2F98A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Biosynthetic protein
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f98A00
4R9LA 1JKGB 1ASKA 3NHXA 3F9SA 3NV0B 1DMQA 1HKXA 3FGYA 6STDA 3DZLA 3JUQA 5CLKA 1GY6A 3VGNA 2STDA 1OHSA 4L8PA 3EN8A 1EA2A 3E99A 1SJWA 5DRVA 3GWRA 3EBYA 3K7CA 3MG1A 4HM0B 4WYKB 4XBYA 3G0KA 4HM3B 3EX9A 4HM5B 3MG3A 3FLJA 3GZBA 1GYBA 1QJGA 3EBTA 1NDOB 1A2KA 3T8NA 1GY5A 1Z1SA 2Z76A 1GY7A 2Z77A 4XDVA 1VZZA 2CKFB 5BXQA 3EQQB 7STDA 1QMAA 3FSDA 3NM2A 3FF2A 4XBXA 3A76A 5FW5A 3MG2A 2GEXA 3GZXB 5IG0A 5IF6A 1OF5A 3LZAA 3VSYA 1EG9B 4CDLA 2INXA 4HM8B 1O7NB 3NXJA 2HMMB 3FKAA 1JN5A 2BMRB 3MYTA 2B24B 4LMIA 4XM4A 2F99A 4ORLA 3EF8A 1O7WB 5IEPA 3EJVA 4R1KA 5D83A 1NWWA 2XRXB 3D9RA 5AEUB 1DMMA 1OF5B 2HMKB 5HGRA 4WWUC 2HMOB 3DUKA 1UUVB 5CF2A 3UNLA 2W2CA 5IENA 4IIAA 5D82A 3STDA 3JUOA 1JN5B 1W02A 4LEHA 4Q53A 5TGNA 3OV4A 1OHPA 3FH1A 3JUNA 4U13A 3SEDA 3CU3A 4HM1B 1OCVA 4HKVB 5CXOA 4HJLB 4I4KA 3K0ZA 4PEJA 4X2OA 5AI1A 1BUQA 1STDA 3JUPA 4HM2B 3RGAA 2OWPA 4HVNA 3MKIA 3F14A 1W00A 4R9KA 1W01A 2YFJB 3SOAA 5AIGA 2F86B 3BLZA 2XSOB 4N3VA 1C7HA 1JB4A 3FF0A 2A15A 3F7XA 5AIIA 1OHOA 3JUMA 1IDPA 1E97A 1OH0A 8CHOA 4HM4B 2JQ5A 3F7SA 2GEYA 1OPYA 1UUWB 3MSOA 2XSHB 1TUHA 3MHEA 4H3UA 5CK6A 3LYGA 3B7CA 3KSPA 5IG4A 5AIHA 3EC9A 3DMCA 5KP4A 2K54A 3F8XA 1W6YA 2HMJB 3ECFA 4XDWA 3ER7A 1O7PB 4GB5A 2RFRA 3HX8A 3DXOA 5JPUA 1ISKA 3IPTA 5KP1A 1AR0A 1O7HB 1U5OA 3Q90A 2BMQB 2YFLB 3DM8A 5D81A 2QGUA 5IG5A 2BMOB 1ZO2A 3NUVA 4KVHA 4MJDA 3CNXA 4WP5A 1S5AA 5JPPA 2CHCA 1K41A 4LGQA 5EVHA 4XB5A 2YFIB 2F98A 3OWUA 3F8HA 2HMLB 3G8ZA 3HZPA 2BNGA 2GXFA 2QIYA 1JB5A 3CPOA 3I0YA 3NBRA 3FZWA 4HM6B 2B1XB 5AIFA 1O7GB 5IG3A 2GBWB 3UJMA 4HZ9B 5AEWB 3OX9A 3H51A 2RCDA 3ROBA 3M8CA 4K1VA 4HM7B 1DMNA 3RGRA 3OWYA 1E3RA 4L7KA 5CF1A 3KE7A 2GBXB 3EN1B 1Q40A 3GZRA 1O7MB 3WMDA 4J9AA 4L8OA 1GS3A 3B4OA 3B4PA 3CNMA 3SOYA 2Z7AA 3B8LA 2RGQA 3OWSA 3GRDA 5IERA 2HMNB 1JB2A 5IEOA 1OUNA 4K1UA 1TP6A 5G2GA 3BB9A 2XR8B 1ZX2A 1NU3A 3HK4A 5STDA 5BVBA 1E3VA 3OXAA 4X2HA 3H3HA 1JKGA 3GZYB 3KKGA 2IMJA 1Q42A 3NV0A 5DREA 1CQSA 1Q40B 4J8TA 3EHCA 4FCJA 2PZVA 1ULJB 1ULIB 3G16A 3KZTA 4HZBB 2UX0A 2I9WA 3S5CA 1WQLB 4OUQA 3F40A 5KP3A 3T8UA 4OVMA 4XBTA 4STDA 1OGXA 4RZMA 4WYKA 1OGZA 4FCMA 2R4IA
chains in the Genus database with same CATH superfamily
4R9LA 1JKGB 1Q7Y4 2W03A 1HU9A 1K734 1ASKA 1GOYA 3NHXA 3F9SA 3NV0B 1BIRA 1RN7A 2OCTA 4BTYA 1UCLA 4IT7A 1ZS7A 3G4S3 1DMQA 3S28A 3WDGB 1B27A 1HKXA 1RNTA 5I97A 3FGYA 1BUJA 3AHSA 6STDA 1YIT3 2ZA4A 3DZLA 1M904 2C4BA 2ZL8A 3JUQA 3Q3FA 3CCM3 1W2ZA 1GY6A 5CLKA 1PYLA 1FGQA 3VGNA 2E2VA 3WA2X 2IUJA 1IVXA 2E2TA 1UI8A 1YNVX 1OHSA 2STDA 3D3LA 1B3SA 2H0HA 1GMRA 4L8PA 1T5YA 4JRFA 3EN8A 4CCVA 3CCQ3 1A90A 1BRNL 1VQ43 1EA2A 1CH0A 3BNDA 2RBIA 3E99A 1SJWA 2C11A 5DRVA 3VF1A 3WR2A 3GWRA 5A0OB 1N9JA 1RN1A 3CCE3 1NB5I 1M9GA 3EBYA 3Q1CA 1B21A 3BIRA 3K7CA 8RNTA 4WFOA 4ZM8A 3V99A 3MG1A 2L1SA 4HM0B 2IYJA 1IT8A 2RNTA 4WYKB 4I5QA 1N9EA 4XBYA 3HOHA 1I2GA 1UCKA 3G0KA 4HM3B 3V92A 3WHOA 3EX9A 4HM5B 3MG3A 3ZFZA 1Q7HA 3FLJA 4GSPA 2WGQA 3GZBA 1T2HA 1IQXA 1GOUA 1GYBA 1QJGA 1TRQA 2IY2A 4CJNA 3EBTA 3DY5A 3LXUX 1NDOB 4JF8A 1A2KA 3U1WA 3T8NA 2BU4A 2UUGC 1GY5A 1Z1SA 5EEOA 1IK3A 2Z76A 1VQQA 3AGNA 4EXRA 1GY7A 2Z77A 2SARA 4XDVA 2D42A 1B2SA 5JBSA 1VZZA 2CKFB 3X40A 1BRKA 1MWSA 3JVCA 3EQQB 3URPA 5BXQA 4MEIA 1QVG2 4N6LA 7STDA 3PGBA 1SIHA 4HYZA 1IYYA 1BRGA 1IQYA 2KXGA 1G96A 1QMAA 1AVLA 1F8NA 3FSDA 2CFKA 3NM2A 1D6ZA 3SLUA 3WA3A 3FF2A 4FMDA 4N6V0 4XBXA 1IV9A 1STFI 3A76A 1I0XA 1K9M4 4J5KA 3MG2A 5FW5A 1YJN3 2GEXA 4EV5A 1MGRA 1UI7A 2UGIA 2OTJ3 3GZXB 3A5EA 5IG0A 2CWVA 5IF6A 1RMSA 1Q9EA 1OF5A 3LZAA 3PS8A 1RGEA 2ZHXB 1QVF2 1G0TA 1FW7A 2W9QA 2W56A 3KSED 2LYXA 1RGGA 3VSYA 1EG9B 1AV4A 3EB8A 1BRIA 1TFKA 1IVVA 3S67A 4CDLA 1GMQA 2INXA 4HM8B 1UCIA 1O7NB 3K5TA 1IQ8A 2ML5A 3NXJA 2CG0A 4BL2A 2XFTA 2HMMB 3FKAA 1D6UA 1JN5A 2KF5A 2OOVC 1GD4A 4BIRA 2FNQA 2FXTA 3I553 4EYCA 2BMRB 3MYTA 2B24B 5BIRA 1EKMA 4LMIA 4XM4A 2AAEA 2V1LA 7RNTA 2F99A 3LTAA 4ORLA 3EF8A 1O7WB 2WGOA 2P0MA 4O3VA 2JDIH 5IEPA 1DE3A 3EJVA 3G6E3 2GU3A 1I0VA 2W04A 4R1KA 3CME3 3CC43 1BSCA 5D83A 1JBSA 4OK0A 1NWWA 1BOXA 1DETA 2XRXB 2SBLA 1SQWA 3D9RA 4QWTA 2CK3H 1LVNA 3CD63 5AEUB 1UGIA 3OW22 1DMMA 1OF5B 2HMKB 1R4YA 5HGRA 2OOVA 4WWUC 2HMOB 3DUKA 1RGCA 1WMOA 1R4CA 1UUVB 2W56B 1X1XA 5ELJA 4AKZA 5CF2A 3UNLA 2W9PA 3KIIA 3BNBA 2W2CA 2KF4A 4FMBA 1K8A4 1V57A 1I8VA 5IENA 3AHWA 4IIAA 2KRTA 5D82A 4IPBA 3STDA 3JUOA 1JN5B 1W2B2 1RGFA 1SPUA 1W02A 2BT3A 4LEHA 2KF6A 4Q53A 1FUTA 4KT3B 3DGMA 2F4YA 1IVWA 5GSPA 1J2BA 5TGNA 3OV4A 1BNJA 1OHPA 3PYJA 1DYUA 2PNCA 3FH1A 3LH4A 1JBRA 3JUNA 2CIUA 1BSBA 1VQL3 1C54A 4U13A 2WOHA 1W6CA 4BTXA 3SEDA 3U97A 3CU3A 4TX4A 2CG1A 1VQO3 3K63A 1MGWA 4HM1B 1OCVA 4HKVB 4EW5A 1V58A 5CXOA 2CX0A 1RLSA 1TIJA 3DGNA 4KFEA 5LC6A 3S29A 4DKIA 1UGHI 1FGRA 3KN4A 2OQEA 1ROVA 3NQYA 4HJLB 1HZ1A 5HOHA 3QK9A 4I4KA 3K0ZA 1LNHA 4PEJA 4X2OA 1TJDA 5AI1A 1BUQA 1STDA 3JUPA 4HM2B 1ROAA 3RGAA 2OWPA 2LQVA 4HVNA 1KD14 1LOYA 1KWIA 1BRSA 4KFDA 1WNHA 3NBJA 4BL3A 1TU5A 3PCSA 3N9HA 3NBBA 4EBGA 1VQ83 4NREA 3EE1A 3MKIA 3F14A 1CYUA 1W00A 1VQP3 4R9KA 1T3BA 1W01A 3NQZA 1L5GB 1YGEA 1WMPA 2GSPA 2YFJB 4G1MB 3SOAA 1MOLA 5AIGA 2F86B 3BLZA 2XSOB 3S27A 1UCJA 1C7HA 1JB4A 1TFOA 4N3VA 3FF0A 2A15A 2O9UX 3F7XA 5AIIA 4MMXB 3AGOA 1I3FA 1US1A 2Z6BA 3CCV3 2XH9A 1RGAA 2F5MA 1BRHA 1NNVA 1OHOA 3JUMA 3X3YA 1A2PA 3LMLA 4K90B 9RNTA 1N8R4 3D5GA 1IDPA 3GSPA 1E97A 1OH0A 1W6GA 3D4AA 8CHOA 4HM4B 2JQ5A 1BNGA 1JJ22 2M7OA 3F7SA 4KFFA 3CCJ3 1Y4KA 1LOWA 1FUSA 1WMNA 2GEYA 1OPYA 1FUWA 4WHAA 1UUWB 1TTOA 1GMPA 3ZG0A 3MSOA 2KF3A 1YIJ3 4N6OB 3PXMA 3UL5A 2C10A 1AQZA 3BU4A 3N54B 1K28A 1N8QA 3CC23 1BANA 2R41A 5G1LA 1VQ73 1RJOA 2XSHB 1TUHA 3MHEA 4H3UA 4MMYB 5CK6A 1S723 1SIIA 4GHOA 1QAFA 2MF7A 3LYGA 1IVUA 3B7CA 3KSPA 1RDSA 2Y73A 3IJEB 5IG4A 1JV2B 4EV2A 1B2MA 1RRHA 3WOFB 3KCHA 1M1XB 3CCU3 1MWUA 6RNTA 4O2HA 3RDEA 5AIHA 2P05A 3EC9A 4NPBA 3DMCA 4AEQA 1DVCA 1G02A 1YVBI 3CC73 5KP4A 2K54A 3F8XA 1W6YA 2HMJB 3ECFA 4XDWA 1RCLA 3RNTA 2RSXA 1RGLA 1UW1A 4AKYA 5AYSC 3I563 3WOEB 3CMA3 2P0XA 2P09A 1RCKA 2P38A 3ER7A 1A67A 1RNBA 1O7PB 1PU4A 1EUIC 4GB5A 3SVAA 2RFRA 3HIGA 1BGSA 3HX8A 3SXXA 3J7Yd 1Q824 3DXOA 1U8CB 5JPUA 1ISKA 3IPTA 5KP1A 2K0MA 2QA43 1AR0A 1QALA 1O7HB 3D5IA 1U5OA 5AYRB 1BSAA 2Q07A 3Q90A 2BMQB 1CYVA 2CC3A 2YFLB 2F5WA 1FGMA 1AY7A 1NB3I 1SARA 3DM8A 4J5GA 3N8BA 5D81A 2QGUA 1M1K4 2XF3A 5IG5A 2IA7A 1B20A 2BMOB 2D1WA 1ZO2A 3LTDA 1RN4A 4RNZA 2QEX3 1UUGB 2OQEC 3NUVA 2BIRA 1FZUA 4KVHA 4MJDA 2ZDJA 3CNXA 1BAOA 2CFWA 2KCDA 4WP5A 1S5AA 5FGOA 5JPPA 2CHCA 2H0IA 1K41A 1RKYA 3D79A 4LGQA 5EVHA 3DGLA 5M18A 3MWZA 1X1WA 3X41A 1LQMB 1Q814 1FGTA 1I2EA 4BTWA 1V74A 5EQLA 2W6JH 2KAAA 3LTBA 4XB5A 2YFIB 2F98A 3UB1A 4R80A 1CEWI 3OWUA 3F8HA 2CWTA 1FYSA 2HMLB 3UL6A 1TRPA 2CW9A 3G8ZA 2Y74A 2YX9A 5M19A 2BO9B 3HZPA 1LQGC 1BVIA 2BNGA 3ALAA 2WOFA 3BNEA 2GXFA 3GAXA 5G1KA 3CXC2 2QIYA 7GSPA 3O8YA 1JB5A 3CPOA 3I0YA 3NBRA 1MWTA 3TDGA 1A2VA 3FZWA 3FCSB 4HM6B 2B1XB 3SYUA 1NO3A 1O7GB 5AIFA 1AVKA 1RGKA 5IG3A 2WO0A 3HI7A 1W7CA 4LSOA 2GBWB 1ZGXA 2CX1A 3UJMA 4HZ9B 1QAKA 2CH9A 2HOHA 6GSPA 5AEWB 3OX9A 3CCL3 1JRQA 3H51A 4HBRA 3FG3A 2RCDA 5LC7A 3ROBA 3M8CA 2J8XB 4K1VA 4RNTA 2CFGA 1I70A 1JNQA 3LOYA 4FCZA 4HM7B 4K61A 1D6YA 3CCS3 4LYLB 1BNFA 1X1YA 4ILFA 4N6TA 4O02B 1OACA 1DMNA 3L0RA 4RNYA 5ELUA 3RGRA 1YHQ3 3DGYA 1FA3A 4GL6A 1IT7A 1BU4A 1Q864 3OWYA 1E3RA 4L7KA 5CF1A 1BRJA 3V98A 3PZWA 3KE7A 2GBXB 4HAAA 1HYFA 3HIIA 1GD3A 3EN1B 1Q40A 1VQK3 3GZRA 3X42A 1O7MB 3WMDA 1BNSA 3LT9A 4J9AA 4L8OA 1GS3A 3B4OA 1YI23 5RNTA 1X1UA 3B4PA 3CNMA 3SOYA 2Z7AA 3B8LA 3AMOA 3CPW2 2RGQA 3OWSA 5IW9A 1VQ53 3GRDA 1MWRA 4CPKA 2CFDA 5IERA 3G713 2HMNB 1JB2A 5IEOA 2MC8A 1OUNA 1YVSA 1YGWA 2CWUA 3BNCA 4K1UA 1TP6A 4N6NB 3Q2PA 4KZ1A 4NHFA 5G2GA 3CCR3 1DVDA 3BB9A 3WODG 2XR8B 1W4NA 1ZX2A 1EEJA 2L4VA 1YJW3 2GU1A 1NU3A 1BSEA 1I3IA 3LT8A 1I2FA 3T0UA 1BNRA 1EQKA 2XFSA 1LXEA 2F56A 1VQ93 1BNIA 3HK4A 5STDA 5BVBA 1KQS2 1E3VA 3OXAA 1WTHA 1LNIA 1MNLA 4X2HA 3H3HA 4RBNA 1T2IA 1BSDA 5BU4A 2BHMA 1VQM3 1JKGA 3GZYB 3KKGA 3K9MC 2IMJA 1BNEA 2CFLA 2K3DA 3SX1A 2OTL3 1Q42A 1RTUA 1JBTA 3NX0A 2ML6A 3NV0A 3IMAB 5DREA 3X3ZA 1CQSA 2H0GA 1B2ZA 1Q40B 4N6UA 1RGHA 1N5HA 1W5ZA 2XEPA 3DH2A 3EHCA 4J8TA 4LZIA 3X3XA 3QRDA 3NM7A 1VQN3 3KFQC 1IU7A 4FCJA 4BU4A 4HOHA 4EC6A 2FGTA 1GSPA 1LOXA 1RSNA 1ULJB 2PZVA 1ULIB 4FMCA 4R4KA 3AMOB 1PFPA 3G16A 3MPHA 4FMAA 1PY3A 3FG1A 4H61A 3KZTA 4HZBB 2UX0A 2E2UA 2I9WA 1KC84 1RHLA 1JZOA 1UDII 3DGOA 3LTCA 5M1AA 1B2XA 1VQ63 3ZG5A 2IUKA 4N6MA 1WQLB 1JZDA 2W0QA 4OUQA 3F40A 5KP3A 3S5CA 1LOVA 1N5PA 3FG4A 1FGOA 2XGLA 4MMZB 3T8UA 4FR9A 4OVMA 4XBTA 4STDA 1OGXA 1KSIA 1YJ93 1LRAA 1GOVA 1NJI4 4RZMA 4O8SA 1B2UA 4WYKA 1IV7A 2AADA 2XGNA 1OGZA 2O3OA 3PCRA 4FCMA 1RRLA 2R4IA
chains in the Genus database with same CATH topology
4R9LA 1JKGB 2W03A 1HU9A 1K734 1ASKA 3NHXA 3F9SA 3NV0B 1RN7A 2OCTA 4BTYA 4IT7A 3G4S3 1DMQA 3S28A 3WDGB 1HKXA 5I97A 3FGYA 1YIT3 6STDA 3DZLA 1M904 2ZL8A 3JUQA 3CCM3 1W2ZA 1GY6A 5CLKA 3VGNA 1FGQA 3WA2X 2E2VA 2IUJA 1IVXA 2E2TA 1UI8A 2STDA 1OHSA 3D3LA 1Q7Y4 3CCQ3 1A90A 4L8PA 1T5YA 4JRFA 3EN8A 4CCVA 1VQ43 1EA2A 3BNDA 3E99A 1SJWA 2C11A 5DRVA 3VF1A 3GWRA 5A0OB 1N9JA 3CCE3 1NB5I 1M9GA 3EBYA 3Q1CA 3K7CA 4WFOA 4ZM8A 3V99A 3MG1A 4HM0B 1IT8A 4WYKB 1N9EA 4XBYA 3V92A 3G0KA 4HM3B 3EX9A 4HM5B 3MG3A 3FLJA 2WGQA 3GZBA 1IQXA 1GYBA 1QJGA 3EBTA 3DY5A 3LXUX 1NDOB 4JF8A 1A2KA 3U1WA 3T8NA 1GY5A 1Z1SA 5EEOA 1IK3A 2Z76A 4EXRA 1GY7A 2Z77A 4XDVA 2D42A 5JBSA 1VZZA 2CKFB 3X40A 3JVCA 5BXQA 3EQQB 4MEIA 1QVG2 4N6LA 7STDA 3PGBA 1SIHA 4HYZA 1IQYA 2KXGA 1G96A 1QMAA 1AVLA 1F8NA 3FSDA 2CFKA 3NM2A 1D6ZA 3SLUA 3WA3A 3FF2A 4FMDA 4N6V0 4XBXA 1IV9A 1STFI 3A76A 1K9M4 5FW5A 3MG2A 1YJN3 2GEXA 4EV5A 1UI7A 2OTJ3 3GZXB 5IG0A 2CWVA 5IF6A 1OF5A 3LZAA 3PS8A 1QVF2 2W9QA 2W56A 3KSED 2LYXA 3VSYA 1EG9B 1AV4A 3EB8A 1TFKA 1IVVA 3S67A 4CDLA 2INXA 4HM8B 1O7NB 3K5TA 1IQ8A 2ML5A 3NXJA 2CG0A 2XFTA 2HMMB 3FKAA 1D6UA 1JN5A 2OOVC 1GD4A 2FNQA 2FXTA 3I553 4EYCA 2BMRB 3MYTA 2B24B 1EKMA 4LMIA 4XM4A 2V1LA 2F99A 3LTAA 4ORLA 3EF8A 1O7WB 2WGOA 2P0MA 4O3VA 2JDIH 5IEPA 3EJVA 3G6E3 2GU3A 2W04A 4R1KA 3CME3 3CC43 5D83A 4OK0A 1NWWA 2XRXB 2SBLA 1SQWA 3D9RA 4QWTA 2CK3H 1LVNA 3CD63 5AEUB 3OW22 1DMMA 1OF5B 2HMKB 5HGRA 2OOVA 4WWUC 2HMOB 3DUKA 1WMOA 1R4CA 1UUVB 2W56B 5ELJA 4AKZA 5CF2A 3UNLA 2W9PA 3KIIA 3BNBA 2W2CA 1K8A4 4FMBA 5IENA 4IIAA 2KRTA 5D82A 4IPBA 3STDA 3JUOA 1JN5B 1W2B2 1SPUA 1W02A 2BT3A 4LEHA 4Q53A 3DGMA 1IVWA 1J2BA 5TGNA 3OV4A 1OHPA 3PYJA 1DYUA 2PNCA 3FH1A 3LH4A 3JUNA 2CIUA 1VQL3 4U13A 2WOHA 1W6CA 4BTXA 3SEDA 3U97A 3CU3A 4TX4A 2CG1A 1VQO3 3K63A 4HM1B 1OCVA 4HKVB 5CXOA 1TIJA 3DGNA 4KFEA 5LC6A 3S29A 1FGRA 3KN4A 2OQEA 1ROVA 3NQYA 4HJLB 3QK9A 4I4KA 3K0ZA 1LNHA 4PEJA 4X2OA 5AI1A 1BUQA 1STDA 3JUPA 4HM2B 1ROAA 3RGAA 2OWPA 2LQVA 4HVNA 1KD14 1KWIA 4KFDA 1WNHA 3NBJA 1TU5A 3PCSA 3N9HA 3NBBA 4EBGA 1VQ83 4NREA 3EE1A 3MKIA 3F14A 1CYUA 1W00A 1VQP3 4R9KA 1W01A 3NQZA 1L5GB 1YGEA 1WMPA 2YFJB 4G1MB 3SOAA 1MOLA 5AIGA 2F86B 3BLZA 2XSOB 3S27A 4N3VA 1C7HA 1JB4A 1TFOA 3FF0A 2A15A 2O9UX 3F7XA 5AIIA 4MMXB 1US1A 2Z6BA 3CCV3 2XH9A 1OHOA 3JUMA 3X3YA 3LMLA 4K90B 1N8R4 1IDPA 1E97A 1OH0A 1W6GA 8CHOA 4HM4B 2JQ5A 1JJ22 2M7OA 3F7SA 4KFFA 3CCJ3 1Y4KA 1WMNA 2GEYA 1OPYA 1FUWA 4WHAA 1UUWB 3MSOA 1YIJ3 4N6OB 3PXMA 3UL5A 2C10A 3N54B 1K28A 1N8QA 3CC23 1VQ73 1RJOA 2XSHB 1TUHA 3MHEA 4H3UA 4MMYB 5CK6A 1S723 1SIIA 1QAFA 2MF7A 3LYGA 1IVUA 3B7CA 3KSPA 3IJEB 2Y73A 5IG4A 1JV2B 4EV2A 1RRHA 3WOFB 1M1XB 3CCU3 4O2HA 3RDEA 5AIHA 2P05A 3EC9A 4AEQA 3DMCA 3CC73 1DVCA 1YVBI 5KP4A 2K54A 3F8XA 1W6YA 2HMJB 3ECFA 4XDWA 2RSXA 1UW1A 4AKYA 5AYSC 3I563 3WOEB 3CMA3 2P0XA 2P09A 2P38A 3ER7A 1A67A 1O7PB 1PU4A 4GB5A 3SVAA 2RFRA 3HIGA 3HX8A 3SXXA 3J7Yd 1Q824 3DXOA 1U8CB 5JPUA 1ISKA 3IPTA 5KP1A 2K0MA 2QA43 1AR0A 1QALA 1O7HB 1U5OA 5AYRB 2Q07A 3Q90A 2BMQB 1CYVA 2CC3A 2YFLB 1FGMA 1NB3I 3DM8A 5D81A 3N8BA 2QGUA 1M1K4 2XF3A 5IG5A 2IA7A 2BMOB 3LTDA 2D1WA 1ZO2A 4RNZA 2QEX3 1Q814 2OQEC 3NUVA 4KVHA 4MJDA 2ZDJA 3CNXA 2KCDA 2CFWA 4WP5A 1S5AA 5FGOA 5JPPA 2CHCA 1RKYA 1K41A 4LGQA 5EVHA 3DGLA 3MWZA 3X41A 1FGTA 4BTWA 1V74A 5EQLA 2W6JH 3LTBA 4XB5A 2YFIB 2F98A 3UB1A 4R80A 1CEWI 3OWUA 3F8HA 2CWTA 2HMLB 3UL6A 2CW9A 3G8ZA 2Y74A 2YX9A 2BO9B 3HZPA 2BNGA 3ALAA 2WOFA 3BNEA 2GXFA 3GAXA 3CXC2 2QIYA 3O8YA 1JB5A 3CPOA 3I0YA 3NBRA 3TDGA 1A2VA 3FZWA 3FCSB 4HM6B 2B1XB 1NO3A 1O7GB 5AIFA 1AVKA 5IG3A 2WO0A 3HI7A 1W7CA 4LSOA 2GBWB 3UJMA 4HZ9B 1QAKA 2CH9A 5AEWB 3OX9A 3CCL3 1JRQA 3H51A 4HBRA 3FG3A 2RCDA 5LC7A 3ROBA 3M8CA 4K1VA 2CFGA 1JNQA 3LOYA 4FCZA 4HM7B 4K61A 1D6YA 3CCS3 4O02B 4N6TA 4RNYA 1OACA 1DMNA 3L0RA 5ELUA 3RGRA 1YHQ3 1FA3A 4GL6A 1IT7A 1Q864 3OWYA 1E3RA 4L7KA 5CF1A 3V98A 3PZWA 3KE7A 2GBXB 3HIIA 1GD3A 3EN1B 1Q40A 1VQK3 3GZRA 3X42A 1O7MB 3WMDA 3LT9A 4J9AA 4L8OA 1GS3A 3B4OA 1YI23 3B4PA 3CNMA 3SOYA 2Z7AA 3B8LA 3AMOA 3CPW2 2RGQA 3OWSA 5IW9A 1VQ53 3GRDA 3G713 2CFDA 5IERA 2HMNB 1JB2A 5IEOA 2MC8A 1OUNA 2CWUA 3BNCA 4K1UA 1TP6A 4N6NB 3Q2PA 4KZ1A 4NHFA 5G2GA 3CCR3 1DVDA 3BB9A 3WODG 2XR8B 1W4NA 1ZX2A 2L4VA 1YJW3 2GU1A 1NU3A 3LT8A 3T0UA 1EQKA 2XFSA 1LXEA 1VQ93 3HK4A 5STDA 5BVBA 1KQS2 1E3VA 3OXAA 1WTHA 1MNLA 4X2HA 3H3HA 4RBNA 1VQM3 2BHMA 1JKGA 3GZYB 3KKGA 3K9MC 2IMJA 2CFLA 3SX1A 2OTL3 1Q42A 3NX0A 2ML6A 3NV0A 3IMAB 5DREA 3X3ZA 1CQSA 1Q40B 4N6UA 1N5HA 1W5ZA 2XEPA 3EHCA 4J8TA 4LZIA 3X3XA 1VQN3 3QRDA 3NM7A 3KFQC 1IU7A 4FCJA 4EC6A 2FGTA 1LOXA 1ULJB 2PZVA 1ULIB 4FMCA 4R4KA 3AMOB 1PFPA 3G16A 3MPHA 4FMAA 3FG1A 4H61A 3KZTA 4HZBB 2UX0A 2E2UA 2I9WA 1KC84 3DGOA 3LTCA 1VQ63 2IUKA 4N6MA 1WQLB 4OUQA 2W0QA 3S5CA 3F40A 5KP3A 1N5PA 3FG4A 1FGOA 2XGLA 4MMZB 3T8UA 4FR9A 4OVMA 4XBTA 4STDA 1OGXA 1KSIA 1YJ93 1NJI4 4RZMA 4O8SA 4WYKA 1IV7A 2XGNA 1OGZA 2O3OA 3PCRA 4FCMA 1RRLA 2R4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9L A;  1JKG B;  1ASK A;  3NHX A;  3F9S A;  3NV0 B;  1DMQ A;  1HKX A;  3FGY A;  6STD A;  3DZL A;  3JUQ A;  5CLK A;  1GY6 A;  3VGN A;  2STD A;  1OHS A;  4L8P A;  3EN8 A;  1EA2 A;  3E99 A;  1SJW A;  5DRV A;  3GWR A;  3EBY A;  3K7C A;  3MG1 A;  4HM0 B;  4WYK B;  4XBY A;  3G0K A;  4HM3 B;  3EX9 A;  4HM5 B;  3MG3 A;  3FLJ A;  3GZB A;  1GYB A;  1QJG A;  3EBT A;  1NDO B;  1A2K A;  3T8N A;  1GY5 A;  1Z1S A;  2Z76 A;  1GY7 A;  2Z77 A;  4XDV A;  1VZZ A;  2CKF B;  5BXQ A;  3EQQ B;  7STD A;  1QMA A;  3FSD A;  3NM2 A;  3FF2 A;  4XBX A;  3A76 A;  5FW5 A;  3MG2 A;  2GEX A;  3GZX B;  5IG0 A;  5IF6 A;  1OF5 A;  3LZA A;  3VSY A;  1EG9 B;  4CDL A;  2INX A;  4HM8 B;  1O7N B;  3NXJ A;  2HMM B;  3FKA A;  1JN5 A;  2BMR B;  3MYT A;  2B24 B;  4LMI A;  4XM4 A;  2F99 A;  4ORL A;  3EF8 A;  1O7W B;  5IEP A;  3EJV A;  4R1K A;  5D83 A;  1NWW A;  2XRX B;  3D9R A;  5AEU B;  1DMM A;  1OF5 B;  2HMK B;  5HGR A;  4WWU C;  2HMO B;  3DUK A;  1UUV B;  5CF2 A;  3UNL A;  2W2C A;  5IEN A;  4IIA A;  5D82 A;  3STD A;  3JUO A;  1JN5 B;  1W02 A;  4LEH A;  4Q53 A;  5TGN A;  3OV4 A;  1OHP A;  3FH1 A;  3JUN A;  4U13 A;  3SED A;  3CU3 A;  4HM1 B;  1OCV A;  4HKV B;  5CXO A;  4HJL B;  4I4K A;  3K0Z A;  4PEJ A;  4X2O A;  5AI1 A;  1BUQ A;  1STD A;  3JUP A;  4HM2 B;  3RGA A;  2OWP A;  4HVN A;  3MKI A;  3F14 A;  1W00 A;  4R9K A;  1W01 A;  2YFJ B;  3SOA A;  5AIG A;  2F86 B;  3BLZ A;  2XSO B;  4N3V A;  1C7H A;  1JB4 A;  3FF0 A;  2A15 A;  3F7X A;  5AII A;  1OHO A;  3JUM A;  1IDP A;  1E97 A;  1OH0 A;  8CHO A;  4HM4 B;  2JQ5 A;  3F7S A;  2GEY A;  1OPY A;  1UUW B;  3MSO A;  2XSH B;  1TUH A;  3MHE A;  4H3U A;  5CK6 A;  3LYG A;  3B7C A;  3KSP A;  5IG4 A;  5AIH A;  3EC9 A;  3DMC A;  5KP4 A;  2K54 A;  3F8X A;  1W6Y A;  2HMJ B;  3ECF A;  4XDW A;  3ER7 A;  1O7P B;  4GB5 A;  2RFR A;  3HX8 A;  3DXO A;  5JPU A;  1ISK A;  3IPT A;  5KP1 A;  1AR0 A;  1O7H B;  1U5O A;  3Q90 A;  2BMQ B;  2YFL B;  3DM8 A;  5D81 A;  2QGU A;  5IG5 A;  2BMO B;  1ZO2 A;  3NUV A;  4KVH A;  4MJD A;  3CNX A;  4WP5 A;  1S5A A;  5JPP A;  2CHC A;  1K41 A;  4LGQ A;  5EVH A;  4XB5 A;  2YFI B;  2F98 A;  3OWU A;  3F8H A;  2HML B;  3G8Z A;  3HZP A;  2BNG A;  2GXF A;  2QIY A;  1JB5 A;  3CPO A;  3I0Y A;  3NBR A;  3FZW A;  4HM6 B;  2B1X B;  5AIF A;  1O7G B;  5IG3 A;  2GBW B;  3UJM A;  4HZ9 B;  5AEW B;  3OX9 A;  3H51 A;  2RCD A;  3ROB A;  3M8C A;  4K1V A;  4HM7 B;  1DMN A;  3RGR A;  3OWY A;  1E3R A;  4L7K A;  5CF1 A;  3KE7 A;  2GBX B;  3EN1 B;  1Q40 A;  3GZR A;  1O7M B;  3WMD A;  4J9A A;  4L8O A;  1GS3 A;  3B4O A;  3B4P A;  3CNM A;  3SOY A;  2Z7A A;  3B8L A;  2RGQ A;  3OWS A;  3GRD A;  5IER A;  2HMN B;  1JB2 A;  5IEO A;  1OUN A;  4K1U A;  1TP6 A;  5G2G A;  3BB9 A;  2XR8 B;  1ZX2 A;  1NU3 A;  3HK4 A;  5STD A;  5BVB A;  1E3V A;  3OXA A;  4X2H A;  3H3H A;  1JKG A;  3GZY B;  3KKG A;  2IMJ A;  1Q42 A;  3NV0 A;  5DRE A;  1CQS A;  1Q40 B;  4J8T A;  3EHC A;  4FCJ A;  2PZV A;  1ULJ B;  1ULI B;  3G16 A;  3KZT A;  4HZB B;  2UX0 A;  2I9W A;  3S5C A;  1WQL B;  4OUQ A;  3F40 A;  5KP3 A;  3T8U A;  4OVM A;  4XBT A;  4STD A;  1OGX A;  4RZM A;  4WYK A;  1OGZ A;  4FCM A;  2R4I A; 
#chains in the Genus database with same CATH topology
 4R9L A;  1JKG B;  1Q7Y 4;  2W03 A;  1HU9 A;  1K73 4;  1ASK A;  1GOY A;  3NHX A;  3F9S A;  3NV0 B;  1BIR A;  1RN7 A;  2OCT A;  4BTY A;  1UCL A;  4IT7 A;  1ZS7 A;  3G4S 3;  1DMQ A;  3S28 A;  3WDG B;  1B27 A;  1HKX A;  1RNT A;  5I97 A;  3FGY A;  1BUJ A;  3AHS A;  6STD A;  1YIT 3;  2ZA4 A;  3DZL A;  1M90 4;  2C4B A;  2ZL8 A;  3JUQ A;  3Q3F A;  3CCM 3;  1W2Z A;  1GY6 A;  5CLK A;  1PYL A;  1FGQ A;  3VGN A;  2E2V A;  3WA2 X;  2IUJ A;  1IVX A;  2E2T A;  1UI8 A;  1YNV X;  1OHS A;  2STD A;  3D3L A;  1B3S A;  2H0H A;  1GMR A;  4L8P A;  1T5Y A;  4JRF A;  3EN8 A;  4CCV A;  3CCQ 3;  1A90 A;  1BRN L;  1VQ4 3;  1EA2 A;  1CH0 A;  3BND A;  2RBI A;  3E99 A;  1SJW A;  2C11 A;  5DRV A;  3VF1 A;  3WR2 A;  3GWR A;  5A0O B;  1N9J A;  1RN1 A;  3CCE 3;  1NB5 I;  1M9G A;  3EBY A;  3Q1C A;  1B21 A;  3BIR A;  3K7C A;  8RNT A;  4WFO A;  4ZM8 A;  3V99 A;  3MG1 A;  2L1S A;  4HM0 B;  2IYJ A;  1IT8 A;  2RNT A;  4WYK B;  4I5Q A;  1N9E A;  4XBY A;  3HOH A;  1I2G A;  1UCK A;  3G0K A;  4HM3 B;  3V92 A;  3WHO A;  3EX9 A;  4HM5 B;  3MG3 A;  3ZFZ A;  1Q7H A;  3FLJ A;  4GSP A;  2WGQ A;  3GZB A;  1T2H A;  1IQX A;  1GOU A;  1GYB A;  1QJG A;  1TRQ A;  2IY2 A;  4CJN A;  3EBT A;  3DY5 A;  3LXU X;  1NDO B;  4JF8 A;  1A2K A;  3U1W A;  3T8N A;  2BU4 A;  2UUG C;  1GY5 A;  1Z1S A;  5EEO A;  1IK3 A;  2Z76 A;  1VQQ A;  3AGN A;  4EXR A;  1GY7 A;  2Z77 A;  2SAR A;  4XDV A;  2D42 A;  1B2S A;  5JBS A;  1VZZ A;  2CKF B;  3X40 A;  1BRK A;  1MWS A;  3JVC A;  3EQQ B;  3URP A;  5BXQ A;  4MEI A;  1QVG 2;  4N6L A;  7STD A;  3PGB A;  1SIH A;  4HYZ A;  1IYY A;  1BRG A;  1IQY A;  2KXG A;  1G96 A;  1QMA A;  1AVL A;  1F8N A;  3FSD A;  2CFK A;  3NM2 A;  1D6Z A;  3SLU A;  3WA3 A;  3FF2 A;  4FMD A;  4N6V 0;  4XBX A;  1IV9 A;  1STF I;  3A76 A;  1I0X A;  1K9M 4;  4J5K A;  3MG2 A;  5FW5 A;  1YJN 3;  2GEX A;  4EV5 A;  1MGR A;  1UI7 A;  2UGI A;  2OTJ 3;  3GZX B;  3A5E A;  5IG0 A;  2CWV A;  5IF6 A;  1RMS A;  1Q9E A;  1OF5 A;  3LZA A;  3PS8 A;  1RGE A;  2ZHX B;  1QVF 2;  1G0T A;  1FW7 A;  2W9Q A;  2W56 A;  3KSE D;  2LYX A;  1RGG A;  3VSY A;  1EG9 B;  1AV4 A;  3EB8 A;  1BRI A;  1TFK A;  1IVV A;  3S67 A;  4CDL A;  1GMQ A;  2INX A;  4HM8 B;  1UCI A;  1O7N B;  3K5T A;  1IQ8 A;  2ML5 A;  3NXJ A;  2CG0 A;  4BL2 A;  2XFT A;  2HMM B;  3FKA A;  1D6U A;  1JN5 A;  2KF5 A;  2OOV C;  1GD4 A;  4BIR A;  2FNQ A;  2FXT A;  3I55 3;  4EYC A;  2BMR B;  3MYT A;  2B24 B;  5BIR A;  1EKM A;  4LMI A;  4XM4 A;  2AAE A;  2V1L A;  7RNT A;  2F99 A;  3LTA A;  4ORL A;  3EF8 A;  1O7W B;  2WGO A;  2P0M A;  4O3V A;  2JDI H;  5IEP A;  1DE3 A;  3EJV A;  3G6E 3;  2GU3 A;  1I0V A;  2W04 A;  4R1K A;  3CME 3;  3CC4 3;  1BSC A;  5D83 A;  1JBS A;  4OK0 A;  1NWW A;  1BOX A;  1DET A;  2XRX B;  2SBL A;  1SQW A;  3D9R A;  4QWT A;  2CK3 H;  1LVN A;  3CD6 3;  5AEU B;  1UGI A;  3OW2 2;  1DMM A;  1OF5 B;  2HMK B;  1R4Y A;  5HGR A;  2OOV A;  4WWU C;  2HMO B;  3DUK A;  1RGC A;  1WMO A;  1R4C A;  1UUV B;  2W56 B;  1X1X A;  5ELJ A;  4AKZ A;  5CF2 A;  3UNL A;  2W9P A;  3KII A;  3BNB A;  2W2C A;  2KF4 A;  4FMB A;  1K8A 4;  1V57 A;  1I8V A;  5IEN A;  3AHW A;  4IIA A;  2KRT A;  5D82 A;  4IPB A;  3STD A;  3JUO A;  1JN5 B;  1W2B 2;  1RGF A;  1SPU A;  1W02 A;  2BT3 A;  4LEH A;  2KF6 A;  4Q53 A;  1FUT A;  4KT3 B;  3DGM A;  2F4Y A;  1IVW A;  5GSP A;  1J2B A;  5TGN A;  3OV4 A;  1BNJ A;  1OHP A;  3PYJ A;  1DYU A;  2PNC A;  3FH1 A;  3LH4 A;  1JBR A;  3JUN A;  2CIU A;  1BSB A;  1VQL 3;  1C54 A;  4U13 A;  2WOH A;  1W6C A;  4BTX A;  3SED A;  3U97 A;  3CU3 A;  4TX4 A;  2CG1 A;  1VQO 3;  3K63 A;  1MGW A;  4HM1 B;  1OCV A;  4HKV B;  4EW5 A;  1V58 A;  5CXO A;  2CX0 A;  1RLS A;  1TIJ A;  3DGN A;  4KFE A;  5LC6 A;  3S29 A;  4DKI A;  1UGH I;  1FGR A;  3KN4 A;  2OQE A;  1ROV A;  3NQY A;  4HJL B;  1HZ1 A;  5HOH A;  3QK9 A;  4I4K A;  3K0Z A;  1LNH A;  4PEJ A;  4X2O A;  1TJD A;  5AI1 A;  1BUQ A;  1STD A;  3JUP A;  4HM2 B;  1ROA A;  3RGA A;  2OWP A;  2LQV A;  4HVN A;  1KD1 4;  1LOY A;  1KWI A;  1BRS A;  4KFD A;  1WNH A;  3NBJ A;  4BL3 A;  1TU5 A;  3PCS A;  3N9H A;  3NBB A;  4EBG A;  1VQ8 3;  4NRE A;  3EE1 A;  3MKI A;  3F14 A;  1CYU A;  1W00 A;  1VQP 3;  4R9K A;  1T3B A;  1W01 A;  3NQZ A;  1L5G B;  1YGE A;  1WMP A;  2GSP A;  2YFJ B;  4G1M B;  3SOA A;  1MOL A;  5AIG A;  2F86 B;  3BLZ A;  2XSO B;  3S27 A;  1UCJ A;  1C7H A;  1JB4 A;  1TFO A;  4N3V A;  3FF0 A;  2A15 A;  2O9U X;  3F7X A;  5AII A;  4MMX B;  3AGO A;  1I3F A;  1US1 A;  2Z6B A;  3CCV 3;  2XH9 A;  1RGA A;  2F5M A;  1BRH A;  1NNV A;  1OHO A;  3JUM A;  3X3Y A;  1A2P A;  3LML A;  4K90 B;  9RNT A;  1N8R 4;  3D5G A;  1IDP A;  3GSP A;  1E97 A;  1OH0 A;  1W6G A;  3D4A A;  8CHO A;  4HM4 B;  2JQ5 A;  1BNG A;  1JJ2 2;  2M7O A;  3F7S A;  4KFF A;  3CCJ 3;  1Y4K A;  1LOW A;  1FUS A;  1WMN A;  2GEY A;  1OPY A;  1FUW A;  4WHA A;  1UUW B;  1TTO A;  1GMP A;  3ZG0 A;  3MSO A;  2KF3 A;  1YIJ 3;  4N6O B;  3PXM A;  3UL5 A;  2C10 A;  1AQZ A;  3BU4 A;  3N54 B;  1K28 A;  1N8Q A;  3CC2 3;  1BAN A;  2R41 A;  5G1L A;  1VQ7 3;  1RJO A;  2XSH B;  1TUH A;  3MHE A;  4H3U A;  4MMY B;  5CK6 A;  1S72 3;  1SII A;  4GHO A;  1QAF A;  2MF7 A;  3LYG A;  1IVU A;  3B7C A;  3KSP A;  1RDS A;  2Y73 A;  3IJE B;  5IG4 A;  1JV2 B;  4EV2 A;  1B2M A;  1RRH A;  3WOF B;  3KCH A;  1M1X B;  3CCU 3;  1MWU A;  6RNT A;  4O2H A;  3RDE A;  5AIH A;  2P05 A;  3EC9 A;  4NPB A;  3DMC A;  4AEQ A;  1DVC A;  1G02 A;  1YVB I;  3CC7 3;  5KP4 A;  2K54 A;  3F8X A;  1W6Y A;  2HMJ B;  3ECF A;  4XDW A;  1RCL A;  3RNT A;  2RSX A;  1RGL A;  1UW1 A;  4AKY A;  5AYS C;  3I56 3;  3WOE B;  3CMA 3;  2P0X A;  2P09 A;  1RCK A;  2P38 A;  3ER7 A;  1A67 A;  1RNB A;  1O7P B;  1PU4 A;  1EUI C;  4GB5 A;  3SVA A;  2RFR A;  3HIG A;  1BGS A;  3HX8 A;  3SXX A;  3J7Y d;  1Q82 4;  3DXO A;  1U8C B;  5JPU A;  1ISK A;  3IPT A;  5KP1 A;  2K0M A;  2QA4 3;  1AR0 A;  1QAL A;  1O7H B;  3D5I A;  1U5O A;  5AYR B;  1BSA A;  2Q07 A;  3Q90 A;  2BMQ B;  1CYV A;  2CC3 A;  2YFL B;  2F5W A;  1FGM A;  1AY7 A;  1NB3 I;  1SAR A;  3DM8 A;  4J5G A;  3N8B A;  5D81 A;  2QGU A;  1M1K 4;  2XF3 A;  5IG5 A;  2IA7 A;  1B20 A;  2BMO B;  2D1W A;  1ZO2 A;  3LTD A;  1RN4 A;  4RNZ A;  2QEX 3;  1UUG B;  2OQE C;  3NUV A;  2BIR A;  1FZU A;  4KVH A;  4MJD A;  2ZDJ A;  3CNX A;  1BAO A;  2CFW A;  2KCD A;  4WP5 A;  1S5A A;  5FGO A;  5JPP A;  2CHC A;  2H0I A;  1K41 A;  1RKY A;  3D79 A;  4LGQ A;  5EVH A;  3DGL A;  5M18 A;  3MWZ A;  1X1W A;  3X41 A;  1LQM B;  1Q81 4;  1FGT A;  1I2E A;  4BTW A;  1V74 A;  5EQL A;  2W6J H;  2KAA A;  3LTB A;  4XB5 A;  2YFI B;  2F98 A;  3UB1 A;  4R80 A;  1CEW I;  3OWU A;  3F8H A;  2CWT A;  1FYS A;  2HML B;  3UL6 A;  1TRP A;  2CW9 A;  3G8Z A;  2Y74 A;  2YX9 A;  5M19 A;  2BO9 B;  3HZP A;  1LQG C;  1BVI A;  2BNG A;  3ALA A;  2WOF A;  3BNE A;  2GXF A;  3GAX A;  5G1K A;  3CXC 2;  2QIY A;  7GSP A;  3O8Y A;  1JB5 A;  3CPO A;  3I0Y A;  3NBR A;  1MWT A;  3TDG A;  1A2V A;  3FZW A;  3FCS B;  4HM6 B;  2B1X B;  3SYU A;  1NO3 A;  1O7G B;  5AIF A;  1AVK A;  1RGK A;  5IG3 A;  2WO0 A;  3HI7 A;  1W7C A;  4LSO A;  2GBW B;  1ZGX A;  2CX1 A;  3UJM A;  4HZ9 B;  1QAK A;  2CH9 A;  2HOH A;  6GSP A;  5AEW B;  3OX9 A;  3CCL 3;  1JRQ A;  3H51 A;  4HBR A;  3FG3 A;  2RCD A;  5LC7 A;  3ROB A;  3M8C A;  2J8X B;  4K1V A;  4RNT A;  2CFG A;  1I70 A;  1JNQ A;  3LOY A;  4FCZ A;  4HM7 B;  4K61 A;  1D6Y A;  3CCS 3;  4LYL B;  1BNF A;  1X1Y A;  4ILF A;  4N6T A;  4O02 B;  1OAC A;  1DMN A;  3L0R A;  4RNY A;  5ELU A;  3RGR A;  1YHQ 3;  3DGY A;  1FA3 A;  4GL6 A;  1IT7 A;  1BU4 A;  1Q86 4;  3OWY A;  1E3R A;  4L7K A;  5CF1 A;  1BRJ A;  3V98 A;  3PZW A;  3KE7 A;  2GBX B;  4HAA A;  1HYF A;  3HII A;  1GD3 A;  3EN1 B;  1Q40 A;  1VQK 3;  3GZR A;  3X42 A;  1O7M B;  3WMD A;  1BNS A;  3LT9 A;  4J9A A;  4L8O A;  1GS3 A;  3B4O A;  1YI2 3;  5RNT A;  1X1U A;  3B4P A;  3CNM A;  3SOY A;  2Z7A A;  3B8L A;  3AMO A;  3CPW 2;  2RGQ A;  3OWS A;  5IW9 A;  1VQ5 3;  3GRD A;  1MWR A;  4CPK A;  2CFD A;  5IER A;  3G71 3;  2HMN B;  1JB2 A;  5IEO A;  2MC8 A;  1OUN A;  1YVS A;  1YGW A;  2CWU A;  3BNC A;  4K1U A;  1TP6 A;  4N6N B;  3Q2P A;  4KZ1 A;  4NHF A;  5G2G A;  3CCR 3;  1DVD A;  3BB9 A;  3WOD G;  2XR8 B;  1W4N A;  1ZX2 A;  1EEJ A;  2L4V A;  1YJW 3;  2GU1 A;  1NU3 A;  1BSE A;  1I3I A;  3LT8 A;  1I2F A;  3T0U A;  1BNR A;  1EQK A;  2XFS A;  1LXE A;  2F56 A;  1VQ9 3;  1BNI A;  3HK4 A;  5STD A;  5BVB A;  1KQS 2;  1E3V A;  3OXA A;  1WTH A;  1LNI A;  1MNL A;  4X2H A;  3H3H A;  4RBN A;  1T2I A;  1BSD A;  5BU4 A;  2BHM A;  1VQM 3;  1JKG A;  3GZY B;  3KKG A;  3K9M C;  2IMJ A;  1BNE A;  2CFL A;  2K3D A;  3SX1 A;  2OTL 3;  1Q42 A;  1RTU A;  1JBT A;  3NX0 A;  2ML6 A;  3NV0 A;  3IMA B;  5DRE A;  3X3Z A;  1CQS A;  2H0G A;  1B2Z A;  1Q40 B;  4N6U A;  1RGH A;  1N5H A;  1W5Z A;  2XEP A;  3DH2 A;  3EHC A;  4J8T A;  4LZI A;  3X3X A;  3QRD A;  3NM7 A;  1VQN 3;  3KFQ C;  1IU7 A;  4FCJ A;  4BU4 A;  4HOH A;  4EC6 A;  2FGT A;  1GSP A;  1LOX A;  1RSN A;  1ULJ B;  2PZV A;  1ULI B;  4FMC A;  4R4K A;  3AMO B;  1PFP A;  3G16 A;  3MPH A;  4FMA A;  1PY3 A;  3FG1 A;  4H61 A;  3KZT A;  4HZB B;  2UX0 A;  2E2U A;  2I9W A;  1KC8 4;  1RHL A;  1JZO A;  1UDI I;  3DGO A;  3LTC A;  5M1A A;  1B2X A;  1VQ6 3;  3ZG5 A;  2IUK A;  4N6M A;  1WQL B;  1JZD A;  2W0Q A;  4OUQ A;  3F40 A;  5KP3 A;  3S5C A;  1LOV A;  1N5P A;  3FG4 A;  1FGO A;  2XGL A;  4MMZ B;  3T8U A;  4FR9 A;  4OVM A;  4XBT A;  4STD A;  1OGX A;  1KSI A;  1YJ9 3;  1LRA A;  1GOV A;  1NJI 4;  4RZM A;  4O8S A;  1B2U A;  4WYK A;  1IV7 A;  2AAD A;  2XGN A;  1OGZ A;  2O3O A;  3PCR A;  4FCM A;  1RRL A;  2R4I A; 
#chains in the Genus database with same CATH homology
 4R9L A;  1JKG B;  2W03 A;  1HU9 A;  1K73 4;  1ASK A;  3NHX A;  3F9S A;  3NV0 B;  1RN7 A;  2OCT A;  4BTY A;  4IT7 A;  3G4S 3;  1DMQ A;  3S28 A;  3WDG B;  1HKX A;  5I97 A;  3FGY A;  1YIT 3;  6STD A;  3DZL A;  1M90 4;  2ZL8 A;  3JUQ A;  3CCM 3;  1W2Z A;  1GY6 A;  5CLK A;  3VGN A;  1FGQ A;  3WA2 X;  2E2V A;  2IUJ A;  1IVX A;  2E2T A;  1UI8 A;  2STD A;  1OHS A;  3D3L A;  1Q7Y 4;  3CCQ 3;  1A90 A;  4L8P A;  1T5Y A;  4JRF A;  3EN8 A;  4CCV A;  1VQ4 3;  1EA2 A;  3BND A;  3E99 A;  1SJW A;  2C11 A;  5DRV A;  3VF1 A;  3GWR A;  5A0O B;  1N9J A;  3CCE 3;  1NB5 I;  1M9G A;  3EBY A;  3Q1C A;  3K7C A;  4WFO A;  4ZM8 A;  3V99 A;  3MG1 A;  4HM0 B;  1IT8 A;  4WYK B;  1N9E A;  4XBY A;  3V92 A;  3G0K A;  4HM3 B;  3EX9 A;  4HM5 B;  3MG3 A;  3FLJ A;  2WGQ A;  3GZB A;  1IQX A;  1GYB A;  1QJG A;  3EBT A;  3DY5 A;  3LXU X;  1NDO B;  4JF8 A;  1A2K A;  3U1W A;  3T8N A;  1GY5 A;  1Z1S A;  5EEO A;  1IK3 A;  2Z76 A;  4EXR A;  1GY7 A;  2Z77 A;  4XDV A;  2D42 A;  5JBS A;  1VZZ A;  2CKF B;  3X40 A;  3JVC A;  5BXQ A;  3EQQ B;  4MEI A;  1QVG 2;  4N6L A;  7STD A;  3PGB A;  1SIH A;  4HYZ A;  1IQY A;  2KXG A;  1G96 A;  1QMA A;  1AVL A;  1F8N A;  3FSD A;  2CFK A;  3NM2 A;  1D6Z A;  3SLU A;  3WA3 A;  3FF2 A;  4FMD A;  4N6V 0;  4XBX A;  1IV9 A;  1STF I;  3A76 A;  1K9M 4;  5FW5 A;  3MG2 A;  1YJN 3;  2GEX A;  4EV5 A;  1UI7 A;  2OTJ 3;  3GZX B;  5IG0 A;  2CWV A;  5IF6 A;  1OF5 A;  3LZA A;  3PS8 A;  1QVF 2;  2W9Q A;  2W56 A;  3KSE D;  2LYX A;  3VSY A;  1EG9 B;  1AV4 A;  3EB8 A;  1TFK A;  1IVV A;  3S67 A;  4CDL A;  2INX A;  4HM8 B;  1O7N B;  3K5T A;  1IQ8 A;  2ML5 A;  3NXJ A;  2CG0 A;  2XFT A;  2HMM B;  3FKA A;  1D6U A;  1JN5 A;  2OOV C;  1GD4 A;  2FNQ A;  2FXT A;  3I55 3;  4EYC A;  2BMR B;  3MYT A;  2B24 B;  1EKM A;  4LMI A;  4XM4 A;  2V1L A;  2F99 A;  3LTA A;  4ORL A;  3EF8 A;  1O7W B;  2WGO A;  2P0M A;  4O3V A;  2JDI H;  5IEP A;  3EJV A;  3G6E 3;  2GU3 A;  2W04 A;  4R1K A;  3CME 3;  3CC4 3;  5D83 A;  4OK0 A;  1NWW A;  2XRX B;  2SBL A;  1SQW A;  3D9R A;  4QWT A;  2CK3 H;  1LVN A;  3CD6 3;  5AEU B;  3OW2 2;  1DMM A;  1OF5 B;  2HMK B;  5HGR A;  2OOV A;  4WWU C;  2HMO B;  3DUK A;  1WMO A;  1R4C A;  1UUV B;  2W56 B;  5ELJ A;  4AKZ A;  5CF2 A;  3UNL A;  2W9P A;  3KII A;  3BNB A;  2W2C A;  1K8A 4;  4FMB A;  5IEN A;  4IIA A;  2KRT A;  5D82 A;  4IPB A;  3STD A;  3JUO A;  1JN5 B;  1W2B 2;  1SPU A;  1W02 A;  2BT3 A;  4LEH A;  4Q53 A;  3DGM A;  1IVW A;  1J2B A;  5TGN A;  3OV4 A;  1OHP A;  3PYJ A;  1DYU A;  2PNC A;  3FH1 A;  3LH4 A;  3JUN A;  2CIU A;  1VQL 3;  4U13 A;  2WOH A;  1W6C A;  4BTX A;  3SED A;  3U97 A;  3CU3 A;  4TX4 A;  2CG1 A;  1VQO 3;  3K63 A;  4HM1 B;  1OCV A;  4HKV B;  5CXO A;  1TIJ A;  3DGN A;  4KFE A;  5LC6 A;  3S29 A;  1FGR A;  3KN4 A;  2OQE A;  1ROV A;  3NQY A;  4HJL B;  3QK9 A;  4I4K A;  3K0Z A;  1LNH A;  4PEJ A;  4X2O A;  5AI1 A;  1BUQ A;  1STD A;  3JUP A;  4HM2 B;  1ROA A;  3RGA A;  2OWP A;  2LQV A;  4HVN A;  1KD1 4;  1KWI A;  4KFD A;  1WNH A;  3NBJ A;  1TU5 A;  3PCS A;  3N9H A;  3NBB A;  4EBG A;  1VQ8 3;  4NRE A;  3EE1 A;  3MKI A;  3F14 A;  1CYU A;  1W00 A;  1VQP 3;  4R9K A;  1W01 A;  3NQZ A;  1L5G B;  1YGE A;  1WMP A;  2YFJ B;  4G1M B;  3SOA A;  1MOL A;  5AIG A;  2F86 B;  3BLZ A;  2XSO B;  3S27 A;  4N3V A;  1C7H A;  1JB4 A;  1TFO A;  3FF0 A;  2A15 A;  2O9U X;  3F7X A;  5AII A;  4MMX B;  1US1 A;  2Z6B A;  3CCV 3;  2XH9 A;  1OHO A;  3JUM A;  3X3Y A;  3LML A;  4K90 B;  1N8R 4;  1IDP A;  1E97 A;  1OH0 A;  1W6G A;  8CHO A;  4HM4 B;  2JQ5 A;  1JJ2 2;  2M7O A;  3F7S A;  4KFF A;  3CCJ 3;  1Y4K A;  1WMN A;  2GEY A;  1OPY A;  1FUW A;  4WHA A;  1UUW B;  3MSO A;  1YIJ 3;  4N6O B;  3PXM A;  3UL5 A;  2C10 A;  3N54 B;  1K28 A;  1N8Q A;  3CC2 3;  1VQ7 3;  1RJO A;  2XSH B;  1TUH A;  3MHE A;  4H3U A;  4MMY B;  5CK6 A;  1S72 3;  1SII A;  1QAF A;  2MF7 A;  3LYG A;  1IVU A;  3B7C A;  3KSP A;  3IJE B;  2Y73 A;  5IG4 A;  1JV2 B;  4EV2 A;  1RRH A;  3WOF B;  1M1X B;  3CCU 3;  4O2H A;  3RDE A;  5AIH A;  2P05 A;  3EC9 A;  4AEQ A;  3DMC A;  3CC7 3;  1DVC A;  1YVB I;  5KP4 A;  2K54 A;  3F8X A;  1W6Y A;  2HMJ B;  3ECF A;  4XDW A;  2RSX A;  1UW1 A;  4AKY A;  5AYS C;  3I56 3;  3WOE B;  3CMA 3;  2P0X A;  2P09 A;  2P38 A;  3ER7 A;  1A67 A;  1O7P B;  1PU4 A;  4GB5 A;  3SVA A;  2RFR A;  3HIG A;  3HX8 A;  3SXX A;  3J7Y d;  1Q82 4;  3DXO A;  1U8C B;  5JPU A;  1ISK A;  3IPT A;  5KP1 A;  2K0M A;  2QA4 3;  1AR0 A;  1QAL A;  1O7H B;  1U5O A;  5AYR B;  2Q07 A;  3Q90 A;  2BMQ B;  1CYV A;  2CC3 A;  2YFL B;  1FGM A;  1NB3 I;  3DM8 A;  5D81 A;  3N8B A;  2QGU A;  1M1K 4;  2XF3 A;  5IG5 A;  2IA7 A;  2BMO B;  3LTD A;  2D1W A;  1ZO2 A;  4RNZ A;  2QEX 3;  1Q81 4;  2OQE C;  3NUV A;  4KVH A;  4MJD A;  2ZDJ A;  3CNX A;  2KCD A;  2CFW A;  4WP5 A;  1S5A A;  5FGO A;  5JPP A;  2CHC A;  1RKY A;  1K41 A;  4LGQ A;  5EVH A;  3DGL A;  3MWZ A;  3X41 A;  1FGT A;  4BTW A;  1V74 A;  5EQL A;  2W6J H;  3LTB A;  4XB5 A;  2YFI B;  2F98 A;  3UB1 A;  4R80 A;  1CEW I;  3OWU A;  3F8H A;  2CWT A;  2HML B;  3UL6 A;  2CW9 A;  3G8Z A;  2Y74 A;  2YX9 A;  2BO9 B;  3HZP A;  2BNG A;  3ALA A;  2WOF A;  3BNE A;  2GXF A;  3GAX A;  3CXC 2;  2QIY A;  3O8Y A;  1JB5 A;  3CPO A;  3I0Y A;  3NBR A;  3TDG A;  1A2V A;  3FZW A;  3FCS B;  4HM6 B;  2B1X B;  1NO3 A;  1O7G B;  5AIF A;  1AVK A;  5IG3 A;  2WO0 A;  3HI7 A;  1W7C A;  4LSO A;  2GBW B;  3UJM A;  4HZ9 B;  1QAK A;  2CH9 A;  5AEW B;  3OX9 A;  3CCL 3;  1JRQ A;  3H51 A;  4HBR A;  3FG3 A;  2RCD A;  5LC7 A;  3ROB A;  3M8C A;  4K1V A;  2CFG A;  1JNQ A;  3LOY A;  4FCZ A;  4HM7 B;  4K61 A;  1D6Y A;  3CCS 3;  4O02 B;  4N6T A;  4RNY A;  1OAC A;  1DMN A;  3L0R A;  5ELU A;  3RGR A;  1YHQ 3;  1FA3 A;  4GL6 A;  1IT7 A;  1Q86 4;  3OWY A;  1E3R A;  4L7K A;  5CF1 A;  3V98 A;  3PZW A;  3KE7 A;  2GBX B;  3HII A;  1GD3 A;  3EN1 B;  1Q40 A;  1VQK 3;  3GZR A;  3X42 A;  1O7M B;  3WMD A;  3LT9 A;  4J9A A;  4L8O A;  1GS3 A;  3B4O A;  1YI2 3;  3B4P A;  3CNM A;  3SOY A;  2Z7A A;  3B8L A;  3AMO A;  3CPW 2;  2RGQ A;  3OWS A;  5IW9 A;  1VQ5 3;  3GRD A;  3G71 3;  2CFD A;  5IER A;  2HMN B;  1JB2 A;  5IEO A;  2MC8 A;  1OUN A;  2CWU A;  3BNC A;  4K1U A;  1TP6 A;  4N6N B;  3Q2P A;  4KZ1 A;  4NHF A;  5G2G A;  3CCR 3;  1DVD A;  3BB9 A;  3WOD G;  2XR8 B;  1W4N A;  1ZX2 A;  2L4V A;  1YJW 3;  2GU1 A;  1NU3 A;  3LT8 A;  3T0U A;  1EQK A;  2XFS A;  1LXE A;  1VQ9 3;  3HK4 A;  5STD A;  5BVB A;  1KQS 2;  1E3V A;  3OXA A;  1WTH A;  1MNL A;  4X2H A;  3H3H A;  4RBN A;  1VQM 3;  2BHM A;  1JKG A;  3GZY B;  3KKG A;  3K9M C;  2IMJ A;  2CFL A;  3SX1 A;  2OTL 3;  1Q42 A;  3NX0 A;  2ML6 A;  3NV0 A;  3IMA B;  5DRE A;  3X3Z A;  1CQS A;  1Q40 B;  4N6U A;  1N5H A;  1W5Z A;  2XEP A;  3EHC A;  4J8T A;  4LZI A;  3X3X A;  1VQN 3;  3QRD A;  3NM7 A;  3KFQ C;  1IU7 A;  4FCJ A;  4EC6 A;  2FGT A;  1LOX A;  1ULJ B;  2PZV A;  1ULI B;  4FMC A;  4R4K A;  3AMO B;  1PFP A;  3G16 A;  3MPH A;  4FMA A;  3FG1 A;  4H61 A;  3KZT A;  4HZB B;  2UX0 A;  2E2U A;  2I9W A;  1KC8 4;  3DGO A;  3LTC A;  1VQ6 3;  2IUK A;  4N6M A;  1WQL B;  4OUQ A;  2W0Q A;  3S5C A;  3F40 A;  5KP3 A;  1N5P A;  3FG4 A;  1FGO A;  2XGL A;  4MMZ B;  3T8U A;  4FR9 A;  4OVM A;  4XBT A;  4STD A;  1OGX A;  1KSI A;  1YJ9 3;  1NJI 4;  4RZM A;  4O8S A;  4WYK A;  1IV7 A;  2XGN A;  1OGZ A;  2O3O A;  3PCR A;  4FCM A;  1RRL A;  2R4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...