2F98A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Biosynthetic protein
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f98A00
1OGZA 1E3RA 5G2GA 1O7PB 1O7WB 4OVMA 2RGQA 3JUMA 2Z76A 3BLZA 1K41A 2B24B 3FSDA 3MSOA 3NV0A 1JN5A 3SOAA 4XBTA 2BMQB 3K7CA 2YFJB 3GZRA 1IDPA 3G0KA 8CHOA 1OHSA 4L7KA 5EVHA 3WMDA 2HMMB 3EF8A 1QJGA 1S5AA 3F40A 3STDA 3GZBA 4FCJA 3OWSA 3CPOA 3EJVA 1JB5A 3DXOA 3UJMA 3EBYA 2F86B 2YFLB 3FZWA 3G16A 3GRDA 3BB9A 3DUKA 1DMNA 3G8ZA 1UUWB 3DM8A 1ZX2A 3A76A 2F99A 4STDA 3T8UA 3MG3A 3ER7A 4LMIA 2XR8B 1Z1SA 5AIFA 1CQSA 5IEOA 4WYKA 2RFRA 4LEHA 4WP5A 3E99A 3NBRA 4PEJA 4HVNA 1SJWA 1OH0A 1DMMA 1WQLB 5AIGA 6STDA 1Q40B 1OCVA 3CNMA 3MG1A 3B7CA 1STDA 3VSYA 3H3HA 5IEPA 3JUPA 4HZBB 1JB4A 4U13A 3FF2A 3LYGA 3F9SA 3HZPA 3MYTA 3I0YA 1EA2A 1ISKA 2QGUA 1ASKA 5IENA 3EX9A 2BMRB 3T8NA 5AEUB 5CXOA 3EN1B 3KKGA 3OV4A 5TGNA 4HM6B 2STDA 3S5CA 2JQ5A 1W6YA 1Q42A 5IERA 3GZYB 2XSHB 1A2KA 4RZMA 1OF5B 2B1XB 2BNGA 2F98A 3MKIA 3Q90A 3JUQA 3VGNA 4X2HA 1NDOB 4HKVB 5IG4A 2QIYA 1O7HB 1UUVB 4LGQA 3B4OA 5FW5A 3NXJA 2XRXB 1OPYA 4XM4A 1TUHA 2HMNB 3F7XA 1NU3A 3FF0A 5CLKA 1O7GB 4FCMA 3B8LA 1GY5A 4K1VA 4ORLA 1Q40A 5KP4A 2GEXA 3EHCA 4K1UA 5DREA 1GS3A 4L8PA 1ZO2A 3LZAA 5BXQA 1W00A 3KE7A 4HM4B 4WWUC 3B4PA 2HMKB 1GY7A 5AI1A 5KP1A 2HMJB 3DZLA 3GZXB 5CK6A 3EC9A 4XBYA 4XDWA 3ECFA 4HJLB 3OWYA 3FH1A 4HM3B 4HM7B 4HZ9B 1OF5A 3FGYA 2A15A 1AR0A 1O7NB 3HK4A 4HM1B 4R9KA 3JUOA 1VZZA 4CDLA 7STDA 2GXFA 2R4IA 4HM0B 2BMOB 2Z77A 3EN8A 5STDA 4OUQA 5BVBA 1TP6A 2XSOB 3GWRA 3NM2A 1GYBA 4J9AA 5D81A 2GEYA 4IIAA 2RCDA 1JKGB 4J8TA 1NWWA 3H51A 2W2CA 3MG2A 3F14A 4KVHA 4N3VA 2Z7AA 3CNXA 5IG3A 3KZTA 1OHPA 1BUQA 1GY6A 1ULIB 3RGAA 5AEWB 3F7SA 4X2OA 4HM2B 3D9RA 1QMAA 3F8HA 5IG0A 4XB5A 2K54A 3HX8A 2PZVA 2OWPA 4L8OA 1E3VA 1O7MB 3ROBA 3DMCA 3JUNA 3NV0B 2GBWB 3M8CA 1JN5B 1OGXA 3FLJA 4GB5A 4Q53A 5HGRA 4R1KA 4H3UA 3NHXA 3OXAA 3UNLA 1W01A 1DMQA 3KSPA 2IMJA 5JPUA 5AIHA 5IF6A 2HMLB 2I9WA 1EG9B 2YFIB 5KP3A 5AIIA 3OWUA 5D83A 4R9LA 2UX0A 3IPTA 5JPPA 4HM8B 3SOYA 3EQQB 1U5OA 3FKAA 2INXA 3CU3A 4I4KA 1E97A 1JKGA 1W02A 4XDVA 3SEDA 1HKXA 4HM5B 2GBXB 2HMOB 1C7HA 3MHEA 3K0ZA 4XBXA 3NUVA 3RGRA 1JB2A 5IG5A 2CKFB 1ULJB 3EBTA 5D82A 2CHCA 1OUNA 4WYKB 5CF2A 5CF1A 3F8XA 4MJDA 5DRVA 1OHOA 3OX9A
chains in the Genus database with same CATH superfamily
1I0XA 1VQ53 4GSPA 4IPBA 2CX0A 1OGZA 3CCR3 1E3RA 5G2GA 1O7PB 5AYRB 1O7WB 1G0TA 3BIRA 3QRDA 4OVMA 2RGQA 2H0HA 3JUMA 2Z76A 1V57A 4JRFA 3BLZA 1K41A 5EQLA 1B2SA 3CCJ3 2GSPA 2B24B 1HYFA 1R4CA 3FSDA 3MSOA 1BGSA 3NV0A 1TJDA 2MC8A 1GMRA 1JN5A 2L1SA 1IVXA 3SOAA 1SQWA 1CEWI 4XBTA 1BRJA 4AKZA 1YIT3 2BMQB 3K9MC 1IYYA 3ZG5A 3K7CA 1W2B2 2Z6BA 2YFJB 1N8R4 3CME3 2XGNA 3AHWA 1B2XA 4O3VA 3GZRA 1LNIA 1IDPA 2BIRA 2IUKA 3G0KA 3S29A 4AKYA 1Q824 8CHOA 3CC43 1OHSA 4L7KA 2C4BA 5EVHA 3WMDA 2HMMB 3EF8A 1JZDA 2KXGA 4BTXA 4MEIA 2GU3A 3LTAA 1BRHA 4CJNA 2OTJ3 1QJGA 2KAAA 4FMDA 2P0MA 1FGTA 3AGOA 3KSED 3QK9A 3FG4A 4EC6A 1S5AA 3D3LA 3F40A 3STDA 3GZBA 1W7CA 4FCJA 1VQL3 1IVVA 1HZ1A 3OWSA 3CPOA 3EJVA 3G713 1EUIC 2CW9A 1JB5A 2AADA 3CD63 4N6OB 1UCIA 3DXOA 1FUWA 1T2HA 3UJMA 3EBYA 1B2UA 3PYJA 1GOVA 2F86B 1B27A 2YFLB 3RDEA 2GU1A 3BU4A 3BNCA 1K8A4 1K9M4 1AY7A 3NM7A 2K0MA 4BL3A 4EW5A 1GSPA 1GMQA 2CFLA 3FZWA 3G16A 3X42A 3GRDA 3BB9A 1IU7A 3DUKA 1DMNA 3U97A 1UGIA 4NHFA 2RNTA 1UUWB 3DM8A 3G8ZA 3LTCA 4FR9A 2PNCA 1BANA 2R41A 3ALAA 3CCE3 4H61A 1ZX2A 3A76A 1BRNL 1RTUA 1VQ63 1WNHA 2F99A 4STDA 1W6GA 3I553 3MWZA 3T8UA 4MMYB 3MG3A 1VQM3 3ER7A 4LMIA 5BU4A 3EB8A 1IQXA 1Y4KA 2XR8B 1Z1SA 1N8QA 2XEPA 3WA2X 1IQYA 5AIFA 1CQSA 5IEOA 1JZOA 1IV9A 1V58A 4WYKA 2RFRA 3NX0A 3HIIA 1JBSA 3X3ZA 2J8XB 4GHOA 2D42A 4MMZB 3UL6A 5M18A 5M19A 4N6V0 1LOVA 1LQMB 3AHSA 2CH9A 1M904 4LEHA 3WR2A 4WP5A 2Y74A 2JDIH 3E99A 3NBRA 4KFDA 7RNTA 1PU4A 4HYZA 4PEJA 4HVNA 1SJWA 1OH0A 1DMMA 1WQLB 1RJOA 5AIGA 4ZM8A 1RRHA 3CCV3 1FA3A 3N9HA 1IVWA 3D5IA 4OK0A 4TX4A 1LRAA 6STDA 4BIRA 1Q40B 3CXC2 2C11A 1OCVA 3CNMA 2MF7A 3MG1A 1SARA 1BU4A 1STDA 3B7CA 3NBBA 3VSYA 3D5GA 1B3SA 1VQN3 2W6JH 1YGWA 1AVLA 3H3HA 5IEPA 3Q2PA 1BAOA 2KCDA 7GSPA 3JUPA 1R4YA 3CMA3 4FMAA 3MPHA 4HZBB 1I2FA 1FGQA 1W5ZA 2P0XA 1JB4A 1UDII 1BUJA 4U13A 1K734 4N6MA 3FF2A 3LYGA 3F9SA 3HZPA 3MYTA 3I0YA 4R4KA 5LC6A 9RNTA 1EA2A 3URPA 1IV7A 1ISKA 3Q1CA 1G96A 4J5KA 1GOUA 2OCTA 3V99A 1BSDA 3SXXA 2QGUA 1TRQA 1YNVX 1BIRA 2F56A 5FGOA 1ASKA 5G1KA 5IENA 3L0RA 1RNTA 3EX9A 2BMRB 2CG0A 4N6NB 3T8NA 5AEUB 1VQO3 3LT8A 3EN1B 3JVCA 2V1LA 3KKGA 3OV4A 4HM6B 5CXOA 5AYSC 5TGNA 3UB1A 2STDA 3SLUA 1JBTA 1SPUA 1X1XA 3LT9A 2JQ5A 3IMAB 1N5HA 3S5CA 1W6YA 2XH9A 2F5WA 1VQ83 2K3DA 3KFQC 1IVUA 1Q42A 1MWTA 1LNHA 3HOHA 3GZYB 2XSHB 5IERA 1FW7A 4CPKA 1A2KA 1YI23 1UI8A 4RZMA 2W03A 3GSPA 1FGRA 1OF5B 3CCL3 1CH0A 2B1XB 4FMCA 3N8BA 2E2UA 1VQQA 2BNGA 2F98A 2W9QA 3MKIA 5LC7A 3Q90A 1TFKA 2XF3A 2F4YA 3FCSB 1UCLA 3JUQA 2HOHA 3NBJA 3VGNA 4X2HA 5GSPA 3DGOA 1BNIA 3LMLA 3KCHA 1NDOB 3DGYA 2P09A 2E2TA 3DY5A 1BNSA 1J2BA 2W56B 1SIHA 1RKYA 4HKVB 1RCKA 2CWTA 1S723 5HOHA 4BTYA 5IG4A 5JBSA 2QIYA 1N9JA 1O7HB 6RNTA 4EXRA 1A2PA 1UUVB 4LGQA 1AV4A 3AMOB 1GMPA 3B4OA 5FW5A 1Q7HA 1BRIA 3NXJA 2BO9B 2CFKA 1YGEA 2FGTA 4MMXB 4EV2A 2XRXB 1OPYA 1U8CB 4XM4A 5BIRA 1YVBI 1TUHA 1US1A 2HMNB 3F7XA 1YJW3 1BRKA 1NU3A 1I2EA 3FF0A 5CLKA 1O7GB 2KF6A 3X3YA 3BNDA 1KD14 1Q9EA 1WTHA 1I0VA 4FCMA 1VQ43 3B8LA 2WOHA 1GY5A 1QAFA 4LZIA 3DGNA 1A67A 3NQZA 4K1VA 1Q40A 4ORLA 2WGQA 1IT8A 1X1UA 2CC3A 5KP4A 2GEXA 3N54B 1SIIA 1NB5I 1A2VA 2O3OA 1W2ZA 1BVIA 4RNTA 4HAAA 3EHCA 4K1UA 2KF4A 3D79A 1MNLA 5DREA 3TDGA 4BL2A 2Y73A 1GS3A 1LOXA 1WMPA 4JF8A 4L8PA 3PS8A 2H0GA 3FG3A 1ZO2A 2CWUA 1GD4A 3LZAA 4EBGA 2ZHXB 3S27A 1UW1A 3FG1A 5BXQA 1VQ93 2XFTA 1A90A 5G1LA 1W00A 2W0QA 3KE7A 4HM4B 4WWUC 1QVG2 3B4PA 2FNQA 2HMKB 1RRLA 3CC23 1GY7A 1G02A 1JV2B 4KFEA 5AI1A 5EEOA 2HMJB 5KP1A 1DVCA 2SBLA 4HBRA 3LXUX 4O8SA 1DYUA 1RGEA 2CK3H 3DZLA 3U1WA 1I3FA 1ZS7A 4R80A 3GZXB 3LTDA 5CK6A 1I70A 1T2IA 2E2VA 1JRQA 3DGMA 2AAEA 3AGNA 3EC9A 3RNTA 1EKMA 5IW9A 3S67A 1BRGA 1PY3A 1RMSA 3K5TA 1DETA 4XBYA 1FUSA 2ML5A 4XDWA 1N5PA 3ECFA 4HJLB 4DKIA 3OWYA 1Q7Y4 3FH1A 3BNBA 4HM3B 4HM7B 4HZ9B 1BNEA 1T3BA 2OQEA 1OF5A 3PXMA 3FGYA 4NPBA 4RNYA 2A15A 1AR0A 3CC73 1STFI 1EEJA 3LTBA 3HIGA 1MWUA 1CYVA 1RGCA 1VQP3 3G6E3 1BOXA 1O7NB 3HK4A 1PYLA 1KQS2 4HM1B 4R9KA 1F8NA 4LYLB 1QALA 2CG1A 2IUJA 3V98A 2IYJA 1VQ73 1Q864 3JUOA 1VZZA 3LOYA 2W56A 4CDLA 1UGHI 1BNGA 1FGMA 7STDA 4GL6A 1WMNA 1TU5A 1IQ8A 1X1WA 1HU9A 1I8VA 4WHAA 1DE3A 2O9UX 1DVDA 1BSAA 2GXFA 2R4IA 1D6UA 3AMOA 3WA3A 1D6ZA 4HM0B 2BMOB 2WOFA 2OQEC 2Z77A 3KIIA 1B2MA 2CX1A 1BSCA 1RCLA 1Q814 1IK3A 3EN8A 1N9EA 1UI7A 3OW22 5STDA 1KC84 2SARA 4OUQA 3UL5A 1NO3A 2C10A 5BVBA 3VF1A 1M1K4 4KZ1A 1TP6A 2BU4A 2M7OA 2XSOB 3GWRA 3NM2A 1GOYA 1GYBA 4J9AA 2GEYA 5D81A 3G4S3 4IIAA 2RCDA 1JKGB 3SVAA 4I5QA 3GAXA 1NWWA 4J8TA 3WOEB 3SYUA 2P38A 1RNBA 3H51A 2W2CA 1UCKA 3MG2A 2BHMA 3X41A 3F14A 4KVHA 4N6LA 1I3IA 1UUGB 4N3VA 3X40A 1V74A 4RNZA 1LVNA 1BNRA 2Z7AA 3I563 2QA43 3CNXA 5IG3A 3KZTA 2Q07A 1RGHA 1RGGA 4BU4A 4RBNA 1OHPA 1RN7A 1BUQA 1AQZA 2P05A 1GY6A 1ULIB 1MWRA 2UGIA 1MOLA 1RN4A 2WO0A 2ZL8A 1EQKA 3RGAA 1NB3I 4EV5A 5AEWB 4QWTA 4K90B 1RDSA 1NNVA 1X1YA 2CFDA 2ZDJA 3F7SA 4G1MB 4X2OA 2OOVA 3PCRA 4HM2B 1RGLA 3D9RA 1M9GA 3PCSA 3ZG0A 3HI7A 1BNJA 1T5YA 1QMAA 3F8HA 1ROVA 5IG0A 3WDGB 4XB5A 2K54A 2KF5A 3HX8A 1RGFA 4KFFA 2IA7A 3WOFB 3J7Yd 2PZVA 4K61A 2OWPA 4L8OA 1OACA 1E3VA 3K63A 1O7MB 3ROBA 1AVKA 4BTWA 3DMCA 3JUNA 3NV0B 3T0UA 2GBWB 1BSEA 3EE1A 3LH4A 1JN5B 3M8CA 2BT3A 2W04A 3A5EA 1WMOA 5ELJA 1OGXA 3FLJA 2RBIA 4GB5A 4Q53A 1YVSA 3Q3FA 5HGRA 3SX1A 1LOWA 2CIUA 4R1KA 2OOVC 4H3UA 1ROAA 5ELUA 2H0IA 3WHOA 1JBRA 1ZGXA 1FZUA 4NREA 3NHXA 1FGOA 2KF3A 1NJI4 3OXAA 4N6UA 1GD3A 1TIJA 2IY2A 1IT7A 3UNLA 3X3XA 1RN1A 1W01A 1BSBA 1MWSA 2L4VA 1TRPA 6GSPA 1JJ22 1FUTA 1DMQA 1W4NA 2ZA4A 2F5MA 3KSPA 3KN4A 1VQK3 3D4AA 1RLSA 2IMJA 5JPUA 4O02B 5AIHA 1LQGC 5IF6A 1TFOA 8RNTA 3CCS3 3CCM3 3CPW2 4HOHA 2HMLB 5A0OB 1YJ93 2I9WA 1RHLA 1EG9B 2UUGC 2YFIB 5KP3A 3WODG 1LXEA 2KRTA 5AIIA 1YJN3 3OWUA 4N6TA 1YHQ3 2YX9A 1B2ZA 4WFOA 5D83A 4ILFA 2WGOA 4R9LA 2UX0A 2W9PA 3IPTA 5M1AA 1C54A 1MGRA 2XGLA 1W6CA 1CYUA 5JPPA 2D1WA 2LQVA 4HM8B 4LSOA 4O2HA 3SOYA 2RSXA 3EQQB 1RGKA 3V92A 1U5OA 3FKAA 2INXA 1UCJA 3CU3A 1JNQA 3O8YA 4I4KA 1E97A 3BNEA 1BRSA 3DH2A 2XFSA 4FMBA 5I97A 2QEX3 1L5GB 1JKGA 1QAKA 1YIJ3 1B21A 4AEQA 1W02A 1K28A 3PZWA 4XDVA 2OTL3 2CWVA 1BNFA 3S28A 1B20A 4FCZA 3SEDA 1HKXA 1M1XB 4HM5B 2GBXB 3NQYA 1D6YA 2HMOB 1C7HA 1KSIA 1RGAA 3CCU3 3MHEA 3K0ZA 4XBXA 1QVF2 2CFGA 3NUVA 3RGRA 1JB2A 4CCVA 5IG5A 2CFWA 3DGLA 2CKFB 1ULJB 1PFPA 3EBTA 2ML6A 3PGBA 5D82A 2CHCA 1OUNA 4WYKB 4EYCA 5CF2A 3F8XA 2LYXA 4KT3B 5CF1A 3CCQ3 5RNTA 1TTOA 4MJDA 5DRVA 3ZFZA 3IJEB 1LOYA 1I2GA 1OHOA 1RSNA 4J5GA 1KWIA 1MGWA 1FYSA 3OX9A 2FXTA 4IT7A
chains in the Genus database with same CATH topology
1VQ53 4IPBA 1OGZA 3CCR3 1E3RA 5G2GA 1O7PB 5AYRB 1O7WB 3QRDA 4OVMA 2RGQA 3JUMA 2Z76A 4JRFA 5EQLA 3BLZA 1K41A 3CCJ3 2B24B 3FSDA 1R4CA 3MSOA 3NV0A 2MC8A 1JN5A 1IVXA 3SOAA 1SQWA 1CEWI 4XBTA 4AKZA 1YIT3 2BMQB 3K9MC 3K7CA 1W2B2 2Z6BA 2YFJB 1N8R4 3CME3 2XGNA 4O3VA 3GZRA 2IUKA 1IDPA 3G0KA 3S29A 4AKYA 1Q824 8CHOA 3CC43 1OHSA 4L7KA 5EVHA 3WMDA 2HMMB 3EF8A 2KXGA 4BTXA 4MEIA 2GU3A 3LTAA 2OTJ3 1QJGA 4FMDA 2P0MA 1FGTA 3KSED 3QK9A 3FG4A 4EC6A 1S5AA 3D3LA 3F40A 3STDA 3GZBA 1W7CA 4FCJA 1VQL3 1IVVA 3OWSA 3CPOA 3EJVA 3G713 2CW9A 1JB5A 3CD63 4N6OB 1FUWA 3DXOA 3UJMA 3EBYA 3PYJA 2F86B 2YFLB 3RDEA 2GU1A 3BNCA 1K8A4 1K9M4 3NM7A 2K0MA 2CFLA 3FZWA 3G16A 3X42A 3GRDA 3BB9A 1IU7A 3DUKA 1DMNA 3U97A 4NHFA 3G8ZA 1UUWB 3DM8A 3LTCA 4FR9A 2PNCA 3CCE3 3ALAA 4H61A 1ZX2A 3A76A 1VQ63 1WNHA 2F99A 4STDA 1W6GA 3I553 3MWZA 3T8UA 4MMYB 3MG3A 1VQM3 3ER7A 4LMIA 3EB8A 1IQXA 1Y4KA 2XR8B 1Z1SA 1N8QA 2XEPA 3WA2X 1IQYA 5AIFA 1CQSA 5IEOA 1IV9A 4WYKA 2RFRA 3NX0A 3HIIA 3X3ZA 4MMZB 2D42A 3UL6A 4N6V0 2CH9A 1M904 4LEHA 4WP5A 2Y74A 2JDIH 3E99A 3NBRA 4KFDA 1PU4A 4HYZA 4PEJA 4HVNA 1SJWA 1OH0A 1DMMA 1RJOA 1WQLB 5AIGA 4ZM8A 1RRHA 3CCV3 1FA3A 3N9HA 1IVWA 4OK0A 4TX4A 6STDA 1Q40B 3CXC2 2C11A 1OCVA 3CNMA 2MF7A 3MG1A 3B7CA 1STDA 3NBBA 3VSYA 1VQN3 2W6JH 1AVLA 3H3HA 5IEPA 3Q2PA 2KCDA 3JUPA 3CMA3 4FMAA 3MPHA 4HZBB 1FGQA 1W5ZA 2P0XA 1JB4A 4U13A 1K734 4N6MA 3FF2A 3LYGA 3F9SA 3HZPA 3MYTA 3I0YA 4R4KA 5LC6A 1EA2A 1IV7A 1ISKA 3Q1CA 1G96A 2OCTA 3V99A 3SXXA 2QGUA 5FGOA 1ASKA 5IENA 3L0RA 3EX9A 2BMRB 2CG0A 4N6NB 3T8NA 5AEUB 1VQO3 3LT8A 3EN1B 3JVCA 2V1LA 3KKGA 3OV4A 4HM6B 5CXOA 5AYSC 5TGNA 3UB1A 2STDA 3SLUA 1SPUA 3LT9A 3S5CA 2JQ5A 3IMAB 1N5HA 1W6YA 2XH9A 1VQ83 3KFQC 1IVUA 1Q42A 1LNHA 5IERA 3GZYB 2XSHB 1A2KA 1YI23 1UI8A 4RZMA 2W03A 1FGRA 1OF5B 3CCL3 2B1XB 4FMCA 3N8BA 2E2UA 2BNGA 2F98A 2W9QA 3MKIA 5LC7A 3Q90A 1TFKA 2XF3A 3JUQA 3FCSB 3NBJA 3VGNA 1EQKA 4X2HA 3DGOA 3LMLA 1NDOB 2P09A 2E2TA 3DY5A 1J2BA 2W56B 1SIHA 1RKYA 4HKVB 1S723 2CWTA 5IG4A 4BTYA 5JBSA 2QIYA 1N9JA 1O7HB 4EXRA 1UUVB 4LGQA 1AV4A 3AMOB 3B4OA 5FW5A 3NXJA 2BO9B 2CFKA 1YGEA 2FGTA 4MMXB 4EV2A 2XRXB 1OPYA 1U8CB 4XM4A 1YVBI 1TUHA 1US1A 2HMNB 3F7XA 1YJW3 1NU3A 3FF0A 5CLKA 1O7GB 3X3YA 3BNDA 1KD14 1VQ43 1WTHA 4FCMA 3B8LA 2WOHA 1GY5A 1QAFA 4LZIA 3DGNA 1A67A 3NQZA 4K1VA 1Q40A 4ORLA 2WGQA 1IT8A 2CC3A 5KP4A 2GEXA 3N54B 1SIIA 1NB5I 1A2VA 2O3OA 1W2ZA 3EHCA 4K1UA 1MNLA 5DREA 3TDGA 2Y73A 1GS3A 1LOXA 1WMPA 4JF8A 4L8PA 3PS8A 3FG3A 1ZO2A 2CWUA 1GD4A 3LZAA 4EBGA 1A90A 3S27A 1UW1A 3FG1A 5BXQA 1VQ93 2XFTA 1W00A 2W0QA 3KE7A 4HM4B 4WWUC 1QVG2 3B4PA 2FNQA 2HMKB 1RRLA 3CC23 1GY7A 1JV2B 4KFEA 5AI1A 5EEOA 2HMJB 5KP1A 1DVCA 2SBLA 4HBRA 3LXUX 4O8SA 1DYUA 2CK3H 3DZLA 3U1WA 4R80A 3GZXB 3LTDA 5CK6A 2E2VA 1JRQA 3DGMA 3EC9A 1EKMA 5IW9A 3S67A 3K5TA 4XBYA 2ML5A 4XDWA 1N5PA 3ECFA 4HJLB 3OWYA 1Q7Y4 3FH1A 3BNBA 4HM3B 4HM7B 4HZ9B 2OQEA 1OF5A 3PXMA 3FGYA 4RNYA 2A15A 1AR0A 3CC73 1STFI 3LTBA 3HIGA 1VQP3 1CYVA 3G6E3 1O7NB 3HK4A 1KQS2 4HM1B 4R9KA 1F8NA 1QALA 2CG1A 2IUJA 3V98A 1VQ73 1Q864 3JUOA 1VZZA 3LOYA 2W56A 4CDLA 1FGMA 7STDA 4GL6A 1WMNA 1TU5A 1IQ8A 4WHAA 1HU9A 2O9UX 1DVDA 2GXFA 2R4IA 1D6UA 3AMOA 3WA3A 1D6ZA 4HM0B 2BMOB 2WOFA 2OQEC 2Z77A 3KIIA 1Q814 1IK3A 3EN8A 1N9EA 1UI7A 3OW22 5STDA 1KC84 4OUQA 3UL5A 1NO3A 2C10A 5BVBA 3VF1A 1M1K4 4KZ1A 1TP6A 2M7OA 2XSOB 3GWRA 3NM2A 1GYBA 4J9AA 2GEYA 5D81A 3G4S3 4IIAA 2RCDA 1JKGB 3SVAA 4J8TA 3GAXA 1NWWA 3WOEB 2P38A 3H51A 2W2CA 3MG2A 3X41A 2BHMA 3F14A 4KVHA 4N6LA 4N3VA 3X40A 1V74A 4RNZA 1LVNA 2Z7AA 3I563 2QA43 3CNXA 5IG3A 3KZTA 2Q07A 4RBNA 1OHPA 1RN7A 1BUQA 2P05A 1GY6A 1ULIB 1MOLA 2WO0A 2ZL8A 3RGAA 1NB3I 4EV5A 5AEWB 4QWTA 4K90B 2CFDA 3F7SA 2ZDJA 4G1MB 4X2OA 2OOVA 3PCRA 4HM2B 3D9RA 3PCSA 1M9GA 3HI7A 1T5YA 1QMAA 3F8HA 1ROVA 5IG0A 3WDGB 4XB5A 2K54A 3HX8A 4KFFA 2IA7A 3WOFB 3J7Yd 2PZVA 4K61A 2OWPA 4L8OA 1OACA 1E3VA 3K63A 1O7MB 3ROBA 1AVKA 4BTWA 3DMCA 3JUNA 3NV0B 3T0UA 2GBWB 3EE1A 3LH4A 1JN5B 3M8CA 2BT3A 2W04A 1WMOA 5ELJA 1OGXA 3FLJA 4GB5A 4Q53A 5HGRA 3SX1A 2CIUA 4R1KA 2OOVC 4H3UA 1ROAA 5ELUA 4NREA 3NHXA 1FGOA 1NJI4 3OXAA 4N6UA 1GD3A 1TIJA 3UNLA 1IT7A 3X3XA 1W01A 2L4VA 1JJ22 1DMQA 1W4NA 3KSPA 3KN4A 1VQK3 2IMJA 5JPUA 4O02B 5AIHA 5IF6A 1TFOA 3CCS3 3CCM3 3CPW2 2HMLB 5A0OB 1YJ93 2I9WA 1EG9B 2YFIB 5KP3A 3WODG 1LXEA 2KRTA 5AIIA 1YJN3 3OWUA 4N6TA 1YHQ3 2YX9A 5D83A 4WFOA 2WGOA 4R9LA 2UX0A 2W9PA 3IPTA 2XGLA 1W6CA 1CYUA 5JPPA 2D1WA 2LQVA 4HM8B 4LSOA 4O2HA 3SOYA 2RSXA 3EQQB 3V92A 1U5OA 3FKAA 2INXA 3CU3A 1JNQA 3O8YA 4I4KA 1E97A 3BNEA 2QEX3 2XFSA 4FMBA 5I97A 1L5GB 1JKGA 1QAKA 1YIJ3 4AEQA 1W02A 1K28A 3PZWA 4XDVA 2OTL3 2CWVA 3S28A 3SEDA 4FCZA 1HKXA 1M1XB 4HM5B 2GBXB 3NQYA 1D6YA 2HMOB 1C7HA 1KSIA 3CCU3 3MHEA 3K0ZA 4XBXA 1QVF2 2CFGA 3NUVA 3RGRA 1JB2A 4CCVA 5IG5A 2CFWA 3DGLA 2CKFB 1ULJB 1PFPA 3EBTA 2ML6A 3PGBA 5D82A 2CHCA 1OUNA 4WYKB 4EYCA 5CF2A 3F8XA 2LYXA 5CF1A 3CCQ3 4MJDA 5DRVA 3IJEB 1OHOA 1KWIA 3OX9A 2FXTA 4IT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGZ A;  1E3R A;  5G2G A;  1O7P B;  1O7W B;  4OVM A;  2RGQ A;  3JUM A;  2Z76 A;  3BLZ A;  1K41 A;  2B24 B;  3FSD A;  3MSO A;  3NV0 A;  1JN5 A;  3SOA A;  4XBT A;  2BMQ B;  3K7C A;  2YFJ B;  3GZR A;  1IDP A;  3G0K A;  8CHO A;  1OHS A;  4L7K A;  5EVH A;  3WMD A;  2HMM B;  3EF8 A;  1QJG A;  1S5A A;  3F40 A;  3STD A;  3GZB A;  4FCJ A;  3OWS A;  3CPO A;  3EJV A;  1JB5 A;  3DXO A;  3UJM A;  3EBY A;  2F86 B;  2YFL B;  3FZW A;  3G16 A;  3GRD A;  3BB9 A;  3DUK A;  1DMN A;  3G8Z A;  1UUW B;  3DM8 A;  1ZX2 A;  3A76 A;  2F99 A;  4STD A;  3T8U A;  3MG3 A;  3ER7 A;  4LMI A;  2XR8 B;  1Z1S A;  5AIF A;  1CQS A;  5IEO A;  4WYK A;  2RFR A;  4LEH A;  4WP5 A;  3E99 A;  3NBR A;  4PEJ A;  4HVN A;  1SJW A;  1OH0 A;  1DMM A;  1WQL B;  5AIG A;  6STD A;  1Q40 B;  1OCV A;  3CNM A;  3MG1 A;  3B7C A;  1STD A;  3VSY A;  3H3H A;  5IEP A;  3JUP A;  4HZB B;  1JB4 A;  4U13 A;  3FF2 A;  3LYG A;  3F9S A;  3HZP A;  3MYT A;  3I0Y A;  1EA2 A;  1ISK A;  2QGU A;  1ASK A;  5IEN A;  3EX9 A;  2BMR B;  3T8N A;  5AEU B;  5CXO A;  3EN1 B;  3KKG A;  3OV4 A;  5TGN A;  4HM6 B;  2STD A;  3S5C A;  2JQ5 A;  1W6Y A;  1Q42 A;  5IER A;  3GZY B;  2XSH B;  1A2K A;  4RZM A;  1OF5 B;  2B1X B;  2BNG A;  2F98 A;  3MKI A;  3Q90 A;  3JUQ A;  3VGN A;  4X2H A;  1NDO B;  4HKV B;  5IG4 A;  2QIY A;  1O7H B;  1UUV B;  4LGQ A;  3B4O A;  5FW5 A;  3NXJ A;  2XRX B;  1OPY A;  4XM4 A;  1TUH A;  2HMN B;  3F7X A;  1NU3 A;  3FF0 A;  5CLK A;  1O7G B;  4FCM A;  3B8L A;  1GY5 A;  4K1V A;  4ORL A;  1Q40 A;  5KP4 A;  2GEX A;  3EHC A;  4K1U A;  5DRE A;  1GS3 A;  4L8P A;  1ZO2 A;  3LZA A;  5BXQ A;  1W00 A;  3KE7 A;  4HM4 B;  4WWU C;  3B4P A;  2HMK B;  1GY7 A;  5AI1 A;  5KP1 A;  2HMJ B;  3DZL A;  3GZX B;  5CK6 A;  3EC9 A;  4XBY A;  4XDW A;  3ECF A;  4HJL B;  3OWY A;  3FH1 A;  4HM3 B;  4HM7 B;  4HZ9 B;  1OF5 A;  3FGY A;  2A15 A;  1AR0 A;  1O7N B;  3HK4 A;  4HM1 B;  4R9K A;  3JUO A;  1VZZ A;  4CDL A;  7STD A;  2GXF A;  2R4I A;  4HM0 B;  2BMO B;  2Z77 A;  3EN8 A;  5STD A;  4OUQ A;  5BVB A;  1TP6 A;  2XSO B;  3GWR A;  3NM2 A;  1GYB A;  4J9A A;  5D81 A;  2GEY A;  4IIA A;  2RCD A;  1JKG B;  4J8T A;  1NWW A;  3H51 A;  2W2C A;  3MG2 A;  3F14 A;  4KVH A;  4N3V A;  2Z7A A;  3CNX A;  5IG3 A;  3KZT A;  1OHP A;  1BUQ A;  1GY6 A;  1ULI B;  3RGA A;  5AEW B;  3F7S A;  4X2O A;  4HM2 B;  3D9R A;  1QMA A;  3F8H A;  5IG0 A;  4XB5 A;  2K54 A;  3HX8 A;  2PZV A;  2OWP A;  4L8O A;  1E3V A;  1O7M B;  3ROB A;  3DMC A;  3JUN A;  3NV0 B;  2GBW B;  3M8C A;  1JN5 B;  1OGX A;  3FLJ A;  4GB5 A;  4Q53 A;  5HGR A;  4R1K A;  4H3U A;  3NHX A;  3OXA A;  3UNL A;  1W01 A;  1DMQ A;  3KSP A;  2IMJ A;  5JPU A;  5AIH A;  5IF6 A;  2HML B;  2I9W A;  1EG9 B;  2YFI B;  5KP3 A;  5AII A;  3OWU A;  5D83 A;  4R9L A;  2UX0 A;  3IPT A;  5JPP A;  4HM8 B;  3SOY A;  3EQQ B;  1U5O A;  3FKA A;  2INX A;  3CU3 A;  4I4K A;  1E97 A;  1JKG A;  1W02 A;  4XDV A;  3SED A;  1HKX A;  4HM5 B;  2GBX B;  2HMO B;  1C7H A;  3MHE A;  3K0Z A;  4XBX A;  3NUV A;  3RGR A;  1JB2 A;  5IG5 A;  2CKF B;  1ULJ B;  3EBT A;  5D82 A;  2CHC A;  1OUN A;  4WYK B;  5CF2 A;  5CF1 A;  3F8X A;  4MJD A;  5DRV A;  1OHO A;  3OX9 A; 
#chains in the Genus database with same CATH topology
 1I0X A;  1VQ5 3;  4GSP A;  4IPB A;  2CX0 A;  1OGZ A;  3CCR 3;  1E3R A;  5G2G A;  1O7P B;  5AYR B;  1O7W B;  1G0T A;  3BIR A;  3QRD A;  4OVM A;  2RGQ A;  2H0H A;  3JUM A;  2Z76 A;  1V57 A;  4JRF A;  3BLZ A;  1K41 A;  5EQL A;  1B2S A;  3CCJ 3;  2GSP A;  2B24 B;  1HYF A;  1R4C A;  3FSD A;  3MSO A;  1BGS A;  3NV0 A;  1TJD A;  2MC8 A;  1GMR A;  1JN5 A;  2L1S A;  1IVX A;  3SOA A;  1SQW A;  1CEW I;  4XBT A;  1BRJ A;  4AKZ A;  1YIT 3;  2BMQ B;  3K9M C;  1IYY A;  3ZG5 A;  3K7C A;  1W2B 2;  2Z6B A;  2YFJ B;  1N8R 4;  3CME 3;  2XGN A;  3AHW A;  1B2X A;  4O3V A;  3GZR A;  1LNI A;  1IDP A;  2BIR A;  2IUK A;  3G0K A;  3S29 A;  4AKY A;  1Q82 4;  8CHO A;  3CC4 3;  1OHS A;  4L7K A;  2C4B A;  5EVH A;  3WMD A;  2HMM B;  3EF8 A;  1JZD A;  2KXG A;  4BTX A;  4MEI A;  2GU3 A;  3LTA A;  1BRH A;  4CJN A;  2OTJ 3;  1QJG A;  2KAA A;  4FMD A;  2P0M A;  1FGT A;  3AGO A;  3KSE D;  3QK9 A;  3FG4 A;  4EC6 A;  1S5A A;  3D3L A;  3F40 A;  3STD A;  3GZB A;  1W7C A;  4FCJ A;  1VQL 3;  1IVV A;  1HZ1 A;  3OWS A;  3CPO A;  3EJV A;  3G71 3;  1EUI C;  2CW9 A;  1JB5 A;  2AAD A;  3CD6 3;  4N6O B;  1UCI A;  3DXO A;  1FUW A;  1T2H A;  3UJM A;  3EBY A;  1B2U A;  3PYJ A;  1GOV A;  2F86 B;  1B27 A;  2YFL B;  3RDE A;  2GU1 A;  3BU4 A;  3BNC A;  1K8A 4;  1K9M 4;  1AY7 A;  3NM7 A;  2K0M A;  4BL3 A;  4EW5 A;  1GSP A;  1GMQ A;  2CFL A;  3FZW A;  3G16 A;  3X42 A;  3GRD A;  3BB9 A;  1IU7 A;  3DUK A;  1DMN A;  3U97 A;  1UGI A;  4NHF A;  2RNT A;  1UUW B;  3DM8 A;  3G8Z A;  3LTC A;  4FR9 A;  2PNC A;  1BAN A;  2R41 A;  3ALA A;  3CCE 3;  4H61 A;  1ZX2 A;  3A76 A;  1BRN L;  1RTU A;  1VQ6 3;  1WNH A;  2F99 A;  4STD A;  1W6G A;  3I55 3;  3MWZ A;  3T8U A;  4MMY B;  3MG3 A;  1VQM 3;  3ER7 A;  4LMI A;  5BU4 A;  3EB8 A;  1IQX A;  1Y4K A;  2XR8 B;  1Z1S A;  1N8Q A;  2XEP A;  3WA2 X;  1IQY A;  5AIF A;  1CQS A;  5IEO A;  1JZO A;  1IV9 A;  1V58 A;  4WYK A;  2RFR A;  3NX0 A;  3HII A;  1JBS A;  3X3Z A;  2J8X B;  4GHO A;  2D42 A;  4MMZ B;  3UL6 A;  5M18 A;  5M19 A;  4N6V 0;  1LOV A;  1LQM B;  3AHS A;  2CH9 A;  1M90 4;  4LEH A;  3WR2 A;  4WP5 A;  2Y74 A;  2JDI H;  3E99 A;  3NBR A;  4KFD A;  7RNT A;  1PU4 A;  4HYZ A;  4PEJ A;  4HVN A;  1SJW A;  1OH0 A;  1DMM A;  1WQL B;  1RJO A;  5AIG A;  4ZM8 A;  1RRH A;  3CCV 3;  1FA3 A;  3N9H A;  1IVW A;  3D5I A;  4OK0 A;  4TX4 A;  1LRA A;  6STD A;  4BIR A;  1Q40 B;  3CXC 2;  2C11 A;  1OCV A;  3CNM A;  2MF7 A;  3MG1 A;  1SAR A;  1BU4 A;  1STD A;  3B7C A;  3NBB A;  3VSY A;  3D5G A;  1B3S A;  1VQN 3;  2W6J H;  1YGW A;  1AVL A;  3H3H A;  5IEP A;  3Q2P A;  1BAO A;  2KCD A;  7GSP A;  3JUP A;  1R4Y A;  3CMA 3;  4FMA A;  3MPH A;  4HZB B;  1I2F A;  1FGQ A;  1W5Z A;  2P0X A;  1JB4 A;  1UDI I;  1BUJ A;  4U13 A;  1K73 4;  4N6M A;  3FF2 A;  3LYG A;  3F9S A;  3HZP A;  3MYT A;  3I0Y A;  4R4K A;  5LC6 A;  9RNT A;  1EA2 A;  3URP A;  1IV7 A;  1ISK A;  3Q1C A;  1G96 A;  4J5K A;  1GOU A;  2OCT A;  3V99 A;  1BSD A;  3SXX A;  2QGU A;  1TRQ A;  1YNV X;  1BIR A;  2F56 A;  5FGO A;  1ASK A;  5G1K A;  5IEN A;  3L0R A;  1RNT A;  3EX9 A;  2BMR B;  2CG0 A;  4N6N B;  3T8N A;  5AEU B;  1VQO 3;  3LT8 A;  3EN1 B;  3JVC A;  2V1L A;  3KKG A;  3OV4 A;  4HM6 B;  5CXO A;  5AYS C;  5TGN A;  3UB1 A;  2STD A;  3SLU A;  1JBT A;  1SPU A;  1X1X A;  3LT9 A;  2JQ5 A;  3IMA B;  1N5H A;  3S5C A;  1W6Y A;  2XH9 A;  2F5W A;  1VQ8 3;  2K3D A;  3KFQ C;  1IVU A;  1Q42 A;  1MWT A;  1LNH A;  3HOH A;  3GZY B;  2XSH B;  5IER A;  1FW7 A;  4CPK A;  1A2K A;  1YI2 3;  1UI8 A;  4RZM A;  2W03 A;  3GSP A;  1FGR A;  1OF5 B;  3CCL 3;  1CH0 A;  2B1X B;  4FMC A;  3N8B A;  2E2U A;  1VQQ A;  2BNG A;  2F98 A;  2W9Q A;  3MKI A;  5LC7 A;  3Q90 A;  1TFK A;  2XF3 A;  2F4Y A;  3FCS B;  1UCL A;  3JUQ A;  2HOH A;  3NBJ A;  3VGN A;  4X2H A;  5GSP A;  3DGO A;  1BNI A;  3LML A;  3KCH A;  1NDO B;  3DGY A;  2P09 A;  2E2T A;  3DY5 A;  1BNS A;  1J2B A;  2W56 B;  1SIH A;  1RKY A;  4HKV B;  1RCK A;  2CWT A;  1S72 3;  5HOH A;  4BTY A;  5IG4 A;  5JBS A;  2QIY A;  1N9J A;  1O7H B;  6RNT A;  4EXR A;  1A2P A;  1UUV B;  4LGQ A;  1AV4 A;  3AMO B;  1GMP A;  3B4O A;  5FW5 A;  1Q7H A;  1BRI A;  3NXJ A;  2BO9 B;  2CFK A;  1YGE A;  2FGT A;  4MMX B;  4EV2 A;  2XRX B;  1OPY A;  1U8C B;  4XM4 A;  5BIR A;  1YVB I;  1TUH A;  1US1 A;  2HMN B;  3F7X A;  1YJW 3;  1BRK A;  1NU3 A;  1I2E A;  3FF0 A;  5CLK A;  1O7G B;  2KF6 A;  3X3Y A;  3BND A;  1KD1 4;  1Q9E A;  1WTH A;  1I0V A;  4FCM A;  1VQ4 3;  3B8L A;  2WOH A;  1GY5 A;  1QAF A;  4LZI A;  3DGN A;  1A67 A;  3NQZ A;  4K1V A;  1Q40 A;  4ORL A;  2WGQ A;  1IT8 A;  1X1U A;  2CC3 A;  5KP4 A;  2GEX A;  3N54 B;  1SII A;  1NB5 I;  1A2V A;  2O3O A;  1W2Z A;  1BVI A;  4RNT A;  4HAA A;  3EHC A;  4K1U A;  2KF4 A;  3D79 A;  1MNL A;  5DRE A;  3TDG A;  4BL2 A;  2Y73 A;  1GS3 A;  1LOX A;  1WMP A;  4JF8 A;  4L8P A;  3PS8 A;  2H0G A;  3FG3 A;  1ZO2 A;  2CWU A;  1GD4 A;  3LZA A;  4EBG A;  2ZHX B;  3S27 A;  1UW1 A;  3FG1 A;  5BXQ A;  1VQ9 3;  2XFT A;  1A90 A;  5G1L A;  1W00 A;  2W0Q A;  3KE7 A;  4HM4 B;  4WWU C;  1QVG 2;  3B4P A;  2FNQ A;  2HMK B;  1RRL A;  3CC2 3;  1GY7 A;  1G02 A;  1JV2 B;  4KFE A;  5AI1 A;  5EEO A;  2HMJ B;  5KP1 A;  1DVC A;  2SBL A;  4HBR A;  3LXU X;  4O8S A;  1DYU A;  1RGE A;  2CK3 H;  3DZL A;  3U1W A;  1I3F A;  1ZS7 A;  4R80 A;  3GZX B;  3LTD A;  5CK6 A;  1I70 A;  1T2I A;  2E2V A;  1JRQ A;  3DGM A;  2AAE A;  3AGN A;  3EC9 A;  3RNT A;  1EKM A;  5IW9 A;  3S67 A;  1BRG A;  1PY3 A;  1RMS A;  3K5T A;  1DET A;  4XBY A;  1FUS A;  2ML5 A;  4XDW A;  1N5P A;  3ECF A;  4HJL B;  4DKI A;  3OWY A;  1Q7Y 4;  3FH1 A;  3BNB A;  4HM3 B;  4HM7 B;  4HZ9 B;  1BNE A;  1T3B A;  2OQE A;  1OF5 A;  3PXM A;  3FGY A;  4NPB A;  4RNY A;  2A15 A;  1AR0 A;  3CC7 3;  1STF I;  1EEJ A;  3LTB A;  3HIG A;  1MWU A;  1CYV A;  1RGC A;  1VQP 3;  3G6E 3;  1BOX A;  1O7N B;  3HK4 A;  1PYL A;  1KQS 2;  4HM1 B;  4R9K A;  1F8N A;  4LYL B;  1QAL A;  2CG1 A;  2IUJ A;  3V98 A;  2IYJ A;  1VQ7 3;  1Q86 4;  3JUO A;  1VZZ A;  3LOY A;  2W56 A;  4CDL A;  1UGH I;  1BNG A;  1FGM A;  7STD A;  4GL6 A;  1WMN A;  1TU5 A;  1IQ8 A;  1X1W A;  1HU9 A;  1I8V A;  4WHA A;  1DE3 A;  2O9U X;  1DVD A;  1BSA A;  2GXF A;  2R4I A;  1D6U A;  3AMO A;  3WA3 A;  1D6Z A;  4HM0 B;  2BMO B;  2WOF A;  2OQE C;  2Z77 A;  3KII A;  1B2M A;  2CX1 A;  1BSC A;  1RCL A;  1Q81 4;  1IK3 A;  3EN8 A;  1N9E A;  1UI7 A;  3OW2 2;  5STD A;  1KC8 4;  2SAR A;  4OUQ A;  3UL5 A;  1NO3 A;  2C10 A;  5BVB A;  3VF1 A;  1M1K 4;  4KZ1 A;  1TP6 A;  2BU4 A;  2M7O A;  2XSO B;  3GWR A;  3NM2 A;  1GOY A;  1GYB A;  4J9A A;  2GEY A;  5D81 A;  3G4S 3;  4IIA A;  2RCD A;  1JKG B;  3SVA A;  4I5Q A;  3GAX A;  1NWW A;  4J8T A;  3WOE B;  3SYU A;  2P38 A;  1RNB A;  3H51 A;  2W2C A;  1UCK A;  3MG2 A;  2BHM A;  3X41 A;  3F14 A;  4KVH A;  4N6L A;  1I3I A;  1UUG B;  4N3V A;  3X40 A;  1V74 A;  4RNZ A;  1LVN A;  1BNR A;  2Z7A A;  3I56 3;  2QA4 3;  3CNX A;  5IG3 A;  3KZT A;  2Q07 A;  1RGH A;  1RGG A;  4BU4 A;  4RBN A;  1OHP A;  1RN7 A;  1BUQ A;  1AQZ A;  2P05 A;  1GY6 A;  1ULI B;  1MWR A;  2UGI A;  1MOL A;  1RN4 A;  2WO0 A;  2ZL8 A;  1EQK A;  3RGA A;  1NB3 I;  4EV5 A;  5AEW B;  4QWT A;  4K90 B;  1RDS A;  1NNV A;  1X1Y A;  2CFD A;  2ZDJ A;  3F7S A;  4G1M B;  4X2O A;  2OOV A;  3PCR A;  4HM2 B;  1RGL A;  3D9R A;  1M9G A;  3PCS A;  3ZG0 A;  3HI7 A;  1BNJ A;  1T5Y A;  1QMA A;  3F8H A;  1ROV A;  5IG0 A;  3WDG B;  4XB5 A;  2K54 A;  2KF5 A;  3HX8 A;  1RGF A;  4KFF A;  2IA7 A;  3WOF B;  3J7Y d;  2PZV A;  4K61 A;  2OWP A;  4L8O A;  1OAC A;  1E3V A;  3K63 A;  1O7M B;  3ROB A;  1AVK A;  4BTW A;  3DMC A;  3JUN A;  3NV0 B;  3T0U A;  2GBW B;  1BSE A;  3EE1 A;  3LH4 A;  1JN5 B;  3M8C A;  2BT3 A;  2W04 A;  3A5E A;  1WMO A;  5ELJ A;  1OGX A;  3FLJ A;  2RBI A;  4GB5 A;  4Q53 A;  1YVS A;  3Q3F A;  5HGR A;  3SX1 A;  1LOW A;  2CIU A;  4R1K A;  2OOV C;  4H3U A;  1ROA A;  5ELU A;  2H0I A;  3WHO A;  1JBR A;  1ZGX A;  1FZU A;  4NRE A;  3NHX A;  1FGO A;  2KF3 A;  1NJI 4;  3OXA A;  4N6U A;  1GD3 A;  1TIJ A;  2IY2 A;  1IT7 A;  3UNL A;  3X3X A;  1RN1 A;  1W01 A;  1BSB A;  1MWS A;  2L4V A;  1TRP A;  6GSP A;  1JJ2 2;  1FUT A;  1DMQ A;  1W4N A;  2ZA4 A;  2F5M A;  3KSP A;  3KN4 A;  1VQK 3;  3D4A A;  1RLS A;  2IMJ A;  5JPU A;  4O02 B;  5AIH A;  1LQG C;  5IF6 A;  1TFO A;  8RNT A;  3CCS 3;  3CCM 3;  3CPW 2;  4HOH A;  2HML B;  5A0O B;  1YJ9 3;  2I9W A;  1RHL A;  1EG9 B;  2UUG C;  2YFI B;  5KP3 A;  3WOD G;  1LXE A;  2KRT A;  5AII A;  1YJN 3;  3OWU A;  4N6T A;  1YHQ 3;  2YX9 A;  1B2Z A;  4WFO A;  5D83 A;  4ILF A;  2WGO A;  4R9L A;  2UX0 A;  2W9P A;  3IPT A;  5M1A A;  1C54 A;  1MGR A;  2XGL A;  1W6C A;  1CYU A;  5JPP A;  2D1W A;  2LQV A;  4HM8 B;  4LSO A;  4O2H A;  3SOY A;  2RSX A;  3EQQ B;  1RGK A;  3V92 A;  1U5O A;  3FKA A;  2INX A;  1UCJ A;  3CU3 A;  1JNQ A;  3O8Y A;  4I4K A;  1E97 A;  3BNE A;  1BRS A;  3DH2 A;  2XFS A;  4FMB A;  5I97 A;  2QEX 3;  1L5G B;  1JKG A;  1QAK A;  1YIJ 3;  1B21 A;  4AEQ A;  1W02 A;  1K28 A;  3PZW A;  4XDV A;  2OTL 3;  2CWV A;  1BNF A;  3S28 A;  1B20 A;  4FCZ A;  3SED A;  1HKX A;  1M1X B;  4HM5 B;  2GBX B;  3NQY A;  1D6Y A;  2HMO B;  1C7H A;  1KSI A;  1RGA A;  3CCU 3;  3MHE A;  3K0Z A;  4XBX A;  1QVF 2;  2CFG A;  3NUV A;  3RGR A;  1JB2 A;  4CCV A;  5IG5 A;  2CFW A;  3DGL A;  2CKF B;  1ULJ B;  1PFP A;  3EBT A;  2ML6 A;  3PGB A;  5D82 A;  2CHC A;  1OUN A;  4WYK B;  4EYC A;  5CF2 A;  3F8X A;  2LYX A;  4KT3 B;  5CF1 A;  3CCQ 3;  5RNT A;  1TTO A;  4MJD A;  5DRV A;  3ZFZ A;  3IJE B;  1LOY A;  1I2G A;  1OHO A;  1RSN A;  4J5G A;  1KWI A;  1MGW A;  1FYS A;  3OX9 A;  2FXT A;  4IT7 A; 
#chains in the Genus database with same CATH homology
 1VQ5 3;  4IPB A;  1OGZ A;  3CCR 3;  1E3R A;  5G2G A;  1O7P B;  5AYR B;  1O7W B;  3QRD A;  4OVM A;  2RGQ A;  3JUM A;  2Z76 A;  4JRF A;  5EQL A;  3BLZ A;  1K41 A;  3CCJ 3;  2B24 B;  3FSD A;  1R4C A;  3MSO A;  3NV0 A;  2MC8 A;  1JN5 A;  1IVX A;  3SOA A;  1SQW A;  1CEW I;  4XBT A;  4AKZ A;  1YIT 3;  2BMQ B;  3K9M C;  3K7C A;  1W2B 2;  2Z6B A;  2YFJ B;  1N8R 4;  3CME 3;  2XGN A;  4O3V A;  3GZR A;  2IUK A;  1IDP A;  3G0K A;  3S29 A;  4AKY A;  1Q82 4;  8CHO A;  3CC4 3;  1OHS A;  4L7K A;  5EVH A;  3WMD A;  2HMM B;  3EF8 A;  2KXG A;  4BTX A;  4MEI A;  2GU3 A;  3LTA A;  2OTJ 3;  1QJG A;  4FMD A;  2P0M A;  1FGT A;  3KSE D;  3QK9 A;  3FG4 A;  4EC6 A;  1S5A A;  3D3L A;  3F40 A;  3STD A;  3GZB A;  1W7C A;  4FCJ A;  1VQL 3;  1IVV A;  3OWS A;  3CPO A;  3EJV A;  3G71 3;  2CW9 A;  1JB5 A;  3CD6 3;  4N6O B;  1FUW A;  3DXO A;  3UJM A;  3EBY A;  3PYJ A;  2F86 B;  2YFL B;  3RDE A;  2GU1 A;  3BNC A;  1K8A 4;  1K9M 4;  3NM7 A;  2K0M A;  2CFL A;  3FZW A;  3G16 A;  3X42 A;  3GRD A;  3BB9 A;  1IU7 A;  3DUK A;  1DMN A;  3U97 A;  4NHF A;  3G8Z A;  1UUW B;  3DM8 A;  3LTC A;  4FR9 A;  2PNC A;  3CCE 3;  3ALA A;  4H61 A;  1ZX2 A;  3A76 A;  1VQ6 3;  1WNH A;  2F99 A;  4STD A;  1W6G A;  3I55 3;  3MWZ A;  3T8U A;  4MMY B;  3MG3 A;  1VQM 3;  3ER7 A;  4LMI A;  3EB8 A;  1IQX A;  1Y4K A;  2XR8 B;  1Z1S A;  1N8Q A;  2XEP A;  3WA2 X;  1IQY A;  5AIF A;  1CQS A;  5IEO A;  1IV9 A;  4WYK A;  2RFR A;  3NX0 A;  3HII A;  3X3Z A;  4MMZ B;  2D42 A;  3UL6 A;  4N6V 0;  2CH9 A;  1M90 4;  4LEH A;  4WP5 A;  2Y74 A;  2JDI H;  3E99 A;  3NBR A;  4KFD A;  1PU4 A;  4HYZ A;  4PEJ A;  4HVN A;  1SJW A;  1OH0 A;  1DMM A;  1RJO A;  1WQL B;  5AIG A;  4ZM8 A;  1RRH A;  3CCV 3;  1FA3 A;  3N9H A;  1IVW A;  4OK0 A;  4TX4 A;  6STD A;  1Q40 B;  3CXC 2;  2C11 A;  1OCV A;  3CNM A;  2MF7 A;  3MG1 A;  3B7C A;  1STD A;  3NBB A;  3VSY A;  1VQN 3;  2W6J H;  1AVL A;  3H3H A;  5IEP A;  3Q2P A;  2KCD A;  3JUP A;  3CMA 3;  4FMA A;  3MPH A;  4HZB B;  1FGQ A;  1W5Z A;  2P0X A;  1JB4 A;  4U13 A;  1K73 4;  4N6M A;  3FF2 A;  3LYG A;  3F9S A;  3HZP A;  3MYT A;  3I0Y A;  4R4K A;  5LC6 A;  1EA2 A;  1IV7 A;  1ISK A;  3Q1C A;  1G96 A;  2OCT A;  3V99 A;  3SXX A;  2QGU A;  5FGO A;  1ASK A;  5IEN A;  3L0R A;  3EX9 A;  2BMR B;  2CG0 A;  4N6N B;  3T8N A;  5AEU B;  1VQO 3;  3LT8 A;  3EN1 B;  3JVC A;  2V1L A;  3KKG A;  3OV4 A;  4HM6 B;  5CXO A;  5AYS C;  5TGN A;  3UB1 A;  2STD A;  3SLU A;  1SPU A;  3LT9 A;  3S5C A;  2JQ5 A;  3IMA B;  1N5H A;  1W6Y A;  2XH9 A;  1VQ8 3;  3KFQ C;  1IVU A;  1Q42 A;  1LNH A;  5IER A;  3GZY B;  2XSH B;  1A2K A;  1YI2 3;  1UI8 A;  4RZM A;  2W03 A;  1FGR A;  1OF5 B;  3CCL 3;  2B1X B;  4FMC A;  3N8B A;  2E2U A;  2BNG A;  2F98 A;  2W9Q A;  3MKI A;  5LC7 A;  3Q90 A;  1TFK A;  2XF3 A;  3JUQ A;  3FCS B;  3NBJ A;  3VGN A;  1EQK A;  4X2H A;  3DGO A;  3LML A;  1NDO B;  2P09 A;  2E2T A;  3DY5 A;  1J2B A;  2W56 B;  1SIH A;  1RKY A;  4HKV B;  1S72 3;  2CWT A;  5IG4 A;  4BTY A;  5JBS A;  2QIY A;  1N9J A;  1O7H B;  4EXR A;  1UUV B;  4LGQ A;  1AV4 A;  3AMO B;  3B4O A;  5FW5 A;  3NXJ A;  2BO9 B;  2CFK A;  1YGE A;  2FGT A;  4MMX B;  4EV2 A;  2XRX B;  1OPY A;  1U8C B;  4XM4 A;  1YVB I;  1TUH A;  1US1 A;  2HMN B;  3F7X A;  1YJW 3;  1NU3 A;  3FF0 A;  5CLK A;  1O7G B;  3X3Y A;  3BND A;  1KD1 4;  1VQ4 3;  1WTH A;  4FCM A;  3B8L A;  2WOH A;  1GY5 A;  1QAF A;  4LZI A;  3DGN A;  1A67 A;  3NQZ A;  4K1V A;  1Q40 A;  4ORL A;  2WGQ A;  1IT8 A;  2CC3 A;  5KP4 A;  2GEX A;  3N54 B;  1SII A;  1NB5 I;  1A2V A;  2O3O A;  1W2Z A;  3EHC A;  4K1U A;  1MNL A;  5DRE A;  3TDG A;  2Y73 A;  1GS3 A;  1LOX A;  1WMP A;  4JF8 A;  4L8P A;  3PS8 A;  3FG3 A;  1ZO2 A;  2CWU A;  1GD4 A;  3LZA A;  4EBG A;  1A90 A;  3S27 A;  1UW1 A;  3FG1 A;  5BXQ A;  1VQ9 3;  2XFT A;  1W00 A;  2W0Q A;  3KE7 A;  4HM4 B;  4WWU C;  1QVG 2;  3B4P A;  2FNQ A;  2HMK B;  1RRL A;  3CC2 3;  1GY7 A;  1JV2 B;  4KFE A;  5AI1 A;  5EEO A;  2HMJ B;  5KP1 A;  1DVC A;  2SBL A;  4HBR A;  3LXU X;  4O8S A;  1DYU A;  2CK3 H;  3DZL A;  3U1W A;  4R80 A;  3GZX B;  3LTD A;  5CK6 A;  2E2V A;  1JRQ A;  3DGM A;  3EC9 A;  1EKM A;  5IW9 A;  3S67 A;  3K5T A;  4XBY A;  2ML5 A;  4XDW A;  1N5P A;  3ECF A;  4HJL B;  3OWY A;  1Q7Y 4;  3FH1 A;  3BNB A;  4HM3 B;  4HM7 B;  4HZ9 B;  2OQE A;  1OF5 A;  3PXM A;  3FGY A;  4RNY A;  2A15 A;  1AR0 A;  3CC7 3;  1STF I;  3LTB A;  3HIG A;  1VQP 3;  1CYV A;  3G6E 3;  1O7N B;  3HK4 A;  1KQS 2;  4HM1 B;  4R9K A;  1F8N A;  1QAL A;  2CG1 A;  2IUJ A;  3V98 A;  1VQ7 3;  1Q86 4;  3JUO A;  1VZZ A;  3LOY A;  2W56 A;  4CDL A;  1FGM A;  7STD A;  4GL6 A;  1WMN A;  1TU5 A;  1IQ8 A;  4WHA A;  1HU9 A;  2O9U X;  1DVD A;  2GXF A;  2R4I A;  1D6U A;  3AMO A;  3WA3 A;  1D6Z A;  4HM0 B;  2BMO B;  2WOF A;  2OQE C;  2Z77 A;  3KII A;  1Q81 4;  1IK3 A;  3EN8 A;  1N9E A;  1UI7 A;  3OW2 2;  5STD A;  1KC8 4;  4OUQ A;  3UL5 A;  1NO3 A;  2C10 A;  5BVB A;  3VF1 A;  1M1K 4;  4KZ1 A;  1TP6 A;  2M7O A;  2XSO B;  3GWR A;  3NM2 A;  1GYB A;  4J9A A;  2GEY A;  5D81 A;  3G4S 3;  4IIA A;  2RCD A;  1JKG B;  3SVA A;  4J8T A;  3GAX A;  1NWW A;  3WOE B;  2P38 A;  3H51 A;  2W2C A;  3MG2 A;  3X41 A;  2BHM A;  3F14 A;  4KVH A;  4N6L A;  4N3V A;  3X40 A;  1V74 A;  4RNZ A;  1LVN A;  2Z7A A;  3I56 3;  2QA4 3;  3CNX A;  5IG3 A;  3KZT A;  2Q07 A;  4RBN A;  1OHP A;  1RN7 A;  1BUQ A;  2P05 A;  1GY6 A;  1ULI B;  1MOL A;  2WO0 A;  2ZL8 A;  3RGA A;  1NB3 I;  4EV5 A;  5AEW B;  4QWT A;  4K90 B;  2CFD A;  3F7S A;  2ZDJ A;  4G1M B;  4X2O A;  2OOV A;  3PCR A;  4HM2 B;  3D9R A;  3PCS A;  1M9G A;  3HI7 A;  1T5Y A;  1QMA A;  3F8H A;  1ROV A;  5IG0 A;  3WDG B;  4XB5 A;  2K54 A;  3HX8 A;  4KFF A;  2IA7 A;  3WOF B;  3J7Y d;  2PZV A;  4K61 A;  2OWP A;  4L8O A;  1OAC A;  1E3V A;  3K63 A;  1O7M B;  3ROB A;  1AVK A;  4BTW A;  3DMC A;  3JUN A;  3NV0 B;  3T0U A;  2GBW B;  3EE1 A;  3LH4 A;  1JN5 B;  3M8C A;  2BT3 A;  2W04 A;  1WMO A;  5ELJ A;  1OGX A;  3FLJ A;  4GB5 A;  4Q53 A;  5HGR A;  3SX1 A;  2CIU A;  4R1K A;  2OOV C;  4H3U A;  1ROA A;  5ELU A;  4NRE A;  3NHX A;  1FGO A;  1NJI 4;  3OXA A;  4N6U A;  1GD3 A;  1TIJ A;  3UNL A;  1IT7 A;  3X3X A;  1W01 A;  2L4V A;  1JJ2 2;  1DMQ A;  1W4N A;  3KSP A;  3KN4 A;  1VQK 3;  2IMJ A;  5JPU A;  4O02 B;  5AIH A;  5IF6 A;  1TFO A;  3CCS 3;  3CCM 3;  3CPW 2;  2HML B;  5A0O B;  1YJ9 3;  2I9W A;  1EG9 B;  2YFI B;  5KP3 A;  3WOD G;  1LXE A;  2KRT A;  5AII A;  1YJN 3;  3OWU A;  4N6T A;  1YHQ 3;  2YX9 A;  5D83 A;  4WFO A;  2WGO A;  4R9L A;  2UX0 A;  2W9P A;  3IPT A;  2XGL A;  1W6C A;  1CYU A;  5JPP A;  2D1W A;  2LQV A;  4HM8 B;  4LSO A;  4O2H A;  3SOY A;  2RSX A;  3EQQ B;  3V92 A;  1U5O A;  3FKA A;  2INX A;  3CU3 A;  1JNQ A;  3O8Y A;  4I4K A;  1E97 A;  3BNE A;  2QEX 3;  2XFS A;  4FMB A;  5I97 A;  1L5G B;  1JKG A;  1QAK A;  1YIJ 3;  4AEQ A;  1W02 A;  1K28 A;  3PZW A;  4XDV A;  2OTL 3;  2CWV A;  3S28 A;  3SED A;  4FCZ A;  1HKX A;  1M1X B;  4HM5 B;  2GBX B;  3NQY A;  1D6Y A;  2HMO B;  1C7H A;  1KSI A;  3CCU 3;  3MHE A;  3K0Z A;  4XBX A;  1QVF 2;  2CFG A;  3NUV A;  3RGR A;  1JB2 A;  4CCV A;  5IG5 A;  2CFW A;  3DGL A;  2CKF B;  1ULJ B;  1PFP A;  3EBT A;  2ML6 A;  3PGB A;  5D82 A;  2CHC A;  1OUN A;  4WYK B;  4EYC A;  5CF2 A;  3F8X A;  2LYX A;  5CF1 A;  3CCQ 3;  4MJD A;  5DRV A;  3IJE B;  1OHO A;  1KWI A;  3OX9 A;  2FXT A;  4IT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...