2F98A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f98A00
1IDPA 3JUMA 4R9KA 4HM1B 4STDA 5IF6A 1UUWB 2HMMB 3MHEA 1A2KA 2XR8B 3EHCA 3CNXA 3DXOA 1HKXA 4HM8B 3HK4A 1GY6A 3GZBA 1O7WB 4HZ9B 3JUNA 3G0KA 3OWSA 3NBRA 3B7CA 4XBYA 2F99A 4I4KA 4WWUC 3S5CA 3LYGA 3HZPA 3B4OA 1STDA 1OHOA 2W2CA 2GBXB 3M8CA 4HM2B 3K7CA 3H51A 2YFLB 2CKFB 3SOAA 4XB5A 2XRXB 5CF1A 3OXAA 2GEYA 1W01A 2HMKB 1E97A 3B4PA 5DREA 1OCVA 1OGXA 5IEPA 3EQQB 3NV0B 4FCJA 4N3VA 4IIAA 4OVMA 3ROBA 3WMDA 3BLZA 3EBYA 3FZWA 5G2GA 3F8HA 4HM0B 2B1XB 5AI1A 2HMNB 2RFRA 4J8TA 2K54A 3JUOA 3VSYA 3RGAA 1W6YA 1OF5A 2INXA 3EC9A 3ER7A 2RCDA 3CU3A 1TP6A 4H3UA 3F40A 1NU3A 3KE7A 3ECFA 3G16A 1TUHA 2XSOB 3G8ZA 4XBTA 2STDA 3F7SA 3SOYA 5AEUB 4L8PA 3OV4A 3EN1B 1Q42A 1U5OA 5CXOA 1JB2A 2PZVA 2I9WA 1OF5B 3IPTA 2GXFA 3JUQA 3DM8A 2CHCA 3MG1A 4XDWA 8CHOA 4ORLA 3MKIA 4K1VA 3A76A 4X2HA 5HGRA 2Z77A 1DMMA 1EA2A 5BXQA 3T8UA 3GRDA 4GB5A 1WQLB 2RGQA 3MG3A 2HMOB 2R4IA 3EF8A 1VZZA 2HMJB 2BNGA 1QMAA 1OUNA 4KVHA 5IG4A 3NXJA 7STDA 5JPUA 1JKGA 5AIHA 2QIYA 3BB9A 3GZYB 2GEXA 3GZRA 5KP3A 1ZO2A 3STDA 4HZBB 4R9LA 2XSHB 3KKGA 5IERA 4MJDA 5BVBA 1UUVB 4HM4B 1EG9B 2GBWB 4HM6B 5CK6A 1DMQA 2A15A 4HKVB 1E3VA 1GS3A 1CQSA 3EN8A 2UX0A 4WYKA 2B24B 2BMQB 5JPPA 4OUQA 4XBXA 1OPYA 1ISKA 1SJWA 5DRVA 2IMJA 2BMRB 3Q90A 3DUKA 3OWYA 4J9AA 2BMOB 5IEOA 3GWRA 2HMLB 1S5AA 5KP4A 1W00A 4HM7B 3OX9A 4HVNA 3MSOA 1DMNA 3FH1A 4HM5B 4RZMA 5D81A 3NUVA 3E99A 4LMIA 5EVHA 3DZLA 5AEWB 2QGUA 1O7HB 2Z7AA 3RGRA 4FCMA 3MYTA 1GYBA 3UNLA 3FF0A 3I0YA 3CPOA 3KZTA 5IG3A 1OH0A 3EBTA 5IG0A 5TGNA 3SEDA 1W02A 2F86B 3HX8A 5AIGA 1O7GB 4X2OA 5IG5A 3FGYA 3EJVA 5D83A 2Z76A 1NWWA 3VGNA 3DMCA 5AIFA 1ASKA 2JQ5A 2F98A 3NV0A 1ULJB 3FF2A 3F7XA 3NM2A 1OGZA 5D82A 5CF2A 3JUPA 3FSDA 3UJMA 1JN5A 3NHXA 3D9RA 1ULIB 5AIIA 3T8NA 4LEHA 1JB5A 3H3HA 1OHSA 1JKGB 3LZAA 3FLJA 3F8XA 4HM3B 4L7KA 4Q53A 1OHPA 1C7HA 1O7PB 1E3RA 3K0ZA 1QJGA 4U13A 4XM4A 1Z1SA 4R1KA 1JN5B 1ZX2A 1Q40A 3EX9A 1O7NB 4WP5A 3GZXB 4PEJA 1GY5A 2OWPA 1AR0A 1K41A 2YFJB 5CLKA 4WYKB 1BUQA 3FKAA 3KSPA 3B8LA 3OWUA 3F9SA 2YFIB 3MG2A 4XDVA 4LGQA 5IENA 1NDOB 4HJLB 4K1UA 6STDA 5FW5A 1Q40B 3CNMA 1GY7A 4CDLA 5KP1A 4L8OA 5STDA 1O7MB 3F14A 1JB4A
chains in the Genus database with same CATH superfamily
3DGYA 1IDPA 3JUMA 4R9KA 2OOVA 1NJI4 1HU9A 1W7CA 4AKZA 5A0OB 4FR9A 1G02A 3AGOA 2JDIH 4LSOA 3AMOA 4HAAA 4EXRA 2IUKA 4HM1B 4STDA 1D6YA 1RGLA 4NREA 4EYCA 5IF6A 1UUWB 3QRDA 5M18A 2HMMB 3MHEA 3D5GA 3CXC2 1B2ZA 1A2KA 2XR8B 3EHCA 2CIUA 3CNXA 1HKXA 3DXOA 3LT9A 1BIRA 3HK4A 3PZWA 4HM8B 1GY6A 3DGMA 4BTYA 3CC43 1RLSA 2WGOA 3FG4A 3GZBA 3G6E3 1QAFA 2Q07A 1KC84 1PYLA 1GSPA 1O7WB 3NQZA 3JUNA 4HZ9B 3G0KA 4N6LA 4RNYA 3OWSA 3BNBA 3NBRA 2CX1A 1AVKA 1W2ZA 2CH9A 2Y74A 3B7CA 2QEX3 2E2TA 2CWVA 3AHSA 1QVG2 1RNTA 1KWIA 3BU4A 4KZ1A 4XBYA 2OTJ3 1VQ53 3MPHA 2M7OA 1SARA 4LYLB 1L5GB 1A67A 2F99A 4I4KA 4WWUC 3S5CA 3NQYA 4BTWA 6RNTA 1YHQ3 1BAOA 1UCKA 2UUGC 3LH4A 3LYGA 3HZPA 3AMOB 1EQKA 3B4OA 1DVDA 1STDA 1UI8A 2K3DA 1G0TA 5G1KA 3T0UA 2KAAA 5M1AA 3I553 2FNQA 2QA43 4RNZA 1OHOA 2W2CA 2GBXB 3M8CA 4HM2B 3S67A 1CYUA 1CH0A 1GD3A 3KIIA 7GSPA 1RKYA 3K7CA 3H51A 1JZDA 1N5PA 1WMNA 3CC73 2YFLB 2CKFB 3SOAA 4XB5A 2XRXB 3WHOA 2F5WA 1IV7A 3OXAA 5CF1A 2GEYA 1W01A 2HMKB 1E97A 3B4PA 5DREA 1OCVA 1OGXA 5IEPA 3EQQB 2XGLA 4BU4A 2C4BA 3NV0B 4FCJA 1RDSA 4N3VA 3OW22 3LT8A 1YIJ3 3JVCA 1JZOA 3CCS3 2CFGA 4MEIA 1T5YA 1V58A 1UCLA 1YNVX 2ZA4A 4H61A 4IIAA 4OVMA 3ROBA 3G713 3PGBA 4FMBA 1IVWA 2WOFA 3SVAA 3WMDA 2RSXA 3CCM3 3WA2X 3WOFB 1RJOA 2E2VA 1D6ZA 3BLZA 2WGQA 2IYJA 3HIGA 3D3LA 4WFOA 3ALAA 3EBYA 1N8QA 4JF8A 3FZWA 4N6V0 2CK3H 5G2GA 1Q7HA 2E2UA 4BTXA 1EEJA 3F8HA 4HM0B 2D1WA 1I0XA 1X1WA 2SARA 1TIJA 4O2HA 3WDGB 1LRAA 1I70A 4BIRA 2W04A 2CFDA 2B1XB 2GU1A 5AI1A 1MWUA 2XFTA 2HMNB 2RFRA 4J8TA 5BU4A 2K54A 2H0GA 3JUOA 1IQ8A 1BSDA 3RGAA 3VSYA 5ELUA 1BGSA 3WOEB 3J7Yd 1VQQA 1STFI 3CCL3 1W6YA 1OF5A 1B2XA 2BIRA 1AV4A 1IQXA 2WOHA 2INXA 2P09A 1YIT3 1IK3A 5IW9A 3EC9A 4HYZA 3ER7A 5M19A 2RCDA 3SXXA 1RNBA 3CU3A 1BNFA 3TDGA 1TP6A 4KT3B 1YVSA 3QK9A 4H3UA 1RN7A 3F40A 3PS8A 3S27A 1NU3A 4N6UA 3X3XA 3I563 3KE7A 4IPBA 3ECFA 4EV5A 3G16A 1TUHA 3NBJA 3LTAA 1WMOA 1MGRA 2XSOB 3G8ZA 4XBTA 2STDA 3F7SA 1CEWI 2F5MA 3FG1A 2O9UX 3SOYA 1JBTA 3X41A 1BSBA 1MWRA 1T2HA 2K0MA 2XGNA 5AEUB 4L8PA 1JBSA 4FMCA 4FMAA 3OV4A 4TX4A 3EN1B 2W6JH 1BNEA 1Q42A 1U5OA 2BHMA 5CXOA 5LC6A 2FGTA 2ML5A 1BNRA 1JB2A 2C10A 4FCZA 2FXTA 1UDII 2PZVA 3KFQC 2I9WA 5JBSA 1OF5B 3IPTA 1TTOA 2GXFA 3UB1A 3JUQA 3FG3A 1HZ1A 3DM8A 4EW5A 1PY3A 1IU7A 1N9EA 2OOVC 4ZM8A 2CHCA 3WA3A 3MG1A 3UL6A 4XDWA 1IV9A 4MMZB 1LOVA 8CHOA 3DGOA 4BL2A 4O8SA 5EQLA 3DGNA 4ORLA 1GD4A 3MKIA 1MGWA 1JRQA 1VQN3 4K1VA 3A76A 4X2HA 5HGRA 1M1K4 2Z77A 1DMMA 1EA2A 3CCJ3 1EKMA 5BXQA 3T8UA 1GMRA 4NPBA 2IA7A 3LMLA 3GRDA 4R4KA 4GB5A 1WQLB 1FUWA 1ROVA 1TJDA 1TFKA 3N54B 1RN4A 2RGQA 1J2BA 1IT8A 3S28A 1W6CA 3MG3A 2HMOB 1VQ83 1RSNA 3HOHA 2R4IA 3EF8A 1VZZA 3G4S3 1X1UA 5AYSC 1X1XA 7RNTA 2HMJB 3X42A 2BNGA 3D5IA 3N8BA 1G96A 1JJ22 1UI7A 3LTBA 1JBRA 1QMAA 1OUNA 4ILFA 4KVHA 5IG4A 1DVCA 3NXJA 3PCRA 3VF1A 7STDA 4O3VA 2CFLA 5JPUA 1BVIA 1JKGA 1T2IA 4DKIA 1C54A 5BIRA 1QAKA 3K5TA 5AIHA 1FGTA 1KQS2 1W4NA 3RDEA 3CCV3 1RGGA 2QIYA 3BB9A 3GZYB 2GEXA 2KXGA 3K9MC 4CJNA 1TRPA 3GZRA 5KP3A 1BRGA 1ZO2A 4JRFA 3STDA 1I3IA 1RCLA 1RTUA 3V99A 5I97A 3CC23 1W6GA 1A2VA 4HZBB 4R9LA 2RBIA 3HIIA 2XSHB 3KKGA 5IERA 4MJDA 5BVBA 1UUVB 1BNGA 1GOUA 4HM4B 1EG9B 1RRLA 2CWTA 3L0RA 3ZFZA 1YJW3 1K9M4 1US1A 2GBWB 2W03A 4HM6B 1FW7A 3LXUX 3ZG5A 1UGIA 1B2SA 2LYXA 1SIIA 1UUGB 5CK6A 1AY7A 1JV2B 1DMQA 2A15A 1B2UA 3BNDA 4HKVB 5EEOA 1WTHA 1GS3A 1E3VA 1CQSA 1BNIA 2UX0A 3EN8A 1FYSA 2O3OA 3LTCA 3HI7A 5HOHA 4WYKA 3AGNA 2B24B 2BMQB 3U1WA 5JPPA 1NB3I 3DGLA 3V98A 3Q2PA 1BRSA 2XFSA 1MWSA 4OUQA 1M1XB 2CC3A 4N6MA 1GMQA 4XBXA 1OPYA 1IVXA 3NBBA 1ISKA 1LNIA 3S29A 5GSPA 1SJWA 2CFKA 3SYUA 5DRVA 2IMJA 2BMRB 3Q90A 2P0MA 1BRIA 1KD14 4R80A 3KSED 3DUKA 3OWYA 2OTL3 1I3FA 1FZUA 1KSIA 3D79A 1Q7Y4 1BRJA 4J9AA 2BMOB 5IEOA 5G1LA 2Z6BA 1U8CB 1HYFA 1MWTA 1BRKA 1S5AA 2HMLB 3GWRA 5KP4A 2OCTA 1W00A 1EUIC 4RBNA 3CCR3 1ZS7A 4HM7B 3OX9A 1I2GA 1YI23 1DETA 4HVNA 1YVBI 2OQEA 3MSOA 1DMNA 1UW1A 2IUJA 1RMSA 2YX9A 3BIRA 3FH1A 4HM5B 3BNEA 1YJ93 1K8A4 1FUSA 4N6NB 3GAXA 1BU4A 4RZMA 5D81A 2L1SA 3NUVA 1RCKA 1YJN3 3E99A 4QWTA 4LMIA 3D4AA 3DZLA 1GMPA 4J5GA 5EVHA 5LC7A 1YGWA 5AEWB 3CMA3 3V92A 1N5HA 1V74A 1FGMA 2W0QA 1WMPA 2QGUA 4I5QA 1O7HB 1RRHA 3U97A 2H0HA 2GSPA 4GL6A 1TU5A 3SX1A 2Z7AA 1FGRA 2F4YA 1PU4A 1B27A 1Y4KA 4EV2A 3EB8A 3KCHA 3RGRA 1WNHA 1M9GA 2XF3A 4FCMA 3MYTA 1GYBA 3MWZA 1BSAA 1K734 3UNLA 3FF0A 1VQ73 4KFEA 4CPKA 3I0YA 2CWUA 2MC8A 3CPOA 3KZTA 3ZG0A 5IG3A 1OH0A 2KCDA 1BRNL 3EBTA 5IG0A 1N8R4 2ZL8A 3GSPA 2W9PA 5TGNA 3SEDA 1A2PA 2P38A 3PYJA 2XH9A 1CYVA 1FGOA 3AHWA 1W02A 4CCVA 1IYYA 1FGQA 1BNJA 2F86B 1M904 2PNCA 3HX8A 5AIGA 1B21A 1O7GB 2SBLA 2R41A 1K28A 4LZIA 1RGEA 3X3YA 4N6TA 4X2OA 5IG5A 1I2FA 2UGIA 3FGYA 4AKYA 2AADA 2ZDJA 3EJVA 3IMAB 1BOXA 5D83A 3IJEB 2AAEA 3CCQ3 4FMDA 2Z76A 1BRHA 1R4CA 4KFFA 1TFOA 3DH2A 3CME3 1NWWA 2KRTA 3FCSB 3WR2A 4HBRA 3VGNA 2W56A 3DMCA 5AIFA 1ASKA 2W9QA 1YGEA 4G1MB 5RNTA 3CCE3 2WO0A 3N9HA 1MNLA 1R4YA 2JQ5A 2F98A 3NV0A 1QVF2 1ULJB 3FF2A 1LNHA 3DY5A 3SLUA 2GU3A 3F7XA 3X3ZA 3NM2A 1D6UA 1OGZA 1SQWA 5D82A 3BNCA 1T3BA 4EC6A 1BSCA 1LOXA 1BANA 4J5KA 3CD63 5CF2A 2F56A 1VQL3 2J8XB 1MOLA 3JUPA 3FSDA 3Q3FA 1VQ93 2ML6A 2P0XA 4EBGA 1VQK3 1BUJA 3UJMA 2RNTA 1UCIA 1X1YA 1B20A 1JN5A 2H0IA 3NHXA 3LTDA 3D9RA 5AYRB 1RN1A 1ULIB 2CG0A 2LQVA 5AIIA 1NB5I 1RGFA 3T8NA 4LEHA 6GSPA 1VQ43 1JB5A 2ZHXB 4MMYB 3H3HA 1GOVA 1VQP3 2Y73A 1OHSA 2W56B 1IQYA 1JKGB 3LZAA 1Q824 2BT3A 3EE1A 3FLJA 1BSEA 3F8XA 4HM3B 4L7KA 3NM7A 4Q53A 4OK0A 3A5EA 1OHPA 4GHOA 3URPA 4NHFA 1S723 1FA3A 4GSPA 1C7HA 1LOWA 4N6OB 1O7PB 2IY2A 2CFWA 2L4VA 3K63A 4K90B 4AEQA 1RHLA 2CW9A 1E3RA 4HOHA 1LXEA 3K0ZA 1QJGA 1ZGXA 1IVVA 1RGCA 4U13A 2C11A 4XM4A 1QALA 1Z1SA 4R1KA 4KFDA 1JN5B 1LOYA 1I0VA 1ZX2A 1Q40A 1LVNA 3EX9A 1IVUA 1FUTA 1O7NB 4WP5A 1N9JA 3GZXB 5ELJA 1OACA 4PEJA 1GY5A 1RGAA 2OWPA 1Q814 1PFPA 1W5ZA 3O8YA 1AR0A 1K41A 1JNQA 2XEPA 4WHAA 2YFJB 5CLKA 3PCSA 4WYKB 3Q1CA 3PXMA 5FGOA 1IT7A 1Q9EA 3RNTA 1LQGC 1VQM3 1BUQA 2OQEC 2KF5A 3FKAA 1RGHA 1NNVA 1VQ63 8RNTA 1AQZA 3KSPA 1I2EA 3UL5A 3B8LA 1TRQA 2BO9B 3OWUA 1B2MA 1I8VA 2V1LA 1F8NA 1SPUA 3KN4A 1DE3A 9RNTA 3F9SA 2YFIB 3MG2A 1BNSA 2BU4A 1VQO3 1LQMB 4XDVA 4MMXB 1UCJA 1SIHA 1UGHI 2MF7A 3CCU3 2KF3A 4LGQA 1AVLA 1ROAA 4BL3A 5IENA 1W2B2 1NDOB 2KF6A 4HJLB 4K1UA 6STDA 1Q864 1GOYA 2CX0A 1B3SA 4IT7A 1Q40B 5FW5A 3CNMA 4K61A 1GY7A 3NX0A 1NO3A 1V57A 3X40A 3WODG 1RGKA 4O02B 3CPW2 3LOYA 4CDLA 1DYUA 5KP1A 4L8OA 2CG1A 1A90A 5STDA 2KF4A 1O7MB 3F14A 4RNTA 2P05A 1JB4A 2D42A 2HOHA
chains in the Genus database with same CATH topology
1IDPA 3JUMA 4R9KA 2OOVA 1NJI4 1HU9A 1W7CA 4AKZA 5A0OB 4FR9A 4LSOA 4EXRA 2JDIH 3AMOA 2IUKA 4HM1B 4STDA 1D6YA 4NREA 4EYCA 5IF6A 1UUWB 3QRDA 2HMMB 3MHEA 3CXC2 1A2KA 2XR8B 3EHCA 2CIUA 3CNXA 1HKXA 3DXOA 3LT9A 3HK4A 3PZWA 4HM8B 1GY6A 3DGMA 4BTYA 3CC43 2WGOA 3FG4A 3GZBA 3G6E3 1QAFA 2Q07A 1KC84 3NQZA 1O7WB 4HZ9B 3JUNA 3G0KA 4N6LA 4RNYA 3OWSA 3BNBA 3NBRA 1AVKA 1W2ZA 2CH9A 2Y74A 3B7CA 2QEX3 2E2TA 2CWVA 1QVG2 1KWIA 4KZ1A 4XBYA 2OTJ3 1VQ53 3MPHA 2M7OA 1L5GB 1A67A 2F99A 4I4KA 4WWUC 3S5CA 3NQYA 4BTWA 1YHQ3 3LYGA 3LH4A 3HZPA 3AMOB 1EQKA 3B4OA 1DVDA 1STDA 1UI8A 3T0UA 3I553 2FNQA 2QA43 4RNZA 1OHOA 2W2CA 2GBXB 3M8CA 4HM2B 3S67A 1CYUA 1GD3A 3KIIA 1RKYA 3K7CA 3H51A 1N5PA 1WMNA 3CC73 2YFLB 2CKFB 3SOAA 4XB5A 2XRXB 5CF1A 1IV7A 3OXAA 2GEYA 1W01A 2HMKB 1E97A 3B4PA 5DREA 1OCVA 1OGXA 5IEPA 3EQQB 2XGLA 3NV0B 4FCJA 4N3VA 3OW22 3LT8A 1YIJ3 3JVCA 3CCS3 2CFGA 4MEIA 1T5YA 4H61A 4IIAA 3G713 4OVMA 3ROBA 3PGBA 4FMBA 1IVWA 2WOFA 3SVAA 3WMDA 2RSXA 3CCM3 3WA2X 3WOFB 1RJOA 2E2VA 1D6ZA 3BLZA 2WGQA 3HIGA 3D3LA 4WFOA 3ALAA 3EBYA 1N8QA 4JF8A 3FZWA 4N6V0 2CK3H 5G2GA 2E2UA 4BTXA 3F8HA 4HM0B 2D1WA 3WDGB 1TIJA 4O2HA 2W04A 2CFDA 2B1XB 2GU1A 5AI1A 2XFTA 2HMNB 2RFRA 4J8TA 2K54A 3JUOA 1IQ8A 3VSYA 3RGAA 3WOEB 5ELUA 3J7Yd 1STFI 3CCL3 1W6YA 1OF5A 1AV4A 1IQXA 2WOHA 2INXA 2P09A 1YIT3 1IK3A 5IW9A 3EC9A 4HYZA 3ER7A 2RCDA 3SXXA 3CU3A 3TDGA 1TP6A 3QK9A 4H3UA 1RN7A 3F40A 3PS8A 3S27A 1NU3A 4N6UA 3X3XA 3I563 3KE7A 4IPBA 3ECFA 4EV5A 3G16A 1TUHA 3NBJA 3LTAA 1WMOA 2XSOB 3G8ZA 4XBTA 2STDA 3F7SA 1CEWI 3FG1A 3SOYA 2O9UX 3X41A 2K0MA 2XGNA 5AEUB 4L8PA 4FMCA 4FMAA 3OV4A 4TX4A 3EN1B 2W6JH 1Q42A 1U5OA 2BHMA 5CXOA 5LC6A 2FGTA 2ML5A 1JB2A 2C10A 4FCZA 2FXTA 2PZVA 3KFQC 5JBSA 2I9WA 1OF5B 3IPTA 2GXFA 3UB1A 3JUQA 3FG3A 3DM8A 2OOVC 1IU7A 1N9EA 3WA3A 4ZM8A 2CHCA 3MG1A 3UL6A 4XDWA 1IV9A 4MMZB 8CHOA 3DGOA 4O8SA 5EQLA 3DGNA 4ORLA 1GD4A 3MKIA 1JRQA 1VQN3 4K1VA 3A76A 4X2HA 5HGRA 1M1K4 2Z77A 1DMMA 1EA2A 3CCJ3 1EKMA 5BXQA 3T8UA 2IA7A 3LMLA 3GRDA 4R4KA 4GB5A 1WQLB 1FUWA 1ROVA 3N54B 1TFKA 2RGQA 1J2BA 1IT8A 3S28A 1W6CA 3MG3A 2HMOB 1VQ83 2R4IA 3EF8A 1VZZA 3G4S3 5AYSC 2HMJB 3X42A 2BNGA 3N8BA 1G96A 1JJ22 1UI7A 3LTBA 1QMAA 1OUNA 4KVHA 5IG4A 1DVCA 3NXJA 3PCRA 3VF1A 7STDA 4O3VA 2CFLA 5JPUA 1JKGA 1QAKA 3K5TA 5AIHA 1FGTA 1KQS2 1W4NA 3RDEA 3CCV3 2QIYA 3BB9A 3GZYB 2GEXA 2KXGA 3K9MC 3GZRA 5KP3A 1ZO2A 4JRFA 3STDA 3V99A 5I97A 3CC23 1W6GA 1A2VA 4HZBB 4R9LA 3HIIA 2XSHB 3KKGA 5IERA 4MJDA 5BVBA 1UUVB 4HM4B 1EG9B 1RRLA 2CWTA 3L0RA 1YJW3 1K9M4 1US1A 2GBWB 2W03A 4HM6B 3LXUX 2LYXA 1SIIA 5CK6A 1JV2B 1DMQA 2A15A 3BNDA 4HKVB 5EEOA 1WTHA 1E3VA 1GS3A 1CQSA 3EN8A 2UX0A 3LTCA 2O3OA 3HI7A 4WYKA 2B24B 2BMQB 3U1WA 5JPPA 1NB3I 3DGLA 3V98A 3Q2PA 2XFSA 4OUQA 1M1XB 2CC3A 4N6MA 4XBXA 1OPYA 1IVXA 3NBBA 1ISKA 3S29A 1SJWA 2CFKA 5DRVA 2IMJA 2BMRB 3Q90A 2P0MA 1KD14 4R80A 3KSED 3DUKA 3OWYA 2OTL3 1KSIA 1Q7Y4 4J9AA 2BMOB 5IEOA 2Z6BA 1U8CB 3GWRA 2HMLB 1S5AA 1S723 5KP4A 2OCTA 1W00A 4RBNA 3CCR3 4HM7B 3OX9A 1YI23 4HVNA 1YVBI 2OQEA 3MSOA 1DMNA 1UW1A 2IUJA 2YX9A 3FH1A 4HM5B 1YJ93 1K8A4 3BNEA 4N6NB 3GAXA 4RZMA 5D81A 3NUVA 1YJN3 3E99A 4QWTA 4LMIA 5EVHA 3DZLA 5LC7A 5AEWB 3CMA3 3V92A 1N5HA 1V74A 1FGMA 2W0QA 1WMPA 2QGUA 1O7HB 1RRHA 3U97A 4GL6A 1TU5A 3SX1A 2Z7AA 1FGRA 1PU4A 1Y4KA 4EV2A 3EB8A 3RGRA 1WNHA 1M9GA 2XF3A 4FCMA 3MYTA 1GYBA 3MWZA 1K734 3UNLA 3FF0A 1VQ73 4KFEA 3I0YA 2CWUA 2MC8A 3CPOA 3KZTA 5IG3A 1OH0A 2KCDA 3EBTA 5IG0A 1N8R4 2ZL8A 2W9PA 5TGNA 3SEDA 2P38A 3PYJA 2XH9A 1CYVA 1FGOA 1W02A 4CCVA 1FGQA 2F86B 1M904 2PNCA 3HX8A 5AIGA 1O7GB 2SBLA 3X3YA 1K28A 4LZIA 4N6TA 4X2OA 5IG5A 3FGYA 4AKYA 2ZDJA 3EJVA 3IMAB 5D83A 3IJEB 3CCQ3 4FMDA 2Z76A 1R4CA 4KFFA 1TFOA 3CME3 1NWWA 2KRTA 3FCSB 4HBRA 3VGNA 2W56A 3DMCA 5AIFA 1ASKA 2W9QA 1YGEA 4G1MB 3CCE3 2WO0A 3N9HA 1MNLA 2JQ5A 2F98A 3NV0A 1QVF2 1ULJB 3FF2A 1LNHA 3DY5A 3SLUA 2GU3A 3F7XA 3X3ZA 3NM2A 1D6UA 1OGZA 1SQWA 5D82A 3BNCA 4EC6A 1LOXA 3CD63 5CF2A 1VQL3 1MOLA 3JUPA 3FSDA 1VQ93 2ML6A 2P0XA 4EBGA 1VQK3 3UJMA 1JN5A 3NHXA 3LTDA 3D9RA 5AYRB 1ULIB 2CG0A 2LQVA 5AIIA 1NB5I 3T8NA 4LEHA 1VQ43 1JB5A 4MMYB 3H3HA 1VQP3 2Y73A 1OHSA 2W56B 1IQYA 1JKGB 3LZAA 1Q824 2BT3A 3EE1A 3FLJA 3F8XA 4HM3B 4L7KA 3NM7A 4Q53A 4OK0A 1OHPA 4NHFA 1FA3A 1C7HA 4N6OB 1O7PB 2CFWA 2L4VA 3K63A 4K90B 4AEQA 2CW9A 1E3RA 1LXEA 3K0ZA 1QJGA 1IVVA 4U13A 2C11A 4XM4A 1QALA 1Z1SA 4R1KA 4KFDA 1JN5B 1ZX2A 1Q40A 1LVNA 3EX9A 1IVUA 1O7NB 4WP5A 1N9JA 3GZXB 5ELJA 1OACA 4PEJA 1GY5A 2OWPA 1Q814 1PFPA 1W5ZA 3O8YA 1AR0A 1K41A 1JNQA 2XEPA 4WHAA 2YFJB 5CLKA 3PCSA 4WYKB 3Q1CA 3PXMA 5FGOA 1IT7A 1VQM3 1BUQA 2OQEC 3FKAA 1VQ63 3KSPA 3UL5A 3B8LA 2BO9B 3OWUA 2V1LA 1F8NA 1SPUA 3KN4A 3F9SA 2YFIB 3MG2A 1VQO3 4XDVA 4MMXB 2MF7A 1SIHA 3CCU3 4LGQA 1AVLA 1ROAA 5IENA 1W2B2 1NDOB 4HJLB 4K1UA 6STDA 1Q864 4IT7A 1Q40B 5FW5A 3CNMA 4K61A 1GY7A 3NX0A 1NO3A 3X40A 3WODG 4O02B 3CPW2 3LOYA 4CDLA 1DYUA 5KP1A 4L8OA 2CG1A 1A90A 5STDA 1O7MB 3F14A 2P05A 1JB4A 2D42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDP A;  3JUM A;  4R9K A;  4HM1 B;  4STD A;  5IF6 A;  1UUW B;  2HMM B;  3MHE A;  1A2K A;  2XR8 B;  3EHC A;  3CNX A;  3DXO A;  1HKX A;  4HM8 B;  3HK4 A;  1GY6 A;  3GZB A;  1O7W B;  4HZ9 B;  3JUN A;  3G0K A;  3OWS A;  3NBR A;  3B7C A;  4XBY A;  2F99 A;  4I4K A;  4WWU C;  3S5C A;  3LYG A;  3HZP A;  3B4O A;  1STD A;  1OHO A;  2W2C A;  2GBX B;  3M8C A;  4HM2 B;  3K7C A;  3H51 A;  2YFL B;  2CKF B;  3SOA A;  4XB5 A;  2XRX B;  5CF1 A;  3OXA A;  2GEY A;  1W01 A;  2HMK B;  1E97 A;  3B4P A;  5DRE A;  1OCV A;  1OGX A;  5IEP A;  3EQQ B;  3NV0 B;  4FCJ A;  4N3V A;  4IIA A;  4OVM A;  3ROB A;  3WMD A;  3BLZ A;  3EBY A;  3FZW A;  5G2G A;  3F8H A;  4HM0 B;  2B1X B;  5AI1 A;  2HMN B;  2RFR A;  4J8T A;  2K54 A;  3JUO A;  3VSY A;  3RGA A;  1W6Y A;  1OF5 A;  2INX A;  3EC9 A;  3ER7 A;  2RCD A;  3CU3 A;  1TP6 A;  4H3U A;  3F40 A;  1NU3 A;  3KE7 A;  3ECF A;  3G16 A;  1TUH A;  2XSO B;  3G8Z A;  4XBT A;  2STD A;  3F7S A;  3SOY A;  5AEU B;  4L8P A;  3OV4 A;  3EN1 B;  1Q42 A;  1U5O A;  5CXO A;  1JB2 A;  2PZV A;  2I9W A;  1OF5 B;  3IPT A;  2GXF A;  3JUQ A;  3DM8 A;  2CHC A;  3MG1 A;  4XDW A;  8CHO A;  4ORL A;  3MKI A;  4K1V A;  3A76 A;  4X2H A;  5HGR A;  2Z77 A;  1DMM A;  1EA2 A;  5BXQ A;  3T8U A;  3GRD A;  4GB5 A;  1WQL B;  2RGQ A;  3MG3 A;  2HMO B;  2R4I A;  3EF8 A;  1VZZ A;  2HMJ B;  2BNG A;  1QMA A;  1OUN A;  4KVH A;  5IG4 A;  3NXJ A;  7STD A;  5JPU A;  1JKG A;  5AIH A;  2QIY A;  3BB9 A;  3GZY B;  2GEX A;  3GZR A;  5KP3 A;  1ZO2 A;  3STD A;  4HZB B;  4R9L A;  2XSH B;  3KKG A;  5IER A;  4MJD A;  5BVB A;  1UUV B;  4HM4 B;  1EG9 B;  2GBW B;  4HM6 B;  5CK6 A;  1DMQ A;  2A15 A;  4HKV B;  1E3V A;  1GS3 A;  1CQS A;  3EN8 A;  2UX0 A;  4WYK A;  2B24 B;  2BMQ B;  5JPP A;  4OUQ A;  4XBX A;  1OPY A;  1ISK A;  1SJW A;  5DRV A;  2IMJ A;  2BMR B;  3Q90 A;  3DUK A;  3OWY A;  4J9A A;  2BMO B;  5IEO A;  3GWR A;  2HML B;  1S5A A;  5KP4 A;  1W00 A;  4HM7 B;  3OX9 A;  4HVN A;  3MSO A;  1DMN A;  3FH1 A;  4HM5 B;  4RZM A;  5D81 A;  3NUV A;  3E99 A;  4LMI A;  5EVH A;  3DZL A;  5AEW B;  2QGU A;  1O7H B;  2Z7A A;  3RGR A;  4FCM A;  3MYT A;  1GYB A;  3UNL A;  3FF0 A;  3I0Y A;  3CPO A;  3KZT A;  5IG3 A;  1OH0 A;  3EBT A;  5IG0 A;  5TGN A;  3SED A;  1W02 A;  2F86 B;  3HX8 A;  5AIG A;  1O7G B;  4X2O A;  5IG5 A;  3FGY A;  3EJV A;  5D83 A;  2Z76 A;  1NWW A;  3VGN A;  3DMC A;  5AIF A;  1ASK A;  2JQ5 A;  2F98 A;  3NV0 A;  1ULJ B;  3FF2 A;  3F7X A;  3NM2 A;  1OGZ A;  5D82 A;  5CF2 A;  3JUP A;  3FSD A;  3UJM A;  1JN5 A;  3NHX A;  3D9R A;  1ULI B;  5AII A;  3T8N A;  4LEH A;  1JB5 A;  3H3H A;  1OHS A;  1JKG B;  3LZA A;  3FLJ A;  3F8X A;  4HM3 B;  4L7K A;  4Q53 A;  1OHP A;  1C7H A;  1O7P B;  1E3R A;  3K0Z A;  1QJG A;  4U13 A;  4XM4 A;  1Z1S A;  4R1K A;  1JN5 B;  1ZX2 A;  1Q40 A;  3EX9 A;  1O7N B;  4WP5 A;  3GZX B;  4PEJ A;  1GY5 A;  2OWP A;  1AR0 A;  1K41 A;  2YFJ B;  5CLK A;  4WYK B;  1BUQ A;  3FKA A;  3KSP A;  3B8L A;  3OWU A;  3F9S A;  2YFI B;  3MG2 A;  4XDV A;  4LGQ A;  5IEN A;  1NDO B;  4HJL B;  4K1U A;  6STD A;  5FW5 A;  1Q40 B;  3CNM A;  1GY7 A;  4CDL A;  5KP1 A;  4L8O A;  5STD A;  1O7M B;  3F14 A;  1JB4 A; 
#chains in the Genus database with same CATH topology
 3DGY A;  1IDP A;  3JUM A;  4R9K A;  2OOV A;  1NJI 4;  1HU9 A;  1W7C A;  4AKZ A;  5A0O B;  4FR9 A;  1G02 A;  3AGO A;  2JDI H;  4LSO A;  3AMO A;  4HAA A;  4EXR A;  2IUK A;  4HM1 B;  4STD A;  1D6Y A;  1RGL A;  4NRE A;  4EYC A;  5IF6 A;  1UUW B;  3QRD A;  5M18 A;  2HMM B;  3MHE A;  3D5G A;  3CXC 2;  1B2Z A;  1A2K A;  2XR8 B;  3EHC A;  2CIU A;  3CNX A;  1HKX A;  3DXO A;  3LT9 A;  1BIR A;  3HK4 A;  3PZW A;  4HM8 B;  1GY6 A;  3DGM A;  4BTY A;  3CC4 3;  1RLS A;  2WGO A;  3FG4 A;  3GZB A;  3G6E 3;  1QAF A;  2Q07 A;  1KC8 4;  1PYL A;  1GSP A;  1O7W B;  3NQZ A;  3JUN A;  4HZ9 B;  3G0K A;  4N6L A;  4RNY A;  3OWS A;  3BNB A;  3NBR A;  2CX1 A;  1AVK A;  1W2Z A;  2CH9 A;  2Y74 A;  3B7C A;  2QEX 3;  2E2T A;  2CWV A;  3AHS A;  1QVG 2;  1RNT A;  1KWI A;  3BU4 A;  4KZ1 A;  4XBY A;  2OTJ 3;  1VQ5 3;  3MPH A;  2M7O A;  1SAR A;  4LYL B;  1L5G B;  1A67 A;  2F99 A;  4I4K A;  4WWU C;  3S5C A;  3NQY A;  4BTW A;  6RNT A;  1YHQ 3;  1BAO A;  1UCK A;  2UUG C;  3LH4 A;  3LYG A;  3HZP A;  3AMO B;  1EQK A;  3B4O A;  1DVD A;  1STD A;  1UI8 A;  2K3D A;  1G0T A;  5G1K A;  3T0U A;  2KAA A;  5M1A A;  3I55 3;  2FNQ A;  2QA4 3;  4RNZ A;  1OHO A;  2W2C A;  2GBX B;  3M8C A;  4HM2 B;  3S67 A;  1CYU A;  1CH0 A;  1GD3 A;  3KII A;  7GSP A;  1RKY A;  3K7C A;  3H51 A;  1JZD A;  1N5P A;  1WMN A;  3CC7 3;  2YFL B;  2CKF B;  3SOA A;  4XB5 A;  2XRX B;  3WHO A;  2F5W A;  1IV7 A;  3OXA A;  5CF1 A;  2GEY A;  1W01 A;  2HMK B;  1E97 A;  3B4P A;  5DRE A;  1OCV A;  1OGX A;  5IEP A;  3EQQ B;  2XGL A;  4BU4 A;  2C4B A;  3NV0 B;  4FCJ A;  1RDS A;  4N3V A;  3OW2 2;  3LT8 A;  1YIJ 3;  3JVC A;  1JZO A;  3CCS 3;  2CFG A;  4MEI A;  1T5Y A;  1V58 A;  1UCL A;  1YNV X;  2ZA4 A;  4H61 A;  4IIA A;  4OVM A;  3ROB A;  3G71 3;  3PGB A;  4FMB A;  1IVW A;  2WOF A;  3SVA A;  3WMD A;  2RSX A;  3CCM 3;  3WA2 X;  3WOF B;  1RJO A;  2E2V A;  1D6Z A;  3BLZ A;  2WGQ A;  2IYJ A;  3HIG A;  3D3L A;  4WFO A;  3ALA A;  3EBY A;  1N8Q A;  4JF8 A;  3FZW A;  4N6V 0;  2CK3 H;  5G2G A;  1Q7H A;  2E2U A;  4BTX A;  1EEJ A;  3F8H A;  4HM0 B;  2D1W A;  1I0X A;  1X1W A;  2SAR A;  1TIJ A;  4O2H A;  3WDG B;  1LRA A;  1I70 A;  4BIR A;  2W04 A;  2CFD A;  2B1X B;  2GU1 A;  5AI1 A;  1MWU A;  2XFT A;  2HMN B;  2RFR A;  4J8T A;  5BU4 A;  2K54 A;  2H0G A;  3JUO A;  1IQ8 A;  1BSD A;  3RGA A;  3VSY A;  5ELU A;  1BGS A;  3WOE B;  3J7Y d;  1VQQ A;  1STF I;  3CCL 3;  1W6Y A;  1OF5 A;  1B2X A;  2BIR A;  1AV4 A;  1IQX A;  2WOH A;  2INX A;  2P09 A;  1YIT 3;  1IK3 A;  5IW9 A;  3EC9 A;  4HYZ A;  3ER7 A;  5M19 A;  2RCD A;  3SXX A;  1RNB A;  3CU3 A;  1BNF A;  3TDG A;  1TP6 A;  4KT3 B;  1YVS A;  3QK9 A;  4H3U A;  1RN7 A;  3F40 A;  3PS8 A;  3S27 A;  1NU3 A;  4N6U A;  3X3X A;  3I56 3;  3KE7 A;  4IPB A;  3ECF A;  4EV5 A;  3G16 A;  1TUH A;  3NBJ A;  3LTA A;  1WMO A;  1MGR A;  2XSO B;  3G8Z A;  4XBT A;  2STD A;  3F7S A;  1CEW I;  2F5M A;  3FG1 A;  2O9U X;  3SOY A;  1JBT A;  3X41 A;  1BSB A;  1MWR A;  1T2H A;  2K0M A;  2XGN A;  5AEU B;  4L8P A;  1JBS A;  4FMC A;  4FMA A;  3OV4 A;  4TX4 A;  3EN1 B;  2W6J H;  1BNE A;  1Q42 A;  1U5O A;  2BHM A;  5CXO A;  5LC6 A;  2FGT A;  2ML5 A;  1BNR A;  1JB2 A;  2C10 A;  4FCZ A;  2FXT A;  1UDI I;  2PZV A;  3KFQ C;  2I9W A;  5JBS A;  1OF5 B;  3IPT A;  1TTO A;  2GXF A;  3UB1 A;  3JUQ A;  3FG3 A;  1HZ1 A;  3DM8 A;  4EW5 A;  1PY3 A;  1IU7 A;  1N9E A;  2OOV C;  4ZM8 A;  2CHC A;  3WA3 A;  3MG1 A;  3UL6 A;  4XDW A;  1IV9 A;  4MMZ B;  1LOV A;  8CHO A;  3DGO A;  4BL2 A;  4O8S A;  5EQL A;  3DGN A;  4ORL A;  1GD4 A;  3MKI A;  1MGW A;  1JRQ A;  1VQN 3;  4K1V A;  3A76 A;  4X2H A;  5HGR A;  1M1K 4;  2Z77 A;  1DMM A;  1EA2 A;  3CCJ 3;  1EKM A;  5BXQ A;  3T8U A;  1GMR A;  4NPB A;  2IA7 A;  3LML A;  3GRD A;  4R4K A;  4GB5 A;  1WQL B;  1FUW A;  1ROV A;  1TJD A;  1TFK A;  3N54 B;  1RN4 A;  2RGQ A;  1J2B A;  1IT8 A;  3S28 A;  1W6C A;  3MG3 A;  2HMO B;  1VQ8 3;  1RSN A;  3HOH A;  2R4I A;  3EF8 A;  1VZZ A;  3G4S 3;  1X1U A;  5AYS C;  1X1X A;  7RNT A;  2HMJ B;  3X42 A;  2BNG A;  3D5I A;  3N8B A;  1G96 A;  1JJ2 2;  1UI7 A;  3LTB A;  1JBR A;  1QMA A;  1OUN A;  4ILF A;  4KVH A;  5IG4 A;  1DVC A;  3NXJ A;  3PCR A;  3VF1 A;  7STD A;  4O3V A;  2CFL A;  5JPU A;  1BVI A;  1JKG A;  1T2I A;  4DKI A;  1C54 A;  5BIR A;  1QAK A;  3K5T A;  5AIH A;  1FGT A;  1KQS 2;  1W4N A;  3RDE A;  3CCV 3;  1RGG A;  2QIY A;  3BB9 A;  3GZY B;  2GEX A;  2KXG A;  3K9M C;  4CJN A;  1TRP A;  3GZR A;  5KP3 A;  1BRG A;  1ZO2 A;  4JRF A;  3STD A;  1I3I A;  1RCL A;  1RTU A;  3V99 A;  5I97 A;  3CC2 3;  1W6G A;  1A2V A;  4HZB B;  4R9L A;  2RBI A;  3HII A;  2XSH B;  3KKG A;  5IER A;  4MJD A;  5BVB A;  1UUV B;  1BNG A;  1GOU A;  4HM4 B;  1EG9 B;  1RRL A;  2CWT A;  3L0R A;  3ZFZ A;  1YJW 3;  1K9M 4;  1US1 A;  2GBW B;  2W03 A;  4HM6 B;  1FW7 A;  3LXU X;  3ZG5 A;  1UGI A;  1B2S A;  2LYX A;  1SII A;  1UUG B;  5CK6 A;  1AY7 A;  1JV2 B;  1DMQ A;  2A15 A;  1B2U A;  3BND A;  4HKV B;  5EEO A;  1WTH A;  1GS3 A;  1E3V A;  1CQS A;  1BNI A;  2UX0 A;  3EN8 A;  1FYS A;  2O3O A;  3LTC A;  3HI7 A;  5HOH A;  4WYK A;  3AGN A;  2B24 B;  2BMQ B;  3U1W A;  5JPP A;  1NB3 I;  3DGL A;  3V98 A;  3Q2P A;  1BRS A;  2XFS A;  1MWS A;  4OUQ A;  1M1X B;  2CC3 A;  4N6M A;  1GMQ A;  4XBX A;  1OPY A;  1IVX A;  3NBB A;  1ISK A;  1LNI A;  3S29 A;  5GSP A;  1SJW A;  2CFK A;  3SYU A;  5DRV A;  2IMJ A;  2BMR B;  3Q90 A;  2P0M A;  1BRI A;  1KD1 4;  4R80 A;  3KSE D;  3DUK A;  3OWY A;  2OTL 3;  1I3F A;  1FZU A;  1KSI A;  3D79 A;  1Q7Y 4;  1BRJ A;  4J9A A;  2BMO B;  5IEO A;  5G1L A;  2Z6B A;  1U8C B;  1HYF A;  1MWT A;  1BRK A;  1S5A A;  2HML B;  3GWR A;  5KP4 A;  2OCT A;  1W00 A;  1EUI C;  4RBN A;  3CCR 3;  1ZS7 A;  4HM7 B;  3OX9 A;  1I2G A;  1YI2 3;  1DET A;  4HVN A;  1YVB I;  2OQE A;  3MSO A;  1DMN A;  1UW1 A;  2IUJ A;  1RMS A;  2YX9 A;  3BIR A;  3FH1 A;  4HM5 B;  3BNE A;  1YJ9 3;  1K8A 4;  1FUS A;  4N6N B;  3GAX A;  1BU4 A;  4RZM A;  5D81 A;  2L1S A;  3NUV A;  1RCK A;  1YJN 3;  3E99 A;  4QWT A;  4LMI A;  3D4A A;  3DZL A;  1GMP A;  4J5G A;  5EVH A;  5LC7 A;  1YGW A;  5AEW B;  3CMA 3;  3V92 A;  1N5H A;  1V74 A;  1FGM A;  2W0Q A;  1WMP A;  2QGU A;  4I5Q A;  1O7H B;  1RRH A;  3U97 A;  2H0H A;  2GSP A;  4GL6 A;  1TU5 A;  3SX1 A;  2Z7A A;  1FGR A;  2F4Y A;  1PU4 A;  1B27 A;  1Y4K A;  4EV2 A;  3EB8 A;  3KCH A;  3RGR A;  1WNH A;  1M9G A;  2XF3 A;  4FCM A;  3MYT A;  1GYB A;  3MWZ A;  1BSA A;  1K73 4;  3UNL A;  3FF0 A;  1VQ7 3;  4KFE A;  4CPK A;  3I0Y A;  2CWU A;  2MC8 A;  3CPO A;  3KZT A;  3ZG0 A;  5IG3 A;  1OH0 A;  2KCD A;  1BRN L;  3EBT A;  5IG0 A;  1N8R 4;  2ZL8 A;  3GSP A;  2W9P A;  5TGN A;  3SED A;  1A2P A;  2P38 A;  3PYJ A;  2XH9 A;  1CYV A;  1FGO A;  3AHW A;  1W02 A;  4CCV A;  1IYY A;  1FGQ A;  1BNJ A;  2F86 B;  1M90 4;  2PNC A;  3HX8 A;  5AIG A;  1B21 A;  1O7G B;  2SBL A;  2R41 A;  1K28 A;  4LZI A;  1RGE A;  3X3Y A;  4N6T A;  4X2O A;  5IG5 A;  1I2F A;  2UGI A;  3FGY A;  4AKY A;  2AAD A;  2ZDJ A;  3EJV A;  3IMA B;  1BOX A;  5D83 A;  3IJE B;  2AAE A;  3CCQ 3;  4FMD A;  2Z76 A;  1BRH A;  1R4C A;  4KFF A;  1TFO A;  3DH2 A;  3CME 3;  1NWW A;  2KRT A;  3FCS B;  3WR2 A;  4HBR A;  3VGN A;  2W56 A;  3DMC A;  5AIF A;  1ASK A;  2W9Q A;  1YGE A;  4G1M B;  5RNT A;  3CCE 3;  2WO0 A;  3N9H A;  1MNL A;  1R4Y A;  2JQ5 A;  2F98 A;  3NV0 A;  1QVF 2;  1ULJ B;  3FF2 A;  1LNH A;  3DY5 A;  3SLU A;  2GU3 A;  3F7X A;  3X3Z A;  3NM2 A;  1D6U A;  1OGZ A;  1SQW A;  5D82 A;  3BNC A;  1T3B A;  4EC6 A;  1BSC A;  1LOX A;  1BAN A;  4J5K A;  3CD6 3;  5CF2 A;  2F56 A;  1VQL 3;  2J8X B;  1MOL A;  3JUP A;  3FSD A;  3Q3F A;  1VQ9 3;  2ML6 A;  2P0X A;  4EBG A;  1VQK 3;  1BUJ A;  3UJM A;  2RNT A;  1UCI A;  1X1Y A;  1B20 A;  1JN5 A;  2H0I A;  3NHX A;  3LTD A;  3D9R A;  5AYR B;  1RN1 A;  1ULI B;  2CG0 A;  2LQV A;  5AII A;  1NB5 I;  1RGF A;  3T8N A;  4LEH A;  6GSP A;  1VQ4 3;  1JB5 A;  2ZHX B;  4MMY B;  3H3H A;  1GOV A;  1VQP 3;  2Y73 A;  1OHS A;  2W56 B;  1IQY A;  1JKG B;  3LZA A;  1Q82 4;  2BT3 A;  3EE1 A;  3FLJ A;  1BSE A;  3F8X A;  4HM3 B;  4L7K A;  3NM7 A;  4Q53 A;  4OK0 A;  3A5E A;  1OHP A;  4GHO A;  3URP A;  4NHF A;  1S72 3;  1FA3 A;  4GSP A;  1C7H A;  1LOW A;  4N6O B;  1O7P B;  2IY2 A;  2CFW A;  2L4V A;  3K63 A;  4K90 B;  4AEQ A;  1RHL A;  2CW9 A;  1E3R A;  4HOH A;  1LXE A;  3K0Z A;  1QJG A;  1ZGX A;  1IVV A;  1RGC A;  4U13 A;  2C11 A;  4XM4 A;  1QAL A;  1Z1S A;  4R1K A;  4KFD A;  1JN5 B;  1LOY A;  1I0V A;  1ZX2 A;  1Q40 A;  1LVN A;  3EX9 A;  1IVU A;  1FUT A;  1O7N B;  4WP5 A;  1N9J A;  3GZX B;  5ELJ A;  1OAC A;  4PEJ A;  1GY5 A;  1RGA A;  2OWP A;  1Q81 4;  1PFP A;  1W5Z A;  3O8Y A;  1AR0 A;  1K41 A;  1JNQ A;  2XEP A;  4WHA A;  2YFJ B;  5CLK A;  3PCS A;  4WYK B;  3Q1C A;  3PXM A;  5FGO A;  1IT7 A;  1Q9E A;  3RNT A;  1LQG C;  1VQM 3;  1BUQ A;  2OQE C;  2KF5 A;  3FKA A;  1RGH A;  1NNV A;  1VQ6 3;  8RNT A;  1AQZ A;  3KSP A;  1I2E A;  3UL5 A;  3B8L A;  1TRQ A;  2BO9 B;  3OWU A;  1B2M A;  1I8V A;  2V1L A;  1F8N A;  1SPU A;  3KN4 A;  1DE3 A;  9RNT A;  3F9S A;  2YFI B;  3MG2 A;  1BNS A;  2BU4 A;  1VQO 3;  1LQM B;  4XDV A;  4MMX B;  1UCJ A;  1SIH A;  1UGH I;  2MF7 A;  3CCU 3;  2KF3 A;  4LGQ A;  1AVL A;  1ROA A;  4BL3 A;  5IEN A;  1W2B 2;  1NDO B;  2KF6 A;  4HJL B;  4K1U A;  6STD A;  1Q86 4;  1GOY A;  2CX0 A;  1B3S A;  4IT7 A;  1Q40 B;  5FW5 A;  3CNM A;  4K61 A;  1GY7 A;  3NX0 A;  1NO3 A;  1V57 A;  3X40 A;  3WOD G;  1RGK A;  4O02 B;  3CPW 2;  3LOY A;  4CDL A;  1DYU A;  5KP1 A;  4L8O A;  2CG1 A;  1A90 A;  5STD A;  2KF4 A;  1O7M B;  3F14 A;  4RNT A;  2P05 A;  1JB4 A;  2D42 A;  2HOH A; 
#chains in the Genus database with same CATH homology
 1IDP A;  3JUM A;  4R9K A;  2OOV A;  1NJI 4;  1HU9 A;  1W7C A;  4AKZ A;  5A0O B;  4FR9 A;  4LSO A;  4EXR A;  2JDI H;  3AMO A;  2IUK A;  4HM1 B;  4STD A;  1D6Y A;  4NRE A;  4EYC A;  5IF6 A;  1UUW B;  3QRD A;  2HMM B;  3MHE A;  3CXC 2;  1A2K A;  2XR8 B;  3EHC A;  2CIU A;  3CNX A;  1HKX A;  3DXO A;  3LT9 A;  3HK4 A;  3PZW A;  4HM8 B;  1GY6 A;  3DGM A;  4BTY A;  3CC4 3;  2WGO A;  3FG4 A;  3GZB A;  3G6E 3;  1QAF A;  2Q07 A;  1KC8 4;  3NQZ A;  1O7W B;  4HZ9 B;  3JUN A;  3G0K A;  4N6L A;  4RNY A;  3OWS A;  3BNB A;  3NBR A;  1AVK A;  1W2Z A;  2CH9 A;  2Y74 A;  3B7C A;  2QEX 3;  2E2T A;  2CWV A;  1QVG 2;  1KWI A;  4KZ1 A;  4XBY A;  2OTJ 3;  1VQ5 3;  3MPH A;  2M7O A;  1L5G B;  1A67 A;  2F99 A;  4I4K A;  4WWU C;  3S5C A;  3NQY A;  4BTW A;  1YHQ 3;  3LYG A;  3LH4 A;  3HZP A;  3AMO B;  1EQK A;  3B4O A;  1DVD A;  1STD A;  1UI8 A;  3T0U A;  3I55 3;  2FNQ A;  2QA4 3;  4RNZ A;  1OHO A;  2W2C A;  2GBX B;  3M8C A;  4HM2 B;  3S67 A;  1CYU A;  1GD3 A;  3KII A;  1RKY A;  3K7C A;  3H51 A;  1N5P A;  1WMN A;  3CC7 3;  2YFL B;  2CKF B;  3SOA A;  4XB5 A;  2XRX B;  5CF1 A;  1IV7 A;  3OXA A;  2GEY A;  1W01 A;  2HMK B;  1E97 A;  3B4P A;  5DRE A;  1OCV A;  1OGX A;  5IEP A;  3EQQ B;  2XGL A;  3NV0 B;  4FCJ A;  4N3V A;  3OW2 2;  3LT8 A;  1YIJ 3;  3JVC A;  3CCS 3;  2CFG A;  4MEI A;  1T5Y A;  4H61 A;  4IIA A;  3G71 3;  4OVM A;  3ROB A;  3PGB A;  4FMB A;  1IVW A;  2WOF A;  3SVA A;  3WMD A;  2RSX A;  3CCM 3;  3WA2 X;  3WOF B;  1RJO A;  2E2V A;  1D6Z A;  3BLZ A;  2WGQ A;  3HIG A;  3D3L A;  4WFO A;  3ALA A;  3EBY A;  1N8Q A;  4JF8 A;  3FZW A;  4N6V 0;  2CK3 H;  5G2G A;  2E2U A;  4BTX A;  3F8H A;  4HM0 B;  2D1W A;  3WDG B;  1TIJ A;  4O2H A;  2W04 A;  2CFD A;  2B1X B;  2GU1 A;  5AI1 A;  2XFT A;  2HMN B;  2RFR A;  4J8T A;  2K54 A;  3JUO A;  1IQ8 A;  3VSY A;  3RGA A;  3WOE B;  5ELU A;  3J7Y d;  1STF I;  3CCL 3;  1W6Y A;  1OF5 A;  1AV4 A;  1IQX A;  2WOH A;  2INX A;  2P09 A;  1YIT 3;  1IK3 A;  5IW9 A;  3EC9 A;  4HYZ A;  3ER7 A;  2RCD A;  3SXX A;  3CU3 A;  3TDG A;  1TP6 A;  3QK9 A;  4H3U A;  1RN7 A;  3F40 A;  3PS8 A;  3S27 A;  1NU3 A;  4N6U A;  3X3X A;  3I56 3;  3KE7 A;  4IPB A;  3ECF A;  4EV5 A;  3G16 A;  1TUH A;  3NBJ A;  3LTA A;  1WMO A;  2XSO B;  3G8Z A;  4XBT A;  2STD A;  3F7S A;  1CEW I;  3FG1 A;  3SOY A;  2O9U X;  3X41 A;  2K0M A;  2XGN A;  5AEU B;  4L8P A;  4FMC A;  4FMA A;  3OV4 A;  4TX4 A;  3EN1 B;  2W6J H;  1Q42 A;  1U5O A;  2BHM A;  5CXO A;  5LC6 A;  2FGT A;  2ML5 A;  1JB2 A;  2C10 A;  4FCZ A;  2FXT A;  2PZV A;  3KFQ C;  5JBS A;  2I9W A;  1OF5 B;  3IPT A;  2GXF A;  3UB1 A;  3JUQ A;  3FG3 A;  3DM8 A;  2OOV C;  1IU7 A;  1N9E A;  3WA3 A;  4ZM8 A;  2CHC A;  3MG1 A;  3UL6 A;  4XDW A;  1IV9 A;  4MMZ B;  8CHO A;  3DGO A;  4O8S A;  5EQL A;  3DGN A;  4ORL A;  1GD4 A;  3MKI A;  1JRQ A;  1VQN 3;  4K1V A;  3A76 A;  4X2H A;  5HGR A;  1M1K 4;  2Z77 A;  1DMM A;  1EA2 A;  3CCJ 3;  1EKM A;  5BXQ A;  3T8U A;  2IA7 A;  3LML A;  3GRD A;  4R4K A;  4GB5 A;  1WQL B;  1FUW A;  1ROV A;  3N54 B;  1TFK A;  2RGQ A;  1J2B A;  1IT8 A;  3S28 A;  1W6C A;  3MG3 A;  2HMO B;  1VQ8 3;  2R4I A;  3EF8 A;  1VZZ A;  3G4S 3;  5AYS C;  2HMJ B;  3X42 A;  2BNG A;  3N8B A;  1G96 A;  1JJ2 2;  1UI7 A;  3LTB A;  1QMA A;  1OUN A;  4KVH A;  5IG4 A;  1DVC A;  3NXJ A;  3PCR A;  3VF1 A;  7STD A;  4O3V A;  2CFL A;  5JPU A;  1JKG A;  1QAK A;  3K5T A;  5AIH A;  1FGT A;  1KQS 2;  1W4N A;  3RDE A;  3CCV 3;  2QIY A;  3BB9 A;  3GZY B;  2GEX A;  2KXG A;  3K9M C;  3GZR A;  5KP3 A;  1ZO2 A;  4JRF A;  3STD A;  3V99 A;  5I97 A;  3CC2 3;  1W6G A;  1A2V A;  4HZB B;  4R9L A;  3HII A;  2XSH B;  3KKG A;  5IER A;  4MJD A;  5BVB A;  1UUV B;  4HM4 B;  1EG9 B;  1RRL A;  2CWT A;  3L0R A;  1YJW 3;  1K9M 4;  1US1 A;  2GBW B;  2W03 A;  4HM6 B;  3LXU X;  2LYX A;  1SII A;  5CK6 A;  1JV2 B;  1DMQ A;  2A15 A;  3BND A;  4HKV B;  5EEO A;  1WTH A;  1E3V A;  1GS3 A;  1CQS A;  3EN8 A;  2UX0 A;  3LTC A;  2O3O A;  3HI7 A;  4WYK A;  2B24 B;  2BMQ B;  3U1W A;  5JPP A;  1NB3 I;  3DGL A;  3V98 A;  3Q2P A;  2XFS A;  4OUQ A;  1M1X B;  2CC3 A;  4N6M A;  4XBX A;  1OPY A;  1IVX A;  3NBB A;  1ISK A;  3S29 A;  1SJW A;  2CFK A;  5DRV A;  2IMJ A;  2BMR B;  3Q90 A;  2P0M A;  1KD1 4;  4R80 A;  3KSE D;  3DUK A;  3OWY A;  2OTL 3;  1KSI A;  1Q7Y 4;  4J9A A;  2BMO B;  5IEO A;  2Z6B A;  1U8C B;  3GWR A;  2HML B;  1S5A A;  1S72 3;  5KP4 A;  2OCT A;  1W00 A;  4RBN A;  3CCR 3;  4HM7 B;  3OX9 A;  1YI2 3;  4HVN A;  1YVB I;  2OQE A;  3MSO A;  1DMN A;  1UW1 A;  2IUJ A;  2YX9 A;  3FH1 A;  4HM5 B;  1YJ9 3;  1K8A 4;  3BNE A;  4N6N B;  3GAX A;  4RZM A;  5D81 A;  3NUV A;  1YJN 3;  3E99 A;  4QWT A;  4LMI A;  5EVH A;  3DZL A;  5LC7 A;  5AEW B;  3CMA 3;  3V92 A;  1N5H A;  1V74 A;  1FGM A;  2W0Q A;  1WMP A;  2QGU A;  1O7H B;  1RRH A;  3U97 A;  4GL6 A;  1TU5 A;  3SX1 A;  2Z7A A;  1FGR A;  1PU4 A;  1Y4K A;  4EV2 A;  3EB8 A;  3RGR A;  1WNH A;  1M9G A;  2XF3 A;  4FCM A;  3MYT A;  1GYB A;  3MWZ A;  1K73 4;  3UNL A;  3FF0 A;  1VQ7 3;  4KFE A;  3I0Y A;  2CWU A;  2MC8 A;  3CPO A;  3KZT A;  5IG3 A;  1OH0 A;  2KCD A;  3EBT A;  5IG0 A;  1N8R 4;  2ZL8 A;  2W9P A;  5TGN A;  3SED A;  2P38 A;  3PYJ A;  2XH9 A;  1CYV A;  1FGO A;  1W02 A;  4CCV A;  1FGQ A;  2F86 B;  1M90 4;  2PNC A;  3HX8 A;  5AIG A;  1O7G B;  2SBL A;  3X3Y A;  1K28 A;  4LZI A;  4N6T A;  4X2O A;  5IG5 A;  3FGY A;  4AKY A;  2ZDJ A;  3EJV A;  3IMA B;  5D83 A;  3IJE B;  3CCQ 3;  4FMD A;  2Z76 A;  1R4C A;  4KFF A;  1TFO A;  3CME 3;  1NWW A;  2KRT A;  3FCS B;  4HBR A;  3VGN A;  2W56 A;  3DMC A;  5AIF A;  1ASK A;  2W9Q A;  1YGE A;  4G1M B;  3CCE 3;  2WO0 A;  3N9H A;  1MNL A;  2JQ5 A;  2F98 A;  3NV0 A;  1QVF 2;  1ULJ B;  3FF2 A;  1LNH A;  3DY5 A;  3SLU A;  2GU3 A;  3F7X A;  3X3Z A;  3NM2 A;  1D6U A;  1OGZ A;  1SQW A;  5D82 A;  3BNC A;  4EC6 A;  1LOX A;  3CD6 3;  5CF2 A;  1VQL 3;  1MOL A;  3JUP A;  3FSD A;  1VQ9 3;  2ML6 A;  2P0X A;  4EBG A;  1VQK 3;  3UJM A;  1JN5 A;  3NHX A;  3LTD A;  3D9R A;  5AYR B;  1ULI B;  2CG0 A;  2LQV A;  5AII A;  1NB5 I;  3T8N A;  4LEH A;  1VQ4 3;  1JB5 A;  4MMY B;  3H3H A;  1VQP 3;  2Y73 A;  1OHS A;  2W56 B;  1IQY A;  1JKG B;  3LZA A;  1Q82 4;  2BT3 A;  3EE1 A;  3FLJ A;  3F8X A;  4HM3 B;  4L7K A;  3NM7 A;  4Q53 A;  4OK0 A;  1OHP A;  4NHF A;  1FA3 A;  1C7H A;  4N6O B;  1O7P B;  2CFW A;  2L4V A;  3K63 A;  4K90 B;  4AEQ A;  2CW9 A;  1E3R A;  1LXE A;  3K0Z A;  1QJG A;  1IVV A;  4U13 A;  2C11 A;  4XM4 A;  1QAL A;  1Z1S A;  4R1K A;  4KFD A;  1JN5 B;  1ZX2 A;  1Q40 A;  1LVN A;  3EX9 A;  1IVU A;  1O7N B;  4WP5 A;  1N9J A;  3GZX B;  5ELJ A;  1OAC A;  4PEJ A;  1GY5 A;  2OWP A;  1Q81 4;  1PFP A;  1W5Z A;  3O8Y A;  1AR0 A;  1K41 A;  1JNQ A;  2XEP A;  4WHA A;  2YFJ B;  5CLK A;  3PCS A;  4WYK B;  3Q1C A;  3PXM A;  5FGO A;  1IT7 A;  1VQM 3;  1BUQ A;  2OQE C;  3FKA A;  1VQ6 3;  3KSP A;  3UL5 A;  3B8L A;  2BO9 B;  3OWU A;  2V1L A;  1F8N A;  1SPU A;  3KN4 A;  3F9S A;  2YFI B;  3MG2 A;  1VQO 3;  4XDV A;  4MMX B;  2MF7 A;  1SIH A;  3CCU 3;  4LGQ A;  1AVL A;  1ROA A;  5IEN A;  1W2B 2;  1NDO B;  4HJL B;  4K1U A;  6STD A;  1Q86 4;  4IT7 A;  1Q40 B;  5FW5 A;  3CNM A;  4K61 A;  1GY7 A;  3NX0 A;  1NO3 A;  3X40 A;  3WOD G;  4O02 B;  3CPW 2;  3LOY A;  4CDL A;  1DYU A;  5KP1 A;  4L8O A;  2CG1 A;  1A90 A;  5STD A;  1O7M B;  3F14 A;  2P05 A;  1JB4 A;  2D42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...