2F98A

Crystal structure of the polyketide cyclase aknh with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
141
structure length
141
Chain Sequence
b'RSEQIAAVRRMVEAYNTGKTDDVADYIHPEYMNPGTLEFTSLRGPELFAINVAWVKKTFSEEARLEEVGIEERADWVRARLVLYGRHVGEMVGMAPTGRLFSGEQIHLLHFVDGKIHHHRDWPDYQGTYRQLGEPWPETEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aklanonic Acid methyl Ester Cyclase, AknH
publication title Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
pubmed doi rcsb
source organism Streptomyces galilaeus
molecule tags Biosynthetic protein
total genus 45
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.23: Aklanonic acid methyl ester cyclase.
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07366 SnoaL SnoaL-like polyketide cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2f98A00
3EN8A 1GY5A 4WP5A 1Q40B 4R1KA 2F99A 1GYBA 4N3VA 3GZBA 4X2HA 2CHCA 3EJVA 5IG3A 3JUNA 1UUVB 2OWPA 1ULIB 4XDVA 3K0ZA 2BMQB 3VGNA 1OGXA 1OF5B 3F8HA 3H51A 1BUQA 3S5CA 3ER7A 2BNGA 3EX9A 4HM7B 1GY7A 4LGQA 5CK6A 4XB5A 5CF1A 2IMJA 2PZVA 3KE7A 2Z76A 4J9AA 5IENA 3DXOA 3DMCA 3DM8A 3MSOA 4PEJA 2JQ5A 4HVNA 4HM2B 3OX9A 3JUMA 1O7HB 5AIIA 4Q53A 5IG0A 5BVBA 1IDPA 3K7CA 1NDOB 2YFLB 2HMKB 1JKGB 4XM4A 4HKVB 3LZAA 2B1XB 3OWYA 3FF0A 1Q42A 2RFRA 5IG5A 5CXOA 2Z77A 5CF2A 1STDA 1NWWA 5AIHA 3DUKA 4L8PA 1U5OA 2INXA 1WQLB 1ULJB 5D81A 1TUHA 4X2OA 3F9SA 2YFIB 4HJLB 1JN5B 3MHEA 3GZRA 3OWSA 3FF2A 3SEDA 5STDA 1Q40A 6STDA 3ECFA 2HMOB 1K41A 2GBXB 1W02A 5KP1A 1S5AA 3HK4A 1OGZA 5AI1A 4FCMA 1O7MB 1OHOA 1VZZA 1UUWB 2GEYA 4I4KA 4H3UA 2RCDA 3D9RA 1OF5A 2HMLB 5D83A 3I0YA 4K1VA 3B7CA 4GB5A 3GZXB 4STDA 5AEUB 1E3VA 3G0KA 3EF8A 4MJDA 4R9LA 4WYKB 1W6YA 2QIYA 2Z7AA 2UX0A 3MYTA 3CNXA 3HZPA 3SOAA 4RZMA 3FZWA 3DZLA 2F86B 2I9WA 3IPTA 3WMDA 1OPYA 2BMOB 5JPPA 3CPOA 2R4IA 1DMMA 3EHCA 7STDA 4LEHA 2BMRB 4FCJA 3NV0B 3GRDA 2GBWB 5KP3A 4IIAA 3FLJA 1Z1SA 3FGYA 1DMQA 1GS3A 1A2KA 5AIGA 1OHPA 3GZYB 1HKXA 5FW5A 3OV4A 1W00A 3T8NA 3B8LA 3F14A 3FSDA 5HGRA 1JKGA 3KKGA 1O7NB 3UNLA 3EN1B 2B24B 4HM4B 4XBXA 5AIFA 3A76A 3ROBA 2A15A 2QGUA 3EC9A 1QMAA 5IG4A 3JUQA 3CNMA 2GEXA 3CU3A 3OWUA 5IEOA 2STDA 1JB2A 1CQSA 3H3HA 5D82A 1C7HA 3MKIA 3NM2A 3BB9A 5IERA 2HMJB 4LMIA 1DMNA 4L7KA 1OUNA 3STDA 4CDLA 4ORLA 4HZBB 5IEPA 1GY6A 1O7PB 4HM0B 1E97A 3F40A 4K1UA 1QJGA 4HM1B 3EBTA 1ZO2A 4HM6B 1JB4A 4XDWA 3NBRA 4HZ9B 1ZX2A 1SJWA 3OXAA 3UJMA 3F8XA 1O7WB 3NHXA 4WYKA 3FKAA 2W2CA 1ISKA 3T8UA 5IF6A 5BXQA 3VSYA 2RGQA 1TP6A 5EVHA 1E3RA 3FH1A 2CKFB 3E99A 3NV0A 1OHSA 2HMNB 3KSPA 3B4PA 8CHOA 2XSHB 3JUOA 2YFJB 1AR0A 4OUQA 3Q90A 3G16A 2XR8B 3HX8A 2XRXB 1O7GB 3G8ZA 1EG9B 2GXFA 3RGRA 3SOYA 4XBTA 5TGNA 4R9KA 4J8TA 4HM5B 2F98A 3GWRA 3NXJA 3JUPA 1OCVA 3EBYA 5JPUA 3MG2A 5AEWB 4HM8B 2HMMB 4U13A 3EQQB 3B4OA 4XBYA 1OH0A 3F7XA 3NUVA 4HM3B 1EA2A 1ASKA 3F7SA 3MG1A 4WWUC 4KVHA 1JN5A 2K54A 3M8CA 3BLZA 5G2GA 2XSOB 1JB5A 4OVMA 5DREA 1W01A 3RGAA 3MG3A 5KP4A 4L8OA 5CLKA 3LYGA 3KZTA 5DRVA 1NU3A
chains in the Genus database with same CATH superfamily
1BRHA 1AY7A 1BNFA 2V1LA 1YJW3 1KSIA 3EN8A 1YVSA 4N6OB 3CXC2 1BSBA 1GY5A 2CFWA 4WP5A 1SARA 4KFEA 1Q40B 4R1KA 2IUJA 4FMAA 3S67A 2F99A 4BU4A 1S723 1WNHA 1LXEA 2CFKA 3D79A 1VQ63 1GYBA 3WR2A 4N3VA 2H0HA 4J5GA 1WMOA 3GZBA 1W2B2 1FUSA 4X2HA 5M18A 2CHCA 3EJVA 5LC7A 1JBRA 5IG3A 1IT7A 1X1YA 1US1A 1UCJA 3JUNA 1UUVB 1QAKA 2OWPA 2W56B 3SXXA 3T0UA 1R4CA 1ULIB 1FGMA 1NO3A 1T5YA 1RMSA 4XDVA 3AMOB 3K0ZA 2BMQB 3GSPA 3VGNA 1OGXA 1PFPA 1L5GB 4NREA 1OF5B 3F8HA 1I2EA 1BRNL 5BU4A 2BU4A 1B27A 1VQ93 3H51A 4NPBA 3WOFB 1BUQA 2CX1A 1KQS2 2CH9A 3OW22 1YIJ3 2ZA4A 3S5CA 3G713 1LOXA 2K0MA 3ER7A 1RCLA 2BNGA 1RGGA 3BU4A 3EX9A 3PGBA 4HM7B 3CCJ3 2CK3H 1CEWI 1GY7A 2P09A 2WO0A 4LGQA 5CK6A 4XB5A 5CF1A 3Q3FA 2IMJA 1GD3A 4KFFA 2P38A 1A2PA 3D4AA 1FGTA 2C4BA 1YNVX 3K63A 2PZVA 1B2MA 2OOVC 3KE7A 3SX1A 3CCE3 3WOEB 4WFOA 1LVNA 1OACA 4KZ1A 2Z76A 2W03A 2FNQA 4J9AA 5IENA 1R4YA 1D6UA 1K28A 1TFOA 6RNTA 3DXOA 5EEOA 2RBIA 1RRLA 3DM8A 1BGSA 3DMCA 3MSOA 4PEJA 1V57A 2ML5A 3EE1A 2JQ5A 1BNSA 4HVNA 4EV2A 4HM2B 1EQKA 1IQXA 2XFSA 1IQ8A 1BSCA 1FA3A 1UCLA 3V92A 2Q07A 3OX9A 1NNVA 3WHOA 4J5KA 3U1WA 3JUMA 1O7HB 1VQP3 4MMXB 1SIIA 5AIIA 3LMLA 3BIRA 3D3LA 4HAAA 4Q53A 4BTYA 1VQK3 3Q2PA 2JDIH 3FG3A 3NQYA 5IG0A 5BVBA 1FW7A 1IDPA 3K7CA 1LQMB 1NDOB 3UL6A 1MOLA 2YFLB 1FGQA 3BNCA 4O2HA 1VQ83 3PCSA 2IUKA 2BHMA 2L4VA 2YX9A 3EB8A 4H61A 4BTWA 1RGAA 1SPUA 2HMKB 1JKGB 3I553 3CD63 2WOFA 4XM4A 4HKVB 3LZAA 2XGNA 1QAFA 4GL6A 4WHAA 3ZFZA 3BNBA 2B1XB 3ZG5A 1BU4A 1UI7A 3OWYA 3FF0A 3X41A 2F56A 1SQWA 1Q42A 1IT8A 1W5ZA 2CFGA 1VQ73 2XGLA 1FGRA 1EUIC 2RFRA 3AGOA 7RNTA 5IG5A 5CXOA 3FG1A 2Z77A 2P0MA 2R41A 3HIGA 5CF2A 1STDA 1RHLA 1NWWA 2QEX3 4DKIA 1CYUA 5AIHA 3DUKA 3LOYA 1GOVA 1ZS7A 5EQLA 2FGTA 1TU5A 4AEQA 2W04A 1K9M4 4L8PA 3X3XA 1Q814 1U5OA 1T2HA 2OOVA 1I2GA 3PZWA 2INXA 1WQLB 1VQQA 2C10A 1ULJB 5D81A 2GU1A 4CPKA 1LRAA 1TUHA 3MWZA 3DGYA 4X2OA 4AKYA 3F9SA 1YJ93 1IVXA 3RDEA 2YFIB 4HJLB 1N8R4 4GSPA 2BO9B 4N6LA 3CC73 3DGLA 1I8VA 1FYSA 1ROVA 1LQGC 2OQEA 1JN5B 1B20A 3WA3A 4KT3B 4O02B 3MHEA 4G1MB 2ZL8A 1I3FA 3GZRA 1Q9EA 3NQZA 1FZUA 2XEPA 3FF2A 3OWSA 3SEDA 1MNLA 4FR9A 3LTAA 3TDGA 5STDA 3K9MC 1Q40A 1M1XB 6STDA 3ECFA 1RGCA 1K41A 1HU9A 1W02A 2GBXB 2HMOB 1S5AA 3N8BA 4NHFA 1AVLA 5KP1A 1Q7Y4 1NJI4 1DYUA 1RRHA 3DY5A 3CCR3 3HK4A 1DE3A 1OGZA 1KC84 4BL3A 1YIT3 2D42A 5AI1A 1RNTA 3KFQC 3CCU3 4FCMA 3O8YA 1O7MB 2C11A 1OHOA 3N54B 1VZZA 4OK0A 1BRIA 1I3IA 3DGOA 4JRFA 1VQ53 2W56A 1B2XA 3LTDA 1HYFA 1RGHA 1BRKA 1UUWB 2GU3A 2GEYA 2CG1A 4I4KA 4N6MA 3WA2X 1UGIA 4H3UA 2RCDA 3D9RA 4N6UA 1A2VA 1OF5A 2HMLB 3WDGB 5D83A 1GMQA 4RNZA 1IQYA 3I0YA 4K1VA 3B7CA 1G96A 4GB5A 3S29A 3GZXB 1BAOA 4RNYA 4STDA 5AEUB 1E3VA 1UGHI 2O9UX 4BIRA 3AHWA 5RNTA 3G0KA 1IVUA 3EF8A 3K5TA 4MJDA 5G1KA 1QVG2 4R9LA 4WYKB 1LOYA 1KD14 1W6YA 1CH0A 1RCKA 4ZM8A 2QIYA 2Z7AA 2UX0A 3NBJA 2ZHXB 3MYTA 3QRDA 3CNXA 3HZPA 3SOAA 4N6V0 4RZMA 3FZWA 4N6NB 3DZLA 2AADA 2F86B 2I9WA 3IPTA 4RBNA 1M904 4I5QA 1OPYA 1X1XA 5GSPA 2BMOB 3WMDA 5ELJA 4GHOA 2Y73A 5JPPA 3CPOA 1B3SA 2R4IA 1GD4A 1DMMA 1AQZA 3NX0A 3EHCA 3FCSB 2Y74A 7STDA 1W6GA 4LZIA 1RLSA 4K61A 1FUTA 4LEHA 1YVBI 5M1AA 2W9PA 2BMRB 4AKZA 1JNQA 4FCJA 1BSDA 3NV0B 3SLUA 3GRDA 3L0RA 2GBWB 1RGEA 1RN4A 5G1LA 5KP3A 1MWRA 1IYYA 3KN4A 4IIAA 1FUWA 5FGOA 3FLJA 1Z1SA 3FGYA 1DMQA 1JBSA 4K90B 1VQL3 1YGEA 1VQN3 3VF1A 1GS3A 1A2KA 5AIGA 3JVCA 3Q1CA 1OHPA 3GZYB 1HKXA 1D6YA 1IVWA 1LOVA 4O8SA 4QWTA 5FW5A 1MWTA 3X40A 2SARA 3OV4A 1GOYA 4KFDA 4FMBA 2P05A 5JBSA 1W00A 1WMPA 3T8NA 1FGOA 1GMPA 2Z6BA 2P0XA 1U8CB 2CWUA 1JKGA 1X1WA 3B8LA 3F14A 3FSDA 5HGRA 4BL2A 2E2UA 3KKGA 1JRQA 1O7NB 1V74A 3ALAA 2OTL3 3UNLA 3QK9A 3EN1B 2UUGC 4MMYB 3NM7A 2B24B 4HM4B 3DH2A 1LNIA 3PCRA 4XBXA 2KF5A 5AIFA 3A76A 1M9GA 3ROBA 1TRQA 2A15A 1BRGA 4N6TA 2CC3A 1BSEA 2QGUA 2W0QA 1K734 5IW9A 2KXGA 1BIRA 1DVDA 3BNEA 2CIUA 3ZG0A 4HBRA 3D5IA 3FG4A 3EC9A 3V99A 5ELUA 1QMAA 1Y4KA 1B2ZA 5IG4A 1UCKA 1UW1A 2OCTA 3JUQA 1IK3A 3CNMA 1V58A 2GEXA 5AYSC 2LQVA 3LH4A 3UL5A 3CU3A 2O3OA 2WOHA 1JZDA 7GSPA 1RN7A 3OWUA 1BOXA 5IEOA 3S28A 2STDA 1NB3I 1EEJA 2RNTA 3X3ZA 1QVF2 4FCZA 1JB2A 4EBGA 1CYVA 1CQSA 3H3HA 1LOWA 2IYJA 2OTJ3 2KAAA 2KF6A 1BVIA 1T3BA 2H0GA 5D82A 3CPW2 1C7HA 3GAXA 3MKIA 3DGMA 3BB9A 3NM2A 1B2UA 1TTOA 2BT3A 2ZDJA 3X3YA 4CCVA 2HMJB 5IERA 2BIRA 4LMIA 1DMNA 4L7KA 1OUNA 3STDA 4CDLA 1D6ZA 1I0XA 4MMZB 1N9EA 2KF3A 4ORLA 3CCL3 2XF3A 5I97A 4HZBB 3CC23 1BUJA 3URPA 3AHSA 5IEPA 1MGRA 2D1WA 1GY6A 3G4S3 2XH9A 1C54A 1O7PB 4HM0B 1E97A 3D5GA 3F40A 3NBBA 4K1UA 2PNCA 1QJGA 4HM1B 1RN1A 2CFDA 3EBTA 1GOUA 3U97A 4ILFA 3AMOA 2AAEA 1ZO2A 4HM6B 1I2FA 1JB4A 3AGNA 4XDWA 1A67A 4R80A 3NBRA 1TFKA 4HZ9B 1J2BA 3X42A 3LXUX 1IVVA 3LTBA 1ZX2A 1SJWA 3OXAA 1BNIA 3UJMA 1UI8A 1VQO3 2XFTA 3F8XA 1IV7A 1O7WB 2K3DA 2IY2A 3KCHA 3NHXA 4WYKA 1IV9A 3FKAA 2W2CA 1PU4A 1ISKA 3T8UA 5IF6A 5BXQA 5A0OB 1YI23 1BRJA 1STFI 2CWVA 4O3VA 2RGQA 3VSYA 1JBTA 5HOHA 5LC6A 4HYZA 3CME3 1TP6A 1W2ZA 1JV2B 3PYJA 5EVHA 3PXMA 1AVKA 2CW9A 3MPHA 2CX0A 2CWTA 1A90A 1LNHA 1W7CA 2CG0A 1E3RA 3FH1A 2CKFB 1MWUA 3S27A 1JJ22 2WGQA 3RNTA 3E99A 1K8A4 3I563 3KIIA 1TIJA 3NV0A 3BNDA 1OHSA 4RNTA 2CFLA 2QA43 1UUGB 2F5MA 8RNTA 3CCQ3 1BNEA 4BTXA 1X1UA 2HMNB 3HI7A 4FMCA 4IT7A 1Q864 6GSPA 2UGIA 3B4PA 3KSPA 8CHOA 1RDSA 1BANA 3SYUA 2XSHB 1Q824 1JZOA 1AV4A 3JUOA 3CC43 1F8NA 2YFJB 1AR0A 1N5HA 1NB5I 2RSXA 1TJDA 1ROAA 4OUQA 3Q90A 2W9QA 4TX4A 2WGOA 3G16A 2XR8B 1BSAA 3CCM3 2HOHA 2OQEC 3HX8A 2XRXB 1N5PA 1VQ43 1EKMA 1O7GB 3G8ZA 1EG9B 3N9HA 2GXFA 3RGRA 3SOYA 2MF7A 2M7OA 1GSPA 1QALA 4XBTA 1SIHA 3IMAB 5TGNA 3LT8A 1RKYA 1WTHA 2KCDA 4LSOA 4R9KA 4J8TA 3J7Yd 4R4KA 1BRSA 4HM5B 2KF4A 1B2SA 2J8XB 2KRTA 1RGFA 2F98A 1I0VA 1N8QA 4MEIA 2F5WA 3WODG 3HOHA 3GWRA 1RTUA 3G6E3 1UCIA 1IU7A 2IA7A 4LYLB 3NXJA 3UB1A 3HIIA 1OCVA 3JUPA 2W6JH 1DVCA 1WMNA 3EBYA 1W4NA 5JPUA 1I70A 1RGKA 3DGNA 3MG2A 5AEWB 1RJOA 4HM8B 4EYCA 2HMMB 9RNTA 1BNJA 2F4YA 4U13A 3V98A 1UDII 3EQQB 2LYXA 1PY3A 3B4OA 5BIRA 1YHQ3 4XBYA 1OH0A 2SBLA 3F7XA 2E2VA 3NUVA 4HM3B 4HOHA 1EA2A 1ASKA 5AYRB 4EC6A 1DETA 1BNRA 3A5EA 2GSPA 1MWSA 2FXTA 3F7SA 1VQM3 4EXRA 3CMA3 1RNBA 3MG1A 4KVHA 4WWUC 2E2TA 1JN5A 2K54A 2MC8A 2ML6A 1G02A 3M8CA 1RSNA 1Q7HA 3BLZA 1PYLA 1ZGXA 4EW5A 1RGLA 3SVAA 1W6CA 4JF8A 1HZ1A 4EV5A 5M19A 1TRPA 3KSED 3LTCA 5G2GA 2XSOB 1JB5A 1B21A 4FMDA 4OVMA 2L1SA 1M1K4 3PS8A 4CJNA 1GMRA 1T2IA 1W01A 5DREA 1MGWA 1KWIA 3CCV3 1BNGA 3RGAA 4IPBA 3MG3A 1YGWA 5KP4A 4L8OA 1YJN3 5CLKA 1G0TA 3LYGA 3KZTA 5DRVA 3IJEB 3CCS3 1NU3A 1N9JA 3LT9A 2H0IA
chains in the Genus database with same CATH topology
1YJW3 2V1LA 1KSIA 3EN8A 4N6OB 3CXC2 1GY5A 2CFWA 4WP5A 4KFEA 1Q40B 4R1KA 2IUJA 4FMAA 3S67A 2F99A 1S723 1WNHA 1LXEA 2CFKA 1VQ63 1GYBA 4N3VA 1W2B2 1WMOA 3GZBA 4X2HA 2CHCA 3EJVA 5LC7A 5IG3A 1IT7A 3SXXA 1US1A 1A67A 3JUNA 1UUVB 1QAKA 2OWPA 2W56B 3T0UA 1R4CA 1ULIB 1FGMA 1NO3A 1T5YA 4XDVA 3AMOB 3K0ZA 2BMQB 3VGNA 1OGXA 1PFPA 1L5GB 4NREA 1OF5B 3F8HA 1VQ93 3H51A 3WOFB 1BUQA 1KQS2 2CH9A 3OW22 1YIJ3 3S5CA 3G713 1LOXA 2K0MA 3ER7A 2BNGA 3EX9A 3PGBA 4HM7B 3CCJ3 2CK3H 1CEWI 1GY7A 2P09A 2WO0A 4LGQA 5CK6A 4XB5A 5CF1A 2IMJA 1GD3A 4KFFA 2P38A 1FGTA 3K63A 2PZVA 2OOVC 3KE7A 3SX1A 3CCE3 3WOEB 4WFOA 1LVNA 1OACA 4KZ1A 2Z76A 2W03A 2FNQA 4J9AA 5IENA 1D6UA 1K28A 1TFOA 3DXOA 5EEOA 3DMCA 1RRLA 3DM8A 3MSOA 4PEJA 2ML5A 3EE1A 2JQ5A 4HVNA 4EV2A 4HM2B 1EQKA 1IQXA 2XFSA 1IQ8A 1FA3A 3V92A 2Q07A 3OX9A 3U1WA 3JUMA 1O7HB 1VQP3 4MMXB 1SIIA 5AIIA 3LMLA 3D3LA 4Q53A 4BTYA 1VQK3 3Q2PA 2JDIH 3FG3A 3NQYA 5IG0A 5BVBA 1IDPA 3K7CA 3UL6A 1NDOB 1MOLA 2YFLB 1FGQA 3BNCA 4O2HA 1VQ83 3PCSA 2IUKA 2BHMA 2L4VA 2YX9A 3EB8A 4H61A 4BTWA 1SPUA 2HMKB 1JKGB 3I553 3CD63 2WOFA 4XM4A 4HKVB 3LZAA 2XGNA 1QAFA 4GL6A 4WHAA 3BNBA 2B1XB 3OWYA 1UI7A 3FF0A 3X41A 1SQWA 1Q42A 1IT8A 1W5ZA 2CFGA 1VQ73 2XGLA 1FGRA 2RFRA 5IG5A 5CXOA 3FG1A 2Z77A 2P0MA 3HIGA 5CF2A 1STDA 2QEX3 1NWWA 1CYUA 5AIHA 3DUKA 3LOYA 1TU5A 5EQLA 2FGTA 4AEQA 2W04A 1K9M4 4L8PA 3X3XA 1Q814 1U5OA 2OOVA 3PZWA 2INXA 1WQLB 2C10A 1ULJB 5D81A 2GU1A 1TUHA 3MWZA 4X2OA 4AKYA 3F9SA 1YJ93 1IVXA 3RDEA 2YFIB 4HJLB 1N8R4 2BO9B 4N6LA 3CC73 3DGLA 1ROVA 2OQEA 1JN5B 3WA3A 4O02B 3MHEA 4G1MB 2ZL8A 3GZRA 3NQZA 3OWSA 3FF2A 2XEPA 3SEDA 1MNLA 4FR9A 3LTAA 3TDGA 5STDA 3K9MC 1Q40A 1M1XB 6STDA 3ECFA 2HMOB 1K41A 1HU9A 1W02A 2GBXB 3N8BA 1S5AA 4NHFA 5KP1A 1AVLA 1Q7Y4 1NJI4 1DYUA 1RRHA 3DY5A 3CCR3 3HK4A 1OGZA 1KC84 1YIT3 2D42A 5AI1A 3KFQC 3CCU3 4FCMA 3O8YA 1O7MB 2C11A 1OHOA 3N54B 1VZZA 4OK0A 3DGOA 4JRFA 1VQ53 2W56A 3LTDA 1UUWB 2GU3A 2GEYA 2CG1A 4I4KA 4N6MA 3WA2X 4H3UA 2RCDA 3D9RA 4N6UA 1A2VA 1OF5A 2HMLB 3WDGB 5D83A 4RNZA 1IQYA 3I0YA 4K1VA 3B7CA 1G96A 4GB5A 3S29A 3GZXB 4STDA 4RNYA 5AEUB 1E3VA 2O9UX 3G0KA 1IVUA 3EF8A 3K5TA 4MJDA 1QVG2 4R9LA 4WYKB 1KD14 1W6YA 4ZM8A 2QIYA 2Z7AA 2UX0A 3NBJA 3MYTA 3QRDA 3CNXA 3HZPA 3SOAA 4N6V0 4RZMA 3FZWA 4N6NB 3DZLA 2F86B 2I9WA 3IPTA 4RBNA 1M904 3WMDA 1OPYA 2BMOB 5ELJA 5JPPA 2Y73A 3CPOA 2R4IA 1GD4A 1DMMA 3NX0A 3EHCA 3FCSB 2Y74A 7STDA 1W6GA 4LZIA 4K61A 4LEHA 1YVBI 2W9PA 2BMRB 4AKZA 1JNQA 4FCJA 3NV0B 3SLUA 3GRDA 3L0RA 2GBWB 5KP3A 3KN4A 4IIAA 1FUWA 5FGOA 3FLJA 1Z1SA 3FGYA 1DMQA 1VQL3 4K90B 1YGEA 1VQN3 3VF1A 1GS3A 1A2KA 5AIGA 3JVCA 3Q1CA 1OHPA 3GZYB 1HKXA 1D6YA 1IVWA 4O8SA 4QWTA 5FW5A 3X40A 3OV4A 4KFDA 4FMBA 2P05A 5JBSA 1W00A 1WMPA 3T8NA 1FGOA 2Z6BA 2P0XA 1U8CB 2CWUA 1JKGA 3B8LA 3F14A 3FSDA 5HGRA 2E2UA 3KKGA 1JRQA 1O7NB 1V74A 3ALAA 2OTL3 3UNLA 3QK9A 3EN1B 4MMYB 3NM7A 2B24B 4HM4B 3PCRA 4XBXA 5AIFA 3A76A 1M9GA 3ROBA 2A15A 4N6TA 2CC3A 2QGUA 2W0QA 1K734 5IW9A 2KXGA 1DVDA 3BNEA 2CIUA 4HBRA 3FG4A 3EC9A 3V99A 5ELUA 1QMAA 1Y4KA 5IG4A 1UW1A 2OCTA 3JUQA 1IK3A 3CNMA 2GEXA 5AYSC 2LQVA 3LH4A 3UL5A 3CU3A 2O3OA 2WOHA 1RN7A 3OWUA 5IEOA 3S28A 2STDA 1NB3I 3X3ZA 1QVF2 4FCZA 1JB2A 4EBGA 1CYVA 1CQSA 3H3HA 2OTJ3 5D82A 3CPW2 1C7HA 3GAXA 3MKIA 3DGMA 3BB9A 3NM2A 5IERA 2BT3A 4CCVA 2ZDJA 3X3YA 2HMJB 4LMIA 1DMNA 4L7KA 1OUNA 3STDA 4CDLA 1D6ZA 4MMZB 1N9EA 4ORLA 3CCL3 2XF3A 5I97A 4HZBB 3CC23 5IEPA 2D1WA 1GY6A 3G4S3 2XH9A 1O7PB 4HM0B 1E97A 3F40A 3NBBA 4K1UA 2PNCA 1QJGA 4HM1B 2CFDA 3EBTA 3U97A 3AMOA 1ZO2A 4HM6B 1JB4A 4XDWA 4R80A 3NBRA 1TFKA 4HZ9B 1J2BA 3X42A 3LXUX 1IVVA 3LTBA 1ZX2A 1SJWA 3OXAA 3UJMA 1UI8A 1VQO3 2XFTA 3F8XA 1IV7A 1O7WB 3NHXA 4WYKA 1IV9A 3FKAA 2W2CA 1PU4A 1ISKA 3T8UA 5IF6A 5BXQA 5A0OB 1YI23 1STFI 2CWVA 4O3VA 2RGQA 3VSYA 5LC6A 4HYZA 3CME3 1TP6A 1W2ZA 1JV2B 3PYJA 5EVHA 3PXMA 2CW9A 1AVKA 3MPHA 2CWTA 1A90A 1LNHA 1W7CA 2CG0A 1E3RA 3FH1A 2CKFB 3S27A 1JJ22 2WGQA 3E99A 1K8A4 3I563 3KIIA 1TIJA 3NV0A 3BNDA 1OHSA 2CFLA 2QA43 3CCQ3 4BTXA 2HMNB 3HI7A 4FMCA 4IT7A 1Q864 3KSPA 3B4PA 8CHOA 2XSHB 1Q824 3CC43 1AV4A 3JUOA 1F8NA 2YFJB 1AR0A 1N5HA 1NB5I 2RSXA 1ROAA 4OUQA 3Q90A 2W9QA 4TX4A 2WGOA 3G16A 2XR8B 3CCM3 2OQEC 3HX8A 2XRXB 1N5PA 1VQ43 1EKMA 1O7GB 3G8ZA 1EG9B 3N9HA 2GXFA 3RGRA 3SOYA 2MF7A 2M7OA 1QALA 4XBTA 1SIHA 3IMAB 5TGNA 3LT8A 1RKYA 1WTHA 2KCDA 4LSOA 4R9KA 4J8TA 3J7Yd 4R4KA 4HM5B 2KRTA 2F98A 1N8QA 4MEIA 3WODG 3GWRA 3G6E3 1IU7A 2IA7A 3UB1A 3NXJA 3HIIA 1OCVA 3JUPA 2W6JH 1DVCA 1WMNA 3EBYA 1W4NA 5JPUA 3DGNA 3MG2A 5AEWB 1RJOA 4HM8B 4EYCA 2HMMB 4U13A 3V98A 3EQQB 2LYXA 3B4OA 1YHQ3 4XBYA 1OH0A 2SBLA 3F7XA 2E2VA 3NUVA 4HM3B 1EA2A 1ASKA 5AYRB 4EC6A 1VQM3 2FXTA 3F7SA 4EXRA 3CMA3 3MG1A 4KVHA 4WWUC 2E2TA 1JN5A 2K54A 2MC8A 2ML6A 3M8CA 3BLZA 3SVAA 1W6CA 4JF8A 4EV5A 3KSED 3LTCA 5G2GA 2XSOB 1JB5A 4FMDA 4OVMA 1M1K4 3PS8A 5DREA 1W01A 1KWIA 3CCV3 3RGAA 4IPBA 3MG3A 5KP4A 1YJN3 4L8OA 5CLKA 3LYGA 3KZTA 5DRVA 3IJEB 3CCS3 1NU3A 1N9JA 3LT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN8 A;  1GY5 A;  4WP5 A;  1Q40 B;  4R1K A;  2F99 A;  1GYB A;  4N3V A;  3GZB A;  4X2H A;  2CHC A;  3EJV A;  5IG3 A;  3JUN A;  1UUV B;  2OWP A;  1ULI B;  4XDV A;  3K0Z A;  2BMQ B;  3VGN A;  1OGX A;  1OF5 B;  3F8H A;  3H51 A;  1BUQ A;  3S5C A;  3ER7 A;  2BNG A;  3EX9 A;  4HM7 B;  1GY7 A;  4LGQ A;  5CK6 A;  4XB5 A;  5CF1 A;  2IMJ A;  2PZV A;  3KE7 A;  2Z76 A;  4J9A A;  5IEN A;  3DXO A;  3DMC A;  3DM8 A;  3MSO A;  4PEJ A;  2JQ5 A;  4HVN A;  4HM2 B;  3OX9 A;  3JUM A;  1O7H B;  5AII A;  4Q53 A;  5IG0 A;  5BVB A;  1IDP A;  3K7C A;  1NDO B;  2YFL B;  2HMK B;  1JKG B;  4XM4 A;  4HKV B;  3LZA A;  2B1X B;  3OWY A;  3FF0 A;  1Q42 A;  2RFR A;  5IG5 A;  5CXO A;  2Z77 A;  5CF2 A;  1STD A;  1NWW A;  5AIH A;  3DUK A;  4L8P A;  1U5O A;  2INX A;  1WQL B;  1ULJ B;  5D81 A;  1TUH A;  4X2O A;  3F9S A;  2YFI B;  4HJL B;  1JN5 B;  3MHE A;  3GZR A;  3OWS A;  3FF2 A;  3SED A;  5STD A;  1Q40 A;  6STD A;  3ECF A;  2HMO B;  1K41 A;  2GBX B;  1W02 A;  5KP1 A;  1S5A A;  3HK4 A;  1OGZ A;  5AI1 A;  4FCM A;  1O7M B;  1OHO A;  1VZZ A;  1UUW B;  2GEY A;  4I4K A;  4H3U A;  2RCD A;  3D9R A;  1OF5 A;  2HML B;  5D83 A;  3I0Y A;  4K1V A;  3B7C A;  4GB5 A;  3GZX B;  4STD A;  5AEU B;  1E3V A;  3G0K A;  3EF8 A;  4MJD A;  4R9L A;  4WYK B;  1W6Y A;  2QIY A;  2Z7A A;  2UX0 A;  3MYT A;  3CNX A;  3HZP A;  3SOA A;  4RZM A;  3FZW A;  3DZL A;  2F86 B;  2I9W A;  3IPT A;  3WMD A;  1OPY A;  2BMO B;  5JPP A;  3CPO A;  2R4I A;  1DMM A;  3EHC A;  7STD A;  4LEH A;  2BMR B;  4FCJ A;  3NV0 B;  3GRD A;  2GBW B;  5KP3 A;  4IIA A;  3FLJ A;  1Z1S A;  3FGY A;  1DMQ A;  1GS3 A;  1A2K A;  5AIG A;  1OHP A;  3GZY B;  1HKX A;  5FW5 A;  3OV4 A;  1W00 A;  3T8N A;  3B8L A;  3F14 A;  3FSD A;  5HGR A;  1JKG A;  3KKG A;  1O7N B;  3UNL A;  3EN1 B;  2B24 B;  4HM4 B;  4XBX A;  5AIF A;  3A76 A;  3ROB A;  2A15 A;  2QGU A;  3EC9 A;  1QMA A;  5IG4 A;  3JUQ A;  3CNM A;  2GEX A;  3CU3 A;  3OWU A;  5IEO A;  2STD A;  1JB2 A;  1CQS A;  3H3H A;  5D82 A;  1C7H A;  3MKI A;  3NM2 A;  3BB9 A;  5IER A;  2HMJ B;  4LMI A;  1DMN A;  4L7K A;  1OUN A;  3STD A;  4CDL A;  4ORL A;  4HZB B;  5IEP A;  1GY6 A;  1O7P B;  4HM0 B;  1E97 A;  3F40 A;  4K1U A;  1QJG A;  4HM1 B;  3EBT A;  1ZO2 A;  4HM6 B;  1JB4 A;  4XDW A;  3NBR A;  4HZ9 B;  1ZX2 A;  1SJW A;  3OXA A;  3UJM A;  3F8X A;  1O7W B;  3NHX A;  4WYK A;  3FKA A;  2W2C A;  1ISK A;  3T8U A;  5IF6 A;  5BXQ A;  3VSY A;  2RGQ A;  1TP6 A;  5EVH A;  1E3R A;  3FH1 A;  2CKF B;  3E99 A;  3NV0 A;  1OHS A;  2HMN B;  3KSP A;  3B4P A;  8CHO A;  2XSH B;  3JUO A;  2YFJ B;  1AR0 A;  4OUQ A;  3Q90 A;  3G16 A;  2XR8 B;  3HX8 A;  2XRX B;  1O7G B;  3G8Z A;  1EG9 B;  2GXF A;  3RGR A;  3SOY A;  4XBT A;  5TGN A;  4R9K A;  4J8T A;  4HM5 B;  2F98 A;  3GWR A;  3NXJ A;  3JUP A;  1OCV A;  3EBY A;  5JPU A;  3MG2 A;  5AEW B;  4HM8 B;  2HMM B;  4U13 A;  3EQQ B;  3B4O A;  4XBY A;  1OH0 A;  3F7X A;  3NUV A;  4HM3 B;  1EA2 A;  1ASK A;  3F7S A;  3MG1 A;  4WWU C;  4KVH A;  1JN5 A;  2K54 A;  3M8C A;  3BLZ A;  5G2G A;  2XSO B;  1JB5 A;  4OVM A;  5DRE A;  1W01 A;  3RGA A;  3MG3 A;  5KP4 A;  4L8O A;  5CLK A;  3LYG A;  3KZT A;  5DRV A;  1NU3 A; 
#chains in the Genus database with same CATH topology
 1BRH A;  1AY7 A;  1BNF A;  2V1L A;  1YJW 3;  1KSI A;  3EN8 A;  1YVS A;  4N6O B;  3CXC 2;  1BSB A;  1GY5 A;  2CFW A;  4WP5 A;  1SAR A;  4KFE A;  1Q40 B;  4R1K A;  2IUJ A;  4FMA A;  3S67 A;  2F99 A;  4BU4 A;  1S72 3;  1WNH A;  1LXE A;  2CFK A;  3D79 A;  1VQ6 3;  1GYB A;  3WR2 A;  4N3V A;  2H0H A;  4J5G A;  1WMO A;  3GZB A;  1W2B 2;  1FUS A;  4X2H A;  5M18 A;  2CHC A;  3EJV A;  5LC7 A;  1JBR A;  5IG3 A;  1IT7 A;  1X1Y A;  1US1 A;  1UCJ A;  3JUN A;  1UUV B;  1QAK A;  2OWP A;  2W56 B;  3SXX A;  3T0U A;  1R4C A;  1ULI B;  1FGM A;  1NO3 A;  1T5Y A;  1RMS A;  4XDV A;  3AMO B;  3K0Z A;  2BMQ B;  3GSP A;  3VGN A;  1OGX A;  1PFP A;  1L5G B;  4NRE A;  1OF5 B;  3F8H A;  1I2E A;  1BRN L;  5BU4 A;  2BU4 A;  1B27 A;  1VQ9 3;  3H51 A;  4NPB A;  3WOF B;  1BUQ A;  2CX1 A;  1KQS 2;  2CH9 A;  3OW2 2;  1YIJ 3;  2ZA4 A;  3S5C A;  3G71 3;  1LOX A;  2K0M A;  3ER7 A;  1RCL A;  2BNG A;  1RGG A;  3BU4 A;  3EX9 A;  3PGB A;  4HM7 B;  3CCJ 3;  2CK3 H;  1CEW I;  1GY7 A;  2P09 A;  2WO0 A;  4LGQ A;  5CK6 A;  4XB5 A;  5CF1 A;  3Q3F A;  2IMJ A;  1GD3 A;  4KFF A;  2P38 A;  1A2P A;  3D4A A;  1FGT A;  2C4B A;  1YNV X;  3K63 A;  2PZV A;  1B2M A;  2OOV C;  3KE7 A;  3SX1 A;  3CCE 3;  3WOE B;  4WFO A;  1LVN A;  1OAC A;  4KZ1 A;  2Z76 A;  2W03 A;  2FNQ A;  4J9A A;  5IEN A;  1R4Y A;  1D6U A;  1K28 A;  1TFO A;  6RNT A;  3DXO A;  5EEO A;  2RBI A;  1RRL A;  3DM8 A;  1BGS A;  3DMC A;  3MSO A;  4PEJ A;  1V57 A;  2ML5 A;  3EE1 A;  2JQ5 A;  1BNS A;  4HVN A;  4EV2 A;  4HM2 B;  1EQK A;  1IQX A;  2XFS A;  1IQ8 A;  1BSC A;  1FA3 A;  1UCL A;  3V92 A;  2Q07 A;  3OX9 A;  1NNV A;  3WHO A;  4J5K A;  3U1W A;  3JUM A;  1O7H B;  1VQP 3;  4MMX B;  1SII A;  5AII A;  3LML A;  3BIR A;  3D3L A;  4HAA A;  4Q53 A;  4BTY A;  1VQK 3;  3Q2P A;  2JDI H;  3FG3 A;  3NQY A;  5IG0 A;  5BVB A;  1FW7 A;  1IDP A;  3K7C A;  1LQM B;  1NDO B;  3UL6 A;  1MOL A;  2YFL B;  1FGQ A;  3BNC A;  4O2H A;  1VQ8 3;  3PCS A;  2IUK A;  2BHM A;  2L4V A;  2YX9 A;  3EB8 A;  4H61 A;  4BTW A;  1RGA A;  1SPU A;  2HMK B;  1JKG B;  3I55 3;  3CD6 3;  2WOF A;  4XM4 A;  4HKV B;  3LZA A;  2XGN A;  1QAF A;  4GL6 A;  4WHA A;  3ZFZ A;  3BNB A;  2B1X B;  3ZG5 A;  1BU4 A;  1UI7 A;  3OWY A;  3FF0 A;  3X41 A;  2F56 A;  1SQW A;  1Q42 A;  1IT8 A;  1W5Z A;  2CFG A;  1VQ7 3;  2XGL A;  1FGR A;  1EUI C;  2RFR A;  3AGO A;  7RNT A;  5IG5 A;  5CXO A;  3FG1 A;  2Z77 A;  2P0M A;  2R41 A;  3HIG A;  5CF2 A;  1STD A;  1RHL A;  1NWW A;  2QEX 3;  4DKI A;  1CYU A;  5AIH A;  3DUK A;  3LOY A;  1GOV A;  1ZS7 A;  5EQL A;  2FGT A;  1TU5 A;  4AEQ A;  2W04 A;  1K9M 4;  4L8P A;  3X3X A;  1Q81 4;  1U5O A;  1T2H A;  2OOV A;  1I2G A;  3PZW A;  2INX A;  1WQL B;  1VQQ A;  2C10 A;  1ULJ B;  5D81 A;  2GU1 A;  4CPK A;  1LRA A;  1TUH A;  3MWZ A;  3DGY A;  4X2O A;  4AKY A;  3F9S A;  1YJ9 3;  1IVX A;  3RDE A;  2YFI B;  4HJL B;  1N8R 4;  4GSP A;  2BO9 B;  4N6L A;  3CC7 3;  3DGL A;  1I8V A;  1FYS A;  1ROV A;  1LQG C;  2OQE A;  1JN5 B;  1B20 A;  3WA3 A;  4KT3 B;  4O02 B;  3MHE A;  4G1M B;  2ZL8 A;  1I3F A;  3GZR A;  1Q9E A;  3NQZ A;  1FZU A;  2XEP A;  3FF2 A;  3OWS A;  3SED A;  1MNL A;  4FR9 A;  3LTA A;  3TDG A;  5STD A;  3K9M C;  1Q40 A;  1M1X B;  6STD A;  3ECF A;  1RGC A;  1K41 A;  1HU9 A;  1W02 A;  2GBX B;  2HMO B;  1S5A A;  3N8B A;  4NHF A;  1AVL A;  5KP1 A;  1Q7Y 4;  1NJI 4;  1DYU A;  1RRH A;  3DY5 A;  3CCR 3;  3HK4 A;  1DE3 A;  1OGZ A;  1KC8 4;  4BL3 A;  1YIT 3;  2D42 A;  5AI1 A;  1RNT A;  3KFQ C;  3CCU 3;  4FCM A;  3O8Y A;  1O7M B;  2C11 A;  1OHO A;  3N54 B;  1VZZ A;  4OK0 A;  1BRI A;  1I3I A;  3DGO A;  4JRF A;  1VQ5 3;  2W56 A;  1B2X A;  3LTD A;  1HYF A;  1RGH A;  1BRK A;  1UUW B;  2GU3 A;  2GEY A;  2CG1 A;  4I4K A;  4N6M A;  3WA2 X;  1UGI A;  4H3U A;  2RCD A;  3D9R A;  4N6U A;  1A2V A;  1OF5 A;  2HML B;  3WDG B;  5D83 A;  1GMQ A;  4RNZ A;  1IQY A;  3I0Y A;  4K1V A;  3B7C A;  1G96 A;  4GB5 A;  3S29 A;  3GZX B;  1BAO A;  4RNY A;  4STD A;  5AEU B;  1E3V A;  1UGH I;  2O9U X;  4BIR A;  3AHW A;  5RNT A;  3G0K A;  1IVU A;  3EF8 A;  3K5T A;  4MJD A;  5G1K A;  1QVG 2;  4R9L A;  4WYK B;  1LOY A;  1KD1 4;  1W6Y A;  1CH0 A;  1RCK A;  4ZM8 A;  2QIY A;  2Z7A A;  2UX0 A;  3NBJ A;  2ZHX B;  3MYT A;  3QRD A;  3CNX A;  3HZP A;  3SOA A;  4N6V 0;  4RZM A;  3FZW A;  4N6N B;  3DZL A;  2AAD A;  2F86 B;  2I9W A;  3IPT A;  4RBN A;  1M90 4;  4I5Q A;  1OPY A;  1X1X A;  5GSP A;  2BMO B;  3WMD A;  5ELJ A;  4GHO A;  2Y73 A;  5JPP A;  3CPO A;  1B3S A;  2R4I A;  1GD4 A;  1DMM A;  1AQZ A;  3NX0 A;  3EHC A;  3FCS B;  2Y74 A;  7STD A;  1W6G A;  4LZI A;  1RLS A;  4K61 A;  1FUT A;  4LEH A;  1YVB I;  5M1A A;  2W9P A;  2BMR B;  4AKZ A;  1JNQ A;  4FCJ A;  1BSD A;  3NV0 B;  3SLU A;  3GRD A;  3L0R A;  2GBW B;  1RGE A;  1RN4 A;  5G1L A;  5KP3 A;  1MWR A;  1IYY A;  3KN4 A;  4IIA A;  1FUW A;  5FGO A;  3FLJ A;  1Z1S A;  3FGY A;  1DMQ A;  1JBS A;  4K90 B;  1VQL 3;  1YGE A;  1VQN 3;  3VF1 A;  1GS3 A;  1A2K A;  5AIG A;  3JVC A;  3Q1C A;  1OHP A;  3GZY B;  1HKX A;  1D6Y A;  1IVW A;  1LOV A;  4O8S A;  4QWT A;  5FW5 A;  1MWT A;  3X40 A;  2SAR A;  3OV4 A;  1GOY A;  4KFD A;  4FMB A;  2P05 A;  5JBS A;  1W00 A;  1WMP A;  3T8N A;  1FGO A;  1GMP A;  2Z6B A;  2P0X A;  1U8C B;  2CWU A;  1JKG A;  1X1W A;  3B8L A;  3F14 A;  3FSD A;  5HGR A;  4BL2 A;  2E2U A;  3KKG A;  1JRQ A;  1O7N B;  1V74 A;  3ALA A;  2OTL 3;  3UNL A;  3QK9 A;  3EN1 B;  2UUG C;  4MMY B;  3NM7 A;  2B24 B;  4HM4 B;  3DH2 A;  1LNI A;  3PCR A;  4XBX A;  2KF5 A;  5AIF A;  3A76 A;  1M9G A;  3ROB A;  1TRQ A;  2A15 A;  1BRG A;  4N6T A;  2CC3 A;  1BSE A;  2QGU A;  2W0Q A;  1K73 4;  5IW9 A;  2KXG A;  1BIR A;  1DVD A;  3BNE A;  2CIU A;  3ZG0 A;  4HBR A;  3D5I A;  3FG4 A;  3EC9 A;  3V99 A;  5ELU A;  1QMA A;  1Y4K A;  1B2Z A;  5IG4 A;  1UCK A;  1UW1 A;  2OCT A;  3JUQ A;  1IK3 A;  3CNM A;  1V58 A;  2GEX A;  5AYS C;  2LQV A;  3LH4 A;  3UL5 A;  3CU3 A;  2O3O A;  2WOH A;  1JZD A;  7GSP A;  1RN7 A;  3OWU A;  1BOX A;  5IEO A;  3S28 A;  2STD A;  1NB3 I;  1EEJ A;  2RNT A;  3X3Z A;  1QVF 2;  4FCZ A;  1JB2 A;  4EBG A;  1CYV A;  1CQS A;  3H3H A;  1LOW A;  2IYJ A;  2OTJ 3;  2KAA A;  2KF6 A;  1BVI A;  1T3B A;  2H0G A;  5D82 A;  3CPW 2;  1C7H A;  3GAX A;  3MKI A;  3DGM A;  3BB9 A;  3NM2 A;  1B2U A;  1TTO A;  2BT3 A;  2ZDJ A;  3X3Y A;  4CCV A;  2HMJ B;  5IER A;  2BIR A;  4LMI A;  1DMN A;  4L7K A;  1OUN A;  3STD A;  4CDL A;  1D6Z A;  1I0X A;  4MMZ B;  1N9E A;  2KF3 A;  4ORL A;  3CCL 3;  2XF3 A;  5I97 A;  4HZB B;  3CC2 3;  1BUJ A;  3URP A;  3AHS A;  5IEP A;  1MGR A;  2D1W A;  1GY6 A;  3G4S 3;  2XH9 A;  1C54 A;  1O7P B;  4HM0 B;  1E97 A;  3D5G A;  3F40 A;  3NBB A;  4K1U A;  2PNC A;  1QJG A;  4HM1 B;  1RN1 A;  2CFD A;  3EBT A;  1GOU A;  3U97 A;  4ILF A;  3AMO A;  2AAE A;  1ZO2 A;  4HM6 B;  1I2F A;  1JB4 A;  3AGN A;  4XDW A;  1A67 A;  4R80 A;  3NBR A;  1TFK A;  4HZ9 B;  1J2B A;  3X42 A;  3LXU X;  1IVV A;  3LTB A;  1ZX2 A;  1SJW A;  3OXA A;  1BNI A;  3UJM A;  1UI8 A;  1VQO 3;  2XFT A;  3F8X A;  1IV7 A;  1O7W B;  2K3D A;  2IY2 A;  3KCH A;  3NHX A;  4WYK A;  1IV9 A;  3FKA A;  2W2C A;  1PU4 A;  1ISK A;  3T8U A;  5IF6 A;  5BXQ A;  5A0O B;  1YI2 3;  1BRJ A;  1STF I;  2CWV A;  4O3V A;  2RGQ A;  3VSY A;  1JBT A;  5HOH A;  5LC6 A;  4HYZ A;  3CME 3;  1TP6 A;  1W2Z A;  1JV2 B;  3PYJ A;  5EVH A;  3PXM A;  1AVK A;  2CW9 A;  3MPH A;  2CX0 A;  2CWT A;  1A90 A;  1LNH A;  1W7C A;  2CG0 A;  1E3R A;  3FH1 A;  2CKF B;  1MWU A;  3S27 A;  1JJ2 2;  2WGQ A;  3RNT A;  3E99 A;  1K8A 4;  3I56 3;  3KII A;  1TIJ A;  3NV0 A;  3BND A;  1OHS A;  4RNT A;  2CFL A;  2QA4 3;  1UUG B;  2F5M A;  8RNT A;  3CCQ 3;  1BNE A;  4BTX A;  1X1U A;  2HMN B;  3HI7 A;  4FMC A;  4IT7 A;  1Q86 4;  6GSP A;  2UGI A;  3B4P A;  3KSP A;  8CHO A;  1RDS A;  1BAN A;  3SYU A;  2XSH B;  1Q82 4;  1JZO A;  1AV4 A;  3JUO A;  3CC4 3;  1F8N A;  2YFJ B;  1AR0 A;  1N5H A;  1NB5 I;  2RSX A;  1TJD A;  1ROA A;  4OUQ A;  3Q90 A;  2W9Q A;  4TX4 A;  2WGO A;  3G16 A;  2XR8 B;  1BSA A;  3CCM 3;  2HOH A;  2OQE C;  3HX8 A;  2XRX B;  1N5P A;  1VQ4 3;  1EKM A;  1O7G B;  3G8Z A;  1EG9 B;  3N9H A;  2GXF A;  3RGR A;  3SOY A;  2MF7 A;  2M7O A;  1GSP A;  1QAL A;  4XBT A;  1SIH A;  3IMA B;  5TGN A;  3LT8 A;  1RKY A;  1WTH A;  2KCD A;  4LSO A;  4R9K A;  4J8T A;  3J7Y d;  4R4K A;  1BRS A;  4HM5 B;  2KF4 A;  1B2S A;  2J8X B;  2KRT A;  1RGF A;  2F98 A;  1I0V A;  1N8Q A;  4MEI A;  2F5W A;  3WOD G;  3HOH A;  3GWR A;  1RTU A;  3G6E 3;  1UCI A;  1IU7 A;  2IA7 A;  4LYL B;  3NXJ A;  3UB1 A;  3HII A;  1OCV A;  3JUP A;  2W6J H;  1DVC A;  1WMN A;  3EBY A;  1W4N A;  5JPU A;  1I70 A;  1RGK A;  3DGN A;  3MG2 A;  5AEW B;  1RJO A;  4HM8 B;  4EYC A;  2HMM B;  9RNT A;  1BNJ A;  2F4Y A;  4U13 A;  3V98 A;  1UDI I;  3EQQ B;  2LYX A;  1PY3 A;  3B4O A;  5BIR A;  1YHQ 3;  4XBY A;  1OH0 A;  2SBL A;  3F7X A;  2E2V A;  3NUV A;  4HM3 B;  4HOH A;  1EA2 A;  1ASK A;  5AYR B;  4EC6 A;  1DET A;  1BNR A;  3A5E A;  2GSP A;  1MWS A;  2FXT A;  3F7S A;  1VQM 3;  4EXR A;  3CMA 3;  1RNB A;  3MG1 A;  4KVH A;  4WWU C;  2E2T A;  1JN5 A;  2K54 A;  2MC8 A;  2ML6 A;  1G02 A;  3M8C A;  1RSN A;  1Q7H A;  3BLZ A;  1PYL A;  1ZGX A;  4EW5 A;  1RGL A;  3SVA A;  1W6C A;  4JF8 A;  1HZ1 A;  4EV5 A;  5M19 A;  1TRP A;  3KSE D;  3LTC A;  5G2G A;  2XSO B;  1JB5 A;  1B21 A;  4FMD A;  4OVM A;  2L1S A;  1M1K 4;  3PS8 A;  4CJN A;  1GMR A;  1T2I A;  1W01 A;  5DRE A;  1MGW A;  1KWI A;  3CCV 3;  1BNG A;  3RGA A;  4IPB A;  3MG3 A;  1YGW A;  5KP4 A;  4L8O A;  1YJN 3;  5CLK A;  1G0T A;  3LYG A;  3KZT A;  5DRV A;  3IJE B;  3CCS 3;  1NU3 A;  1N9J A;  3LT9 A;  2H0I A; 
#chains in the Genus database with same CATH homology
 1YJW 3;  2V1L A;  1KSI A;  3EN8 A;  4N6O B;  3CXC 2;  1GY5 A;  2CFW A;  4WP5 A;  4KFE A;  1Q40 B;  4R1K A;  2IUJ A;  4FMA A;  3S67 A;  2F99 A;  1S72 3;  1WNH A;  1LXE A;  2CFK A;  1VQ6 3;  1GYB A;  4N3V A;  1W2B 2;  1WMO A;  3GZB A;  4X2H A;  2CHC A;  3EJV A;  5LC7 A;  5IG3 A;  1IT7 A;  3SXX A;  1US1 A;  1A67 A;  3JUN A;  1UUV B;  1QAK A;  2OWP A;  2W56 B;  3T0U A;  1R4C A;  1ULI B;  1FGM A;  1NO3 A;  1T5Y A;  4XDV A;  3AMO B;  3K0Z A;  2BMQ B;  3VGN A;  1OGX A;  1PFP A;  1L5G B;  4NRE A;  1OF5 B;  3F8H A;  1VQ9 3;  3H51 A;  3WOF B;  1BUQ A;  1KQS 2;  2CH9 A;  3OW2 2;  1YIJ 3;  3S5C A;  3G71 3;  1LOX A;  2K0M A;  3ER7 A;  2BNG A;  3EX9 A;  3PGB A;  4HM7 B;  3CCJ 3;  2CK3 H;  1CEW I;  1GY7 A;  2P09 A;  2WO0 A;  4LGQ A;  5CK6 A;  4XB5 A;  5CF1 A;  2IMJ A;  1GD3 A;  4KFF A;  2P38 A;  1FGT A;  3K63 A;  2PZV A;  2OOV C;  3KE7 A;  3SX1 A;  3CCE 3;  3WOE B;  4WFO A;  1LVN A;  1OAC A;  4KZ1 A;  2Z76 A;  2W03 A;  2FNQ A;  4J9A A;  5IEN A;  1D6U A;  1K28 A;  1TFO A;  3DXO A;  5EEO A;  3DMC A;  1RRL A;  3DM8 A;  3MSO A;  4PEJ A;  2ML5 A;  3EE1 A;  2JQ5 A;  4HVN A;  4EV2 A;  4HM2 B;  1EQK A;  1IQX A;  2XFS A;  1IQ8 A;  1FA3 A;  3V92 A;  2Q07 A;  3OX9 A;  3U1W A;  3JUM A;  1O7H B;  1VQP 3;  4MMX B;  1SII A;  5AII A;  3LML A;  3D3L A;  4Q53 A;  4BTY A;  1VQK 3;  3Q2P A;  2JDI H;  3FG3 A;  3NQY A;  5IG0 A;  5BVB A;  1IDP A;  3K7C A;  3UL6 A;  1NDO B;  1MOL A;  2YFL B;  1FGQ A;  3BNC A;  4O2H A;  1VQ8 3;  3PCS A;  2IUK A;  2BHM A;  2L4V A;  2YX9 A;  3EB8 A;  4H61 A;  4BTW A;  1SPU A;  2HMK B;  1JKG B;  3I55 3;  3CD6 3;  2WOF A;  4XM4 A;  4HKV B;  3LZA A;  2XGN A;  1QAF A;  4GL6 A;  4WHA A;  3BNB A;  2B1X B;  3OWY A;  1UI7 A;  3FF0 A;  3X41 A;  1SQW A;  1Q42 A;  1IT8 A;  1W5Z A;  2CFG A;  1VQ7 3;  2XGL A;  1FGR A;  2RFR A;  5IG5 A;  5CXO A;  3FG1 A;  2Z77 A;  2P0M A;  3HIG A;  5CF2 A;  1STD A;  2QEX 3;  1NWW A;  1CYU A;  5AIH A;  3DUK A;  3LOY A;  1TU5 A;  5EQL A;  2FGT A;  4AEQ A;  2W04 A;  1K9M 4;  4L8P A;  3X3X A;  1Q81 4;  1U5O A;  2OOV A;  3PZW A;  2INX A;  1WQL B;  2C10 A;  1ULJ B;  5D81 A;  2GU1 A;  1TUH A;  3MWZ A;  4X2O A;  4AKY A;  3F9S A;  1YJ9 3;  1IVX A;  3RDE A;  2YFI B;  4HJL B;  1N8R 4;  2BO9 B;  4N6L A;  3CC7 3;  3DGL A;  1ROV A;  2OQE A;  1JN5 B;  3WA3 A;  4O02 B;  3MHE A;  4G1M B;  2ZL8 A;  3GZR A;  3NQZ A;  3OWS A;  3FF2 A;  2XEP A;  3SED A;  1MNL A;  4FR9 A;  3LTA A;  3TDG A;  5STD A;  3K9M C;  1Q40 A;  1M1X B;  6STD A;  3ECF A;  2HMO B;  1K41 A;  1HU9 A;  1W02 A;  2GBX B;  3N8B A;  1S5A A;  4NHF A;  5KP1 A;  1AVL A;  1Q7Y 4;  1NJI 4;  1DYU A;  1RRH A;  3DY5 A;  3CCR 3;  3HK4 A;  1OGZ A;  1KC8 4;  1YIT 3;  2D42 A;  5AI1 A;  3KFQ C;  3CCU 3;  4FCM A;  3O8Y A;  1O7M B;  2C11 A;  1OHO A;  3N54 B;  1VZZ A;  4OK0 A;  3DGO A;  4JRF A;  1VQ5 3;  2W56 A;  3LTD A;  1UUW B;  2GU3 A;  2GEY A;  2CG1 A;  4I4K A;  4N6M A;  3WA2 X;  4H3U A;  2RCD A;  3D9R A;  4N6U A;  1A2V A;  1OF5 A;  2HML B;  3WDG B;  5D83 A;  4RNZ A;  1IQY A;  3I0Y A;  4K1V A;  3B7C A;  1G96 A;  4GB5 A;  3S29 A;  3GZX B;  4STD A;  4RNY A;  5AEU B;  1E3V A;  2O9U X;  3G0K A;  1IVU A;  3EF8 A;  3K5T A;  4MJD A;  1QVG 2;  4R9L A;  4WYK B;  1KD1 4;  1W6Y A;  4ZM8 A;  2QIY A;  2Z7A A;  2UX0 A;  3NBJ A;  3MYT A;  3QRD A;  3CNX A;  3HZP A;  3SOA A;  4N6V 0;  4RZM A;  3FZW A;  4N6N B;  3DZL A;  2F86 B;  2I9W A;  3IPT A;  4RBN A;  1M90 4;  3WMD A;  1OPY A;  2BMO B;  5ELJ A;  5JPP A;  2Y73 A;  3CPO A;  2R4I A;  1GD4 A;  1DMM A;  3NX0 A;  3EHC A;  3FCS B;  2Y74 A;  7STD A;  1W6G A;  4LZI A;  4K61 A;  4LEH A;  1YVB I;  2W9P A;  2BMR B;  4AKZ A;  1JNQ A;  4FCJ A;  3NV0 B;  3SLU A;  3GRD A;  3L0R A;  2GBW B;  5KP3 A;  3KN4 A;  4IIA A;  1FUW A;  5FGO A;  3FLJ A;  1Z1S A;  3FGY A;  1DMQ A;  1VQL 3;  4K90 B;  1YGE A;  1VQN 3;  3VF1 A;  1GS3 A;  1A2K A;  5AIG A;  3JVC A;  3Q1C A;  1OHP A;  3GZY B;  1HKX A;  1D6Y A;  1IVW A;  4O8S A;  4QWT A;  5FW5 A;  3X40 A;  3OV4 A;  4KFD A;  4FMB A;  2P05 A;  5JBS A;  1W00 A;  1WMP A;  3T8N A;  1FGO A;  2Z6B A;  2P0X A;  1U8C B;  2CWU A;  1JKG A;  3B8L A;  3F14 A;  3FSD A;  5HGR A;  2E2U A;  3KKG A;  1JRQ A;  1O7N B;  1V74 A;  3ALA A;  2OTL 3;  3UNL A;  3QK9 A;  3EN1 B;  4MMY B;  3NM7 A;  2B24 B;  4HM4 B;  3PCR A;  4XBX A;  5AIF A;  3A76 A;  1M9G A;  3ROB A;  2A15 A;  4N6T A;  2CC3 A;  2QGU A;  2W0Q A;  1K73 4;  5IW9 A;  2KXG A;  1DVD A;  3BNE A;  2CIU A;  4HBR A;  3FG4 A;  3EC9 A;  3V99 A;  5ELU A;  1QMA A;  1Y4K A;  5IG4 A;  1UW1 A;  2OCT A;  3JUQ A;  1IK3 A;  3CNM A;  2GEX A;  5AYS C;  2LQV A;  3LH4 A;  3UL5 A;  3CU3 A;  2O3O A;  2WOH A;  1RN7 A;  3OWU A;  5IEO A;  3S28 A;  2STD A;  1NB3 I;  3X3Z A;  1QVF 2;  4FCZ A;  1JB2 A;  4EBG A;  1CYV A;  1CQS A;  3H3H A;  2OTJ 3;  5D82 A;  3CPW 2;  1C7H A;  3GAX A;  3MKI A;  3DGM A;  3BB9 A;  3NM2 A;  5IER A;  2BT3 A;  4CCV A;  2ZDJ A;  3X3Y A;  2HMJ B;  4LMI A;  1DMN A;  4L7K A;  1OUN A;  3STD A;  4CDL A;  1D6Z A;  4MMZ B;  1N9E A;  4ORL A;  3CCL 3;  2XF3 A;  5I97 A;  4HZB B;  3CC2 3;  5IEP A;  2D1W A;  1GY6 A;  3G4S 3;  2XH9 A;  1O7P B;  4HM0 B;  1E97 A;  3F40 A;  3NBB A;  4K1U A;  2PNC A;  1QJG A;  4HM1 B;  2CFD A;  3EBT A;  3U97 A;  3AMO A;  1ZO2 A;  4HM6 B;  1JB4 A;  4XDW A;  4R80 A;  3NBR A;  1TFK A;  4HZ9 B;  1J2B A;  3X42 A;  3LXU X;  1IVV A;  3LTB A;  1ZX2 A;  1SJW A;  3OXA A;  3UJM A;  1UI8 A;  1VQO 3;  2XFT A;  3F8X A;  1IV7 A;  1O7W B;  3NHX A;  4WYK A;  1IV9 A;  3FKA A;  2W2C A;  1PU4 A;  1ISK A;  3T8U A;  5IF6 A;  5BXQ A;  5A0O B;  1YI2 3;  1STF I;  2CWV A;  4O3V A;  2RGQ A;  3VSY A;  5LC6 A;  4HYZ A;  3CME 3;  1TP6 A;  1W2Z A;  1JV2 B;  3PYJ A;  5EVH A;  3PXM A;  2CW9 A;  1AVK A;  3MPH A;  2CWT A;  1A90 A;  1LNH A;  1W7C A;  2CG0 A;  1E3R A;  3FH1 A;  2CKF B;  3S27 A;  1JJ2 2;  2WGQ A;  3E99 A;  1K8A 4;  3I56 3;  3KII A;  1TIJ A;  3NV0 A;  3BND A;  1OHS A;  2CFL A;  2QA4 3;  3CCQ 3;  4BTX A;  2HMN B;  3HI7 A;  4FMC A;  4IT7 A;  1Q86 4;  3KSP A;  3B4P A;  8CHO A;  2XSH B;  1Q82 4;  3CC4 3;  1AV4 A;  3JUO A;  1F8N A;  2YFJ B;  1AR0 A;  1N5H A;  1NB5 I;  2RSX A;  1ROA A;  4OUQ A;  3Q90 A;  2W9Q A;  4TX4 A;  2WGO A;  3G16 A;  2XR8 B;  3CCM 3;  2OQE C;  3HX8 A;  2XRX B;  1N5P A;  1VQ4 3;  1EKM A;  1O7G B;  3G8Z A;  1EG9 B;  3N9H A;  2GXF A;  3RGR A;  3SOY A;  2MF7 A;  2M7O A;  1QAL A;  4XBT A;  1SIH A;  3IMA B;  5TGN A;  3LT8 A;  1RKY A;  1WTH A;  2KCD A;  4LSO A;  4R9K A;  4J8T A;  3J7Y d;  4R4K A;  4HM5 B;  2KRT A;  2F98 A;  1N8Q A;  4MEI A;  3WOD G;  3GWR A;  3G6E 3;  1IU7 A;  2IA7 A;  3UB1 A;  3NXJ A;  3HII A;  1OCV A;  3JUP A;  2W6J H;  1DVC A;  1WMN A;  3EBY A;  1W4N A;  5JPU A;  3DGN A;  3MG2 A;  5AEW B;  1RJO A;  4HM8 B;  4EYC A;  2HMM B;  4U13 A;  3V98 A;  3EQQ B;  2LYX A;  3B4O A;  1YHQ 3;  4XBY A;  1OH0 A;  2SBL A;  3F7X A;  2E2V A;  3NUV A;  4HM3 B;  1EA2 A;  1ASK A;  5AYR B;  4EC6 A;  1VQM 3;  2FXT A;  3F7S A;  4EXR A;  3CMA 3;  3MG1 A;  4KVH A;  4WWU C;  2E2T A;  1JN5 A;  2K54 A;  2MC8 A;  2ML6 A;  3M8C A;  3BLZ A;  3SVA A;  1W6C A;  4JF8 A;  4EV5 A;  3KSE D;  3LTC A;  5G2G A;  2XSO B;  1JB5 A;  4FMD A;  4OVM A;  1M1K 4;  3PS8 A;  5DRE A;  1W01 A;  1KWI A;  3CCV 3;  3RGA A;  4IPB A;  3MG3 A;  5KP4 A;  1YJN 3;  4L8O A;  5CLK A;  3LYG A;  3KZT A;  5DRV A;  3IJE B;  3CCS 3;  1NU3 A;  1N9J A;  3LT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...