2F98A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Biosynthetic protein
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f98A00
2W2CA 5D81A 1ASKA 4ORLA 1E3RA 1OF5B 2JQ5A 1A2KA 1W02A 1VZZA 3HX8A 3JUPA 2HMNB 5AIHA 5DRVA 8CHOA 3JUQA 1TP6A 5JPPA 4K1UA 1O7NB 5TGNA 5JPUA 3EX9A 4XM4A 5BXQA 4HJLB 1GY5A 3IPTA 1JN5B 5D83A 3EBTA 2I9WA 4HM5B 1OPYA 3CPOA 3RGAA 2GEXA 5IENA 5IG4A 1UUVB 3A76A 3F8HA 3LYGA 1U5OA 4GB5A 4J9AA 3GZYB 3MKIA 3M8CA 3FH1A 5KP4A 5D82A 5BVBA 1O7HB 3CNMA 1JKGA 1NWWA 1IDPA 3NXJA 2B24B 1JB4A 4STDA 1O7WB 1JN5A 4HM6B 3S5CA 2Z76A 3Q90A 3EC9A 1Q42A 4HM4B 3UJMA 4HZ9B 5CF2A 3FGYA 3EJVA 1DMNA 3KE7A 1W01A 2PZVA 3FSDA 3MG3A 5AEWB 1STDA 4K1VA 1QJGA 4XBTA 5IG3A 2F86B 3OXAA 1EA2A 3B4PA 3K7CA 1Q40B 2INXA 3EN1B 2K54A 2BNGA 1GY6A 5AIIA 3B8LA 4HKVB 3G8ZA 2BMOB 3DZLA 4R9KA 1OGXA 4WP5A 5AI1A 3STDA 3WMDA 1BUQA 1HKXA 3F8XA 2CKFB 4HM8B 4HVNA 2F99A 3E99A 3FF2A 3H3HA 3VSYA 1OHOA 3FZWA 1GY7A 4LMIA 1GYBA 4XBXA 1UUWB 5EVHA 3EBYA 3EN8A 4R1KA 4R9LA 4HZBB 4PEJA 5G2GA 3B7CA 3EF8A 4HM1B 1GS3A 4OVMA 3NM2A 3OV4A 2BMQB 3NUVA 4FCJA 4HM2B 1S5AA 4HM3B 4J8TA 2XRXB 1QMAA 3CU3A 2HMKB 4XB5A 5AIFA 1JB5A 1ULJB 2GBXB 3JUOA 3NV0B 4HM0B 4WYKA 3MYTA 3MHEA 4XDVA 5CF1A 3LZAA 1NDOB 3D9RA 3F7SA 2OWPA 5STDA 1WQLB 1E97A 3F9SA 3VGNA 5KP1A 5IG5A 1E3VA 2HMOB 1ZX2A 3FLJA 5AEUB 3ECFA 3G16A 3HZPA 5CK6A 1O7GB 1OF5A 3JUMA 3I0YA 1JB2A 3KSPA 3F14A 1O7PB 5DREA 3H51A 4U13A 5FW5A 3RGRA 3ROBA 4I4KA 1AR0A 3MG2A 3B4OA 4CDLA 1DMQA 2B1XB 1JKGB 1Z1SA 2HMJB 1K41A 1OCVA 4N3VA 3FF0A 2GBWB 3EQQB 1OGZA 2RGQA 3NHXA 4RZMA 5IEOA 1NU3A 2RFRA 2CHCA 1ZO2A 1SJWA 3UNLA 2HMMB 2Z7AA 5CLKA 2YFJB 3KKGA 2BMRB 3F7XA 1OHSA 5IEPA 7STDA 1ISKA 2A15A 1ULIB 4KVHA 4MJDA 5AIGA 2XR8B 3FKAA 3GWRA 4L8OA 5IG0A 4LEHA 4IIAA 3SOAA 5IERA 3T8UA 4X2OA 2IMJA 1C7HA 1EG9B 1W00A 3DM8A 2GXFA 3EHCA 3GRDA 4WWUC 1W6YA 1OUNA 1O7MB 2RCDA 4HM7B 4Q53A 1CQSA 3DUKA 3MG1A 3JUNA 2UX0A 2F98A 4WYKB 4FCMA 4XDWA 5HGRA 6STDA 3NBRA 4L7KA 3OWUA 1DMMA 3MSOA 3T8NA 2QGUA 3DXOA 2QIYA 3K0ZA 2XSOB 3NV0A 3GZRA 3F40A 5IF6A 3KZTA 1OH0A 2GEYA 3OX9A 2STDA 2Z77A 3GZBA 4OUQA 4X2HA 5KP3A 3HK4A 2YFIB 3OWSA 4L8PA 3CNXA 4XBYA 3SOYA 2R4IA 2XSHB 2YFLB 3G0KA 3OWYA 1OHPA 5CXOA 1Q40A 2HMLB 3BB9A 4LGQA 1TUHA 3GZXB 3SEDA 3BLZA 4H3UA 3ER7A 3DMCA
chains in the Genus database with same CATH superfamily
2P09A 2JQ5A 3JUPA 1I2FA 1BVIA 1SQWA 1TP6A 1UUGB 1O7NB 2FNQA 4K1UA 4N6NB 5TGNA 2IUJA 1PYLA 5BXQA 1GY5A 4WHAA 1YJN3 3KIIA 1JN5B 1IVVA 2H0IA 3EBTA 1VQN3 4KFDA 2GEXA 3WA3A 2ZHXB 1UUVB 4GSPA 4GB5A 5LC7A 1N8R4 1IYYA 3GZYB 1AY7A 1LOVA 4H61A 1W6GA 1WMPA 1OACA 2XGLA 1TFOA 1IDPA 2B24B 1GOUA 1JB4A 3GAXA 1A90A 2IA7A 3Q90A 5EQLA 1N9EA 4J5GA 1Y4KA 1BNGA 1FA3A 2BHMA 3U97A 3WHOA 1DMNA 1G02A 3LTDA 1BSBA 2KF4A 5IG3A 5AYSC 1EA2A 3HI7A 1IV9A 4FMDA 1Q40B 1MWRA 1BANA 2BNGA 5AI1A 3WMDA 2PNCA 1R4CA 1CYVA 4O02B 2QEX3 3RDEA 2F99A 3E99A 1BRJA 3CCS3 3D5GA 3H3HA 8RNTA 1GY7A 4LMIA 1GYBA 3X40A 1UUWB 2P0MA 3EN8A 4R1KA 3VSYA 4PEJA 5CF1A 5JBSA 1KQS2 4MEIA 3NBJA 3NM2A 3PS8A 2BMQB 3NUVA 4XB5A 4EW5A 5IG0A 3CU3A 3Q2PA 1JB5A 3MPHA 1GD3A 1X1UA 3OW22 3MYTA 1BIRA 1RLSA 3F9SA 3VGNA 1UCJA 3AGNA 3PXMA 2IYJA 2WGQA 5CK6A 2OOVC 1O7GB 4LZIA 3I0YA 3WODG 3V92A 2Y74A 5DREA 1UCIA 4CDLA 1DMQA 4O2HA 1I3IA 2WOHA 3T0UA 3ZFZA 1Z1SA 2CX0A 3PCRA 1VQ63 1RJOA 1MNLA 2KXGA 3N9HA 1K41A 4N3VA 4RZMA 3FF0A 3EQQB 2RGQA 3NHXA 1B2XA 1IT7A 4CPKA 3CCQ3 2RFRA 2CHCA 1VQO3 1FW7A 1SJWA 5HOHA 2YFJB 1R4YA 2BMRB 4FMAA 2KRTA 3G4S3 1M1K4 7RNTA 1SARA 5AIGA 3FKAA 3G713 4L8OA 1BRNL 1B21A 5IERA 2OOVA 1C7HA 2Z6BA 2CWUA 3X41A 1X1WA 2RCDA 4HM7B 4WYKB 5BIRA 2UX0A 2F98A 1WMOA 1D6YA 2FXTA 2W9PA 1Q9EA 3K0ZA 2P0XA 2WGOA 2XFTA 3DY5A 2BT3A 1A67A 3KZTA 2STDA 1K734 3GZBA 4X2HA 4R80A 3AMOA 2IY2A 2JDIH 2LYXA 1B2MA 3SOYA 1RDSA 2R4IA 3FG4A 2OQEC 2XSHB 3G0KA 1FGMA 1AQZA 2OTL3 3O8YA 3NM7A 1DE3A 1I70A 4NHFA 1DETA 1NB5I 2W2CA 5D81A 1ASKA 4ORLA 9RNTA 3CD63 3SYUA 1A2KA 1W02A 1VZZA 1BNEA 2CFKA 2HMNB 2W03A 1MWSA 2ZA4A 3HX8A 4LYLB 1GMRA 4XM4A 1KSIA 2CC3A 3MWZA 3IPTA 4HJLB 3WOFB 1MGWA 4JRFA 1HZ1A 6RNTA 1SIIA 1OPYA 3D4AA 3RGAA 1RHLA 4NREA 4FMCA 3AGOA 1DVDA 3LYGA 1U5OA 2GU3A 2ZL8A 5BU4A 1N9JA 1JKGA 1BGSA 3CCR3 1NWWA 1Q864 3NXJA 2RBIA 5RNTA 1QAFA 2CFWA 4HM6B 1JN5A 4BTWA 3KSED 3WOEB 3CME3 2Z76A 3NQZA 3EC9A 3S67A 1Q42A 1UCLA 4HM4B 5CF2A 3FCSB 1SIHA 1TTOA 3CPW2 5ELUA 1YI23 3BIRA 1BNFA 1LQMB 1KWIA 4KZ1A 3DGOA 1GOYA 3KE7A 1UI7A 1A2PA 1W01A 3FSDA 3Q3FA 5G1KA 3WDGB 3CC23 1JBRA 1QJGA 1LRAA 3OXAA 4GL6A 2P05A 3IMAB 4DKIA 1W4NA 2CWVA 2L4VA 3FG1A 3V99A 1I0VA 1NJI4 2K54A 1GY6A 1BRKA 1JZOA 1OGXA 1RKYA 1RSNA 1LXEA 2BO9B 1T2HA 3N54B 1YIJ3 1TU5A 3FF2A 3X3XA 1GMQA 3PCSA 3U1WA 2ML6A 1MGRA 4ILFA 1LOYA 1VQ73 4K90B 1VQ53 4R9LA 1YIT3 3J7Yd 4OVMA 3DGMA 1ZS7A 1GS3A 2XGNA 1FGQA 2CW9A 3LH4A 4HM3B 1BSDA 3PGBA 2GBXB 7STDA 3NV0B 4XDVA 1FYSA 1US1A 1NDOB 3HIGA 5STDA 2OWPA 5KP1A 4MMXB 1YHQ3 1B3SA 1I0XA 3ECFA 1N5HA 3LOYA 2CG0A 1T2IA 4EC6A 3F14A 3PYJA 1O7PB 4ZM8A 3CCL3 4U13A 1M9GA 1CH0A 1RTUA 1N8QA 2B1XB 3QRDA 1B20A 1IU7A 1BAOA 3BU4A 1MWTA 3VF1A 2UUGC 3ZG5A 5JPPA 2GBWB 5IEOA 3G6E3 1BOXA 1NU3A 2F5MA 4I5QA 3BNBA 1UDII 1AV4A 2HMMB 3KKGA 5IEPA 1EKMA 3GSPA 1VQM3 3EE1A 2XR8B 1PY3A 2E2TA 2F56A 2KAAA 4NPBA 1LQGC 4RNZA 4BIRA 2CWTA 1W6YA 1N5PA 1O7MB 4Q53A 1CQSA 4TX4A 4RNYA 1W6CA 3OWUA 1IVWA 3DXOA 2QIYA 1IVXA 1LVNA 4HBRA 3TDGA 2GEYA 4LSOA 1QAKA 3ZG0A 1RGAA 6GSPA 1VQP3 3WA2X 2GU1A 2YFIB 4L8PA 1CEWI 1D6ZA 3I553 4XBYA 2L1SA 2M7OA 1IT8A 5CXOA 3DH2A 4EYCA 3SEDA 1X1YA 3BLZA 4H3UA 1LNHA 1BRSA 1Q7Y4 1LOWA 1RGHA 5AIHA 2O3OA 8CHOA 2AAEA 7GSPA 1IK3A 3EX9A 1RRHA 1FGRA 4OK0A 4AEQA 1KD14 2I9WA 4HM5B 1W2B2 5IENA 1BUJA 4EXRA 3NBBA 1JZDA 1TRPA 3DGNA 3I563 3MKIA 5KP4A 3FH1A 2BIRA 5D82A 5BVBA 1O7HB 1V57A 3CNMA 1RMSA 1RGKA 3WR2A 4HAAA 3ALAA 2W9QA 4STDA 1O7WB 3LTBA 4R4KA 1B27A 2CK3H 3LXUX 3UJMA 1F8NA 2XEPA 3FGYA 3EJVA 1JBTA 3V98A 3N8BA 2PZVA 1YVSA 2WOFA 1UGIA 4K1VA 1RGGA 1X1XA 4XBTA 2R41A 5M18A 1I2EA 3B4PA 3LTCA 2INXA 3EN1B 2UGIA 5AIIA 5G1LA 1GD4A 3HOHA 3B8LA 4HKVB 3URPA 2BMOB 3CC43 3BNEA 2W6JH 2IUKA 2V1LA 1BUQA 1HKXA 2K0MA 1AVLA 2CKFB 1D6UA 3K5TA 1JRQA 4BTYA 2KCDA 1OHOA 1RN7A 3IJEB 1IVUA 2W0QA 3BNCA 4XBXA 1SPUA 1DYUA 4HZBB 4HM1B 1FGTA 3OV4A 4HM2B 4FCJA 3CCV3 1EEJA 1S5AA 1WNHA 3D5IA 1IQXA 4HM0B 2CX1A 4WYKA 3LZAA 3D9RA 1JV2B 2F4YA 3F7SA 1WQLB 2GSPA 1UGHI 2MF7A 1E3VA 1L5GB 1ZX2A 1EUIC 3FLJA 5IG5A 1RN1A 5AEUB 1ROVA 1NNVA 3CC73 1OF5A 2K3DA 1RCLA 4MMYB 1UW1A 3AHWA 1BNRA 3ROBA 2SARA 3LMLA 1AR0A 4I4KA 4IPBA 2Q07A 1IQYA 1JKGB 1BNJA 4RNTA 4CCVA 1JBSA 3SLUA 1PU4A 2P38A 1BRIA 3DGYA 1OCVA 1TRQA 4G1MB 1S723 1RGEA 1OGZA 4WFOA 1B2ZA 1W2ZA 1YJ93 2D42A 4QWTA 2Z7AA 5CLKA 3F7XA 1I8VA 1ISKA 2FGTA 2A15A 1ULIB 2D1WA 4KVHA 4MJDA 1TFKA 4AKYA 3GWRA 4HYZA 4LEHA 4IIAA 3SOAA 3T8UA 4X2OA 2IMJA 5GSPA 2CFDA 1W00A 4N6TA 1T5YA 2W56A 3EHCA 3GRDA 1OUNA 5DRVA 1MWUA 5A0OB 2XFSA 3DGLA 1WTHA 2ML5A 3DUKA 3MG1A 3RNTA 1TIJA 1RCKA 4FCMA 5HGRA 4N6LA 6STDA 1Q814 3T8NA 1K28A 2J8XB 1BSAA 1I3FA 4IT7A 3F40A 1M904 5IF6A 2C11A 1VQ83 3OX9A 1IV7A 2Z77A 3AMOB 4OUQA 3K63A 3QK9A 1QALA 3HK4A 3JVCA 1BU4A 3CNXA 4EBGA 1QVF2 4FMBA 4FR9A 1K9M4 4EV5A 3X3ZA 3PZWA 2YFLB 3OWYA 3LT9A 1OHPA 4N6OB 1K8A4 1Q40A 2HMLB 3BB9A 1M1XB 1T3BA 3AHSA 1AVKA 1STFI 3KN4A 3ER7A 3DMCA 1EQKA 1W5ZA 5I97A 2F5WA 1BSCA 1E3RA 1OF5B 5EEOA 1KC84 1Q7HA 1VQ93 3CCJ3 1HU9A 3JUQA 4MMZB 2HOHA 1BNIA 4O8SA 1VQQA 2E2VA 2H0HA 2OTJ3 2CG1A 2Y73A 5D83A 3HIIA 3SVAA 3CPOA 5IG4A 3A76A 2XF3A 3F8HA 4O3VA 4GHOA 4J9AA 3M8CA 1YGEA 2SBLA 2H0GA 3K9MC 2WO0A 1QVG2 1U8CB 4EV2A 5M1AA 1C54A 3D3LA 3CCM3 1YVBI 2KF6A 3S5CA 1RGFA 1ROAA 5M19A 1A2VA 2E2UA 1BRHA 4HZ9B 1VQK3 2RSXA 2CFLA 2RNTA 2MC8A 1W7CA 2QA43 5AEWB 3MG3A 3S28A 1STDA 5FGOA 2C10A 1J2BA 4BU4A 2F86B 4KT3B 1FUTA 3K7CA 2XH9A 1DVCA 3A5EA 1VQ43 3KFQC 1LNIA 1V58A 3X3YA 1RRLA 2OQEA 1NO3A 4R9KA 3G8ZA 3STDA 3DZLA 3EB8A 3D79A 4WP5A 1V74A 3F8XA 4HM8B 4HVNA 4N6MA 3UB1A 1UI8A 3CXC2 2CIUA 3FZWA 4KFEA 4BL2A 2ZDJA 3EBYA 5G2GA 4CJNA 3B7CA 3EF8A 1G0TA 1B2SA 1BNSA 1FGOA 1YNVX 4J8TA 4N6UA 2XRXB 1QMAA 5AIFA 2HMKB 5EVHA 1ULJB 3JUOA 2KF3A 1FZUA 4JF8A 3MHEA 1HYFA 1G96A 1RNBA 1E97A 3LT8A 1BRGA 2HMOB 3Q1CA 1CYUA 4AKZA 3G16A 4RBNA 3HZPA 3JUMA 3KCHA 3S29A 3CCE3 5LC6A 1JB2A 1ZGXA 3KSPA 3LTAA 1RNTA 3H51A 5FW5A 3RGRA 3MG2A 3B4OA 5JPUA 3S27A 1YJW3 1YGWA 2HMJB 4HOHA 3L0RA 3UL6A 2CH9A 3SX1A 1ZO2A 5ELJA 3UNLA 1GSPA 1IQ8A 5IW9A 1RGCA 2YX9A 3FG3A 1OHSA 1VQL3 1BSEA 2OCTA 1B2UA 1GMPA 1RN4A 2CFGA 2W56B 3UL5A 1EG9B 3DM8A 2GXFA 4K61A 4WWUC 3NX0A 1FUSA 4XDWA 1JJ22 3JUNA 2C4BA 2O9UX 3NBRA 2W04A 4L7KA 1DMMA 1RGLA 1TJDA 2QGUA 3MSOA 1PFPA 3NQYA 2KF5A 2XSOB 3GZRA 3NV0A 3SXXA 3CCU3 1OH0A 1I2GA 1NB3I 3BNDA 2AADA 5KP3A 4BTXA 3OWSA 4FCZA 1UCKA 1GOVA 3CMA3 3X42A 2BU4A 4J5KA 4KFFA 1FUWA 1JNQA 5AYRB 4BL3A 4N6V0 2LQVA 1MOLA 1WMNA 1LOXA 4LGQA 1TUHA 3GZXB 1Q824
chains in the Genus database with same CATH topology
2P09A 2JQ5A 3JUPA 2IUJA 1SQWA 1TP6A 4K1UA 1O7NB 2FNQA 4N6NB 5TGNA 5JPUA 5BXQA 1YJN3 1GY5A 4WHAA 3KIIA 1JN5B 1IVVA 3EBTA 1VQN3 4KFDA 2GEXA 3WA3A 1UUVB 4GB5A 5LC7A 1N8R4 3GZYB 4H61A 1W6GA 1WMPA 1OACA 2XGLA 1TFOA 1IDPA 2B24B 1JB4A 3GAXA 1A90A 2IA7A 3Q90A 5EQLA 1N9EA 1Y4KA 1FA3A 2BHMA 3U97A 1DMNA 3LTDA 5IG3A 5AYSC 1EA2A 3HI7A 1IV9A 4FMDA 1Q40B 2BNGA 5AI1A 3WMDA 2PNCA 1R4CA 1CYVA 4O02B 2QEX3 3RDEA 2F99A 3E99A 3H3HA 1GY7A 4LMIA 1GYBA 3X40A 1UUWB 2P0MA 3EN8A 4R1KA 3VSYA 4PEJA 5CF1A 5JBSA 1KQS2 4MEIA 3NBJA 3NM2A 3PS8A 2BMQB 3NUVA 4XB5A 5IG0A 3CU3A 3Q2PA 1JB5A 3MPHA 1GD3A 3OW22 3MYTA 3F9SA 3VGNA 3PXMA 2WGQA 5CK6A 2OOVC 1O7GB 4LZIA 3I0YA 3WODG 3V92A 2Y74A 5DREA 4CDLA 1DMQA 4O2HA 2WOHA 3T0UA 1Z1SA 3PCRA 1VQ63 1RJOA 1MNLA 2KXGA 3N9HA 1K41A 4N3VA 4RZMA 3FF0A 3EQQB 2RGQA 3NHXA 1IT7A 3CCQ3 2RFRA 2CHCA 1VQO3 1SJWA 2YFJB 2BMRB 4FMAA 2KRTA 3G4S3 1M1K4 5AIGA 3FKAA 3G713 4L8OA 5IERA 2OOVA 1C7HA 2Z6BA 2CWUA 3X41A 2RCDA 4HM7B 4WYKB 2UX0A 2F98A 1WMOA 1D6YA 2FXTA 2W9PA 3K0ZA 2P0XA 2WGOA 2XFTA 3DY5A 2BT3A 1A67A 3KZTA 2STDA 1K734 3GZBA 4X2HA 4R80A 3AMOA 2JDIH 2LYXA 3SOYA 2R4IA 3FG4A 2OQEC 2XSHB 3G0KA 1FGMA 2OTL3 3O8YA 3NM7A 4NHFA 1NB5I 2W2CA 5D81A 1ASKA 4ORLA 3CD63 1A2KA 1W02A 1VZZA 2CFKA 3HX8A 2HMNB 2W03A 4XM4A 1KSIA 2CC3A 3MWZA 3IPTA 4HJLB 3WOFB 4JRFA 1SIIA 1OPYA 3RGAA 4NREA 4FMCA 1DVDA 3LYGA 1U5OA 2GU3A 2ZL8A 1N9JA 1JKGA 3CCR3 1NWWA 1Q864 3NXJA 1QAFA 2CFWA 4HM6B 1JN5A 4BTWA 3KSED 3WOEB 3CME3 2Z76A 3NQZA 3EC9A 3S67A 1Q42A 4HM4B 5CF2A 3CPW2 3FCSB 1SIHA 5ELUA 1YI23 4KZ1A 1KWIA 3DGOA 3KE7A 1UI7A 1W01A 3FSDA 3WDGB 3CC23 1QJGA 3OXAA 4GL6A 2P05A 3IMAB 1W4NA 2CWVA 2L4VA 3FG1A 3V99A 1NJI4 2K54A 1GY6A 1OGXA 1RKYA 1LXEA 2BO9B 3N54B 1YIJ3 1TU5A 3FF2A 3X3XA 3PCSA 3U1WA 2ML6A 1VQ73 4K90B 1VQ53 4R9LA 1YIT3 3J7Yd 4OVMA 3DGMA 1GS3A 2XGNA 1FGQA 2CW9A 3LH4A 4HM3B 3PGBA 2GBXB 7STDA 3NV0B 4XDVA 1US1A 1NDOB 3HIGA 5STDA 2OWPA 5KP1A 4MMXB 1YHQ3 3ECFA 1N5HA 3LOYA 2CG0A 4EC6A 3F14A 3PYJA 1O7PB 4ZM8A 3CCL3 4U13A 1M9GA 1N8QA 2B1XB 3QRDA 1IU7A 3VF1A 5JPPA 2GBWB 5IEOA 3G6E3 1NU3A 3BNBA 1AV4A 2HMMB 3KKGA 5IEPA 1EKMA 1VQM3 3EE1A 2XR8B 2E2TA 4RNZA 2CWTA 1W6YA 1N5PA 1O7MB 4Q53A 1CQSA 4TX4A 4RNYA 1W6CA 3OWUA 1IVWA 3DXOA 2QIYA 1IVXA 1LVNA 4HBRA 3TDGA 2GEYA 1QAKA 1VQP3 3WA2X 2GU1A 2YFIB 4L8PA 1CEWI 1D6ZA 3I553 4XBYA 2M7OA 1IT8A 5CXOA 4EYCA 3SEDA 3BLZA 4H3UA 1LNHA 1Q7Y4 5AIHA 2O3OA 8CHOA 1IK3A 3EX9A 1RRHA 1FGRA 4OK0A 4AEQA 1KD14 2I9WA 4HM5B 1W2B2 5IENA 4EXRA 3NBBA 3DGNA 3I563 3MKIA 5KP4A 3FH1A 5D82A 5BVBA 1O7HB 3CNMA 3ALAA 2W9QA 4STDA 1O7WB 3LTBA 4R4KA 2CK3H 3LXUX 3UJMA 1F8NA 2XEPA 3FGYA 3EJVA 3V98A 3N8BA 2PZVA 2WOFA 4K1VA 4XBTA 3B4PA 3LTCA 2INXA 3EN1B 5AIIA 1GD4A 3B8LA 4HKVB 1BUQA 2BMOB 3CC43 3BNEA 2W6JH 2IUKA 2V1LA 1HKXA 2K0MA 1AVLA 2CKFB 1D6UA 3K5TA 1JRQA 4BTYA 2KCDA 1OHOA 1RN7A 3IJEB 1IVUA 2W0QA 3BNCA 4XBXA 1SPUA 1DYUA 4HZBB 4HM1B 1FGTA 3OV4A 4HM2B 4FCJA 3CCV3 1S5AA 1WNHA 1IQXA 4HM0B 4WYKA 3LZAA 3D9RA 1JV2B 3F7SA 1WQLB 2MF7A 1E3VA 1L5GB 1ZX2A 5IG5A 3FLJA 5AEUB 1ROVA 3CC73 1OF5A 4MMYB 1UW1A 3ROBA 3LMLA 1AR0A 4I4KA 4IPBA 2Q07A 1IQYA 1JKGB 4CCVA 3SLUA 1PU4A 2P38A 1OCVA 4G1MB 1S723 1OGZA 4WFOA 1W2ZA 1YJ93 2D42A 4QWTA 2Z7AA 5CLKA 3F7XA 1ISKA 2FGTA 2A15A 1ULIB 2D1WA 4KVHA 4MJDA 1TFKA 4AKYA 3GWRA 4HYZA 4LEHA 4IIAA 3SOAA 3T8UA 4X2OA 2IMJA 2CFDA 1W00A 4N6TA 3EHCA 1T5YA 2W56A 3GRDA 1OUNA 5DRVA 5A0OB 2XFSA 3DGLA 1WTHA 2ML5A 3DUKA 3MG1A 1TIJA 4FCMA 5HGRA 6STDA 4N6LA 1Q814 3T8NA 1K28A 4IT7A 3F40A 1M904 5IF6A 2C11A 1VQ83 3OX9A 1IV7A 2Z77A 3AMOB 4OUQA 3K63A 3QK9A 1QALA 3HK4A 3JVCA 3CNXA 4EBGA 1QVF2 4FMBA 4FR9A 1K9M4 4EV5A 3X3ZA 3PZWA 2YFLB 3OWYA 3LT9A 1OHPA 4N6OB 1K8A4 1Q40A 2HMLB 3BB9A 1M1XB 1AVKA 1STFI 3KN4A 3ER7A 3DMCA 1EQKA 1W5ZA 5I97A 1E3RA 1OF5B 5EEOA 1KC84 1VQ93 3CCJ3 1HU9A 3JUQA 4MMZB 4O8SA 2E2VA 2OTJ3 2CG1A 2Y73A 5D83A 3HIIA 3SVAA 3CPOA 5IG4A 3A76A 2XF3A 3F8HA 4O3VA 4J9AA 3M8CA 1YGEA 2SBLA 3K9MC 2WO0A 1QVG2 1U8CB 4EV2A 3D3LA 3CCM3 1YVBI 3S5CA 1ROAA 1A2VA 2E2UA 4HZ9B 1VQK3 2RSXA 2CFLA 2MC8A 1W7CA 2QA43 5AEWB 3MG3A 3S28A 1STDA 5FGOA 2C10A 1J2BA 2F86B 3K7CA 2XH9A 1DVCA 1VQ43 3KFQC 3X3YA 1RRLA 2OQEA 1NO3A 4R9KA 3G8ZA 3STDA 3DZLA 3EB8A 4WP5A 1V74A 3F8XA 4HM8B 4HVNA 4N6MA 3UB1A 1UI8A 3CXC2 2CIUA 3FZWA 4KFEA 2ZDJA 3EBYA 5G2GA 3B7CA 3EF8A 1FGOA 4J8TA 4N6UA 5EVHA 2XRXB 1QMAA 5AIFA 2HMKB 1ULJB 3JUOA 4JF8A 3MHEA 1G96A 1E97A 3LT8A 3Q1CA 2HMOB 1CYUA 4AKZA 3G16A 4RBNA 3HZPA 3JUMA 3S29A 3CCE3 5LC6A 1JB2A 3KSPA 3LTAA 3RGRA 3H51A 5FW5A 3MG2A 3B4OA 3S27A 1YJW3 2HMJB 3L0RA 3UL6A 2CH9A 3SX1A 1ZO2A 5ELJA 3UNLA 1IQ8A 5IW9A 2YX9A 3FG3A 1OHSA 1VQL3 2OCTA 2CFGA 2W56B 3UL5A 1EG9B 3DM8A 2GXFA 4K61A 4WWUC 3NX0A 4XDWA 1JJ22 3JUNA 2O9UX 3NBRA 2W04A 4L7KA 1DMMA 3MSOA 3NQYA 2QGUA 4LSOA 1PFPA 3NV0A 2XSOB 3CCS3 3GZRA 3SXXA 3CCU3 1OH0A 1NB3I 3BNDA 5KP3A 4BTXA 3OWSA 4FCZA 3CMA3 3X42A 4KFFA 1FUWA 1JNQA 5AYRB 4N6V0 2LQVA 1MOLA 1WMNA 1LOXA 4LGQA 1TUHA 3GZXB 1Q824
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2C A;  5D81 A;  1ASK A;  4ORL A;  1E3R A;  1OF5 B;  2JQ5 A;  1A2K A;  1W02 A;  1VZZ A;  3HX8 A;  3JUP A;  2HMN B;  5AIH A;  5DRV A;  8CHO A;  3JUQ A;  1TP6 A;  5JPP A;  4K1U A;  1O7N B;  5TGN A;  5JPU A;  3EX9 A;  4XM4 A;  5BXQ A;  4HJL B;  1GY5 A;  3IPT A;  1JN5 B;  5D83 A;  3EBT A;  2I9W A;  4HM5 B;  1OPY A;  3CPO A;  3RGA A;  2GEX A;  5IEN A;  5IG4 A;  1UUV B;  3A76 A;  3F8H A;  3LYG A;  1U5O A;  4GB5 A;  4J9A A;  3GZY B;  3MKI A;  3M8C A;  3FH1 A;  5KP4 A;  5D82 A;  5BVB A;  1O7H B;  3CNM A;  1JKG A;  1NWW A;  1IDP A;  3NXJ A;  2B24 B;  1JB4 A;  4STD A;  1O7W B;  1JN5 A;  4HM6 B;  3S5C A;  2Z76 A;  3Q90 A;  3EC9 A;  1Q42 A;  4HM4 B;  3UJM A;  4HZ9 B;  5CF2 A;  3FGY A;  3EJV A;  1DMN A;  3KE7 A;  1W01 A;  2PZV A;  3FSD A;  3MG3 A;  5AEW B;  1STD A;  4K1V A;  1QJG A;  4XBT A;  5IG3 A;  2F86 B;  3OXA A;  1EA2 A;  3B4P A;  3K7C A;  1Q40 B;  2INX A;  3EN1 B;  2K54 A;  2BNG A;  1GY6 A;  5AII A;  3B8L A;  4HKV B;  3G8Z A;  2BMO B;  3DZL A;  4R9K A;  1OGX A;  4WP5 A;  5AI1 A;  3STD A;  3WMD A;  1BUQ A;  1HKX A;  3F8X A;  2CKF B;  4HM8 B;  4HVN A;  2F99 A;  3E99 A;  3FF2 A;  3H3H A;  3VSY A;  1OHO A;  3FZW A;  1GY7 A;  4LMI A;  1GYB A;  4XBX A;  1UUW B;  5EVH A;  3EBY A;  3EN8 A;  4R1K A;  4R9L A;  4HZB B;  4PEJ A;  5G2G A;  3B7C A;  3EF8 A;  4HM1 B;  1GS3 A;  4OVM A;  3NM2 A;  3OV4 A;  2BMQ B;  3NUV A;  4FCJ A;  4HM2 B;  1S5A A;  4HM3 B;  4J8T A;  2XRX B;  1QMA A;  3CU3 A;  2HMK B;  4XB5 A;  5AIF A;  1JB5 A;  1ULJ B;  2GBX B;  3JUO A;  3NV0 B;  4HM0 B;  4WYK A;  3MYT A;  3MHE A;  4XDV A;  5CF1 A;  3LZA A;  1NDO B;  3D9R A;  3F7S A;  2OWP A;  5STD A;  1WQL B;  1E97 A;  3F9S A;  3VGN A;  5KP1 A;  5IG5 A;  1E3V A;  2HMO B;  1ZX2 A;  3FLJ A;  5AEU B;  3ECF A;  3G16 A;  3HZP A;  5CK6 A;  1O7G B;  1OF5 A;  3JUM A;  3I0Y A;  1JB2 A;  3KSP A;  3F14 A;  1O7P B;  5DRE A;  3H51 A;  4U13 A;  5FW5 A;  3RGR A;  3ROB A;  4I4K A;  1AR0 A;  3MG2 A;  3B4O A;  4CDL A;  1DMQ A;  2B1X B;  1JKG B;  1Z1S A;  2HMJ B;  1K41 A;  1OCV A;  4N3V A;  3FF0 A;  2GBW B;  3EQQ B;  1OGZ A;  2RGQ A;  3NHX A;  4RZM A;  5IEO A;  1NU3 A;  2RFR A;  2CHC A;  1ZO2 A;  1SJW A;  3UNL A;  2HMM B;  2Z7A A;  5CLK A;  2YFJ B;  3KKG A;  2BMR B;  3F7X A;  1OHS A;  5IEP A;  7STD A;  1ISK A;  2A15 A;  1ULI B;  4KVH A;  4MJD A;  5AIG A;  2XR8 B;  3FKA A;  3GWR A;  4L8O A;  5IG0 A;  4LEH A;  4IIA A;  3SOA A;  5IER A;  3T8U A;  4X2O A;  2IMJ A;  1C7H A;  1EG9 B;  1W00 A;  3DM8 A;  2GXF A;  3EHC A;  3GRD A;  4WWU C;  1W6Y A;  1OUN A;  1O7M B;  2RCD A;  4HM7 B;  4Q53 A;  1CQS A;  3DUK A;  3MG1 A;  3JUN A;  2UX0 A;  2F98 A;  4WYK B;  4FCM A;  4XDW A;  5HGR A;  6STD A;  3NBR A;  4L7K A;  3OWU A;  1DMM A;  3MSO A;  3T8N A;  2QGU A;  3DXO A;  2QIY A;  3K0Z A;  2XSO B;  3NV0 A;  3GZR A;  3F40 A;  5IF6 A;  3KZT A;  1OH0 A;  2GEY A;  3OX9 A;  2STD A;  2Z77 A;  3GZB A;  4OUQ A;  4X2H A;  5KP3 A;  3HK4 A;  2YFI B;  3OWS A;  4L8P A;  3CNX A;  4XBY A;  3SOY A;  2R4I A;  2XSH B;  2YFL B;  3G0K A;  3OWY A;  1OHP A;  5CXO A;  1Q40 A;  2HML B;  3BB9 A;  4LGQ A;  1TUH A;  3GZX B;  3SED A;  3BLZ A;  4H3U A;  3ER7 A;  3DMC A; 
#chains in the Genus database with same CATH topology
 2P09 A;  2JQ5 A;  3JUP A;  1I2F A;  1BVI A;  1SQW A;  1TP6 A;  1UUG B;  1O7N B;  2FNQ A;  4K1U A;  4N6N B;  5TGN A;  2IUJ A;  1PYL A;  5BXQ A;  1GY5 A;  4WHA A;  1YJN 3;  3KII A;  1JN5 B;  1IVV A;  2H0I A;  3EBT A;  1VQN 3;  4KFD A;  2GEX A;  3WA3 A;  2ZHX B;  1UUV B;  4GSP A;  4GB5 A;  5LC7 A;  1N8R 4;  1IYY A;  3GZY B;  1AY7 A;  1LOV A;  4H61 A;  1W6G A;  1WMP A;  1OAC A;  2XGL A;  1TFO A;  1IDP A;  2B24 B;  1GOU A;  1JB4 A;  3GAX A;  1A90 A;  2IA7 A;  3Q90 A;  5EQL A;  1N9E A;  4J5G A;  1Y4K A;  1BNG A;  1FA3 A;  2BHM A;  3U97 A;  3WHO A;  1DMN A;  1G02 A;  3LTD A;  1BSB A;  2KF4 A;  5IG3 A;  5AYS C;  1EA2 A;  3HI7 A;  1IV9 A;  4FMD A;  1Q40 B;  1MWR A;  1BAN A;  2BNG A;  5AI1 A;  3WMD A;  2PNC A;  1R4C A;  1CYV A;  4O02 B;  2QEX 3;  3RDE A;  2F99 A;  3E99 A;  1BRJ A;  3CCS 3;  3D5G A;  3H3H A;  8RNT A;  1GY7 A;  4LMI A;  1GYB A;  3X40 A;  1UUW B;  2P0M A;  3EN8 A;  4R1K A;  3VSY A;  4PEJ A;  5CF1 A;  5JBS A;  1KQS 2;  4MEI A;  3NBJ A;  3NM2 A;  3PS8 A;  2BMQ B;  3NUV A;  4XB5 A;  4EW5 A;  5IG0 A;  3CU3 A;  3Q2P A;  1JB5 A;  3MPH A;  1GD3 A;  1X1U A;  3OW2 2;  3MYT A;  1BIR A;  1RLS A;  3F9S A;  3VGN A;  1UCJ A;  3AGN A;  3PXM A;  2IYJ A;  2WGQ A;  5CK6 A;  2OOV C;  1O7G B;  4LZI A;  3I0Y A;  3WOD G;  3V92 A;  2Y74 A;  5DRE A;  1UCI A;  4CDL A;  1DMQ A;  4O2H A;  1I3I A;  2WOH A;  3T0U A;  3ZFZ A;  1Z1S A;  2CX0 A;  3PCR A;  1VQ6 3;  1RJO A;  1MNL A;  2KXG A;  3N9H A;  1K41 A;  4N3V A;  4RZM A;  3FF0 A;  3EQQ B;  2RGQ A;  3NHX A;  1B2X A;  1IT7 A;  4CPK A;  3CCQ 3;  2RFR A;  2CHC A;  1VQO 3;  1FW7 A;  1SJW A;  5HOH A;  2YFJ B;  1R4Y A;  2BMR B;  4FMA A;  2KRT A;  3G4S 3;  1M1K 4;  7RNT A;  1SAR A;  5AIG A;  3FKA A;  3G71 3;  4L8O A;  1BRN L;  1B21 A;  5IER A;  2OOV A;  1C7H A;  2Z6B A;  2CWU A;  3X41 A;  1X1W A;  2RCD A;  4HM7 B;  4WYK B;  5BIR A;  2UX0 A;  2F98 A;  1WMO A;  1D6Y A;  2FXT A;  2W9P A;  1Q9E A;  3K0Z A;  2P0X A;  2WGO A;  2XFT A;  3DY5 A;  2BT3 A;  1A67 A;  3KZT A;  2STD A;  1K73 4;  3GZB A;  4X2H A;  4R80 A;  3AMO A;  2IY2 A;  2JDI H;  2LYX A;  1B2M A;  3SOY A;  1RDS A;  2R4I A;  3FG4 A;  2OQE C;  2XSH B;  3G0K A;  1FGM A;  1AQZ A;  2OTL 3;  3O8Y A;  3NM7 A;  1DE3 A;  1I70 A;  4NHF A;  1DET A;  1NB5 I;  2W2C A;  5D81 A;  1ASK A;  4ORL A;  9RNT A;  3CD6 3;  3SYU A;  1A2K A;  1W02 A;  1VZZ A;  1BNE A;  2CFK A;  2HMN B;  2W03 A;  1MWS A;  2ZA4 A;  3HX8 A;  4LYL B;  1GMR A;  4XM4 A;  1KSI A;  2CC3 A;  3MWZ A;  3IPT A;  4HJL B;  3WOF B;  1MGW A;  4JRF A;  1HZ1 A;  6RNT A;  1SII A;  1OPY A;  3D4A A;  3RGA A;  1RHL A;  4NRE A;  4FMC A;  3AGO A;  1DVD A;  3LYG A;  1U5O A;  2GU3 A;  2ZL8 A;  5BU4 A;  1N9J A;  1JKG A;  1BGS A;  3CCR 3;  1NWW A;  1Q86 4;  3NXJ A;  2RBI A;  5RNT A;  1QAF A;  2CFW A;  4HM6 B;  1JN5 A;  4BTW A;  3KSE D;  3WOE B;  3CME 3;  2Z76 A;  3NQZ A;  3EC9 A;  3S67 A;  1Q42 A;  1UCL A;  4HM4 B;  5CF2 A;  3FCS B;  1SIH A;  1TTO A;  3CPW 2;  5ELU A;  1YI2 3;  3BIR A;  1BNF A;  1LQM B;  1KWI A;  4KZ1 A;  3DGO A;  1GOY A;  3KE7 A;  1UI7 A;  1A2P A;  1W01 A;  3FSD A;  3Q3F A;  5G1K A;  3WDG B;  3CC2 3;  1JBR A;  1QJG A;  1LRA A;  3OXA A;  4GL6 A;  2P05 A;  3IMA B;  4DKI A;  1W4N A;  2CWV A;  2L4V A;  3FG1 A;  3V99 A;  1I0V A;  1NJI 4;  2K54 A;  1GY6 A;  1BRK A;  1JZO A;  1OGX A;  1RKY A;  1RSN A;  1LXE A;  2BO9 B;  1T2H A;  3N54 B;  1YIJ 3;  1TU5 A;  3FF2 A;  3X3X A;  1GMQ A;  3PCS A;  3U1W A;  2ML6 A;  1MGR A;  4ILF A;  1LOY A;  1VQ7 3;  4K90 B;  1VQ5 3;  4R9L A;  1YIT 3;  3J7Y d;  4OVM A;  3DGM A;  1ZS7 A;  1GS3 A;  2XGN A;  1FGQ A;  2CW9 A;  3LH4 A;  4HM3 B;  1BSD A;  3PGB A;  2GBX B;  7STD A;  3NV0 B;  4XDV A;  1FYS A;  1US1 A;  1NDO B;  3HIG A;  5STD A;  2OWP A;  5KP1 A;  4MMX B;  1YHQ 3;  1B3S A;  1I0X A;  3ECF A;  1N5H A;  3LOY A;  2CG0 A;  1T2I A;  4EC6 A;  3F14 A;  3PYJ A;  1O7P B;  4ZM8 A;  3CCL 3;  4U13 A;  1M9G A;  1CH0 A;  1RTU A;  1N8Q A;  2B1X B;  3QRD A;  1B20 A;  1IU7 A;  1BAO A;  3BU4 A;  1MWT A;  3VF1 A;  2UUG C;  3ZG5 A;  5JPP A;  2GBW B;  5IEO A;  3G6E 3;  1BOX A;  1NU3 A;  2F5M A;  4I5Q A;  3BNB A;  1UDI I;  1AV4 A;  2HMM B;  3KKG A;  5IEP A;  1EKM A;  3GSP A;  1VQM 3;  3EE1 A;  2XR8 B;  1PY3 A;  2E2T A;  2F56 A;  2KAA A;  4NPB A;  1LQG C;  4RNZ A;  4BIR A;  2CWT A;  1W6Y A;  1N5P A;  1O7M B;  4Q53 A;  1CQS A;  4TX4 A;  4RNY A;  1W6C A;  3OWU A;  1IVW A;  3DXO A;  2QIY A;  1IVX A;  1LVN A;  4HBR A;  3TDG A;  2GEY A;  4LSO A;  1QAK A;  3ZG0 A;  1RGA A;  6GSP A;  1VQP 3;  3WA2 X;  2GU1 A;  2YFI B;  4L8P A;  1CEW I;  1D6Z A;  3I55 3;  4XBY A;  2L1S A;  2M7O A;  1IT8 A;  5CXO A;  3DH2 A;  4EYC A;  3SED A;  1X1Y A;  3BLZ A;  4H3U A;  1LNH A;  1BRS A;  1Q7Y 4;  1LOW A;  1RGH A;  5AIH A;  2O3O A;  8CHO A;  2AAE A;  7GSP A;  1IK3 A;  3EX9 A;  1RRH A;  1FGR A;  4OK0 A;  4AEQ A;  1KD1 4;  2I9W A;  4HM5 B;  1W2B 2;  5IEN A;  1BUJ A;  4EXR A;  3NBB A;  1JZD A;  1TRP A;  3DGN A;  3I56 3;  3MKI A;  5KP4 A;  3FH1 A;  2BIR A;  5D82 A;  5BVB A;  1O7H B;  1V57 A;  3CNM A;  1RMS A;  1RGK A;  3WR2 A;  4HAA A;  3ALA A;  2W9Q A;  4STD A;  1O7W B;  3LTB A;  4R4K A;  1B27 A;  2CK3 H;  3LXU X;  3UJM A;  1F8N A;  2XEP A;  3FGY A;  3EJV A;  1JBT A;  3V98 A;  3N8B A;  2PZV A;  1YVS A;  2WOF A;  1UGI A;  4K1V A;  1RGG A;  1X1X A;  4XBT A;  2R41 A;  5M18 A;  1I2E A;  3B4P A;  3LTC A;  2INX A;  3EN1 B;  2UGI A;  5AII A;  5G1L A;  1GD4 A;  3HOH A;  3B8L A;  4HKV B;  3URP A;  2BMO B;  3CC4 3;  3BNE A;  2W6J H;  2IUK A;  2V1L A;  1BUQ A;  1HKX A;  2K0M A;  1AVL A;  2CKF B;  1D6U A;  3K5T A;  1JRQ A;  4BTY A;  2KCD A;  1OHO A;  1RN7 A;  3IJE B;  1IVU A;  2W0Q A;  3BNC A;  4XBX A;  1SPU A;  1DYU A;  4HZB B;  4HM1 B;  1FGT A;  3OV4 A;  4HM2 B;  4FCJ A;  3CCV 3;  1EEJ A;  1S5A A;  1WNH A;  3D5I A;  1IQX A;  4HM0 B;  2CX1 A;  4WYK A;  3LZA A;  3D9R A;  1JV2 B;  2F4Y A;  3F7S A;  1WQL B;  2GSP A;  1UGH I;  2MF7 A;  1E3V A;  1L5G B;  1ZX2 A;  1EUI C;  3FLJ A;  5IG5 A;  1RN1 A;  5AEU B;  1ROV A;  1NNV A;  3CC7 3;  1OF5 A;  2K3D A;  1RCL A;  4MMY B;  1UW1 A;  3AHW A;  1BNR A;  3ROB A;  2SAR A;  3LML A;  1AR0 A;  4I4K A;  4IPB A;  2Q07 A;  1IQY A;  1JKG B;  1BNJ A;  4RNT A;  4CCV A;  1JBS A;  3SLU A;  1PU4 A;  2P38 A;  1BRI A;  3DGY A;  1OCV A;  1TRQ A;  4G1M B;  1S72 3;  1RGE A;  1OGZ A;  4WFO A;  1B2Z A;  1W2Z A;  1YJ9 3;  2D42 A;  4QWT A;  2Z7A A;  5CLK A;  3F7X A;  1I8V A;  1ISK A;  2FGT A;  2A15 A;  1ULI B;  2D1W A;  4KVH A;  4MJD A;  1TFK A;  4AKY A;  3GWR A;  4HYZ A;  4LEH A;  4IIA A;  3SOA A;  3T8U A;  4X2O A;  2IMJ A;  5GSP A;  2CFD A;  1W00 A;  4N6T A;  1T5Y A;  2W56 A;  3EHC A;  3GRD A;  1OUN A;  5DRV A;  1MWU A;  5A0O B;  2XFS A;  3DGL A;  1WTH A;  2ML5 A;  3DUK A;  3MG1 A;  3RNT A;  1TIJ A;  1RCK A;  4FCM A;  5HGR A;  4N6L A;  6STD A;  1Q81 4;  3T8N A;  1K28 A;  2J8X B;  1BSA A;  1I3F A;  4IT7 A;  3F40 A;  1M90 4;  5IF6 A;  2C11 A;  1VQ8 3;  3OX9 A;  1IV7 A;  2Z77 A;  3AMO B;  4OUQ A;  3K63 A;  3QK9 A;  1QAL A;  3HK4 A;  3JVC A;  1BU4 A;  3CNX A;  4EBG A;  1QVF 2;  4FMB A;  4FR9 A;  1K9M 4;  4EV5 A;  3X3Z A;  3PZW A;  2YFL B;  3OWY A;  3LT9 A;  1OHP A;  4N6O B;  1K8A 4;  1Q40 A;  2HML B;  3BB9 A;  1M1X B;  1T3B A;  3AHS A;  1AVK A;  1STF I;  3KN4 A;  3ER7 A;  3DMC A;  1EQK A;  1W5Z A;  5I97 A;  2F5W A;  1BSC A;  1E3R A;  1OF5 B;  5EEO A;  1KC8 4;  1Q7H A;  1VQ9 3;  3CCJ 3;  1HU9 A;  3JUQ A;  4MMZ B;  2HOH A;  1BNI A;  4O8S A;  1VQQ A;  2E2V A;  2H0H A;  2OTJ 3;  2CG1 A;  2Y73 A;  5D83 A;  3HII A;  3SVA A;  3CPO A;  5IG4 A;  3A76 A;  2XF3 A;  3F8H A;  4O3V A;  4GHO A;  4J9A A;  3M8C A;  1YGE A;  2SBL A;  2H0G A;  3K9M C;  2WO0 A;  1QVG 2;  1U8C B;  4EV2 A;  5M1A A;  1C54 A;  3D3L A;  3CCM 3;  1YVB I;  2KF6 A;  3S5C A;  1RGF A;  1ROA A;  5M19 A;  1A2V A;  2E2U A;  1BRH A;  4HZ9 B;  1VQK 3;  2RSX A;  2CFL A;  2RNT A;  2MC8 A;  1W7C A;  2QA4 3;  5AEW B;  3MG3 A;  3S28 A;  1STD A;  5FGO A;  2C10 A;  1J2B A;  4BU4 A;  2F86 B;  4KT3 B;  1FUT A;  3K7C A;  2XH9 A;  1DVC A;  3A5E A;  1VQ4 3;  3KFQ C;  1LNI A;  1V58 A;  3X3Y A;  1RRL A;  2OQE A;  1NO3 A;  4R9K A;  3G8Z A;  3STD A;  3DZL A;  3EB8 A;  3D79 A;  4WP5 A;  1V74 A;  3F8X A;  4HM8 B;  4HVN A;  4N6M A;  3UB1 A;  1UI8 A;  3CXC 2;  2CIU A;  3FZW A;  4KFE A;  4BL2 A;  2ZDJ A;  3EBY A;  5G2G A;  4CJN A;  3B7C A;  3EF8 A;  1G0T A;  1B2S A;  1BNS A;  1FGO A;  1YNV X;  4J8T A;  4N6U A;  2XRX B;  1QMA A;  5AIF A;  2HMK B;  5EVH A;  1ULJ B;  3JUO A;  2KF3 A;  1FZU A;  4JF8 A;  3MHE A;  1HYF A;  1G96 A;  1RNB A;  1E97 A;  3LT8 A;  1BRG A;  2HMO B;  3Q1C A;  1CYU A;  4AKZ A;  3G16 A;  4RBN A;  3HZP A;  3JUM A;  3KCH A;  3S29 A;  3CCE 3;  5LC6 A;  1JB2 A;  1ZGX A;  3KSP A;  3LTA A;  1RNT A;  3H51 A;  5FW5 A;  3RGR A;  3MG2 A;  3B4O A;  5JPU A;  3S27 A;  1YJW 3;  1YGW A;  2HMJ B;  4HOH A;  3L0R A;  3UL6 A;  2CH9 A;  3SX1 A;  1ZO2 A;  5ELJ A;  3UNL A;  1GSP A;  1IQ8 A;  5IW9 A;  1RGC A;  2YX9 A;  3FG3 A;  1OHS A;  1VQL 3;  1BSE A;  2OCT A;  1B2U A;  1GMP A;  1RN4 A;  2CFG A;  2W56 B;  3UL5 A;  1EG9 B;  3DM8 A;  2GXF A;  4K61 A;  4WWU C;  3NX0 A;  1FUS A;  4XDW A;  1JJ2 2;  3JUN A;  2C4B A;  2O9U X;  3NBR A;  2W04 A;  4L7K A;  1DMM A;  1RGL A;  1TJD A;  2QGU A;  3MSO A;  1PFP A;  3NQY A;  2KF5 A;  2XSO B;  3GZR A;  3NV0 A;  3SXX A;  3CCU 3;  1OH0 A;  1I2G A;  1NB3 I;  3BND A;  2AAD A;  5KP3 A;  4BTX A;  3OWS A;  4FCZ A;  1UCK A;  1GOV A;  3CMA 3;  3X42 A;  2BU4 A;  4J5K A;  4KFF A;  1FUW A;  1JNQ A;  5AYR B;  4BL3 A;  4N6V 0;  2LQV A;  1MOL A;  1WMN A;  1LOX A;  4LGQ A;  1TUH A;  3GZX B;  1Q82 4; 
#chains in the Genus database with same CATH homology
 2P09 A;  2JQ5 A;  3JUP A;  2IUJ A;  1SQW A;  1TP6 A;  4K1U A;  1O7N B;  2FNQ A;  4N6N B;  5TGN A;  5JPU A;  5BXQ A;  1YJN 3;  1GY5 A;  4WHA A;  3KII A;  1JN5 B;  1IVV A;  3EBT A;  1VQN 3;  4KFD A;  2GEX A;  3WA3 A;  1UUV B;  4GB5 A;  5LC7 A;  1N8R 4;  3GZY B;  4H61 A;  1W6G A;  1WMP A;  1OAC A;  2XGL A;  1TFO A;  1IDP A;  2B24 B;  1JB4 A;  3GAX A;  1A90 A;  2IA7 A;  3Q90 A;  5EQL A;  1N9E A;  1Y4K A;  1FA3 A;  2BHM A;  3U97 A;  1DMN A;  3LTD A;  5IG3 A;  5AYS C;  1EA2 A;  3HI7 A;  1IV9 A;  4FMD A;  1Q40 B;  2BNG A;  5AI1 A;  3WMD A;  2PNC A;  1R4C A;  1CYV A;  4O02 B;  2QEX 3;  3RDE A;  2F99 A;  3E99 A;  3H3H A;  1GY7 A;  4LMI A;  1GYB A;  3X40 A;  1UUW B;  2P0M A;  3EN8 A;  4R1K A;  3VSY A;  4PEJ A;  5CF1 A;  5JBS A;  1KQS 2;  4MEI A;  3NBJ A;  3NM2 A;  3PS8 A;  2BMQ B;  3NUV A;  4XB5 A;  5IG0 A;  3CU3 A;  3Q2P A;  1JB5 A;  3MPH A;  1GD3 A;  3OW2 2;  3MYT A;  3F9S A;  3VGN A;  3PXM A;  2WGQ A;  5CK6 A;  2OOV C;  1O7G B;  4LZI A;  3I0Y A;  3WOD G;  3V92 A;  2Y74 A;  5DRE A;  4CDL A;  1DMQ A;  4O2H A;  2WOH A;  3T0U A;  1Z1S A;  3PCR A;  1VQ6 3;  1RJO A;  1MNL A;  2KXG A;  3N9H A;  1K41 A;  4N3V A;  4RZM A;  3FF0 A;  3EQQ B;  2RGQ A;  3NHX A;  1IT7 A;  3CCQ 3;  2RFR A;  2CHC A;  1VQO 3;  1SJW A;  2YFJ B;  2BMR B;  4FMA A;  2KRT A;  3G4S 3;  1M1K 4;  5AIG A;  3FKA A;  3G71 3;  4L8O A;  5IER A;  2OOV A;  1C7H A;  2Z6B A;  2CWU A;  3X41 A;  2RCD A;  4HM7 B;  4WYK B;  2UX0 A;  2F98 A;  1WMO A;  1D6Y A;  2FXT A;  2W9P A;  3K0Z A;  2P0X A;  2WGO A;  2XFT A;  3DY5 A;  2BT3 A;  1A67 A;  3KZT A;  2STD A;  1K73 4;  3GZB A;  4X2H A;  4R80 A;  3AMO A;  2JDI H;  2LYX A;  3SOY A;  2R4I A;  3FG4 A;  2OQE C;  2XSH B;  3G0K A;  1FGM A;  2OTL 3;  3O8Y A;  3NM7 A;  4NHF A;  1NB5 I;  2W2C A;  5D81 A;  1ASK A;  4ORL A;  3CD6 3;  1A2K A;  1W02 A;  1VZZ A;  2CFK A;  3HX8 A;  2HMN B;  2W03 A;  4XM4 A;  1KSI A;  2CC3 A;  3MWZ A;  3IPT A;  4HJL B;  3WOF B;  4JRF A;  1SII A;  1OPY A;  3RGA A;  4NRE A;  4FMC A;  1DVD A;  3LYG A;  1U5O A;  2GU3 A;  2ZL8 A;  1N9J A;  1JKG A;  3CCR 3;  1NWW A;  1Q86 4;  3NXJ A;  1QAF A;  2CFW A;  4HM6 B;  1JN5 A;  4BTW A;  3KSE D;  3WOE B;  3CME 3;  2Z76 A;  3NQZ A;  3EC9 A;  3S67 A;  1Q42 A;  4HM4 B;  5CF2 A;  3CPW 2;  3FCS B;  1SIH A;  5ELU A;  1YI2 3;  4KZ1 A;  1KWI A;  3DGO A;  3KE7 A;  1UI7 A;  1W01 A;  3FSD A;  3WDG B;  3CC2 3;  1QJG A;  3OXA A;  4GL6 A;  2P05 A;  3IMA B;  1W4N A;  2CWV A;  2L4V A;  3FG1 A;  3V99 A;  1NJI 4;  2K54 A;  1GY6 A;  1OGX A;  1RKY A;  1LXE A;  2BO9 B;  3N54 B;  1YIJ 3;  1TU5 A;  3FF2 A;  3X3X A;  3PCS A;  3U1W A;  2ML6 A;  1VQ7 3;  4K90 B;  1VQ5 3;  4R9L A;  1YIT 3;  3J7Y d;  4OVM A;  3DGM A;  1GS3 A;  2XGN A;  1FGQ A;  2CW9 A;  3LH4 A;  4HM3 B;  3PGB A;  2GBX B;  7STD A;  3NV0 B;  4XDV A;  1US1 A;  1NDO B;  3HIG A;  5STD A;  2OWP A;  5KP1 A;  4MMX B;  1YHQ 3;  3ECF A;  1N5H A;  3LOY A;  2CG0 A;  4EC6 A;  3F14 A;  3PYJ A;  1O7P B;  4ZM8 A;  3CCL 3;  4U13 A;  1M9G A;  1N8Q A;  2B1X B;  3QRD A;  1IU7 A;  3VF1 A;  5JPP A;  2GBW B;  5IEO A;  3G6E 3;  1NU3 A;  3BNB A;  1AV4 A;  2HMM B;  3KKG A;  5IEP A;  1EKM A;  1VQM 3;  3EE1 A;  2XR8 B;  2E2T A;  4RNZ A;  2CWT A;  1W6Y A;  1N5P A;  1O7M B;  4Q53 A;  1CQS A;  4TX4 A;  4RNY A;  1W6C A;  3OWU A;  1IVW A;  3DXO A;  2QIY A;  1IVX A;  1LVN A;  4HBR A;  3TDG A;  2GEY A;  1QAK A;  1VQP 3;  3WA2 X;  2GU1 A;  2YFI B;  4L8P A;  1CEW I;  1D6Z A;  3I55 3;  4XBY A;  2M7O A;  1IT8 A;  5CXO A;  4EYC A;  3SED A;  3BLZ A;  4H3U A;  1LNH A;  1Q7Y 4;  5AIH A;  2O3O A;  8CHO A;  1IK3 A;  3EX9 A;  1RRH A;  1FGR A;  4OK0 A;  4AEQ A;  1KD1 4;  2I9W A;  4HM5 B;  1W2B 2;  5IEN A;  4EXR A;  3NBB A;  3DGN A;  3I56 3;  3MKI A;  5KP4 A;  3FH1 A;  5D82 A;  5BVB A;  1O7H B;  3CNM A;  3ALA A;  2W9Q A;  4STD A;  1O7W B;  3LTB A;  4R4K A;  2CK3 H;  3LXU X;  3UJM A;  1F8N A;  2XEP A;  3FGY A;  3EJV A;  3V98 A;  3N8B A;  2PZV A;  2WOF A;  4K1V A;  4XBT A;  3B4P A;  3LTC A;  2INX A;  3EN1 B;  5AII A;  1GD4 A;  3B8L A;  4HKV B;  1BUQ A;  2BMO B;  3CC4 3;  3BNE A;  2W6J H;  2IUK A;  2V1L A;  1HKX A;  2K0M A;  1AVL A;  2CKF B;  1D6U A;  3K5T A;  1JRQ A;  4BTY A;  2KCD A;  1OHO A;  1RN7 A;  3IJE B;  1IVU A;  2W0Q A;  3BNC A;  4XBX A;  1SPU A;  1DYU A;  4HZB B;  4HM1 B;  1FGT A;  3OV4 A;  4HM2 B;  4FCJ A;  3CCV 3;  1S5A A;  1WNH A;  1IQX A;  4HM0 B;  4WYK A;  3LZA A;  3D9R A;  1JV2 B;  3F7S A;  1WQL B;  2MF7 A;  1E3V A;  1L5G B;  1ZX2 A;  5IG5 A;  3FLJ A;  5AEU B;  1ROV A;  3CC7 3;  1OF5 A;  4MMY B;  1UW1 A;  3ROB A;  3LML A;  1AR0 A;  4I4K A;  4IPB A;  2Q07 A;  1IQY A;  1JKG B;  4CCV A;  3SLU A;  1PU4 A;  2P38 A;  1OCV A;  4G1M B;  1S72 3;  1OGZ A;  4WFO A;  1W2Z A;  1YJ9 3;  2D42 A;  4QWT A;  2Z7A A;  5CLK A;  3F7X A;  1ISK A;  2FGT A;  2A15 A;  1ULI B;  2D1W A;  4KVH A;  4MJD A;  1TFK A;  4AKY A;  3GWR A;  4HYZ A;  4LEH A;  4IIA A;  3SOA A;  3T8U A;  4X2O A;  2IMJ A;  2CFD A;  1W00 A;  4N6T A;  3EHC A;  1T5Y A;  2W56 A;  3GRD A;  1OUN A;  5DRV A;  5A0O B;  2XFS A;  3DGL A;  1WTH A;  2ML5 A;  3DUK A;  3MG1 A;  1TIJ A;  4FCM A;  5HGR A;  6STD A;  4N6L A;  1Q81 4;  3T8N A;  1K28 A;  4IT7 A;  3F40 A;  1M90 4;  5IF6 A;  2C11 A;  1VQ8 3;  3OX9 A;  1IV7 A;  2Z77 A;  3AMO B;  4OUQ A;  3K63 A;  3QK9 A;  1QAL A;  3HK4 A;  3JVC A;  3CNX A;  4EBG A;  1QVF 2;  4FMB A;  4FR9 A;  1K9M 4;  4EV5 A;  3X3Z A;  3PZW A;  2YFL B;  3OWY A;  3LT9 A;  1OHP A;  4N6O B;  1K8A 4;  1Q40 A;  2HML B;  3BB9 A;  1M1X B;  1AVK A;  1STF I;  3KN4 A;  3ER7 A;  3DMC A;  1EQK A;  1W5Z A;  5I97 A;  1E3R A;  1OF5 B;  5EEO A;  1KC8 4;  1VQ9 3;  3CCJ 3;  1HU9 A;  3JUQ A;  4MMZ B;  4O8S A;  2E2V A;  2OTJ 3;  2CG1 A;  2Y73 A;  5D83 A;  3HII A;  3SVA A;  3CPO A;  5IG4 A;  3A76 A;  2XF3 A;  3F8H A;  4O3V A;  4J9A A;  3M8C A;  1YGE A;  2SBL A;  3K9M C;  2WO0 A;  1QVG 2;  1U8C B;  4EV2 A;  3D3L A;  3CCM 3;  1YVB I;  3S5C A;  1ROA A;  1A2V A;  2E2U A;  4HZ9 B;  1VQK 3;  2RSX A;  2CFL A;  2MC8 A;  1W7C A;  2QA4 3;  5AEW B;  3MG3 A;  3S28 A;  1STD A;  5FGO A;  2C10 A;  1J2B A;  2F86 B;  3K7C A;  2XH9 A;  1DVC A;  1VQ4 3;  3KFQ C;  3X3Y A;  1RRL A;  2OQE A;  1NO3 A;  4R9K A;  3G8Z A;  3STD A;  3DZL A;  3EB8 A;  4WP5 A;  1V74 A;  3F8X A;  4HM8 B;  4HVN A;  4N6M A;  3UB1 A;  1UI8 A;  3CXC 2;  2CIU A;  3FZW A;  4KFE A;  2ZDJ A;  3EBY A;  5G2G A;  3B7C A;  3EF8 A;  1FGO A;  4J8T A;  4N6U A;  5EVH A;  2XRX B;  1QMA A;  5AIF A;  2HMK B;  1ULJ B;  3JUO A;  4JF8 A;  3MHE A;  1G96 A;  1E97 A;  3LT8 A;  3Q1C A;  2HMO B;  1CYU A;  4AKZ A;  3G16 A;  4RBN A;  3HZP A;  3JUM A;  3S29 A;  3CCE 3;  5LC6 A;  1JB2 A;  3KSP A;  3LTA A;  3RGR A;  3H51 A;  5FW5 A;  3MG2 A;  3B4O A;  3S27 A;  1YJW 3;  2HMJ B;  3L0R A;  3UL6 A;  2CH9 A;  3SX1 A;  1ZO2 A;  5ELJ A;  3UNL A;  1IQ8 A;  5IW9 A;  2YX9 A;  3FG3 A;  1OHS A;  1VQL 3;  2OCT A;  2CFG A;  2W56 B;  3UL5 A;  1EG9 B;  3DM8 A;  2GXF A;  4K61 A;  4WWU C;  3NX0 A;  4XDW A;  1JJ2 2;  3JUN A;  2O9U X;  3NBR A;  2W04 A;  4L7K A;  1DMM A;  3MSO A;  3NQY A;  2QGU A;  4LSO A;  1PFP A;  3NV0 A;  2XSO B;  3CCS 3;  3GZR A;  3SXX A;  3CCU 3;  1OH0 A;  1NB3 I;  3BND A;  5KP3 A;  4BTX A;  3OWS A;  4FCZ A;  3CMA 3;  3X42 A;  4KFF A;  1FUW A;  1JNQ A;  5AYR B;  4N6V 0;  2LQV A;  1MOL A;  1WMN A;  1LOX A;  4LGQ A;  1TUH A;  3GZX B;  1Q82 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...