X3YA 5AYSC 2Y73A 3GSPA 1AQZA 1IVUA 5EQLA 5HOHA 4BU4A 1WMPA 2HOHA 3BB9A 3DGMA 1UCLA 1BRNL 5BU4A 1RNBA 1FGOA 3MKIA 2CX1A 2FXTA 1EKMA 1RN4A 3MYTA 3WA3A 3JUOA 1MGRA 3UL6A 1VQM3 1ULJB 3WDGB 4BTXA 2QEX3 2SARA 1JBRA 2L4VA 4N6OB 1IK3A 3HOHA 2OTL3 1RHLA 2BIRA 2Z7AA 2RNTA 2MF7A 3DXOA 2WOHA 2QA43 3KSPA 3EN8A 1EUIC 4KFEA 3CME3 4LMIA 3Q90A 1V58A 3KN4A 1ULIB 2OWPA 1JN5A 3EHCA 3EQQB 3H51A 4BL2A 3DGOA 3Q1CA 4O3VA 2K0MA 3V98A 5IEPA 2F99A 1HYFA 5FGOA 2CC3A 3VGNA 1BAOA 3DGNA 4I5QA 3BNBA 7GSPA 3LH4A 1TTOA 3S5CA 3GWRA 1W02A 5EVHA 2QGUA 1JNQA 1FGQA 1QVG2 1TUHA 1YGEA 4KZ1A 4RNYA 1BNFA 1R4YA 2PNCA 3UB1A 1VQ83 3G6E3 3FG4A 1UUVB 3A76A 3DH2A 4JRFA 4HJLB 1I0VA 1AR0A 1BRSA 1TFKA 3EX9A 3FF2A 1BUQA 1QJGA 2CKFB 2V1LA 2W9PA 1AY7A 3K7CA 4AKZA 1UI8A 2AAEA 3OWYA 4HVNA 4PEJA 4HM2B 1GY6A 1CH0A 3FKAA 1TU5A 5JPPA 1QALA 3D4AA 1GOYA 4R1KA 1JJ22 3EJVA 3OX9A 4AEQA 1DE3A 2XEPA 3F14A 2P09A 3B4PA 2K54A 3H3HA 4U13A 2RBIA 3AMOA 2CIUA 3AGOA 5RNTA 4HZBB 2YX9A 5BIRA 1LXEA 1JN5B 1V74A 5AEWB 2CWUA 1IV7A 1EEJA 1JB2A 2KXGA 3A5EA 3KZTA 3EB8A 3LTDA 2WO0A 5IERA 1C7HA 1DETA 1RGGA 3FF0A 4EBGA 1VQO3 1YJ93 4KFDA 1Q814 1RCLA 3D5GA 2GEYA 1Q7HA 1IQYA 5A0OB 1I8VA 2BU4A 1TIJA 3SXXA
chains in the Genus database with same CATH topology
1W6YA 3F8HA 3PS8A 3CCM3 2CFKA 3K63A 3SLUA 3ER7A 3ECFA 3K9MC 1GY7A 2W04A 3X40A 2XGLA 3KIIA 1AVKA 1W7CA 2HMKB 1KD14 3CD63 1IVXA 2HMNB 4HM7B 1VQK3 2OTJ3 1ROAA 3D9RA 1GD4A 4R9LA 5JPUA 1FGRA 2P05A 3F7SA 4WFOA 3J7Yd 1YIJ3 1WMOA 3B7CA 5IG3A 2M7OA 3BNCA 4FMDA 3FG3A 3I0YA 1W2ZA 3S29A 1RN7A 3AMOB 2O9UX 2C10A 5EEOA 3NQZA 4LEHA 1JB5A 4K61A 1E97A 1S5AA 4FR9A 4O2HA 1YVBI 2CK3H 3CC43 2ML6A 2ZL8A 1FGTA 3FG1A 1IVWA 3V99A 1LOXA 8CHOA 1VQ53 4G1MB 3WA2X 1OHSA 3OW22 3KE7A 2A15A 4R9KA 4RZMA 1N5HA 2W56B 1Q42A 5STDA 3DY5A 3LTAA 5G2GA 4R80A 2CWVA 2R4IA 3EBTA 2P0XA 5IG4A 3G8ZA 2GU3A 3GRDA 3CU3A 1STFI 1STDA 3JUMA 1SIIA 3CPOA 3MG1A 4KFFA 4EXRA 4J9AA 2RFRA 1OF5A 2E2UA 4NREA 2F98A 1W4NA 1IV9A 3LT9A 3WMDA 3CC23 3PGBA 1VQ43 2IMJA 1DVCA 2YFIB 2HMMB 3NM2A 3FZWA 3EN1B 1VQN3 2O3OA 3SX1A 2WOFA 3RGAA 5BVBA 3SOYA 1L5GB 3V92A 1PFPA 3MSOA 2CFWA 1SJWA 1AVLA 1VQ93 4EV2A 3MG2A 3NQYA 3N54B 3CXC2 1DMNA 4GL6A 3FCSB 1W5ZA 4HBRA 5JBSA 2IA7A 3L0RA 4AKYA 2XR8B 1N8R4 2SBLA 4HZ9B 3F7XA 5AIHA 1VQP3 2CW9A 2LQVA 3EF8A 3JUPA 1O7PB 2WGQA 3LZAA 3MHEA 1O7MB 1CQSA 4XB5A 3PCSA 4N6V0 1NB3I 1OCVA 4FMCA 1W01A 4XDVA 1NJI4 1EG9B 4K90B 3T0UA 3K0ZA 1OF5B 3CCV3 2XH9A 3JUNA 5IG5A 1UI7A 5IG0A 1A2KA 1QAFA 4JF8A 2GBXB 5CXOA 4XM4A 3X3ZA 4WYKA 2XF3A 3G4S3 4XBYA 2RSXA 3T8UA 1K28A 3B4OA 1OGXA 3VSYA 3T8NA 2GU1A 1JRQA 3DUKA 5KP4A 3CCR3 3X3XA 2W6JH 1NO3A 1E3VA 4GB5A 2ZDJA 2OOVC 2C11A 3SOAA 3ALAA 1DYUA 1IT8A 4QWTA 3STDA 6STDA 2GEXA 2RGQA 2KCDA 2Z77A 4HM8B 4CCVA 1D6YA 1CYUA 3LYGA 4N3VA 2XSHB 3F8XA 5IW9A 3LMLA 2P0MA 3I563 3CCU3 2FNQA 1NB5I 1DVDA 1TP6A 3BNDA 3S28A 2OCTA 4MMYB 4FCJA 2W56A 1Q7Y4 4WHAA 3X42A 2P38A 4WYKB 2CHCA 3B8LA 1UW1A 2INXA 4KVHA 4LZIA 1YJW3 1VQ63 1ROVA 2CH9A 4R4KA 4IPBA 2B24B 3NBJA 3QRDA 4MEIA 1MNLA 1G96A 1O7HB 2OOVA 5IF6A 1WQLB 2JQ5A 4O02B 4XBTA 3CCQ3 3PXMA 1ZX2A 7STDA 2D42A 4MMXB 5DRVA 2HMOB 3HIIA 1GD3A 3LT8A 1UUWB 1K734 3HK4A 5D82A 4H3UA 1KC84 5CF2A 4XDWA 2PZVA 1LNHA 3O8YA 3GZBA 2CFGA 5IEOA 1YHQ3 3OWSA 1IQ8A 2GXFA 3CC73 2FGTA 1US1A 2BT3A 1U5OA 1WNHA 4FMBA 1Q824 2XRXB 1F8NA 4CDLA 2W03A 1OACA 2HMJB 3DM8A 1SIHA 3S27A 4X2OA 2UX0A 1W00A 3VF1A 2W2CA 3TDGA 3IMAB 3NXJA 1Q864 3Q2PA 3EC9A 4MMZB 5D83A 1GS3A 3DZLA 2CFDA 1RKYA 2Y74A 3JVCA 3UL5A 2XFSA 1O7NB 3X41A 3SEDA 2IUJA 4MJDA 2W0QA 3ROBA 4OVMA 1RRHA 2KRTA 1M1K4 3CPW2 2E2VA 2OQEC 4HM6B 3CCJ3 4HYZA 2BMRB 1IU7A 4X2HA 2CG1A 1EA2A 1RRLA 1M904 5AEUB 1JB4A 4N6LA 4K1UA 2WGOA 4BTWA 4N6NB 1KQS2 3HI7A 2JDIH 1OH0A 3WOFB 1FUWA 3FGYA 5KP1A 5ELJA 1N5PA 2Z76A 5CLKA 1YJN3 1A90A 3GAXA 3DMCA 2YFLB 3N9HA 3G713 4WP5A 3WODG 3OXAA 3F40A 5KP3A 3PYJA 1O7GB 1KSIA 1JV2B 2GBWB 2BO9B 2E2TA 1WTHA 5ELUA 1JKGA 1O7WB 3S67A 4L8OA 3LTCA 1SPUA 2XGNA 1IDPA 1VZZA 2MC8A 1HKXA 1VQL3 1M1XB 1ISKA 3NM7A 4L7KA 3WOEB 2OQEA 3G16A 5AYRB 3DGLA 3F9SA 4EV5A 4EYCA 1QAKA 4N6UA 4OUQA 2ML5A 1PU4A 1W2B2 2I9WA 4WWUC 4OK0A 3MWZA 2LYXA 5FW5A 1J2BA 1E3RA 3EBYA 1NDOB 3KKGA 3NV0A 3GZYB 4HM5B 1FGMA 1Z1SA 4XBXA 3GZXB 2XFTA 3RGRA 1N9JA 2F86B 1IQXA 3I553 3IJEB 3NBBA 2CWTA 4HM3B 3K5TA 1S723 3UJMA 1YI23 1EQKA 4BTYA 4L8PA 1QVF2 1NWWA 5LC6A 2W9QA 4N6MA 1ZO2A 1U8CB 5I97A 4HM0B 1R4CA 2QIYA 3FLJA 4HM4B 5D81A 4O8SA 5CF1A 2BMOB 5IENA 1JKGB 1HU9A 1KWIA 3GZRA 2D1WA 2CFLA 3LXUX 1YIT3 3BNEA 2YFJB 3HIGA 1NU3A 4ORLA 3CNMA 5DREA 3CMA3 3MPHA 3U97A 4RBNA 4J8TA 3PZWA 2STDA 1VQ73 2HMLB 5HGRA 3HZPA 3CNXA 1FA3A 2BNGA 4IIAA 1K9M4 4FMAA 5TGNA 1Q40A 3NUVA 3UNLA 3CCE3 3CCS3 4NHFA 4LGQA 3NBRA 1OUNA 3HX8A 1AV4A 1A2VA 5AIFA 4N6TA 4ZM8A 1GYBA 1OGZA 1SQWA 1D6ZA 3NV0B 1Y4KA 5AIGA 2BMQB 4TX4A 3OV4A 4Q53A 1K8A4 4I4KA 4RNZA 3M8CA 3SVAA 4K1VA 3JUQA 1CYVA 1CEWI 2CG0A 1T5YA 1IT7A 3QK9A 4H61A 1D6UA 2IUKA 1ASKA 3N8BA 1LVNA 2Q07A 3NHXA 5BXQA 2Z6BA 1DMQA 1IVVA 3FSDA 1OHPA 3D3LA 1DMMA 3FH1A 4IT7A 5LC7A 3CCL3 2B1XB 1A67A 1OHOA 3KSED 4HM1B 3EE1A 3IPTA 3LTBA 3MG3A 4HKVB 1W6CA 3PCRA 3NX0A 3KFQC 4FCZA 1GY5A 3OWUA 1N8QA 1K41A 3G0KA 1Q40B 5CK6A 5AI1A 1QMAA 4EC6A 1MOLA 3RDEA 1M9GA 2BHMA 5AIIA 1WMNA 2XSOB 2RCDA 1RJOA 3LOYA 1OPYA 1W6GA 4LSOA 4STDA 3U1WA 1N9EA 3E99A 1TFOA 4FCMA 3X3YA 3BLZA 5AYSC 2Y73A 1IVUA 5EQLA 1WMPA 3BB9A 3DGMA 1FGOA 3MKIA 2FXTA 1EKMA 3MYTA 3WA3A 3JUOA 3UL6A 1VQM3 1ULJB 3WDGB 4BTXA 2QEX3 2L4VA 4N6OB 1IK3A 2OTL3 2Z7AA 2MF7A 3DXOA 2WOHA 2QA43 3KSPA 3EN8A 4KFEA 3CME3 4LMIA 3Q90A 3KN4A 1ULIB 2OWPA 1JN5A 3EHCA 3EQQB 3H51A 3DGOA 3Q1CA 4O3VA 2K0MA 3V98A 5IEPA 2F99A 5FGOA 2CC3A 3VGNA 3DGNA 3BNBA 3LH4A 3S5CA 3GWRA 1W02A 5EVHA 2QGUA 1JNQA 1FGQA 1QVG2 1TUHA 1YGEA 4KZ1A 4RNYA 2PNCA 3UB1A 1VQ83 3G6E3 3FG4A 1UUVB 3A76A 4JRFA 4HJLB 1AR0A 1TFKA 3EX9A 3FF2A 1BUQA 1QJGA 2CKFB 2V1LA 2W9PA 3K7CA 4AKZA 1UI8A 3OWYA 4HVNA 4PEJA 4HM2B 1GY6A 1TU5A 3FKAA 5JPPA 1QALA 4R1KA 1JJ22 3EJVA 3OX9A 4AEQA 2XEPA 3F14A 2P09A 3B4PA 2K54A 3H3HA 4U13A 3AMOA 2CIUA 4HZBB 2YX9A 1LXEA 1JN5B 1V74A 5AEWB 2CWUA 1IV7A 1JB2A 2KXGA 3KZTA 3EB8A 3LTDA 2WO0A 5IERA 1C7HA 3FF0A 4EBGA 1YJ93 1VQO3 4KFDA 1Q814 2GEYA 1IQYA 5A0OB 1TIJA 3SXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW9 A;  3J7Y d;  2FXT A;  3QK9 A; 
#chains in the Genus database with same CATH topology
 1RGF A;  1W6Y A;  3F8H A;  3PS8 A;  3CCM 3;  2CFK A;  3K63 A;  3SLU A;  3ER7 A;  3ECF A;  3K9M C;  4RNT A;  1BAN A;  2J8X B;  1LOY A;  1BUJ A;  1V57 A;  1GY7 A;  2W04 A;  3D79 A;  3X40 A;  2XGL A;  3KII A;  1AVK A;  1W7C A;  2HMK B;  4CJN A;  1KD1 4;  1IVX A;  2HMN B;  3CD6 3;  4HM7 B;  1VQK 3;  2OTJ 3;  1B2S A;  1ROA A;  3D9R A;  1GD4 A;  1GMP A;  4R9L A;  1FGR A;  1B2U A;  2P05 A;  3F7S A;  2F4Y A;  4WFO A;  1WMO A;  3B7C A;  5IG3 A;  3J7Y d;  2M7O A;  3BNC A;  4FMD A;  3FG3 A;  3I0Y A;  1W2Z A;  3S29 A;  1RN7 A;  3AMO B;  2O9U X;  1VQQ A;  2C10 A;  5EEO A;  3NQZ A;  4LEH A;  3WR2 A;  1JB5 A;  4K61 A;  1E97 A;  4DKI A;  1S5A A;  1UGH I;  1LOW A;  4FR9 A;  4O2H A;  1FYS A;  2KF6 A;  1YVB I;  2CK3 H;  3CC4 3;  2ML6 A;  2ZL8 A;  3BIR A;  1FGT A;  3FG1 A;  3RNT A;  1IVW A;  3V99 A;  1LOX A;  8CHO A;  1BNI A;  1VQ5 3;  4G1M B;  3WA2 X;  1OHS A;  3OW2 2;  3KE7 A;  2A15 A;  4R9K A;  4RZM A;  1N5H A;  2W56 B;  4GHO A;  1Q42 A;  1RCK A;  5STD A;  1UCI A;  1BRJ A;  1YVS A;  3DY5 A;  3LTA A;  5G2G A;  4R80 A;  4CPK A;  2CWV A;  2R4I A;  3ZG5 A;  3EBT A;  1YIJ 3;  2P0X A;  5IG4 A;  3G8Z A;  2GU3 A;  3GRD A;  3CU3 A;  1STF I;  1STD A;  3JUM A;  1SII A;  3CPO A;  3MG1 A;  4KFF A;  4EXR A;  4J9A A;  5M18 A;  2RFR A;  1OF5 A;  2E2U A;  4NRE A;  5M19 A;  2F98 A;  1W4N A;  1IV9 A;  3LT9 A;  3WMD A;  3CC2 3;  1UCK A;  3PGB A;  1VQ4 3;  2IMJ A;  1DVC A;  1BGS A;  2YFI B;  2HMM B;  3NM2 A;  3FZW A;  3EN1 B;  1VQN 3;  2O3O A;  3SX1 A;  2WOF A;  3RGA A;  5BVB A;  3SOY A;  3AGN A;  1BSD A;  1BVI A;  1L5G B;  1NNV A;  3V92 A;  1PFP A;  3MSO A;  1JBT A;  2CFW A;  3KCH A;  1I3I A;  1SJW A;  1UUG B;  1GMQ A;  1RGA A;  1AVL A;  1VQ9 3;  1BSA A;  3MG2 A;  3NQY A;  4EV2 A;  3N54 B;  3CXC 2;  1DMN A;  4GL6 A;  3FCS B;  2H0G A;  1W5Z A;  4HBR A;  5JBS A;  1B2Z A;  2IA7 A;  3L0R A;  4AKY A;  2GSP A;  2XR8 B;  5M1A A;  1N8R 4;  2SBL A;  4HZ9 B;  3F7X A;  5AIH A;  1I70 A;  1VQP 3;  2CW9 A;  2LQV A;  1HZ1 A;  3EF8 A;  1O7P B;  2WGQ A;  3JUP A;  3LZA A;  3MHE A;  1O7M B;  1CQS A;  1RGK A;  4XB5 A;  3PCS A;  4N6V 0;  1NB3 I;  1MGW A;  1OCV A;  1LOV A;  4FMC A;  1GOV A;  4KT3 B;  1W01 A;  4XDV A;  1NJI 4;  1EG9 B;  4K90 B;  3T0U A;  3K0Z A;  1OF5 B;  3CCV 3;  1FUT A;  2H0I A;  2XH9 A;  3JUN A;  1ZS7 A;  1UI7 A;  5IG0 A;  5IG5 A;  1A2K A;  1QAF A;  4JF8 A;  2GBX B;  5CXO A;  4XM4 A;  1PYL A;  3X3Z A;  4WYK A;  1RMS A;  2XF3 A;  3G4S 3;  4XBY A;  2RSX A;  3T8U A;  1GOU A;  1K28 A;  1BNJ A;  3B4O A;  1OGX A;  3VSY A;  3T8N A;  2GU1 A;  1JRQ A;  3DUK A;  1G02 A;  5KP4 A;  3CCR 3;  3X3X A;  1BSE A;  1BRG A;  2W6J H;  1NO3 A;  1E3V A;  4GB5 A;  2ZDJ A;  1FUS A;  2OOV C;  2C11 A;  3SOA A;  3ALA A;  1LNI A;  1DYU A;  1IT8 A;  4QWT A;  3STD A;  6STD A;  2GEX A;  1FA3 A;  2RGQ A;  2KCD A;  5G1L A;  2Z77 A;  4HM8 B;  4CCV A;  1D6Y A;  1CYU A;  1B21 A;  3LYG A;  4N3V A;  1FW7 A;  1JBS A;  1SAR A;  2XSH B;  1I2G A;  3F8X A;  5IW9 A;  3LML A;  2P0M A;  3I56 3;  3CCU 3;  3DGY A;  1BSC A;  2FNQ A;  1NB5 I;  1DVD A;  1TP6 A;  3BND A;  3S28 A;  2OCT A;  4MMY B;  4FCJ A;  2W56 A;  1Q7Y 4;  4WHA A;  1RGE A;  1G0T A;  2P38 A;  3X42 A;  4HAA A;  4WYK B;  2AAD A;  2CHC A;  3B8L A;  1UW1 A;  2INX A;  1YNV X;  4KVH A;  4ILF A;  1YGW A;  4LZI A;  1YJW 3;  1VQ6 3;  1ROV A;  2K3D A;  2CH9 A;  4R4K A;  4IPB A;  1C54 A;  2B24 B;  3NBJ A;  2KAA A;  3QRD A;  4MEI A;  1MNL A;  1G96 A;  1O7H B;  4BIR A;  2OOV A;  5IF6 A;  5JPU A;  1WQL B;  2JQ5 A;  4O02 B;  4XBT A;  3CCQ 3;  3PXM A;  1ZX2 A;  7STD A;  1UCJ A;  2D42 A;  1RGC A;  4MMX B;  5DRV A;  2HMO B;  3HII A;  1GD3 A;  3LT8 A;  1UUW B;  2C4B A;  1K73 4;  3HK4 A;  9RNT A;  5D82 A;  4H3U A;  1KC8 4;  5CF2 A;  4XDW A;  5GSP A;  2PZV A;  1LNH A;  1X1X A;  3O8Y A;  3GZB A;  1I0X A;  2CFG A;  5IEO A;  1YHQ 3;  3OWS A;  1IQ8 A;  2GXF A;  3CC7 3;  2FGT A;  1I3F A;  1US1 A;  2BT3 A;  1U5O A;  1WNH A;  4FMB A;  1Q82 4;  2XRX B;  1F8N A;  4CDL A;  2W03 A;  1OAC A;  2HMJ B;  3DM8 A;  1SIH A;  3S27 A;  4X2O A;  2UX0 A;  1RTU A;  1W00 A;  3VF1 A;  2W2C A;  3TDG A;  1JZO A;  3IMA B;  3NXJ A;  1Q86 4;  3Q2P A;  1BOX A;  7RNT A;  3EC9 A;  1RN1 A;  1A2P A;  4MMZ B;  5D83 A;  1GS3 A;  3DZL A;  1BNS A;  2CFD A;  2Y74 A;  1MWT A;  1UGI A;  3JVC A;  1RKY A;  1EQK A;  1X1W A;  3UL5 A;  2XFS A;  1O7N B;  3X41 A;  1JZD A;  3SED A;  2IUJ A;  4MJD A;  2W0Q A;  3ROB A;  4OVM A;  1RRH A;  1GMR A;  2KRT A;  4J5K A;  3CPW 2;  1M1K 4;  2E2V A;  4EW5 A;  2F5M A;  2OQE C;  4HM6 B;  3CCJ 3;  4HYZ A;  1GSP A;  2BMR B;  1BRI A;  1IU7 A;  4X2H A;  5G1K A;  1EA2 A;  1RRL A;  4LYL B;  2CG1 A;  1JB4 A;  5AEU B;  4N6L A;  4K1U A;  1M90 4;  1B2X A;  2WGO A;  4BTW A;  1LQG C;  4N6N B;  1KQS 2;  1BRK A;  3HI7 A;  2JDI H;  1OH0 A;  8RNT A;  1BNG A;  3WOF B;  1FUW A;  3FGY A;  5KP1 A;  1FZU A;  5ELJ A;  1N5P A;  2Z76 A;  2IY2 A;  5CLK A;  1YJN 3;  1A90 A;  3GAX A;  1TRP A;  3DMC A;  3Q3F A;  2YFL B;  3N9H A;  1PY3 A;  3G71 3;  1T3B A;  4WP5 A;  3WOD G;  3OXA A;  3F40 A;  5KP3 A;  1UDI I;  1O7G B;  3PYJ A;  4BL3 A;  1KSI A;  1JV2 B;  2GBW B;  1T2I A;  2BO9 B;  2E2T A;  1WTH A;  5ELU A;  2ZHX B;  1JKG A;  1O7W B;  3S67 A;  4L8O A;  3LTC A;  2UUG C;  1SPU A;  2XGN A;  1IDP A;  1VZZ A;  2MC8 A;  1LQM B;  1HKX A;  3D5I A;  2H0H A;  1VQL 3;  1M1X B;  1ISK A;  3NM7 A;  4L7K A;  3WOE B;  2UGI A;  2OQE A;  3G16 A;  5AYR B;  3DGL A;  3F9S A;  4EV5 A;  4EYC A;  1QAK A;  4N6U A;  4OUQ A;  2ML5 A;  1PU4 A;  2ZA4 A;  1W2B 2;  2I9W A;  4WWU C;  4OK0 A;  3MWZ A;  1LRA A;  2LYX A;  5FW5 A;  1J2B A;  1E3R A;  3EBY A;  1NDO B;  3KKG A;  3NV0 A;  3GZY B;  2IYJ A;  4HM5 B;  1FGM A;  1Z1S A;  4XBX A;  3GZX B;  2XFT A;  3RGR A;  1N9J A;  2F86 B;  1IQX A;  3I55 3;  3IJE B;  3NBB A;  2CWT A;  4HM3 B;  3K5T A;  1S72 3;  3UJM A;  1YI2 3;  3URP A;  4BTY A;  4L8P A;  1QVF 2;  6RNT A;  1NWW A;  1BU4 A;  5LC6 A;  1RGL A;  2R41 A;  2W9Q A;  3AHW A;  1TJD A;  1ZO2 A;  4N6M A;  1U8C B;  5I97 A;  1X1U A;  1R4C A;  4HM0 B;  4HOH A;  2QIY A;  3FLJ A;  4HM4 B;  5D81 A;  4O8S A;  5CF1 A;  2BMO B;  5IEN A;  1JKG B;  1HU9 A;  1KWI A;  3GZR A;  2D1W A;  2KF4 A;  2CFL A;  3LXU X;  1YIT 3;  3BNE A;  2YFJ B;  4NPB A;  3HIG A;  1NU3 A;  4ORL A;  1T2H A;  3CNM A;  5DRE A;  3CMA 3;  3MPH A;  3U97 A;  4RBN A;  1BNR A;  4J8T A;  3PZW A;  2STD A;  1MWS A;  1X1Y A;  1VQ7 3;  2HML B;  1RDS A;  5HGR A;  3HZP A;  2CX0 A;  2KF5 A;  2BNG A;  3CNX A;  4IIA A;  1K9M 4;  4FMA A;  5TGN A;  1Q40 A;  3NUV A;  3UNL A;  3CCE 3;  3CCS 3;  4NHF A;  4LGQ A;  3WHO A;  3NBR A;  1OUN A;  3HX8 A;  1AV4 A;  1A2V A;  1Q9E A;  5AIF A;  1IYY A;  4N6T A;  4ZM8 A;  1GYB A;  1TRQ A;  1OGZ A;  1SQW A;  1ZGX A;  1D6Z A;  3NV0 B;  1Y4K A;  5AIG A;  2BMQ B;  4TX4 A;  3OV4 A;  4Q53 A;  1K8A 4;  1RLS A;  4I4K A;  4RNZ A;  3M8C A;  3SVA A;  1I2E A;  1MWU A;  4K1V A;  3JUQ A;  1CYV A;  1CEW I;  2CG0 A;  1T5Y A;  3SYU A;  1IT7 A;  6GSP A;  3QK9 A;  4H61 A;  1D6U A;  1RSN A;  1BIR A;  2IUK A;  3ZFZ A;  1ASK A;  3N8B A;  1LVN A;  2Q07 A;  3NHX A;  5BXQ A;  1DMQ A;  1IVV A;  2Z6B A;  3FSD A;  1OHP A;  3D3L A;  1DMM A;  3FH1 A;  4IT7 A;  5LC7 A;  3CCL 3;  2B1X B;  1I2F A;  1A67 A;  1BNE A;  1OHO A;  3ZG0 A;  1B3S A;  3KSE D;  4HM1 B;  1B27 A;  3EE1 A;  1RNT A;  3IPT A;  3LTB A;  3MG3 A;  4HKV B;  1W6C A;  3PCR A;  3AHS A;  1B2M A;  1B20 A;  3NX0 A;  1MWR A;  3KFQ C;  4FCZ A;  1GY5 A;  3OWU A;  2KF3 A;  1N8Q A;  1K41 A;  3G0K A;  1Q40 B;  5CK6 A;  5AI1 A;  1QMA A;  4EC6 A;  3BU4 A;  1MOL A;  3RDE A;  1M9G A;  4J5G A;  2BHM A;  5AII A;  1WMN A;  2XSO B;  2RCD A;  1RJO A;  2F56 A;  4GSP A;  1BRH A;  3LOY A;  1OPY A;  1W6G A;  2F5W A;  4LSO A;  4STD A;  3U1W A;  1RGH A;  1N9E A;  1BSB A;  1TFO A;  3E99 A;  2L1S A;  3BLZ A;  4FCM A;  3X3Y A;  5AYS C;  2Y73 A;  3GSP A;  1AQZ A;  1IVU A;  5EQL A;  5HOH A;  4BU4 A;  1WMP A;  2HOH A;  3BB9 A;  3DGM A;  1UCL A;  1BRN L;  5BU4 A;  1RNB A;  1FGO A;  3MKI A;  2CX1 A;  2FXT A;  1EKM A;  1RN4 A;  3MYT A;  3WA3 A;  3JUO A;  1MGR A;  3UL6 A;  1VQM 3;  1ULJ B;  3WDG B;  4BTX A;  2QEX 3;  2SAR A;  1JBR A;  2L4V A;  4N6O B;  1IK3 A;  3HOH A;  2OTL 3;  1RHL A;  2BIR A;  2Z7A A;  2RNT A;  2MF7 A;  3DXO A;  2WOH A;  2QA4 3;  3KSP A;  3EN8 A;  1EUI C;  4KFE A;  3CME 3;  4LMI A;  3Q90 A;  1V58 A;  3KN4 A;  1ULI B;  2OWP A;  1JN5 A;  3EHC A;  3EQQ B;  3H51 A;  4BL2 A;  3DGO A;  3Q1C A;  4O3V A;  2K0M A;  3V98 A;  5IEP A;  2F99 A;  1HYF A;  5FGO A;  2CC3 A;  3VGN A;  1BAO A;  3DGN A;  4I5Q A;  3BNB A;  7GSP A;  3LH4 A;  1TTO A;  3S5C A;  3GWR A;  1W02 A;  5EVH A;  2QGU A;  1JNQ A;  1FGQ A;  1QVG 2;  1TUH A;  1YGE A;  4KZ1 A;  4RNY A;  1BNF A;  1R4Y A;  2PNC A;  3UB1 A;  1VQ8 3;  3G6E 3;  3FG4 A;  1UUV B;  3A76 A;  3DH2 A;  4JRF A;  4HJL B;  1I0V A;  1AR0 A;  1BRS A;  1TFK A;  3EX9 A;  3FF2 A;  1BUQ A;  1QJG A;  2CKF B;  2V1L A;  2W9P A;  1AY7 A;  3K7C A;  4AKZ A;  1UI8 A;  2AAE A;  3OWY A;  4HVN A;  4PEJ A;  4HM2 B;  1GY6 A;  1CH0 A;  3FKA A;  1TU5 A;  5JPP A;  1QAL A;  3D4A A;  1GOY A;  4R1K A;  1JJ2 2;  3EJV A;  3OX9 A;  4AEQ A;  1DE3 A;  2XEP A;  3F14 A;  2P09 A;  3B4P A;  2K54 A;  3H3H A;  4U13 A;  2RBI A;  3AMO A;  2CIU A;  3AGO A;  5RNT A;  4HZB B;  2YX9 A;  5BIR A;  1LXE A;  1JN5 B;  1V74 A;  5AEW B;  2CWU A;  1IV7 A;  1EEJ A;  1JB2 A;  2KXG A;  3A5E A;  3KZT A;  3EB8 A;  3LTD A;  2WO0 A;  5IER A;  1C7H A;  1DET A;  1RGG A;  3FF0 A;  4EBG A;  1VQO 3;  1YJ9 3;  4KFD A;  1Q81 4;  1RCL A;  3D5G A;  2GEY A;  1Q7H A;  1IQY A;  5A0O B;  1I8V A;  2BU4 A;  1TIJ A;  3SXX A; 
#chains in the Genus database with same CATH homology
 1W6Y A;  3F8H A;  3PS8 A;  3CCM 3;  2CFK A;  3K63 A;  3SLU A;  3ER7 A;  3ECF A;  3K9M C;  1GY7 A;  2W04 A;  3X40 A;  2XGL A;  3KII A;  1AVK A;  1W7C A;  2HMK B;  1KD1 4;  3CD6 3;  1IVX A;  2HMN B;  4HM7 B;  1VQK 3;  2OTJ 3;  1ROA A;  3D9R A;  1GD4 A;  4R9L A;  5JPU A;  1FGR A;  2P05 A;  3F7S A;  4WFO A;  3J7Y d;  1YIJ 3;  1WMO A;  3B7C A;  5IG3 A;  2M7O A;  3BNC A;  4FMD A;  3FG3 A;  3I0Y A;  1W2Z A;  3S29 A;  1RN7 A;  3AMO B;  2O9U X;  2C10 A;  5EEO A;  3NQZ A;  4LEH A;  1JB5 A;  4K61 A;  1E97 A;  1S5A A;  4FR9 A;  4O2H A;  1YVB I;  2CK3 H;  3CC4 3;  2ML6 A;  2ZL8 A;  1FGT A;  3FG1 A;  1IVW A;  3V99 A;  1LOX A;  8CHO A;  1VQ5 3;  4G1M B;  3WA2 X;  1OHS A;  3OW2 2;  3KE7 A;  2A15 A;  4R9K A;  4RZM A;  1N5H A;  2W56 B;  1Q42 A;  5STD A;  3DY5 A;  3LTA A;  5G2G A;  4R80 A;  2CWV A;  2R4I A;  3EBT A;  2P0X A;  5IG4 A;  3G8Z A;  2GU3 A;  3GRD A;  3CU3 A;  1STF I;  1STD A;  3JUM A;  1SII A;  3CPO A;  3MG1 A;  4KFF A;  4EXR A;  4J9A A;  2RFR A;  1OF5 A;  2E2U A;  4NRE A;  2F98 A;  1W4N A;  1IV9 A;  3LT9 A;  3WMD A;  3CC2 3;  3PGB A;  1VQ4 3;  2IMJ A;  1DVC A;  2YFI B;  2HMM B;  3NM2 A;  3FZW A;  3EN1 B;  1VQN 3;  2O3O A;  3SX1 A;  2WOF A;  3RGA A;  5BVB A;  3SOY A;  1L5G B;  3V92 A;  1PFP A;  3MSO A;  2CFW A;  1SJW A;  1AVL A;  1VQ9 3;  4EV2 A;  3MG2 A;  3NQY A;  3N54 B;  3CXC 2;  1DMN A;  4GL6 A;  3FCS B;  1W5Z A;  4HBR A;  5JBS A;  2IA7 A;  3L0R A;  4AKY A;  2XR8 B;  1N8R 4;  2SBL A;  4HZ9 B;  3F7X A;  5AIH A;  1VQP 3;  2CW9 A;  2LQV A;  3EF8 A;  3JUP A;  1O7P B;  2WGQ A;  3LZA A;  3MHE A;  1O7M B;  1CQS A;  4XB5 A;  3PCS A;  4N6V 0;  1NB3 I;  1OCV A;  4FMC A;  1W01 A;  4XDV A;  1NJI 4;  1EG9 B;  4K90 B;  3T0U A;  3K0Z A;  1OF5 B;  3CCV 3;  2XH9 A;  3JUN A;  5IG5 A;  1UI7 A;  5IG0 A;  1A2K A;  1QAF A;  4JF8 A;  2GBX B;  5CXO A;  4XM4 A;  3X3Z A;  4WYK A;  2XF3 A;  3G4S 3;  4XBY A;  2RSX A;  3T8U A;  1K28 A;  3B4O A;  1OGX A;  3VSY A;  3T8N A;  2GU1 A;  1JRQ A;  3DUK A;  5KP4 A;  3CCR 3;  3X3X A;  2W6J H;  1NO3 A;  1E3V A;  4GB5 A;  2ZDJ A;  2OOV C;  2C11 A;  3SOA A;  3ALA A;  1DYU A;  1IT8 A;  4QWT A;  3STD A;  6STD A;  2GEX A;  2RGQ A;  2KCD A;  2Z77 A;  4HM8 B;  4CCV A;  1D6Y A;  1CYU A;  3LYG A;  4N3V A;  2XSH B;  3F8X A;  5IW9 A;  3LML A;  2P0M A;  3I56 3;  3CCU 3;  2FNQ A;  1NB5 I;  1DVD A;  1TP6 A;  3BND A;  3S28 A;  2OCT A;  4MMY B;  4FCJ A;  2W56 A;  1Q7Y 4;  4WHA A;  3X42 A;  2P38 A;  4WYK B;  2CHC A;  3B8L A;  1UW1 A;  2INX A;  4KVH A;  4LZI A;  1YJW 3;  1VQ6 3;  1ROV A;  2CH9 A;  4R4K A;  4IPB A;  2B24 B;  3NBJ A;  3QRD A;  4MEI A;  1MNL A;  1G96 A;  1O7H B;  2OOV A;  5IF6 A;  1WQL B;  2JQ5 A;  4O02 B;  4XBT A;  3CCQ 3;  3PXM A;  1ZX2 A;  7STD A;  2D42 A;  4MMX B;  5DRV A;  2HMO B;  3HII A;  1GD3 A;  3LT8 A;  1UUW B;  1K73 4;  3HK4 A;  5D82 A;  4H3U A;  1KC8 4;  5CF2 A;  4XDW A;  2PZV A;  1LNH A;  3O8Y A;  3GZB A;  2CFG A;  5IEO A;  1YHQ 3;  3OWS A;  1IQ8 A;  2GXF A;  3CC7 3;  2FGT A;  1US1 A;  2BT3 A;  1U5O A;  1WNH A;  4FMB A;  1Q82 4;  2XRX B;  1F8N A;  4CDL A;  2W03 A;  1OAC A;  2HMJ B;  3DM8 A;  1SIH A;  3S27 A;  4X2O A;  2UX0 A;  1W00 A;  3VF1 A;  2W2C A;  3TDG A;  3IMA B;  3NXJ A;  1Q86 4;  3Q2P A;  3EC9 A;  4MMZ B;  5D83 A;  1GS3 A;  3DZL A;  2CFD A;  1RKY A;  2Y74 A;  3JVC A;  3UL5 A;  2XFS A;  1O7N B;  3X41 A;  3SED A;  2IUJ A;  4MJD A;  2W0Q A;  3ROB A;  4OVM A;  1RRH A;  2KRT A;  1M1K 4;  3CPW 2;  2E2V A;  2OQE C;  4HM6 B;  3CCJ 3;  4HYZ A;  2BMR B;  1IU7 A;  4X2H A;  2CG1 A;  1EA2 A;  1RRL A;  1M90 4;  5AEU B;  1JB4 A;  4N6L A;  4K1U A;  2WGO A;  4BTW A;  4N6N B;  1KQS 2;  3HI7 A;  2JDI H;  1OH0 A;  3WOF B;  1FUW A;  3FGY A;  5KP1 A;  5ELJ A;  1N5P A;  2Z76 A;  5CLK A;  1YJN 3;  1A90 A;  3GAX A;  3DMC A;  2YFL B;  3N9H A;  3G71 3;  4WP5 A;  3WOD G;  3OXA A;  3F40 A;  5KP3 A;  3PYJ A;  1O7G B;  1KSI A;  1JV2 B;  2GBW B;  2BO9 B;  2E2T A;  1WTH A;  5ELU A;  1JKG A;  1O7W B;  3S67 A;  4L8O A;  3LTC A;  1SPU A;  2XGN A;  1IDP A;  1VZZ A;  2MC8 A;  1HKX A;  1VQL 3;  1M1X B;  1ISK A;  3NM7 A;  4L7K A;  3WOE B;  2OQE A;  3G16 A;  5AYR B;  3DGL A;  3F9S A;  4EV5 A;  4EYC A;  1QAK A;  4N6U A;  4OUQ A;  2ML5 A;  1PU4 A;  1W2B 2;  2I9W A;  4WWU C;  4OK0 A;  3MWZ A;  2LYX A;  5FW5 A;  1J2B A;  1E3R A;  3EBY A;  1NDO B;  3KKG A;  3NV0 A;  3GZY B;  4HM5 B;  1FGM A;  1Z1S A;  4XBX A;  3GZX B;  2XFT A;  3RGR A;  1N9J A;  2F86 B;  1IQX A;  3I55 3;  3IJE B;  3NBB A;  2CWT A;  4HM3 B;  3K5T A;  1S72 3;  3UJM A;  1YI2 3;  1EQK A;  4BTY A;  4L8P A;  1QVF 2;  1NWW A;  5LC6 A;  2W9Q A;  4N6M A;  1ZO2 A;  1U8C B;  5I97 A;  4HM0 B;  1R4C A;  2QIY A;  3FLJ A;  4HM4 B;  5D81 A;  4O8S A;  5CF1 A;  2BMO B;  5IEN A;  1JKG B;  1HU9 A;  1KWI A;  3GZR A;  2D1W A;  2CFL A;  3LXU X;  1YIT 3;  3BNE A;  2YFJ B;  3HIG A;  1NU3 A;  4ORL A;  3CNM A;  5DRE A;  3CMA 3;  3MPH A;  3U97 A;  4RBN A;  4J8T A;  3PZW A;  2STD A;  1VQ7 3;  2HML B;  5HGR A;  3HZP A;  3CNX A;  1FA3 A;  2BNG A;  4IIA A;  1K9M 4;  4FMA A;  5TGN A;  1Q40 A;  3NUV A;  3UNL A;  3CCE 3;  3CCS 3;  4NHF A;  4LGQ A;  3NBR A;  1OUN A;  3HX8 A;  1AV4 A;  1A2V A;  5AIF A;  4N6T A;  4ZM8 A;  1GYB A;  1OGZ A;  1SQW A;  1D6Z A;  3NV0 B;  1Y4K A;  5AIG A;  2BMQ B;  4TX4 A;  3OV4 A;  4Q53 A;  1K8A 4;  4I4K A;  4RNZ A;  3M8C A;  3SVA A;  4K1V A;  3JUQ A;  1CYV A;  1CEW I;  2CG0 A;  1T5Y A;  1IT7 A;  3QK9 A;  4H61 A;  1D6U A;  2IUK A;  1ASK A;  3N8B A;  1LVN A;  2Q07 A;  3NHX A;  5BXQ A;  2Z6B A;  1DMQ A;  1IVV A;  3FSD A;  1OHP A;  3D3L A;  1DMM A;  3FH1 A;  4IT7 A;  5LC7 A;  3CCL 3;  2B1X B;  1A67 A;  1OHO A;  3KSE D;  4HM1 B;  3EE1 A;  3IPT A;  3LTB A;  3MG3 A;  4HKV B;  1W6C A;  3PCR A;  3NX0 A;  3KFQ C;  4FCZ A;  1GY5 A;  3OWU A;  1N8Q A;  1K41 A;  3G0K A;  1Q40 B;  5CK6 A;  5AI1 A;  1QMA A;  4EC6 A;  1MOL A;  3RDE A;  1M9G A;  2BHM A;  5AII A;  1WMN A;  2XSO B;  2RCD A;  1RJO A;  3LOY A;  1OPY A;  1W6G A;  4LSO A;  4STD A;  3U1W A;  1N9E A;  3E99 A;  1TFO A;  4FCM A;  3X3Y A;  3BLZ A;  5AYS C;  2Y73 A;  1IVU A;  5EQL A;  1WMP A;  3BB9 A;  3DGM A;  1FGO A;  3MKI A;  2FXT A;  1EKM A;  3MYT A;  3WA3 A;  3JUO A;  3UL6 A;  1VQM 3;  1ULJ B;  3WDG B;  4BTX A;  2QEX 3;  2L4V A;  4N6O B;  1IK3 A;  2OTL 3;  2Z7A A;  2MF7 A;  3DXO A;  2WOH A;  2QA4 3;  3KSP A;  3EN8 A;  4KFE A;  3CME 3;  4LMI A;  3Q90 A;  3KN4 A;  1ULI B;  2OWP A;  1JN5 A;  3EHC A;  3EQQ B;  3H51 A;  3DGO A;  3Q1C A;  4O3V A;  2K0M A;  3V98 A;  5IEP A;  2F99 A;  5FGO A;  2CC3 A;  3VGN A;  3DGN A;  3BNB A;  3LH4 A;  3S5C A;  3GWR A;  1W02 A;  5EVH A;  2QGU A;  1JNQ A;  1FGQ A;  1QVG 2;  1TUH A;  1YGE A;  4KZ1 A;  4RNY A;  2PNC A;  3UB1 A;  1VQ8 3;  3G6E 3;  3FG4 A;  1UUV B;  3A76 A;  4JRF A;  4HJL B;  1AR0 A;  1TFK A;  3EX9 A;  3FF2 A;  1BUQ A;  1QJG A;  2CKF B;  2V1L A;  2W9P A;  3K7C A;  4AKZ A;  1UI8 A;  3OWY A;  4HVN A;  4PEJ A;  4HM2 B;  1GY6 A;  1TU5 A;  3FKA A;  5JPP A;  1QAL A;  4R1K A;  1JJ2 2;  3EJV A;  3OX9 A;  4AEQ A;  2XEP A;  3F14 A;  2P09 A;  3B4P A;  2K54 A;  3H3H A;  4U13 A;  3AMO A;  2CIU A;  4HZB B;  2YX9 A;  1LXE A;  1JN5 B;  1V74 A;  5AEW B;  2CWU A;  1IV7 A;  1JB2 A;  2KXG A;  3KZT A;  3EB8 A;  3LTD A;  2WO0 A;  5IER A;  1C7H A;  3FF0 A;  4EBG A;  1YJ9 3;  1VQO 3;  4KFD A;  1Q81 4;  2GEY A;  1IQY A;  5A0O B;  1TIJ A;  3SXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...