2HMMB

Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
b'INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmmB00
3G0KA 5AIFA 2GXFA 3HX8A 3M8CA 2XSOB 1GY7A 1VZZA 1IDPA 1JKGA 2Z7AA 4L8PA 4L8OA 3F9SA 3G16A 5IF6A 3ER7A 2BMOB 5IG4A 1CQSA 3B4PA 2STDA 4HM5B 4LMIA 5KP1A 3EF8A 4X2HA 5AIGA 1GY5A 4HJLB 4HM7B 2R4IA 3DXOA 5IEOA 5EVHA 1E3VA 2QGUA 4XDWA 3MHEA 3UJMA 3WMDA 1GS3A 3B4OA 3NV0A 4LEHA 4J9AA 1OF5A 1U5OA 1OUNA 1TUHA 2BNGA 5AIHA 5AI1A 1UUWB 3MG3A 2Z77A 2RGQA 5IG5A 1A2KA 4OUQA 3D9RA 3CNXA 2RCDA 3A76A 4J8TA 4U13A 2HMNB 5DRVA 4HM8B 2F86B 1Q40B 1O7MB 1O7NB 1OHSA 2HMMB 3H51A 1OHOA 4FCJA 3KKGA 3EX9A 3G8ZA 1O7WB 3Q90A 1E97A 1EA2A 3EC9A 3NUVA 3FSDA 5CLKA 5D83A 5AIIA 3S5CA 3CNMA 4XDVA 3DUKA 1AR0A 1DMNA 2K54A 4R9LA 5TGNA 1ZX2A 4X2OA 2IMJA 2HMOB 3GZYB 3FZWA 1JB2A 1TP6A 2YFLB 4HM3B 4GB5A 3JUPA 3SOAA 5AEUB 4R9KA 2INXA 3IPTA 1HKXA 2Z76A 1JKGB 4WWUC 1ASKA 4PEJA 5AEWB 4OVMA 1O7GB 5CK6A 3H3HA 3DM8A 1JB5A 3K7CA 2BMRB 3F40A 3B8LA 3ROBA 3STDA 5STDA 2PZVA 1O7PB 4HKVB 4STDA 4WP5A 3MSOA 3NHXA 1WQLB 4ORLA 5HGRA 3GZXB 3CU3A 1W01A 3FF0A 3GZRA 5JPPA 1W02A 3B7CA 3FH1A 4XBTA 1ZO2A 3NV0B 2GBWB 3JUQA 4WYKB 1ISKA 4HM4B 3VGNA 3UNLA 6STDA 1DMQA 4HM1B 3JUMA 3EJVA 1QJGA 3K0ZA 1GY6A 1OPYA 3RGAA 5CF1A 3FF2A 3VSYA 3SEDA 4FCMA 3F8HA 4XM4A 2I9WA 3LYGA 3CPOA 2RFRA 5KP3A 2GEXA 4K1UA 2OWPA 2HMLB 1JN5A 3FLJA 4HM2B 5JPUA 2XR8B 3OWSA 4HM6B 5CF2A 2CKFB 4XBXA 1GYBA 3EN8A 1ULJB 4N3VA 2XSHB 3OXAA 3T8UA 3FKAA 3JUNA 3GWRA 4XB5A 7STDA 1NWWA 4R1KA 3DZLA 3EN1B 2XRXB 4XBYA 2YFJB 2HMJB 2GBXB 4CDLA 3OWUA 5BXQA 4HM0B 3LZAA 3T8NA 3MYTA 3F7SA 3NBRA 4LGQA 3F7XA 1W00A 2F98A 3EHCA 3F14A 1JB4A 4H3UA 5IERA 1NDOB 1ULIB 2B1XB 5D82A 3NXJA 3RGRA 4I4KA 3EQQB 5DREA 2B24B 1K41A 4RZMA 2QIYA 1OGXA 3BB9A 3JUOA 3EBYA 1NU3A 3SOYA 3HK4A 1O7HB 4HZ9B 4Q53A 4K1VA 3OV4A 1OF5B 1OH0A 1DMMA 3DMCA 1OHPA 8CHOA 3BLZA 4WYKA 3ECFA 4IIAA 3GZBA 3KE7A 3HZPA 1W6YA 5IENA 2BMQB 5IG3A 1OGZA 2JQ5A 1C7HA 5CXOA 5IEPA 2CHCA 1Q42A 1Q40A 4KVHA 2A15A 3OX9A 3KSPA 2UX0A 2HMKB 5IG0A 3F8XA 4HZBB 5D81A 3MKIA 3GRDA 4L7KA 1Z1SA 1EG9B 2W2CA 2YFIB 3I0YA 3MG2A 1OCVA 1BUQA 5KP4A 3MG1A 3NM2A 4HVNA 1JN5B 5G2GA 1STDA 1QMAA 2GEYA 1E3RA 3OWYA 3EBTA 3KZTA 1SJWA 1UUVB 5BVBA 3E99A 2F99A 5FW5A 1S5AA 3FGYA 4MJDA
chains in the Genus database with same CATH superfamily
3SX1A 4RBNA 1LOWA 3PCRA 1D6UA 3V92A 3CD63 3G0KA 1LNIA 2W6JH 1NO3A 1B2UA 5AIFA 1BNIA 2GXFA 1MNLA 3LTCA 1UW1A 3HX8A 3M8CA 2XSOB 5ELJA 1B2SA 4R4KA 2CW9A 8RNTA 1GY7A 2MF7A 1VZZA 2MC8A 1IDPA 1BRGA 1WTHA 4FMAA 3X3YA 3ZG5A 3K63A 1Q824 1JKGA 1I8VA 1RTUA 4MMXB 1RGGA 2BT3A 2Z7AA 1ZGXA 1JRQA 3DGYA 1A90A 3DH2A 1RLSA 4L8PA 4L8OA 1QALA 1MGWA 2FNQA 3F9SA 3PGBA 4N6TA 3T0UA 3G16A 5IF6A 3CCM3 3ER7A 2KXGA 1WMOA 1RGAA 1BANA 2BMOB 2BO9B 1UDII 2CFLA 3WA2X 3X41A 5IG4A 2F4YA 1CQSA 3FG1A 1BRHA 3SYUA 3X3ZA 1Q864 3HI7A 2K3DA 3B4PA 2STDA 4HM5B 1UI8A 4LMIA 5KP1A 4KT3B 2BHMA 3EF8A 3KN4A 1IVUA 1N8R4 3URPA 3IJEB 1Q7Y4 1I70A 4X2HA 1RCKA 5AIGA 2CC3A 1DYUA 4HBRA 2CIUA 1GY5A 4HJLB 3CC73 6RNTA 4HM7B 9RNTA 1VQ83 2R4IA 2W0QA 3U97A 3DXOA 3BNBA 2CG0A 1RGFA 1GOVA 1T3BA 5IEOA 3NX0A 1W2ZA 3OW22 1I3FA 5EVHA 1E3VA 2QGUA 3DGLA 4XDWA 3MHEA 1UCKA 2GU1A 5AYSC 3UJMA 1MWSA 1RGEA 1RN4A 1GS3A 3WMDA 3NM7A 1I3IA 4MMYB 3B4OA 2BU4A 5BU4A 1M9GA 3NV0A 1HZ1A 1YIT3 1WNHA 4LEHA 2RBIA 4O3VA 1PYLA 3DGNA 4J9AA 5AYRB 1NNVA 1R4CA 1OF5A 2HOHA 1U5OA 2XH9A 3BIRA 1OUNA 1RRHA 3ZFZA 2FGTA 5LC7A 4DKIA 1TUHA 1QVF2 2CFGA 4N6MA 2W04A 1YVBI 1NB5I 1IYYA 1LVNA 2BNGA 5AIHA 2L4VA 5AI1A 1LRAA 1UUWB 3S28A 1SIHA 1PFPA 3LT8A 2IUKA 4N6V0 1RGKA 2Z77A 3MG3A 3X40A 4LSOA 2RGQA 5IG5A 1A2KA 4OUQA 1YVSA 3AMOA 3D9RA 1RGCA 1UI7A 1SARA 4EXRA 2CX0A 1B2MA 3CNXA 3X42A 4LYLB 1VQ93 2D1WA 3AGNA 2O3OA 1D6YA 3BNCA 2RCDA 3A76A 4J8TA 4U13A 1V58A 2HMNB 5G1LA 3SVAA 5DRVA 3I553 4NREA 1VQK3 2OTL3 4HM8B 2F86B 2XFTA 2F5WA 4N6LA 1VQQA 1Q40B 1TJDA 1O7MB 1X1XA 1N9EA 1O7NB 2UUGC 1S723 1A67A 1OHSA 2HMMB 2KCDA 3H51A 1OHOA 4FCJA 3KKGA 3EX9A 2AADA 4BL2A 3N54B 1FGOA 3HIGA 2FXTA 1TFKA 4BL3A 3QRDA 3G8ZA 3D5IA 1W2B2 3NQYA 3D3LA 2OTJ3 2IY2A 4BIRA 1VQ63 1O7WB 2UGIA 3Q90A 2KF3A 3RNTA 1LOXA 1E97A 2Y73A 1IU7A 1BNJA 3BNDA 1EA2A 3EC9A 1I0VA 4BU4A 3NUVA 3FSDA 2XGLA 3WDGB 1RHLA 2D42A 1VQL3 1IQXA 5CLKA 3D79A 5D83A 1NJI4 2OQEC 5AIIA 1OACA 4CCVA 1GD4A 3S5CA 3CNMA 3S29A 4XDVA 3DUKA 1FGTA 4ZM8A 1X1UA 4NPBA 4ILFA 1TRQA 1AR0A 2LQVA 1DMNA 1B2XA 2K54A 1JZDA 2ZDJA 1YGEA 3HOHA 1YJN3 1ROAA 4R9LA 5TGNA 1ZX2A 1IT8A 4FMDA 3RDEA 4X2OA 1W6GA 2HMOB 2IMJA 2M7OA 3GZYB 3TDGA 4N6UA 1LQGC 4AKZA 7GSPA 3FZWA 2KRTA 1JB2A 1TP6A 2LYXA 1N5PA 2YFLB 2WGQA 2R41A 4HM3B 1KD14 4GB5A 3CXC2 1A2VA 2OOVC 2C11A 3JUPA 3SOAA 4MEIA 1SPUA 5AEUB 4R9KA 2INXA 3IPTA 2CFWA 1HKXA 1X1YA 2XF3A 4EYCA 2Z76A 1JKGB 3Q2PA 2C4BA 1W4NA 4WWUC 1ASKA 4FR9A 2YX9A 4PEJA 1WMNA 5AEWB 4OVMA 1O7GB 1BNRA 5CK6A 4IPBA 3PCSA 1VQO3 1MWRA 3H3HA 3DM8A 3CCR3 1JB5A 5A0OB 1RDSA 2KF5A 3KSED 3K7CA 2BMRB 2ZL8A 3F40A 3MWZA 3B8LA 1L5GB 1BRNL 3EB8A 4KFFA 5GSPA 3ROBA 2WOFA 5STDA 2PZVA 3STDA 1BUJA 2E2VA 1TRPA 1N8QA 1O7PB 3WODG 3CC23 1WMPA 3L0RA 2KF6A 4HKVB 1K9M4 3CC43 4STDA 4WP5A 4K90B 3MSOA 1IVVA 1FUSA 2CG1A 5RNTA 2CX1A 1FGQA 2OOVA 3NHXA 2J8XB 1WQLB 3A5EA 3J7Yd 1FGMA 3LMLA 4ORLA 3G6E3 1G96A 2H0HA 1M1K4 1KQS2 5HGRA 4HYZA 3GZXB 3CU3A 3WR2A 1IT7A 1STFI 1QAKA 1EKMA 1BGSA 1W01A 4LZIA 2IYJA 1VQN3 3NBBA 3FF0A 3GZRA 1QAFA 5JPPA 1BIRA 1RNTA 1IV7A 1BSAA 1PY3A 1Y4KA 1UCJA 1W02A 3B7CA 4RNTA 2K0MA 3FH1A 4XBTA 1ZO2A 3NV0B 1Q7HA 1LXEA 2P05A 2GBWB 2ML5A 3V98A 3CCL3 1GMQA 4EBGA 4WHAA 3JUQA 4WYKB 1YIJ3 1RGLA 3CPW2 3UB1A 4RNYA 1ISKA 1CH0A 4FMBA 2P09A 4HM4B 3EE1A 1T2IA 1C54A 3VGNA 7RNTA 1W6CA 3UNLA 6STDA 1QVG2 5FGOA 4BTWA 1TFOA 2XGNA 3UL6A 1DMQA 1X1WA 4HM1B 3JUMA 3G4S3 3EJVA 5JBSA 3IMAB 1B21A 1QJGA 3K0ZA 3GAXA 3KIIA 5G1KA 3CME3 1Q814 4OK0A 1RKYA 1GY6A 1OPYA 3RGAA 4J5KA 1VQ53 3AMOB 3S27A 5CF1A 2IA7A 1B20A 3FF2A 1G02A 1JNQA 1RNBA 1SIIA 3CCQ3 3VSYA 3SEDA 3NQZA 4FCMA 3UL5A 1BNFA 2KF4A 3F8HA 4WFOA 1VQP3 1AVKA 4XM4A 2I9WA 1W7CA 1HYFA 3LYGA 2XEPA 3CPOA 4KFDA 2RFRA 5KP3A 3CCS3 5ELUA 2GEXA 1IVWA 1TTOA 4K1UA 2OWPA 1CYUA 1KSIA 4JF8A 2HMLB 2W56A 1JN5A 3AHWA 3FLJA 3FG4A 2W03A 3GSPA 1BNGA 2WGOA 1BRSA 3MPHA 4HM2B 4EC6A 1EEJA 1I2GA 2XR8B 5JPUA 4O02B 1UGHI 3OWSA 4HM6B 1UCIA 3Q3FA 5HOHA 1DETA 5CF2A 2CKFB 2Q07A 4NHFA 4XBXA 1GYBA 1LOVA 1UGIA 4K61A 4AEQA 3BNEA 3EN8A 2E2TA 3NBJA 1ULJB 4N3VA 2XSHB 1AY7A 3OXAA 3T8UA 2JDIH 4EV5A 1K28A 1I0XA 3FKAA 3JUNA 3DY5A 1IV9A 3GWRA 3PXMA 4N6OB 1U8CB 4O8SA 4XB5A 7STDA 3PZWA 1R4YA 1NWWA 5EEOA 2Y74A 3U1WA 4R1KA 3DZLA 3WOFB 1FA3A 2W9PA 3AHSA 1FUWA 1JBRA 4CPKA 3X3XA 2AAEA 1V57A 2XRXB 3EN1B 1DVDA 4AKYA 1T2HA 1VQM3 1SQWA 4XBYA 2CWVA 2YFJB 1G0TA 2HMJB 4MMZB 3CCU3 1FGRA 4BTYA 1CYVA 1UCLA 2ML6A 4GL6A 1N5HA 3LH4A 3N8BA 3QK9A 1BRKA 2GBXB 2ZHXB 1A2PA 1RN7A 1EQKA 1HU9A 5M1AA 4CDLA 2CFDA 3OWUA 5BXQA 2F56A 4HM0B 2OQEA 3LZAA 1MGRA 3T8NA 2CWUA 3D4AA 3MYTA 2SARA 3F7SA 1IQ8A 4I5QA 3LTBA 1DE3A 1GOYA 2H0IA 2W9QA 3NBRA 4LGQA 3F7XA 1YJW3 1W00A 2F98A 1LQMB 2CK3H 2OCTA 1GOUA 3EHCA 5M18A 2ZA4A 1TIJA 3F14A 5EQLA 1JB4A 4EV2A 1JJ22 2WOHA 2F5MA 1FUTA 1I2EA 3CCE3 4H3UA 5IERA 1JZOA 2KAAA 1NDOB 3WOEB 1ULIB 1N9JA 1Q9EA 1BNEA 1V74A 2B1XB 1YJ93 5D82A 1B3SA 3K5TA 3NXJA 1DVCA 3CMA3 4EW5A 3RGRA 1BAOA 4I4KA 2QA43 3EQQB 5DREA 1UUGB 1VQ43 3LTAA 4KZ1A 1US1A 1BRIA 1CEWI 2B24B 1K41A 2CH9A 3DGOA 3AGOA 3PS8A 4RZMA 1BSCA 5M19A 2QIYA 1YI23 1OGXA 3BB9A 3N9HA 1RMSA 3JUOA 3BU4A 3EBYA 1NU3A 2Z6BA 1W5ZA 3KCHA 5I97A 3SOYA 4FCZA 1IQYA 3HK4A 1O7HB 4N6NB 1YHQ3 4HZ9B 2P38A 1BOXA 4Q53A 4K1VA 3DGMA 3LTDA 3SLUA 1K8A4 1FW7A 3OV4A 1OF5B 4H61A 1OH0A 1DMMA 1BVIA 3DMCA 1BSDA 3V99A 1RGHA 1TU5A 1D6ZA 1OHPA 1JBSA 3ALAA 1B27A 2O9UX 1BSEA 2BIRA 3JVCA 1I2FA 3BLZA 8CHOA 4WYKA 3ECFA 3Q1CA 1F8NA 1IK3A 2GSPA 4IIAA 3GZBA 1M904 3LXUX 3KE7A 1IVXA 3HZPA 1LOYA 3PYJA 2L1SA 1AQZA 1W6YA 2P0XA 3HIIA 4RNZA 2GU3A 2BMQB 4KFEA 4CJNA 5IENA 1AV4A 2H0GA 5IG3A 1OGZA 4HOHA 4O2HA 1KC84 2JQ5A 1MWUA 1C7HA 2P0MA 5CXOA 5IEPA 1M1XB 2CHCA 3VF1A 2PNCA 1RSNA 1Q42A 4G1MB 1VQ73 1Q40A 3FG3A 1RCLA 1YNVX 3ZG0A 1EUIC 4KVHA 3KFQC 1AVLA 1YGWA 1JV2B 1RN1A 2A15A 5BIRA 2QEX3 3OX9A 3WA3A 3G713 2SBLA 3KSPA 2RSXA 4JRFA 2UX0A 2HMKB 5IG0A 4BTXA 1GMPA 4FMCA 3F8XA 4HZBB 5D81A 3MKIA 4QWTA 3GRDA 4GHOA 2IUJA 4L7KA 1Z1SA 1GSPA 1EG9B 1FYSA 1J2BA 2W2CA 2YFIB 1MOLA 1ZS7A 3I0YA 4J5GA 3MG2A 1OCVA 3S67A 1BUQA 5KP4A 3LT9A 3MG1A 1NB3I 3NM2A 3O8YA 4HVNA 1LNHA 2C10A 1JN5B 2RNTA 2V1LA 2W56B 4R80A 2WO0A 5G2GA 1STDA 5IW9A 1BRJA 4IT7A 1QMAA 4TX4A 1ROVA 2GEYA 1K734 1E3RA 1BSBA 5LC6A 1PU4A 1KWIA 3OWYA 1B2ZA 1RRLA 3LOYA 3EBTA 1JBTA 4GSPA 3K9MC 3KZTA 1SJWA 1UUVB 3I563 2CWTA 5BVBA 1GMRA 1T5YA 1BNSA 2F99A 3E99A 5FW5A 3CCJ3 3CCV3 3FCSB 6GSPA 1MWTA 1FZUA 1GD3A 2XFSA 4HAAA 1S5AA 1BU4A 2CFKA 3SXXA 3D5GA 3WHOA 3FGYA 2E2UA 1RJOA 4MJDA
chains in the Genus database with same CATH topology
3SX1A 4RBNA 3PCRA 1D6UA 3V92A 3CD63 3G0KA 2W6JH 1NO3A 5AIFA 2GXFA 1MNLA 3LTCA 1UW1A 3HX8A 3M8CA 2XSOB 5ELJA 4R4KA 2CW9A 1GY7A 2MF7A 1VZZA 2MC8A 1IDPA 1WTHA 4FMAA 3X3YA 3K63A 1Q824 1JKGA 4MMXB 2BT3A 2Z7AA 1JRQA 1A90A 4L8PA 4L8OA 1QALA 2FNQA 3F9SA 4N6TA 3PGBA 3T0UA 3G16A 5IF6A 3CCM3 3ER7A 2KXGA 1WMOA 2BMOB 3X41A 2BO9B 2CFLA 3WA2X 5IG4A 1CQSA 3FG1A 3X3ZA 1Q864 3HI7A 3B4PA 2STDA 4HM5B 1UI8A 4LMIA 5KP1A 2BHMA 3EF8A 3KN4A 1IVUA 1N8R4 3IJEB 1Q7Y4 4X2HA 5AIGA 2CC3A 1DYUA 4HBRA 2CIUA 1GY5A 4HJLB 3CC73 4HM7B 1VQ83 2R4IA 2W0QA 3U97A 3DXOA 3BNBA 2CG0A 5IEOA 3NX0A 1W2ZA 3OW22 5EVHA 1E3VA 2QGUA 3DGLA 4XDWA 3MHEA 2GU1A 5AYSC 3UJMA 3WMDA 1GS3A 3NM7A 4MMYB 3B4OA 1M9GA 3NV0A 1YIT3 1WNHA 4LEHA 4O3VA 3DGNA 4J9AA 5AYRB 1R4CA 1OF5A 1U5OA 2XH9A 1OUNA 1RRHA 2FGTA 5LC7A 1QVF2 1TUHA 2CFGA 4N6MA 2W04A 1YVBI 1NB5I 1LVNA 2BNGA 5AIHA 2L4VA 5AI1A 1UUWB 3S28A 1SIHA 1PFPA 3LT8A 2IUKA 4N6V0 3MG3A 2Z77A 3X40A 4LSOA 2RGQA 5IG5A 1A2KA 4OUQA 3AMOA 3D9RA 1UI7A 4EXRA 3CNXA 3X42A 1VQ93 2D1WA 2O3OA 1D6YA 3BNCA 2RCDA 3A76A 4J8TA 4U13A 2HMNB 3SVAA 5DRVA 3I553 4NREA 1VQK3 2OTL3 4HM8B 2F86B 2XFTA 4N6LA 1Q40B 1O7MB 1N9EA 1O7NB 1S723 1A67A 1OHSA 2HMMB 2KCDA 3H51A 1OHOA 4FCJA 3KKGA 3EX9A 3N54B 1FGOA 3HIGA 2FXTA 1TFKA 3QRDA 3G8ZA 1W2B2 3NQYA 3D3LA 2OTJ3 1VQ63 1O7WB 3Q90A 1LOXA 1E97A 2Y73A 1IU7A 3BNDA 1EA2A 3EC9A 3NUVA 3FSDA 2XGLA 3WDGB 2D42A 1VQL3 1IQXA 5CLKA 5D83A 1NJI4 2OQEC 5AIIA 1OACA 4CCVA 1GD4A 3S5CA 3CNMA 3S29A 4XDVA 3DUKA 1FGTA 4ZM8A 1AR0A 2LQVA 1DMNA 2K54A 2ZDJA 1YGEA 1YJN3 1ROAA 4R9LA 5TGNA 1ZX2A 1IT8A 4FMDA 3RDEA 4X2OA 1W6GA 2HMOB 2IMJA 2M7OA 3GZYB 3TDGA 4N6UA 4AKZA 1K9M4 3FZWA 2KRTA 1JB2A 1TP6A 2LYXA 1N5PA 2YFLB 2WGQA 4HM3B 1KD14 4GB5A 3CXC2 1A2VA 2OOVC 2C11A 3JUPA 3SOAA 4MEIA 1SPUA 5AEUB 4R9KA 2INXA 3IPTA 2CFWA 1HKXA 2XF3A 4EYCA 2Z76A 1JKGB 3Q2PA 1W4NA 4WWUC 1ASKA 4FR9A 2YX9A 4PEJA 1WMNA 5AEWB 4OVMA 1O7GB 5CK6A 4IPBA 3PCSA 1VQO3 3H3HA 3DM8A 3CCR3 1JB5A 5A0OB 3KSED 3K7CA 2BMRB 2ZL8A 3F40A 3MWZA 3B8LA 1L5GB 3EB8A 4KFFA 3ROBA 3STDA 2WOFA 5STDA 2PZVA 2E2VA 1N8QA 1O7PB 3WODG 3CC23 1WMPA 3L0RA 4HKVB 3CC43 4STDA 4WP5A 4K90B 3MSOA 1IVVA 2CG1A 1FGQA 2OOVA 3NHXA 1WQLB 3J7Yd 1FGMA 3LMLA 4ORLA 3G6E3 1G96A 1M1K4 1KQS2 5HGRA 4HYZA 3GZXB 3CU3A 1IT7A 1STFI 1QAKA 1EKMA 1W01A 4LZIA 1VQN3 3NBBA 3FF0A 3GZRA 1QAFA 5JPPA 1IV7A 1Y4KA 1W02A 3B7CA 2K0MA 3FH1A 4XBTA 1ZO2A 3NV0B 2P05A 1LXEA 3V98A 2GBWB 2ML5A 3CCL3 4EBGA 4WHAA 3JUQA 4WYKB 1YIJ3 3CPW2 3UB1A 4RNYA 1ISKA 4FMBA 2P09A 4HM4B 3EE1A 3VGNA 1W6CA 3UNLA 6STDA 1QVG2 5FGOA 4BTWA 1TFOA 2XGNA 3UL6A 1DMQA 4HM1B 3JUMA 3G4S3 3EJVA 5JBSA 3IMAB 1QJGA 3K0ZA 3GAXA 3KIIA 3CME3 1Q814 4OK0A 1RKYA 1GY6A 1OPYA 3RGAA 1VQ53 3AMOB 3S27A 5CF1A 2IA7A 3FF2A 1JNQA 1SIIA 3CCQ3 3VSYA 3SEDA 3NQZA 4FCMA 3UL5A 1VQP3 3F8HA 4WFOA 1AVKA 4XM4A 2I9WA 1W7CA 3LYGA 4KFDA 2XEPA 3CPOA 2RFRA 5KP3A 3CCS3 5ELUA 2GEXA 1IVWA 4K1UA 2OWPA 1CYUA 1KSIA 4JF8A 2HMLB 2W56A 1JN5A 3FG4A 3FLJA 2W03A 2WGOA 3MPHA 4HM2B 5JPUA 4EC6A 2XR8B 4O02B 3OWSA 4HM6B 5CF2A 2CKFB 2Q07A 4NHFA 4XBXA 1GYBA 4AEQA 4K61A 3BNEA 3EN8A 2E2TA 3NBJA 1ULJB 4N3VA 2XSHB 3OXAA 3T8UA 2JDIH 4EV5A 1K28A 3FKAA 3JUNA 3DY5A 1IV9A 3GWRA 3PXMA 4N6OB 1U8CB 4O8SA 4XB5A 7STDA 3PZWA 5EEOA 1NWWA 2Y74A 3U1WA 4R1KA 3DZLA 3WOFB 1FA3A 2W9PA 1FUWA 3X3XA 3EN1B 2XRXB 1DVDA 4AKYA 1VQM3 1SQWA 4XBYA 2CWVA 2YFJB 2HMJB 4MMZB 3CCU3 1FGRA 4BTYA 1CYVA 2ML6A 4GL6A 1N5HA 3LH4A 3N8BA 3QK9A 2GBXB 1RN7A 1EQKA 1HU9A 4CDLA 2CFDA 3OWUA 5BXQA 4HM0B 2OQEA 3LZAA 3T8NA 2CWUA 3MYTA 3F7SA 1IQ8A 3LTBA 2W9QA 3NBRA 4LGQA 3F7XA 1YJW3 1W00A 2F98A 2CK3H 2OCTA 3EHCA 1TIJA 3F14A 5EQLA 1JB4A 4EV2A 1JJ22 2WOHA 3CCE3 4H3UA 5IERA 1NDOB 3WOEB 1ULIB 1N9JA 1V74A 2B1XB 1YJ93 5D82A 3K5TA 3NXJA 1DVCA 3CMA3 3RGRA 4I4KA 2QA43 3EQQB 5DREA 1VQ43 3LTAA 4KZ1A 1US1A 1CEWI 2B24B 1K41A 2CH9A 3DGOA 3PS8A 4RZMA 2QIYA 1YI23 1OGXA 3BB9A 3N9HA 3JUOA 3EBYA 1NU3A 2Z6BA 1W5ZA 5I97A 3SOYA 4FCZA 1IQYA 3HK4A 1O7HB 4N6NB 1YHQ3 4HZ9B 2P38A 4Q53A 4K1VA 3DGMA 3LTDA 3SLUA 1K8A4 3OV4A 1OF5B 4H61A 1OH0A 1DMMA 3DMCA 3V99A 1TU5A 1D6ZA 1OHPA 3ALAA 2O9UX 3JVCA 8CHOA 3BLZA 4WYKA 3ECFA 3Q1CA 1F8NA 1IK3A 4IIAA 3GZBA 1M904 3LXUX 3KE7A 1IVXA 3HZPA 3PYJA 2P0XA 3HIIA 1W6YA 4RNZA 5IENA 2GU3A 2BMQB 4KFEA 1AV4A 5IG3A 1OGZA 4O2HA 1KC84 2JQ5A 1C7HA 2P0MA 5CXOA 5IEPA 1M1XB 2CHCA 3VF1A 2PNCA 1Q42A 4G1MB 1VQ73 1Q40A 3FG3A 4KVHA 3KFQC 1AVLA 1JV2B 2A15A 2QEX3 3OX9A 3WA3A 3G713 2SBLA 3KSPA 2RSXA 4JRFA 2UX0A 2HMKB 5IG0A 4BTXA 4FMCA 3F8XA 4HZBB 5D81A 3MKIA 4QWTA 3GRDA 2IUJA 4L7KA 1Z1SA 1EG9B 1J2BA 2W2CA 2YFIB 1MOLA 3I0YA 3S67A 3MG2A 1OCVA 1BUQA 5KP4A 3LT9A 3MG1A 1NB3I 3NM2A 3O8YA 4HVNA 1LNHA 2C10A 1JN5B 2W56B 2V1LA 4R80A 5G2GA 2WO0A 1STDA 5IW9A 4IT7A 1QMAA 4TX4A 1ROVA 2GEYA 1K734 1E3RA 5LC6A 1PU4A 1KWIA 3OWYA 3LOYA 1RRLA 3EBTA 3K9MC 3KZTA 1SJWA 1UUVB 3I563 2CWTA 5BVBA 3E99A 1T5YA 2F99A 3CCJ3 3CCV3 5FW5A 3FCSB 1GD3A 2XFSA 1S5AA 2CFKA 3SXXA 3FGYA 2E2UA 1RJOA 4MJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0K A;  5AIF A;  2GXF A;  3HX8 A;  3M8C A;  2XSO B;  1GY7 A;  1VZZ A;  1IDP A;  1JKG A;  2Z7A A;  4L8P A;  4L8O A;  3F9S A;  3G16 A;  5IF6 A;  3ER7 A;  2BMO B;  5IG4 A;  1CQS A;  3B4P A;  2STD A;  4HM5 B;  4LMI A;  5KP1 A;  3EF8 A;  4X2H A;  5AIG A;  1GY5 A;  4HJL B;  4HM7 B;  2R4I A;  3DXO A;  5IEO A;  5EVH A;  1E3V A;  2QGU A;  4XDW A;  3MHE A;  3UJM A;  3WMD A;  1GS3 A;  3B4O A;  3NV0 A;  4LEH A;  4J9A A;  1OF5 A;  1U5O A;  1OUN A;  1TUH A;  2BNG A;  5AIH A;  5AI1 A;  1UUW B;  3MG3 A;  2Z77 A;  2RGQ A;  5IG5 A;  1A2K A;  4OUQ A;  3D9R A;  3CNX A;  2RCD A;  3A76 A;  4J8T A;  4U13 A;  2HMN B;  5DRV A;  4HM8 B;  2F86 B;  1Q40 B;  1O7M B;  1O7N B;  1OHS A;  2HMM B;  3H51 A;  1OHO A;  4FCJ A;  3KKG A;  3EX9 A;  3G8Z A;  1O7W B;  3Q90 A;  1E97 A;  1EA2 A;  3EC9 A;  3NUV A;  3FSD A;  5CLK A;  5D83 A;  5AII A;  3S5C A;  3CNM A;  4XDV A;  3DUK A;  1AR0 A;  1DMN A;  2K54 A;  4R9L A;  5TGN A;  1ZX2 A;  4X2O A;  2IMJ A;  2HMO B;  3GZY B;  3FZW A;  1JB2 A;  1TP6 A;  2YFL B;  4HM3 B;  4GB5 A;  3JUP A;  3SOA A;  5AEU B;  4R9K A;  2INX A;  3IPT A;  1HKX A;  2Z76 A;  1JKG B;  4WWU C;  1ASK A;  4PEJ A;  5AEW B;  4OVM A;  1O7G B;  5CK6 A;  3H3H A;  3DM8 A;  1JB5 A;  3K7C A;  2BMR B;  3F40 A;  3B8L A;  3ROB A;  3STD A;  5STD A;  2PZV A;  1O7P B;  4HKV B;  4STD A;  4WP5 A;  3MSO A;  3NHX A;  1WQL B;  4ORL A;  5HGR A;  3GZX B;  3CU3 A;  1W01 A;  3FF0 A;  3GZR A;  5JPP A;  1W02 A;  3B7C A;  3FH1 A;  4XBT A;  1ZO2 A;  3NV0 B;  2GBW B;  3JUQ A;  4WYK B;  1ISK A;  4HM4 B;  3VGN A;  3UNL A;  6STD A;  1DMQ A;  4HM1 B;  3JUM A;  3EJV A;  1QJG A;  3K0Z A;  1GY6 A;  1OPY A;  3RGA A;  5CF1 A;  3FF2 A;  3VSY A;  3SED A;  4FCM A;  3F8H A;  4XM4 A;  2I9W A;  3LYG A;  3CPO A;  2RFR A;  5KP3 A;  2GEX A;  4K1U A;  2OWP A;  2HML B;  1JN5 A;  3FLJ A;  4HM2 B;  5JPU A;  2XR8 B;  3OWS A;  4HM6 B;  5CF2 A;  2CKF B;  4XBX A;  1GYB A;  3EN8 A;  1ULJ B;  4N3V A;  2XSH B;  3OXA A;  3T8U A;  3FKA A;  3JUN A;  3GWR A;  4XB5 A;  7STD A;  1NWW A;  4R1K A;  3DZL A;  3EN1 B;  2XRX B;  4XBY A;  2YFJ B;  2HMJ B;  2GBX B;  4CDL A;  3OWU A;  5BXQ A;  4HM0 B;  3LZA A;  3T8N A;  3MYT A;  3F7S A;  3NBR A;  4LGQ A;  3F7X A;  1W00 A;  2F98 A;  3EHC A;  3F14 A;  1JB4 A;  4H3U A;  5IER A;  1NDO B;  1ULI B;  2B1X B;  5D82 A;  3NXJ A;  3RGR A;  4I4K A;  3EQQ B;  5DRE A;  2B24 B;  1K41 A;  4RZM A;  2QIY A;  1OGX A;  3BB9 A;  3JUO A;  3EBY A;  1NU3 A;  3SOY A;  3HK4 A;  1O7H B;  4HZ9 B;  4Q53 A;  4K1V A;  3OV4 A;  1OF5 B;  1OH0 A;  1DMM A;  3DMC A;  1OHP A;  8CHO A;  3BLZ A;  4WYK A;  3ECF A;  4IIA A;  3GZB A;  3KE7 A;  3HZP A;  1W6Y A;  5IEN A;  2BMQ B;  5IG3 A;  1OGZ A;  2JQ5 A;  1C7H A;  5CXO A;  5IEP A;  2CHC A;  1Q42 A;  1Q40 A;  4KVH A;  2A15 A;  3OX9 A;  3KSP A;  2UX0 A;  2HMK B;  5IG0 A;  3F8X A;  4HZB B;  5D81 A;  3MKI A;  3GRD A;  4L7K A;  1Z1S A;  1EG9 B;  2W2C A;  2YFI B;  3I0Y A;  3MG2 A;  1OCV A;  1BUQ A;  5KP4 A;  3MG1 A;  3NM2 A;  4HVN A;  1JN5 B;  5G2G A;  1STD A;  1QMA A;  2GEY A;  1E3R A;  3OWY A;  3EBT A;  3KZT A;  1SJW A;  1UUV B;  5BVB A;  3E99 A;  2F99 A;  5FW5 A;  1S5A A;  3FGY A;  4MJD A; 
#chains in the Genus database with same CATH topology
 3SX1 A;  4RBN A;  1LOW A;  3PCR A;  1D6U A;  3V92 A;  3CD6 3;  3G0K A;  1LNI A;  2W6J H;  1NO3 A;  1B2U A;  5AIF A;  1BNI A;  2GXF A;  1MNL A;  3LTC A;  1UW1 A;  3HX8 A;  3M8C A;  2XSO B;  5ELJ A;  1B2S A;  4R4K A;  2CW9 A;  8RNT A;  1GY7 A;  2MF7 A;  1VZZ A;  2MC8 A;  1IDP A;  1BRG A;  1WTH A;  4FMA A;  3X3Y A;  3ZG5 A;  3K63 A;  1Q82 4;  1JKG A;  1I8V A;  1RTU A;  4MMX B;  1RGG A;  2BT3 A;  2Z7A A;  1ZGX A;  1JRQ A;  3DGY A;  1A90 A;  3DH2 A;  1RLS A;  4L8P A;  4L8O A;  1QAL A;  1MGW A;  2FNQ A;  3F9S A;  3PGB A;  4N6T A;  3T0U A;  3G16 A;  5IF6 A;  3CCM 3;  3ER7 A;  2KXG A;  1WMO A;  1RGA A;  1BAN A;  2BMO B;  2BO9 B;  1UDI I;  2CFL A;  3WA2 X;  3X41 A;  5IG4 A;  2F4Y A;  1CQS A;  3FG1 A;  1BRH A;  3SYU A;  3X3Z A;  1Q86 4;  3HI7 A;  2K3D A;  3B4P A;  2STD A;  4HM5 B;  1UI8 A;  4LMI A;  5KP1 A;  4KT3 B;  2BHM A;  3EF8 A;  3KN4 A;  1IVU A;  1N8R 4;  3URP A;  3IJE B;  1Q7Y 4;  1I70 A;  4X2H A;  1RCK A;  5AIG A;  2CC3 A;  1DYU A;  4HBR A;  2CIU A;  1GY5 A;  4HJL B;  3CC7 3;  6RNT A;  4HM7 B;  9RNT A;  1VQ8 3;  2R4I A;  2W0Q A;  3U97 A;  3DXO A;  3BNB A;  2CG0 A;  1RGF A;  1GOV A;  1T3B A;  5IEO A;  3NX0 A;  1W2Z A;  3OW2 2;  1I3F A;  5EVH A;  1E3V A;  2QGU A;  3DGL A;  4XDW A;  3MHE A;  1UCK A;  2GU1 A;  5AYS C;  3UJM A;  1MWS A;  1RGE A;  1RN4 A;  1GS3 A;  3WMD A;  3NM7 A;  1I3I A;  4MMY B;  3B4O A;  2BU4 A;  5BU4 A;  1M9G A;  3NV0 A;  1HZ1 A;  1YIT 3;  1WNH A;  4LEH A;  2RBI A;  4O3V A;  1PYL A;  3DGN A;  4J9A A;  5AYR B;  1NNV A;  1R4C A;  1OF5 A;  2HOH A;  1U5O A;  2XH9 A;  3BIR A;  1OUN A;  1RRH A;  3ZFZ A;  2FGT A;  5LC7 A;  4DKI A;  1TUH A;  1QVF 2;  2CFG A;  4N6M A;  2W04 A;  1YVB I;  1NB5 I;  1IYY A;  1LVN A;  2BNG A;  5AIH A;  2L4V A;  5AI1 A;  1LRA A;  1UUW B;  3S28 A;  1SIH A;  1PFP A;  3LT8 A;  2IUK A;  4N6V 0;  1RGK A;  2Z77 A;  3MG3 A;  3X40 A;  4LSO A;  2RGQ A;  5IG5 A;  1A2K A;  4OUQ A;  1YVS A;  3AMO A;  3D9R A;  1RGC A;  1UI7 A;  1SAR A;  4EXR A;  2CX0 A;  1B2M A;  3CNX A;  3X42 A;  4LYL B;  1VQ9 3;  2D1W A;  3AGN A;  2O3O A;  1D6Y A;  3BNC A;  2RCD A;  3A76 A;  4J8T A;  4U13 A;  1V58 A;  2HMN B;  5G1L A;  3SVA A;  5DRV A;  3I55 3;  4NRE A;  1VQK 3;  2OTL 3;  4HM8 B;  2F86 B;  2XFT A;  2F5W A;  4N6L A;  1VQQ A;  1Q40 B;  1TJD A;  1O7M B;  1X1X A;  1N9E A;  1O7N B;  2UUG C;  1S72 3;  1A67 A;  1OHS A;  2HMM B;  2KCD A;  3H51 A;  1OHO A;  4FCJ A;  3KKG A;  3EX9 A;  2AAD A;  4BL2 A;  3N54 B;  1FGO A;  3HIG A;  2FXT A;  1TFK A;  4BL3 A;  3QRD A;  3G8Z A;  3D5I A;  1W2B 2;  3NQY A;  3D3L A;  2OTJ 3;  2IY2 A;  4BIR A;  1VQ6 3;  1O7W B;  2UGI A;  3Q90 A;  2KF3 A;  3RNT A;  1LOX A;  1E97 A;  2Y73 A;  1IU7 A;  1BNJ A;  3BND A;  1EA2 A;  3EC9 A;  1I0V A;  4BU4 A;  3NUV A;  3FSD A;  2XGL A;  3WDG B;  1RHL A;  2D42 A;  1VQL 3;  1IQX A;  5CLK A;  3D79 A;  5D83 A;  1NJI 4;  2OQE C;  5AII A;  1OAC A;  4CCV A;  1GD4 A;  3S5C A;  3CNM A;  3S29 A;  4XDV A;  3DUK A;  1FGT A;  4ZM8 A;  1X1U A;  4NPB A;  4ILF A;  1TRQ A;  1AR0 A;  2LQV A;  1DMN A;  1B2X A;  2K54 A;  1JZD A;  2ZDJ A;  1YGE A;  3HOH A;  1YJN 3;  1ROA A;  4R9L A;  5TGN A;  1ZX2 A;  1IT8 A;  4FMD A;  3RDE A;  4X2O A;  1W6G A;  2HMO B;  2IMJ A;  2M7O A;  3GZY B;  3TDG A;  4N6U A;  1LQG C;  4AKZ A;  7GSP A;  3FZW A;  2KRT A;  1JB2 A;  1TP6 A;  2LYX A;  1N5P A;  2YFL B;  2WGQ A;  2R41 A;  4HM3 B;  1KD1 4;  4GB5 A;  3CXC 2;  1A2V A;  2OOV C;  2C11 A;  3JUP A;  3SOA A;  4MEI A;  1SPU A;  5AEU B;  4R9K A;  2INX A;  3IPT A;  2CFW A;  1HKX A;  1X1Y A;  2XF3 A;  4EYC A;  2Z76 A;  1JKG B;  3Q2P A;  2C4B A;  1W4N A;  4WWU C;  1ASK A;  4FR9 A;  2YX9 A;  4PEJ A;  1WMN A;  5AEW B;  4OVM A;  1O7G B;  1BNR A;  5CK6 A;  4IPB A;  3PCS A;  1VQO 3;  1MWR A;  3H3H A;  3DM8 A;  3CCR 3;  1JB5 A;  5A0O B;  1RDS A;  2KF5 A;  3KSE D;  3K7C A;  2BMR B;  2ZL8 A;  3F40 A;  3MWZ A;  3B8L A;  1L5G B;  1BRN L;  3EB8 A;  4KFF A;  5GSP A;  3ROB A;  2WOF A;  5STD A;  2PZV A;  3STD A;  1BUJ A;  2E2V A;  1TRP A;  1N8Q A;  1O7P B;  3WOD G;  3CC2 3;  1WMP A;  3L0R A;  2KF6 A;  4HKV B;  1K9M 4;  3CC4 3;  4STD A;  4WP5 A;  4K90 B;  3MSO A;  1IVV A;  1FUS A;  2CG1 A;  5RNT A;  2CX1 A;  1FGQ A;  2OOV A;  3NHX A;  2J8X B;  1WQL B;  3A5E A;  3J7Y d;  1FGM A;  3LML A;  4ORL A;  3G6E 3;  1G96 A;  2H0H A;  1M1K 4;  1KQS 2;  5HGR A;  4HYZ A;  3GZX B;  3CU3 A;  3WR2 A;  1IT7 A;  1STF I;  1QAK A;  1EKM A;  1BGS A;  1W01 A;  4LZI A;  2IYJ A;  1VQN 3;  3NBB A;  3FF0 A;  3GZR A;  1QAF A;  5JPP A;  1BIR A;  1RNT A;  1IV7 A;  1BSA A;  1PY3 A;  1Y4K A;  1UCJ A;  1W02 A;  3B7C A;  4RNT A;  2K0M A;  3FH1 A;  4XBT A;  1ZO2 A;  3NV0 B;  1Q7H A;  1LXE A;  2P05 A;  2GBW B;  2ML5 A;  3V98 A;  3CCL 3;  1GMQ A;  4EBG A;  4WHA A;  3JUQ A;  4WYK B;  1YIJ 3;  1RGL A;  3CPW 2;  3UB1 A;  4RNY A;  1ISK A;  1CH0 A;  4FMB A;  2P09 A;  4HM4 B;  3EE1 A;  1T2I A;  1C54 A;  3VGN A;  7RNT A;  1W6C A;  3UNL A;  6STD A;  1QVG 2;  5FGO A;  4BTW A;  1TFO A;  2XGN A;  3UL6 A;  1DMQ A;  1X1W A;  4HM1 B;  3JUM A;  3G4S 3;  3EJV A;  5JBS A;  3IMA B;  1B21 A;  1QJG A;  3K0Z A;  3GAX A;  3KII A;  5G1K A;  3CME 3;  1Q81 4;  4OK0 A;  1RKY A;  1GY6 A;  1OPY A;  3RGA A;  4J5K A;  1VQ5 3;  3AMO B;  3S27 A;  5CF1 A;  2IA7 A;  1B20 A;  3FF2 A;  1G02 A;  1JNQ A;  1RNB A;  1SII A;  3CCQ 3;  3VSY A;  3SED A;  3NQZ A;  4FCM A;  3UL5 A;  1BNF A;  2KF4 A;  3F8H A;  4WFO A;  1VQP 3;  1AVK A;  4XM4 A;  2I9W A;  1W7C A;  1HYF A;  3LYG A;  2XEP A;  3CPO A;  4KFD A;  2RFR A;  5KP3 A;  3CCS 3;  5ELU A;  2GEX A;  1IVW A;  1TTO A;  4K1U A;  2OWP A;  1CYU A;  1KSI A;  4JF8 A;  2HML B;  2W56 A;  1JN5 A;  3AHW A;  3FLJ A;  3FG4 A;  2W03 A;  3GSP A;  1BNG A;  2WGO A;  1BRS A;  3MPH A;  4HM2 B;  4EC6 A;  1EEJ A;  1I2G A;  2XR8 B;  5JPU A;  4O02 B;  1UGH I;  3OWS A;  4HM6 B;  1UCI A;  3Q3F A;  5HOH A;  1DET A;  5CF2 A;  2CKF B;  2Q07 A;  4NHF A;  4XBX A;  1GYB A;  1LOV A;  1UGI A;  4K61 A;  4AEQ A;  3BNE A;  3EN8 A;  2E2T A;  3NBJ A;  1ULJ B;  4N3V A;  2XSH B;  1AY7 A;  3OXA A;  3T8U A;  2JDI H;  4EV5 A;  1K28 A;  1I0X A;  3FKA A;  3JUN A;  3DY5 A;  1IV9 A;  3GWR A;  3PXM A;  4N6O B;  1U8C B;  4O8S A;  4XB5 A;  7STD A;  3PZW A;  1R4Y A;  1NWW A;  5EEO A;  2Y74 A;  3U1W A;  4R1K A;  3DZL A;  3WOF B;  1FA3 A;  2W9P A;  3AHS A;  1FUW A;  1JBR A;  4CPK A;  3X3X A;  2AAE A;  1V57 A;  2XRX B;  3EN1 B;  1DVD A;  4AKY A;  1T2H A;  1VQM 3;  1SQW A;  4XBY A;  2CWV A;  2YFJ B;  1G0T A;  2HMJ B;  4MMZ B;  3CCU 3;  1FGR A;  4BTY A;  1CYV A;  1UCL A;  2ML6 A;  4GL6 A;  1N5H A;  3LH4 A;  3N8B A;  3QK9 A;  1BRK A;  2GBX B;  2ZHX B;  1A2P A;  1RN7 A;  1EQK A;  1HU9 A;  5M1A A;  4CDL A;  2CFD A;  3OWU A;  5BXQ A;  2F56 A;  4HM0 B;  2OQE A;  3LZA A;  1MGR A;  3T8N A;  2CWU A;  3D4A A;  3MYT A;  2SAR A;  3F7S A;  1IQ8 A;  4I5Q A;  3LTB A;  1DE3 A;  1GOY A;  2H0I A;  2W9Q A;  3NBR A;  4LGQ A;  3F7X A;  1YJW 3;  1W00 A;  2F98 A;  1LQM B;  2CK3 H;  2OCT A;  1GOU A;  3EHC A;  5M18 A;  2ZA4 A;  1TIJ A;  3F14 A;  5EQL A;  1JB4 A;  4EV2 A;  1JJ2 2;  2WOH A;  2F5M A;  1FUT A;  1I2E A;  3CCE 3;  4H3U A;  5IER A;  1JZO A;  2KAA A;  1NDO B;  3WOE B;  1ULI B;  1N9J A;  1Q9E A;  1BNE A;  1V74 A;  2B1X B;  1YJ9 3;  5D82 A;  1B3S A;  3K5T A;  3NXJ A;  1DVC A;  3CMA 3;  4EW5 A;  3RGR A;  1BAO A;  4I4K A;  2QA4 3;  3EQQ B;  5DRE A;  1UUG B;  1VQ4 3;  3LTA A;  4KZ1 A;  1US1 A;  1BRI A;  1CEW I;  2B24 B;  1K41 A;  2CH9 A;  3DGO A;  3AGO A;  3PS8 A;  4RZM A;  1BSC A;  5M19 A;  2QIY A;  1YI2 3;  1OGX A;  3BB9 A;  3N9H A;  1RMS A;  3JUO A;  3BU4 A;  3EBY A;  1NU3 A;  2Z6B A;  1W5Z A;  3KCH A;  5I97 A;  3SOY A;  4FCZ A;  1IQY A;  3HK4 A;  1O7H B;  4N6N B;  1YHQ 3;  4HZ9 B;  2P38 A;  1BOX A;  4Q53 A;  4K1V A;  3DGM A;  3LTD A;  3SLU A;  1K8A 4;  1FW7 A;  3OV4 A;  1OF5 B;  4H61 A;  1OH0 A;  1DMM A;  1BVI A;  3DMC A;  1BSD A;  3V99 A;  1RGH A;  1TU5 A;  1D6Z A;  1OHP A;  1JBS A;  3ALA A;  1B27 A;  2O9U X;  1BSE A;  2BIR A;  3JVC A;  1I2F A;  3BLZ A;  8CHO A;  4WYK A;  3ECF A;  3Q1C A;  1F8N A;  1IK3 A;  2GSP A;  4IIA A;  3GZB A;  1M90 4;  3LXU X;  3KE7 A;  1IVX A;  3HZP A;  1LOY A;  3PYJ A;  2L1S A;  1AQZ A;  1W6Y A;  2P0X A;  3HII A;  4RNZ A;  2GU3 A;  2BMQ B;  4KFE A;  4CJN A;  5IEN A;  1AV4 A;  2H0G A;  5IG3 A;  1OGZ A;  4HOH A;  4O2H A;  1KC8 4;  2JQ5 A;  1MWU A;  1C7H A;  2P0M A;  5CXO A;  5IEP A;  1M1X B;  2CHC A;  3VF1 A;  2PNC A;  1RSN A;  1Q42 A;  4G1M B;  1VQ7 3;  1Q40 A;  3FG3 A;  1RCL A;  1YNV X;  3ZG0 A;  1EUI C;  4KVH A;  3KFQ C;  1AVL A;  1YGW A;  1JV2 B;  1RN1 A;  2A15 A;  5BIR A;  2QEX 3;  3OX9 A;  3WA3 A;  3G71 3;  2SBL A;  3KSP A;  2RSX A;  4JRF A;  2UX0 A;  2HMK B;  5IG0 A;  4BTX A;  1GMP A;  4FMC A;  3F8X A;  4HZB B;  5D81 A;  3MKI A;  4QWT A;  3GRD A;  4GHO A;  2IUJ A;  4L7K A;  1Z1S A;  1GSP A;  1EG9 B;  1FYS A;  1J2B A;  2W2C A;  2YFI B;  1MOL A;  1ZS7 A;  3I0Y A;  4J5G A;  3MG2 A;  1OCV A;  3S67 A;  1BUQ A;  5KP4 A;  3LT9 A;  3MG1 A;  1NB3 I;  3NM2 A;  3O8Y A;  4HVN A;  1LNH A;  2C10 A;  1JN5 B;  2RNT A;  2V1L A;  2W56 B;  4R80 A;  2WO0 A;  5G2G A;  1STD A;  5IW9 A;  1BRJ A;  4IT7 A;  1QMA A;  4TX4 A;  1ROV A;  2GEY A;  1K73 4;  1E3R A;  1BSB A;  5LC6 A;  1PU4 A;  1KWI A;  3OWY A;  1B2Z A;  1RRL A;  3LOY A;  3EBT A;  1JBT A;  4GSP A;  3K9M C;  3KZT A;  1SJW A;  1UUV B;  3I56 3;  2CWT A;  5BVB A;  1GMR A;  1T5Y A;  1BNS A;  2F99 A;  3E99 A;  5FW5 A;  3CCJ 3;  3CCV 3;  3FCS B;  6GSP A;  1MWT A;  1FZU A;  1GD3 A;  2XFS A;  4HAA A;  1S5A A;  1BU4 A;  2CFK A;  3SXX A;  3D5G A;  3WHO A;  3FGY A;  2E2U A;  1RJO A;  4MJD A; 
#chains in the Genus database with same CATH homology
 3SX1 A;  4RBN A;  3PCR A;  1D6U A;  3V92 A;  3CD6 3;  3G0K A;  2W6J H;  1NO3 A;  5AIF A;  2GXF A;  1MNL A;  3LTC A;  1UW1 A;  3HX8 A;  3M8C A;  2XSO B;  5ELJ A;  4R4K A;  2CW9 A;  1GY7 A;  2MF7 A;  1VZZ A;  2MC8 A;  1IDP A;  1WTH A;  4FMA A;  3X3Y A;  3K63 A;  1Q82 4;  1JKG A;  4MMX B;  2BT3 A;  2Z7A A;  1JRQ A;  1A90 A;  4L8P A;  4L8O A;  1QAL A;  2FNQ A;  3F9S A;  4N6T A;  3PGB A;  3T0U A;  3G16 A;  5IF6 A;  3CCM 3;  3ER7 A;  2KXG A;  1WMO A;  2BMO B;  3X41 A;  2BO9 B;  2CFL A;  3WA2 X;  5IG4 A;  1CQS A;  3FG1 A;  3X3Z A;  1Q86 4;  3HI7 A;  3B4P A;  2STD A;  4HM5 B;  1UI8 A;  4LMI A;  5KP1 A;  2BHM A;  3EF8 A;  3KN4 A;  1IVU A;  1N8R 4;  3IJE B;  1Q7Y 4;  4X2H A;  5AIG A;  2CC3 A;  1DYU A;  4HBR A;  2CIU A;  1GY5 A;  4HJL B;  3CC7 3;  4HM7 B;  1VQ8 3;  2R4I A;  2W0Q A;  3U97 A;  3DXO A;  3BNB A;  2CG0 A;  5IEO A;  3NX0 A;  1W2Z A;  3OW2 2;  5EVH A;  1E3V A;  2QGU A;  3DGL A;  4XDW A;  3MHE A;  2GU1 A;  5AYS C;  3UJM A;  3WMD A;  1GS3 A;  3NM7 A;  4MMY B;  3B4O A;  1M9G A;  3NV0 A;  1YIT 3;  1WNH A;  4LEH A;  4O3V A;  3DGN A;  4J9A A;  5AYR B;  1R4C A;  1OF5 A;  1U5O A;  2XH9 A;  1OUN A;  1RRH A;  2FGT A;  5LC7 A;  1QVF 2;  1TUH A;  2CFG A;  4N6M A;  2W04 A;  1YVB I;  1NB5 I;  1LVN A;  2BNG A;  5AIH A;  2L4V A;  5AI1 A;  1UUW B;  3S28 A;  1SIH A;  1PFP A;  3LT8 A;  2IUK A;  4N6V 0;  3MG3 A;  2Z77 A;  3X40 A;  4LSO A;  2RGQ A;  5IG5 A;  1A2K A;  4OUQ A;  3AMO A;  3D9R A;  1UI7 A;  4EXR A;  3CNX A;  3X42 A;  1VQ9 3;  2D1W A;  2O3O A;  1D6Y A;  3BNC A;  2RCD A;  3A76 A;  4J8T A;  4U13 A;  2HMN B;  3SVA A;  5DRV A;  3I55 3;  4NRE A;  1VQK 3;  2OTL 3;  4HM8 B;  2F86 B;  2XFT A;  4N6L A;  1Q40 B;  1O7M B;  1N9E A;  1O7N B;  1S72 3;  1A67 A;  1OHS A;  2HMM B;  2KCD A;  3H51 A;  1OHO A;  4FCJ A;  3KKG A;  3EX9 A;  3N54 B;  1FGO A;  3HIG A;  2FXT A;  1TFK A;  3QRD A;  3G8Z A;  1W2B 2;  3NQY A;  3D3L A;  2OTJ 3;  1VQ6 3;  1O7W B;  3Q90 A;  1LOX A;  1E97 A;  2Y73 A;  1IU7 A;  3BND A;  1EA2 A;  3EC9 A;  3NUV A;  3FSD A;  2XGL A;  3WDG B;  2D42 A;  1VQL 3;  1IQX A;  5CLK A;  5D83 A;  1NJI 4;  2OQE C;  5AII A;  1OAC A;  4CCV A;  1GD4 A;  3S5C A;  3CNM A;  3S29 A;  4XDV A;  3DUK A;  1FGT A;  4ZM8 A;  1AR0 A;  2LQV A;  1DMN A;  2K54 A;  2ZDJ A;  1YGE A;  1YJN 3;  1ROA A;  4R9L A;  5TGN A;  1ZX2 A;  1IT8 A;  4FMD A;  3RDE A;  4X2O A;  1W6G A;  2HMO B;  2IMJ A;  2M7O A;  3GZY B;  3TDG A;  4N6U A;  4AKZ A;  1K9M 4;  3FZW A;  2KRT A;  1JB2 A;  1TP6 A;  2LYX A;  1N5P A;  2YFL B;  2WGQ A;  4HM3 B;  1KD1 4;  4GB5 A;  3CXC 2;  1A2V A;  2OOV C;  2C11 A;  3JUP A;  3SOA A;  4MEI A;  1SPU A;  5AEU B;  4R9K A;  2INX A;  3IPT A;  2CFW A;  1HKX A;  2XF3 A;  4EYC A;  2Z76 A;  1JKG B;  3Q2P A;  1W4N A;  4WWU C;  1ASK A;  4FR9 A;  2YX9 A;  4PEJ A;  1WMN A;  5AEW B;  4OVM A;  1O7G B;  5CK6 A;  4IPB A;  3PCS A;  1VQO 3;  3H3H A;  3DM8 A;  3CCR 3;  1JB5 A;  5A0O B;  3KSE D;  3K7C A;  2BMR B;  2ZL8 A;  3F40 A;  3MWZ A;  3B8L A;  1L5G B;  3EB8 A;  4KFF A;  3ROB A;  3STD A;  2WOF A;  5STD A;  2PZV A;  2E2V A;  1N8Q A;  1O7P B;  3WOD G;  3CC2 3;  1WMP A;  3L0R A;  4HKV B;  3CC4 3;  4STD A;  4WP5 A;  4K90 B;  3MSO A;  1IVV A;  2CG1 A;  1FGQ A;  2OOV A;  3NHX A;  1WQL B;  3J7Y d;  1FGM A;  3LML A;  4ORL A;  3G6E 3;  1G96 A;  1M1K 4;  1KQS 2;  5HGR A;  4HYZ A;  3GZX B;  3CU3 A;  1IT7 A;  1STF I;  1QAK A;  1EKM A;  1W01 A;  4LZI A;  1VQN 3;  3NBB A;  3FF0 A;  3GZR A;  1QAF A;  5JPP A;  1IV7 A;  1Y4K A;  1W02 A;  3B7C A;  2K0M A;  3FH1 A;  4XBT A;  1ZO2 A;  3NV0 B;  2P05 A;  1LXE A;  3V98 A;  2GBW B;  2ML5 A;  3CCL 3;  4EBG A;  4WHA A;  3JUQ A;  4WYK B;  1YIJ 3;  3CPW 2;  3UB1 A;  4RNY A;  1ISK A;  4FMB A;  2P09 A;  4HM4 B;  3EE1 A;  3VGN A;  1W6C A;  3UNL A;  6STD A;  1QVG 2;  5FGO A;  4BTW A;  1TFO A;  2XGN A;  3UL6 A;  1DMQ A;  4HM1 B;  3JUM A;  3G4S 3;  3EJV A;  5JBS A;  3IMA B;  1QJG A;  3K0Z A;  3GAX A;  3KII A;  3CME 3;  1Q81 4;  4OK0 A;  1RKY A;  1GY6 A;  1OPY A;  3RGA A;  1VQ5 3;  3AMO B;  3S27 A;  5CF1 A;  2IA7 A;  3FF2 A;  1JNQ A;  1SII A;  3CCQ 3;  3VSY A;  3SED A;  3NQZ A;  4FCM A;  3UL5 A;  1VQP 3;  3F8H A;  4WFO A;  1AVK A;  4XM4 A;  2I9W A;  1W7C A;  3LYG A;  4KFD A;  2XEP A;  3CPO A;  2RFR A;  5KP3 A;  3CCS 3;  5ELU A;  2GEX A;  1IVW A;  4K1U A;  2OWP A;  1CYU A;  1KSI A;  4JF8 A;  2HML B;  2W56 A;  1JN5 A;  3FG4 A;  3FLJ A;  2W03 A;  2WGO A;  3MPH A;  4HM2 B;  5JPU A;  4EC6 A;  2XR8 B;  4O02 B;  3OWS A;  4HM6 B;  5CF2 A;  2CKF B;  2Q07 A;  4NHF A;  4XBX A;  1GYB A;  4AEQ A;  4K61 A;  3BNE A;  3EN8 A;  2E2T A;  3NBJ A;  1ULJ B;  4N3V A;  2XSH B;  3OXA A;  3T8U A;  2JDI H;  4EV5 A;  1K28 A;  3FKA A;  3JUN A;  3DY5 A;  1IV9 A;  3GWR A;  3PXM A;  4N6O B;  1U8C B;  4O8S A;  4XB5 A;  7STD A;  3PZW A;  5EEO A;  1NWW A;  2Y74 A;  3U1W A;  4R1K A;  3DZL A;  3WOF B;  1FA3 A;  2W9P A;  1FUW A;  3X3X A;  3EN1 B;  2XRX B;  1DVD A;  4AKY A;  1VQM 3;  1SQW A;  4XBY A;  2CWV A;  2YFJ B;  2HMJ B;  4MMZ B;  3CCU 3;  1FGR A;  4BTY A;  1CYV A;  2ML6 A;  4GL6 A;  1N5H A;  3LH4 A;  3N8B A;  3QK9 A;  2GBX B;  1RN7 A;  1EQK A;  1HU9 A;  4CDL A;  2CFD A;  3OWU A;  5BXQ A;  4HM0 B;  2OQE A;  3LZA A;  3T8N A;  2CWU A;  3MYT A;  3F7S A;  1IQ8 A;  3LTB A;  2W9Q A;  3NBR A;  4LGQ A;  3F7X A;  1YJW 3;  1W00 A;  2F98 A;  2CK3 H;  2OCT A;  3EHC A;  1TIJ A;  3F14 A;  5EQL A;  1JB4 A;  4EV2 A;  1JJ2 2;  2WOH A;  3CCE 3;  4H3U A;  5IER A;  1NDO B;  3WOE B;  1ULI B;  1N9J A;  1V74 A;  2B1X B;  1YJ9 3;  5D82 A;  3K5T A;  3NXJ A;  1DVC A;  3CMA 3;  3RGR A;  4I4K A;  2QA4 3;  3EQQ B;  5DRE A;  1VQ4 3;  3LTA A;  4KZ1 A;  1US1 A;  1CEW I;  2B24 B;  1K41 A;  2CH9 A;  3DGO A;  3PS8 A;  4RZM A;  2QIY A;  1YI2 3;  1OGX A;  3BB9 A;  3N9H A;  3JUO A;  3EBY A;  1NU3 A;  2Z6B A;  1W5Z A;  5I97 A;  3SOY A;  4FCZ A;  1IQY A;  3HK4 A;  1O7H B;  4N6N B;  1YHQ 3;  4HZ9 B;  2P38 A;  4Q53 A;  4K1V A;  3DGM A;  3LTD A;  3SLU A;  1K8A 4;  3OV4 A;  1OF5 B;  4H61 A;  1OH0 A;  1DMM A;  3DMC A;  3V99 A;  1TU5 A;  1D6Z A;  1OHP A;  3ALA A;  2O9U X;  3JVC A;  8CHO A;  3BLZ A;  4WYK A;  3ECF A;  3Q1C A;  1F8N A;  1IK3 A;  4IIA A;  3GZB A;  1M90 4;  3LXU X;  3KE7 A;  1IVX A;  3HZP A;  3PYJ A;  2P0X A;  3HII A;  1W6Y A;  4RNZ A;  5IEN A;  2GU3 A;  2BMQ B;  4KFE A;  1AV4 A;  5IG3 A;  1OGZ A;  4O2H A;  1KC8 4;  2JQ5 A;  1C7H A;  2P0M A;  5CXO A;  5IEP A;  1M1X B;  2CHC A;  3VF1 A;  2PNC A;  1Q42 A;  4G1M B;  1VQ7 3;  1Q40 A;  3FG3 A;  4KVH A;  3KFQ C;  1AVL A;  1JV2 B;  2A15 A;  2QEX 3;  3OX9 A;  3WA3 A;  3G71 3;  2SBL A;  3KSP A;  2RSX A;  4JRF A;  2UX0 A;  2HMK B;  5IG0 A;  4BTX A;  4FMC A;  3F8X A;  4HZB B;  5D81 A;  3MKI A;  4QWT A;  3GRD A;  2IUJ A;  4L7K A;  1Z1S A;  1EG9 B;  1J2B A;  2W2C A;  2YFI B;  1MOL A;  3I0Y A;  3S67 A;  3MG2 A;  1OCV A;  1BUQ A;  5KP4 A;  3LT9 A;  3MG1 A;  1NB3 I;  3NM2 A;  3O8Y A;  4HVN A;  1LNH A;  2C10 A;  1JN5 B;  2W56 B;  2V1L A;  4R80 A;  5G2G A;  2WO0 A;  1STD A;  5IW9 A;  4IT7 A;  1QMA A;  4TX4 A;  1ROV A;  2GEY A;  1K73 4;  1E3R A;  5LC6 A;  1PU4 A;  1KWI A;  3OWY A;  3LOY A;  1RRL A;  3EBT A;  3K9M C;  3KZT A;  1SJW A;  1UUV B;  3I56 3;  2CWT A;  5BVB A;  3E99 A;  1T5Y A;  2F99 A;  3CCJ 3;  3CCV 3;  5FW5 A;  3FCS B;  1GD3 A;  2XFS A;  1S5A A;  2CFK A;  3SXX A;  3FGY A;  2E2U A;  1RJO A;  4MJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...