2HMMB

Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmmB00
1QMAA 3F8XA 3GZYB 4I4KA 1ASKA 3HX8A 1DMQA 4PEJA 5JPUA 3EHCA 2XR8B 1JB2A 5EVHA 3EBYA 5JPPA 3OX9A 1O7MB 5AIIA 2BNGA 4J9AA 3JUNA 3GWRA 3K0ZA 1OGZA 3DXOA 5IEOA 4XB5A 1HKXA 1VZZA 3FF2A 3NV0B 1STDA 3IPTA 3HK4A 3KE7A 5CLKA 5D81A 1JB5A 4HKVB 1GY6A 3BLZA 4MJDA 1ULIB 1S5AA 3S5CA 2RGQA 3F7SA 4L8OA 3NUVA 2BMRB 2BMQB 1ZX2A 2YFIB 3GZXB 1TP6A 2Z7AA 4L7KA 1WQLB 3MG3A 4HM2B 4HZBB 3F9SA 5IG0A 4HM7B 5IERA 3GZRA 4HM0B 3EBTA 1Q40B 3G8ZA 3K7CA 1O7GB 4LMIA 3ER7A 3MG2A 2Z76A 3KSPA 1JKGB 3CNXA 5HGRA 3CPOA 2YFJB 3FGYA 3VGNA 1OHPA 3OV4A 1W02A 7STDA 2F99A 4LEHA 5AIGA 1OF5A 1CQSA 5TGNA 3T8UA 3KKGA 2GXFA 1ISKA 1Q40A 3LYGA 3F14A 4K1UA 4HM1B 3EX9A 4GB5A 3MHEA 3UNLA 2XSOB 4LGQA 2BMOB 4X2OA 2QGUA 4R1KA 5STDA 3M8CA 3OWYA 3EC9A 5KP1A 5IG4A 3NBRA 1EA2A 4XDVA 3GRDA 1UUVB 2OWPA 3JUQA 3MYTA 4WYKB 3D9RA 5IEPA 2RFRA 4OUQA 3JUOA 3DZLA 5FW5A 4XBXA 2INXA 3G0KA 3DM8A 3FH1A 2PZVA 2HMLB 8CHOA 5IG3A 3ROBA 1OH0A 1U5OA 3ECFA 1UUWB 2R4IA 2GEYA 3DMCA 4WYKA 3STDA 5IF6A 3T8NA 1C7HA 4STDA 2XRXB 2RCDA 4IIAA 4Q53A 1K41A 3NV0A 3KZTA 3FF0A 2I9WA 2CHCA 3F8HA 1DMNA 3Q90A 1E3RA 3H51A 1Z1SA 5CF2A 2A15A 1GYBA 3LZAA 2IMJA 1IDPA 5AIHA 3UJMA 4ORLA 1AR0A 1OHOA 1TUHA 3OXAA 2STDA 4WP5A 5G2GA 3DUKA 4U13A 2K54A 2QIYA 3FZWA 5KP4A 5KP3A 2B24B 3MSOA 4X2HA 5CF1A 4HM6B 4HM8B 3VSYA 1OGXA 2HMNB 2GBWB 3OWSA 2UX0A 1A2KA 4XDWA 1EG9B 3NM2A 2W2CA 1GY7A 3I0YA 1JKGA 5AIFA 4HVNA 3RGRA 3NHXA 5DREA 5AI1A 2GEXA 3GZBA 1Q42A 3H3HA 1OCVA 4XM4A 3G16A 4RZMA 1ZO2A 3EQQB 1E3VA 1OHSA 5IG5A 5DRVA 3B7CA 1BUQA 3HZPA 3WMDA 1JN5B 1W00A 4CDLA 4J8TA 4XBYA 1NWWA 3EJVA 3EN1B 2HMJB 3CU3A 5CXOA 2CKFB 3JUPA 2JQ5A 3B4OA 3SEDA 5AEWB 3MG1A 5BXQA 1E97A 4N3VA 4XBTA 4FCJA 3B8LA 2HMKB 1ULJB 3MKIA 2F86B 5D82A 3BB9A 2Z77A 4FCMA 1W01A 1JN5A 3F40A 3A76A 1O7WB 3CNMA 4HM5B 3EF8A 1W6YA 2B1XB 1GY5A 4R9KA 5BVBA 4HZ9B 4HJLB 4K1VA 3FKAA 2XSHB 2HMOB 2YFLB 1JB4A 3RGAA 3SOYA 1GS3A 1NU3A 3FLJA 1O7PB 5D83A 5CK6A 4HM4B 4OVMA 1NDOB 4WWUC 3OWUA 3NXJA 4L8PA 5IENA 3JUMA 1OF5B 1OPYA 4R9LA 2F98A 3EN8A 1SJWA 1DMMA 4HM3B 5AEUB 6STDA 1O7HB 1QJGA 3F7XA 2GBXB 1O7NB 3B4PA 3SOAA 1OUNA 2HMMB 4KVHA 3E99A 3FSDA 4H3UA
chains in the Genus database with same CATH superfamily
1LOVA 4O8SA 2CX0A 4FMDA 3LH4A 2ZA4A 1QMAA 3X3YA 1IVWA 4FCZA 3F8XA 2LQVA 2SBLA 1RGCA 3GZYB 2WGQA 5BU4A 1FZUA 1VQ53 1YVSA 1I3FA 4I4KA 1ASKA 1DVCA 1VQQA 3HX8A 4EXRA 3U97A 1L5GB 5IW9A 1DMQA 2IUKA 4PEJA 3IMAB 1BNIA 3CXC2 1JBTA 3D5IA 3NM7A 5JPUA 2W03A 3AMOB 3EHCA 3N8BA 3D3LA 1YI23 1DVDA 2XR8B 1CYUA 4N6TA 1GOVA 1JB2A 3K5TA 5EVHA 4EV5A 4N6MA 2QA43 2OTJ3 3EBYA 1FUWA 1I8VA 1NB3I 1BU4A 5HOHA 5JPPA 3OX9A 1GMQA 1D6UA 2CH9A 2OQEC 3G4S3 3LMLA 1RNBA 1O7MB 5AIIA 2OQEA 1JV2B 1N5HA 2BNGA 4J9AA 4N6LA 2E2UA 3JUNA 5FGOA 3GWRA 2IA7A 2K0MA 1RDSA 3ALAA 1RSNA 3FCSB 2KXGA 3K0ZA 3PZWA 2F56A 3TDGA 1OGZA 3DXOA 1LQGC 4KFFA 5IEOA 3BNDA 2W04A 4XB5A 1AY7A 1HKXA 1V57A 1Q9EA 1VZZA 3AGNA 3FF2A 4EYCA 1FUSA 1SQWA 2BHMA 1T2HA 1T2IA 1PU4A 3NV0B 1STDA 3AMOA 3IPTA 3DGNA 3HK4A 3CCS3 2KF5A 3KE7A 1W7CA 5CLKA 1NJI4 1T5YA 1LNHA 5D81A 1JB5A 1LNIA 5G1LA 1LOWA 1BVIA 4RNTA 4HKVB 1DE3A 1GY6A 3FG1A 1BGSA 2CWUA 3QK9A 1ZS7A 3BLZA 2P0MA 5M19A 4CCVA 3AHSA 3CCE3 2CIUA 1VQ73 2P05A 4MJDA 4KFDA 4I5QA 1ULIB 1W4NA 1CYVA 3AHWA 5LC6A 4RNYA 1RGFA 1S5AA 4QWTA 3S5CA 2RGQA 3F7SA 1I0VA 4L8OA 1VQM3 7GSPA 2H0HA 1B21A 1RRHA 3NUVA 1A2VA 2BMRB 2BMQB 3CCM3 4WHAA 1IV9A 4K61A 1ZX2A 1VQN3 2YFIB 3NBJA 5JBSA 1W5ZA 3GZXB 1MNLA 1TP6A 1BAOA 2Z7AA 4L7KA 1VQK3 1WQLB 3MG3A 4HM2B 1IK3A 1TFOA 1EKMA 1WNHA 2OOVC 2W56A 3FG4A 3PS8A 2OOVA 4HZBB 3LTAA 4WFOA 3NX0A 1X1XA 1IT7A 2O9UX 3F9SA 7RNTA 1MWUA 5IG0A 3BNCA 4O02B 4DKIA 1WTHA 4HM7B 2C10A 5IERA 3GZRA 3KCHA 4HM0B 3WDGB 4BL2A 1N8R4 2RNTA 3EBTA 1Q40B 3G8ZA 3K7CA 3URPA 1JRQA 1UI8A 1O7GB 2LYXA 4LMIA 1BRNL 4HBRA 3ER7A 2F4YA 2Z76A 3MG2A 1BRIA 1QVG2 3KSPA 1JKGB 1BRSA 2P09A 1VQ43 2RBIA 2CFKA 2R41A 3CPW2 1W2B2 3OW22 2K3DA 3CCQ3 3CNXA 5HGRA 3CPOA 2CC3A 3X42A 2YFJB 3FGYA 3VGNA 1VQ93 3G713 1W6GA 4ZM8A 3PYJA 3LTDA 1OHPA 2IY2A 1IQXA 2KAAA 2W0QA 2XFTA 3OV4A 1FGMA 2GU1A 3I563 1RN4A 1R4CA 1MWTA 1W02A 3UL5A 3HIIA 2F99A 3VF1A 2Z6BA 3Q3FA 1G96A 7STDA 4LEHA 5AIGA 1CQSA 1BRHA 1OF5A 5TGNA 1BNEA 2V1LA 1BNGA 1STFI 3ZG5A 3T8UA 1BANA 1BSEA 3KKGA 4BTXA 4IPBA 2GXFA 1ISKA 4H61A 1Q40A 1X1UA 3LYGA 4BIRA 4CJNA 3F14A 4KFEA 3DGYA 4HM1B 2JDIH 4ILFA 4K1UA 1BSBA 2KRTA 4KT3B 3BNBA 1LQMB 3EX9A 4GB5A 1Q7HA 3MHEA 2W9QA 1YGEA 4GSPA 2XSOB 3UNLA 2MF7A 3D79A 1WMOA 4LGQA 2BMOB 4X2OA 4GHOA 1AVLA 2QGUA 4R1KA 3CC73 2BU4A 5STDA 1M1XB 1JBRA 3M8CA 3EE1A 1IT8A 3Q1CA 1V74A 5GSPA 3OWYA 4BTYA 3EC9A 3SVAA 1Q814 4MEIA 3CD63 5KP1A 3DGMA 5IG4A 1SIIA 2GSPA 1BSDA 1EA2A 1UW1A 2P0XA 2ZHXB 3AGOA 3NBRA 4XDVA 1A67A 1QAKA 3GRDA 1Y4KA 1UUVB 2OWPA 3JUQA 3MYTA 1BUJA 3N54B 4WYKB 3D9RA 1UCKA 5IEPA 1FYSA 2RFRA 4OUQA 2CFLA 3JUOA 3DZLA 4N6OB 1C54A 1GOUA 5FW5A 2KF6A 1UI7A 1AVKA 1CH0A 2INXA 4XBXA 3G0KA 1RGEA 2PNCA 1EEJA 1LOYA 3I553 2Y74A 4RNZA 3DM8A 3WR2A 1W6CA 3FH1A 2F5WA 2PZVA 2UGIA 2HMLB 1K9M4 1FGOA 1UCLA 3LXUX 3WA3A 1KC84 1FGRA 1A90A 1G02A 8CHOA 1A2PA 5IG3A 2OCTA 1YNVX 4MMZB 1OH0A 3ROBA 1U5OA 3ECFA 3ZFZA 1UUWB 1I2FA 2CW9A 1OACA 2R4IA 5AYRB 1D6ZA 1ZGXA 1RGKA 2GEYA 2H0GA 3PCSA 1UUGB 3DMCA 4WYKA 6GSPA 3STDA 4BTWA 5IF6A 3IJEB 1SPUA 1RHLA 1NNVA 3T8NA 2KF4A 3KFQC 3X3ZA 4AKYA 1C7HA 1UGHI 2ZDJA 4STDA 1B2SA 4EBGA 2FXTA 1IQYA 2XRXB 1Q864 2RCDA 1GMPA 4IIAA 4Q53A 3ZG0A 1K41A 2KCDA 1IVVA 2M7OA 1GD4A 1BRKA 3RNTA 3NV0A 3G6E3 1EUIC 3LOYA 3KZTA 1BSAA 2ML6A 3FF0A 2I9WA 3HIGA 2CHCA 3F8HA 3CC23 1DMNA 1VQL3 3DGOA 1RN7A 1G0TA 1E3RA 3Q90A 2BT3A 4FMCA 4N6UA 1WMNA 2E2TA 4JF8A 1IV7A 3S27A 1BNRA 2IUJA 3H51A 1RTUA 4AKZA 1Z1SA 1RCLA 2L4VA 4BU4A 1TRPA 4HYZA 5CF2A 3EB8A 2A15A 3LT8A 1GYBA 1MWRA 3S29A 1TFKA 3SLUA 3LZAA 2IMJA 2CG1A 3V92A 1TIJA 1Q824 1VQ83 1IYYA 1PYLA 1MOLA 1IDPA 4N6V0 5AIHA 3UJMA 1KD14 1LOXA 4ORLA 1B2ZA 1AR0A 1HZ1A 1OHOA 2CFDA 1TUHA 3LTBA 3OXAA 4O3VA 3CCR3 1QVF2 2STDA 4WP5A 5G2GA 1PFPA 3DUKA 2K54A 4U13A 1M9GA 2GU3A 2QIYA 3FZWA 1TTOA 2KF3A 5KP4A 1K734 3DY5A 1IVXA 1RKYA 5KP3A 3D5GA 2B24B 3L0RA 4NHFA 3MSOA 2CX1A 4K90B 1B20A 3SXXA 1B27A 1YIJ3 4X2HA 2AADA 1I2EA 1MGWA 5CF1A 2XFSA 4HM6B 9RNTA 4G1MB 1AV4A 2P38A 4HM8B 3VSYA 1UDII 1OGXA 1SARA 2HMNB 3V99A 1RRLA 1J2BA 3A5EA 3CCJ3 2GBWB 1FGQA 2HOHA 2FNQA 3OWSA 4IT7A 1FW7A 3K63A 2UX0A 3CME3 1A2KA 4JRFA 3Q2PA 4XDWA 1EG9B 3NM2A 1S723 1TJDA 2W2CA 1RGAA 2UUGC 1LXEA 2CWVA 3RDEA 1GY7A 3I0YA 4J5KA 1JKGA 2FGTA 5AIFA 1JJ22 2WOHA 4O2HA 4HVNA 1ROVA 2C4BA 5RNTA 3RGRA 1NO3A 1LRAA 4R4KA 3NHXA 5DREA 2D42A 2RSXA 3UB1A 3PGBA 4LZIA 3DH2A 1M1K4 1FA3A 1M904 4HAAA 3DGLA 5AI1A 3CCV3 1N9JA 6RNTA 1K28A 2GEXA 3GZBA 2XGNA 1Q42A 1WMPA 1ROAA 4NPBA 3GSPA 1CEWI 3H3HA 3X41A 1YIT3 1OCVA 4XM4A 3G16A 4RZMA 2Q07A 5EQLA 1ZO2A 2BIRA 1RN1A 3EQQB 1LVNA 1E3VA 3PCRA 1N8QA 1OHSA 2H0IA 1YJ93 3KSED 1IVUA 5IG5A 3KIIA 1RJOA 5DRVA 1MGRA 3B7CA 3O8YA 1RGHA 4TX4A 1B2XA 1W2ZA 4MMYB 1BNSA 4NREA 3CCL3 1BUQA 1GSPA 1NB5I 1D6YA 2IYJA 3HZPA 5ELUA 3WMDA 2BO9B 5G1KA 1I3IA 1HYFA 3NQYA 3WOFB 1JN5B 1DETA 1W00A 1YVBI 4CDLA 4J8TA 4XBYA 5A0OB 1NWWA 3EJVA 3EN1B 4FR9A 2HMJB 1B2MA 3CU3A 2O3OA 3SYUA 2E2VA 4J5GA 1IQ8A 1MWSA 1VQ63 5CXOA 5M18A 2Y73A 2CKFB 4MMXB 3JUPA 2JQ5A 3B4OA 3SEDA 5AEWB 1RLSA 1UCIA 3WODG 1KSIA 3MG1A 5BXQA 5EEOA 1E97A 1GOYA 4N3VA 2W6JH 4RBNA 1RCKA 4FCJA 4XBTA 3B8LA 2HMKB 1ULJB 3WA2X 1BNJA 3MKIA 1BRJA 1V58A 2F86B 3MWZA 4GL6A 3JVCA 3KN4A 4LSOA 5D82A 3BB9A 4FMAA 3PXMA 1RNTA 4BL3A 2F5MA 2Z77A 4FCMA 3X40A 1BIRA 1YGWA 1W01A 1I0XA 2WGOA 3J7Yd 1JN5A 1B2UA 1B3SA 3F40A 3A76A 3CC43 1O7WB 1UGIA 2D1WA 3CNMA 2W56B 1GMRA 1UCJA 3HI7A 3EF8A 1W6YA 4HM5B 1YJN3 3BIRA 2B1XB 2XH9A 1FGTA 4LYLB 3T0UA 1GY5A 4HOHA 8RNTA 1I2GA 3S28A 3HOHA 4R9KA 5BVBA 4HZ9B 4HJLB 4K1VA 2QEX3 3FKAA 1BSCA 2AAEA 2XSHB 1VQP3 4FMBA 2HMOB 3BNEA 2YFLB 3SX1A 1PY3A 3NBBA 1BOXA 1JB4A 1DYUA 2XF3A 3K9MC 1RGGA 3WHOA 1BRGA 3RGAA 2CFGA 5LC7A 1RGLA 3S67A 2CFWA 1I70A 1F8NA 3SOYA 4EV2A 1GS3A 1NU3A 1FUTA 4CPKA 1BNFA 3FLJA 1O7PB 5D83A 1K8A4 5CK6A 4HM4B 4OVMA 1RMSA 2ML5A 1AQZA 1TRQA 1YJW3 3CMA3 4R80A 1NDOB 2SARA 4WWUC 5ELJA 3GAXA 1T3BA 3UL6A 3X3XA 1GD3A 1US1A 2C11A 3NXJA 3OWUA 1JZDA 4L8PA 1JZOA 2CG0A 1U8CB 5IENA 3JUMA 1OF5B 4N6NB 1OPYA 2CK3H 4R9LA 2F98A 1VQO3 3EN8A 2MC8A 1QAFA 4EC6A 3NQZA 1YHQ3 1SJWA 1DMMA 3MPHA 4HM3B 3V98A 5AEUB 6STDA 5I97A 1O7HB 1QJGA 3F7XA 3LTCA 1IU7A 1R4YA 2GBXB 1SIHA 2J8XB 4KZ1A 3N9HA 3LT9A 2ZL8A 1X1YA 1KWIA 1QALA 1JNQA 1N9EA 1Q7Y4 3U1WA 2XGLA 1EQKA 2W9PA 4AEQA 1O7NB 2WOFA 2XEPA 3CCU3 1KQS2 2OTL3 2L1SA 3B4PA 1JBSA 1X1WA 3SOAA 4EW5A 1TU5A 1OUNA 5AYSC 2HMMB 5BIRA 3BU4A 2CWTA 3D4AA 4KVHA 1N5PA 2WO0A 5M1AA 2YX9A 4OK0A 3FG3A 1HU9A 3E99A 3QRDA 3FSDA 3WOEB 4H3UA
chains in the Genus database with same CATH topology
4O8SA 4FMDA 3LH4A 1QMAA 3X3YA 1IVWA 4FCZA 3F8XA 2LQVA 2SBLA 3GZYB 2WGQA 1VQ53 4I4KA 1ASKA 1DVCA 3HX8A 4EXRA 3U97A 1L5GB 5IW9A 1DMQA 2IUKA 4PEJA 3IMAB 3CXC2 3NM7A 5JPUA 2W03A 3AMOB 3EHCA 3N8BA 3D3LA 1YI23 1DVDA 2XR8B 1CYUA 4N6TA 1JB2A 3K5TA 5EVHA 4EV5A 4N6MA 2QA43 2OTJ3 3EBYA 1FUWA 1NB3I 5JPPA 3OX9A 2CH9A 1D6UA 2OQEC 3G4S3 3LMLA 1O7MB 5AIIA 2OQEA 1JV2B 1N5HA 2BNGA 4J9AA 4N6LA 2E2UA 3JUNA 5FGOA 3GWRA 2IA7A 2K0MA 3ALAA 3FCSB 3K0ZA 3TDGA 2KXGA 3PZWA 1OGZA 3DXOA 4KFFA 5IEOA 3BNDA 2W04A 4XB5A 1HKXA 1VZZA 3FF2A 4EYCA 1SQWA 2BHMA 1PU4A 3NV0B 1STDA 3AMOA 3IPTA 3DGNA 3HK4A 3CCS3 3KE7A 1W7CA 5CLKA 1NJI4 1T5YA 1LNHA 5D81A 1JB5A 4HKVB 1GY6A 3FG1A 2CWUA 3QK9A 3BLZA 2P0MA 4CCVA 3CCE3 2CIUA 1VQ73 2P05A 4MJDA 4KFDA 5LC6A 1ULIB 1W4NA 1CYVA 4RNYA 1S5AA 4QWTA 3S5CA 2RGQA 3F7SA 4L8OA 1VQM3 1RRHA 3NUVA 1A2VA 2BMRB 2BMQB 3CCM3 4WHAA 1IV9A 4K61A 1ZX2A 1VQN3 2YFIB 3NBJA 5JBSA 1W5ZA 3GZXB 1MNLA 1TP6A 2Z7AA 4L7KA 1VQK3 1WQLB 3MG3A 4HM2B 1IK3A 1TFOA 1EKMA 1WNHA 2OOVC 2W56A 3FG4A 3PS8A 2OOVA 4HZBB 3LTAA 4WFOA 3NX0A 1IT7A 2O9UX 3F9SA 5IG0A 3BNCA 4O02B 1WTHA 4HM7B 2C10A 5IERA 3GZRA 4HM0B 3WDGB 1N8R4 3EBTA 1Q40B 3G8ZA 3K7CA 1JRQA 1UI8A 1O7GB 2LYXA 4LMIA 4HBRA 3ER7A 3MG2A 2Z76A 1QVG2 3KSPA 1JKGB 2P09A 1VQ43 2CFKA 3CPW2 1W2B2 3OW22 3CCQ3 3CNXA 5HGRA 3CPOA 2CC3A 3X42A 2YFJB 3FGYA 3VGNA 1VQ93 3G713 1W6GA 4ZM8A 3PYJA 3LTDA 1OHPA 2XFTA 1IQXA 3OV4A 2W0QA 1FGMA 2GU1A 3I563 1R4CA 1W02A 3UL5A 7STDA 3HIIA 2F99A 3VF1A 2Z6BA 3G6E3 1G96A 4LEHA 5AIGA 1CQSA 1OF5A 5TGNA 2V1LA 1STFI 3T8UA 3KKGA 4BTXA 4IPBA 2GXFA 1ISKA 4H61A 1Q40A 3LYGA 3F14A 4KFEA 4K1UA 4HM1B 2JDIH 2KRTA 3BNBA 3EX9A 4GB5A 3MHEA 2W9QA 1YGEA 3UNLA 2XSOB 2MF7A 1WMOA 4LGQA 2BMOB 4X2OA 1AVLA 2QGUA 4R1KA 3CC73 5STDA 1M1XB 3M8CA 3EE1A 1IT8A 3Q1CA 1V74A 1Q814 3OWYA 4BTYA 3EC9A 3SVAA 3CD63 4MEIA 5KP1A 3DGMA 5IG4A 1SIIA 1UW1A 1EA2A 2P0XA 3NBRA 4XDVA 1A67A 1QAKA 3GRDA 1Y4KA 1UUVB 2OWPA 3JUQA 3MYTA 3N54B 4WYKB 3D9RA 5IEPA 2RFRA 4OUQA 2CFLA 3JUOA 3DZLA 4N6OB 5FW5A 1UI7A 1AVKA 2INXA 4XBXA 3G0KA 2PNCA 3I553 2Y74A 4RNZA 3DM8A 1W6CA 3FH1A 2PZVA 1K9M4 2HMLB 1FGOA 3LXUX 3WA3A 1KC84 1FGRA 1A90A 8CHOA 5IG3A 2OCTA 4MMZB 1OH0A 3ROBA 1U5OA 3ECFA 1UUWB 2CW9A 1OACA 2R4IA 5AYRB 1D6ZA 2GEYA 3PCSA 3DMCA 4WYKA 3STDA 4BTWA 5IF6A 3IJEB 1SPUA 3T8NA 4AKYA 3KFQC 3X3ZA 1C7HA 4STDA 2ZDJA 4EBGA 2FXTA 1IQYA 2XRXB 1Q864 2RCDA 4IIAA 4Q53A 1K41A 2KCDA 1IVVA 2M7OA 1GD4A 3NV0A 3LOYA 3KZTA 2ML6A 3FF0A 2I9WA 3HIGA 2CHCA 3F8HA 3CC23 1DMNA 1VQL3 3DGOA 1RN7A 3Q90A 1E3RA 2BT3A 4FMCA 4N6UA 1WMNA 2E2TA 4JF8A 1IV7A 3S27A 2IUJA 3H51A 4AKZA 1Z1SA 2L4VA 4HYZA 5CF2A 3EB8A 2A15A 3LT8A 1GYBA 3S29A 3V92A 1TFKA 3SLUA 3LZAA 2IMJA 2CG1A 1TIJA 1Q824 1VQ83 1MOLA 1IDPA 4N6V0 5AIHA 3UJMA 1KD14 1LOXA 4ORLA 1AR0A 1OHOA 2CFDA 3LTBA 1TUHA 4O3VA 3OXAA 3CCR3 1QVF2 2STDA 4WP5A 5G2GA 1PFPA 3DUKA 2K54A 4U13A 1M9GA 2GU3A 2QIYA 3FZWA 5KP4A 1K734 3DY5A 1IVXA 1RKYA 5KP3A 2B24B 3L0RA 4NHFA 3MSOA 4K90B 3SXXA 1YIJ3 4X2HA 5CF1A 2XFSA 4HM6B 4G1MB 1AV4A 2P38A 4HM8B 3VSYA 1OGXA 2HMNB 3V99A 1RRLA 1J2BA 3CCJ3 2GBWB 1FGQA 4IT7A 2FNQA 3OWSA 3K63A 2UX0A 3CME3 1A2KA 4JRFA 3Q2PA 4XDWA 1EG9B 3NM2A 1S723 2W2CA 1LXEA 2CWVA 3RDEA 1GY7A 3I0YA 1JKGA 2FGTA 5AIFA 1JJ22 2WOHA 4O2HA 4HVNA 1ROVA 3RGRA 1NO3A 4R4KA 3NHXA 5DREA 2D42A 2RSXA 3UB1A 3PGBA 4LZIA 1M1K4 1FA3A 1M904 3DGLA 5AI1A 3CCV3 1N9JA 1K28A 2GEXA 3GZBA 2XGNA 1Q42A 1WMPA 1ROAA 1CEWI 3H3HA 3X41A 1YIT3 1OCVA 4XM4A 3G16A 4RZMA 2Q07A 5EQLA 1ZO2A 3EQQB 1LVNA 1E3VA 3PCRA 1N8QA 1OHSA 1YJ93 3KSED 1IVUA 5IG5A 3KIIA 1RJOA 5DRVA 3B7CA 3O8YA 4TX4A 1W2ZA 4MMYB 4NREA 3CCL3 1BUQA 1NB5I 1D6YA 3HZPA 5ELUA 3WMDA 2BO9B 3NQYA 3WOFB 1JN5B 1W00A 1YVBI 4CDLA 4J8TA 4XBYA 5A0OB 1NWWA 3EJVA 3EN1B 4FR9A 2HMJB 3CU3A 2O3OA 2E2VA 1IQ8A 1VQ63 5CXOA 2Y73A 2CKFB 4MMXB 3JUPA 2JQ5A 3B4OA 3SEDA 5AEWB 3WODG 1KSIA 3MG1A 5BXQA 5EEOA 1E97A 4N3VA 2W6JH 4RBNA 4FCJA 4XBTA 3B8LA 2HMKB 1ULJB 3WA2X 3MKIA 4GL6A 1EQKA 2F86B 4LSOA 3MWZA 5D82A 3JVCA 3KN4A 3BB9A 4FMAA 3PXMA 2Z77A 4FCMA 3X40A 1W01A 2WGOA 3J7Yd 1JN5A 3F40A 3A76A 3CC43 1O7WB 2D1WA 3CNMA 2W56B 1YJN3 3HI7A 4HM5B 3EF8A 1W6YA 2B1XB 2XH9A 1FGTA 3T0UA 1GY5A 3S28A 4R9KA 5BVBA 4HZ9B 4HJLB 4K1VA 2QEX3 3FKAA 2XSHB 1VQP3 4FMBA 2HMOB 3BNEA 2YFLB 3SX1A 3NBBA 1JB4A 2XF3A 1DYUA 3K9MC 3RGAA 2CFGA 5LC7A 3S67A 2CFWA 1F8NA 3SOYA 4EV2A 1GS3A 1NU3A 1K8A4 3FLJA 1O7PB 5D83A 5CK6A 4HM4B 4OVMA 2ML5A 3CMA3 1YJW3 4R80A 1NDOB 5ELJA 4WWUC 3GAXA 3UL6A 3X3XA 1GD3A 1US1A 2C11A 3NXJA 3OWUA 4L8PA 2CG0A 1U8CB 5IENA 3JUMA 1OF5B 4N6NB 1OPYA 2CK3H 4R9LA 2F98A 1VQO3 3EN8A 2MC8A 1QAFA 4EC6A 3NQZA 1YHQ3 1SJWA 1DMMA 3MPHA 4HM3B 3V98A 5AEUB 6STDA 5I97A 1O7HB 1QJGA 3F7XA 3LTCA 1IU7A 2GBXB 1SIHA 4KZ1A 3N9HA 3LT9A 2ZL8A 1KWIA 1QALA 1JNQA 1N9EA 1Q7Y4 3U1WA 2XGLA 2W9PA 4AEQA 1O7NB 2WOFA 2XEPA 3CCU3 1KQS2 2OTL3 3B4PA 3SOAA 1TU5A 1OUNA 5AYSC 2HMMB 2CWTA 4KVHA 1N5PA 2WO0A 2YX9A 4OK0A 3FG3A 1HU9A 3E99A 3QRDA 3FSDA 3WOEB 4H3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMA A;  3F8X A;  3GZY B;  4I4K A;  1ASK A;  3HX8 A;  1DMQ A;  4PEJ A;  5JPU A;  3EHC A;  2XR8 B;  1JB2 A;  5EVH A;  3EBY A;  5JPP A;  3OX9 A;  1O7M B;  5AII A;  2BNG A;  4J9A A;  3JUN A;  3GWR A;  3K0Z A;  1OGZ A;  3DXO A;  5IEO A;  4XB5 A;  1HKX A;  1VZZ A;  3FF2 A;  3NV0 B;  1STD A;  3IPT A;  3HK4 A;  3KE7 A;  5CLK A;  5D81 A;  1JB5 A;  4HKV B;  1GY6 A;  3BLZ A;  4MJD A;  1ULI B;  1S5A A;  3S5C A;  2RGQ A;  3F7S A;  4L8O A;  3NUV A;  2BMR B;  2BMQ B;  1ZX2 A;  2YFI B;  3GZX B;  1TP6 A;  2Z7A A;  4L7K A;  1WQL B;  3MG3 A;  4HM2 B;  4HZB B;  3F9S A;  5IG0 A;  4HM7 B;  5IER A;  3GZR A;  4HM0 B;  3EBT A;  1Q40 B;  3G8Z A;  3K7C A;  1O7G B;  4LMI A;  3ER7 A;  3MG2 A;  2Z76 A;  3KSP A;  1JKG B;  3CNX A;  5HGR A;  3CPO A;  2YFJ B;  3FGY A;  3VGN A;  1OHP A;  3OV4 A;  1W02 A;  7STD A;  2F99 A;  4LEH A;  5AIG A;  1OF5 A;  1CQS A;  5TGN A;  3T8U A;  3KKG A;  2GXF A;  1ISK A;  1Q40 A;  3LYG A;  3F14 A;  4K1U A;  4HM1 B;  3EX9 A;  4GB5 A;  3MHE A;  3UNL A;  2XSO B;  4LGQ A;  2BMO B;  4X2O A;  2QGU A;  4R1K A;  5STD A;  3M8C A;  3OWY A;  3EC9 A;  5KP1 A;  5IG4 A;  3NBR A;  1EA2 A;  4XDV A;  3GRD A;  1UUV B;  2OWP A;  3JUQ A;  3MYT A;  4WYK B;  3D9R A;  5IEP A;  2RFR A;  4OUQ A;  3JUO A;  3DZL A;  5FW5 A;  4XBX A;  2INX A;  3G0K A;  3DM8 A;  3FH1 A;  2PZV A;  2HML B;  8CHO A;  5IG3 A;  3ROB A;  1OH0 A;  1U5O A;  3ECF A;  1UUW B;  2R4I A;  2GEY A;  3DMC A;  4WYK A;  3STD A;  5IF6 A;  3T8N A;  1C7H A;  4STD A;  2XRX B;  2RCD A;  4IIA A;  4Q53 A;  1K41 A;  3NV0 A;  3KZT A;  3FF0 A;  2I9W A;  2CHC A;  3F8H A;  1DMN A;  3Q90 A;  1E3R A;  3H51 A;  1Z1S A;  5CF2 A;  2A15 A;  1GYB A;  3LZA A;  2IMJ A;  1IDP A;  5AIH A;  3UJM A;  4ORL A;  1AR0 A;  1OHO A;  1TUH A;  3OXA A;  2STD A;  4WP5 A;  5G2G A;  3DUK A;  4U13 A;  2K54 A;  2QIY A;  3FZW A;  5KP4 A;  5KP3 A;  2B24 B;  3MSO A;  4X2H A;  5CF1 A;  4HM6 B;  4HM8 B;  3VSY A;  1OGX A;  2HMN B;  2GBW B;  3OWS A;  2UX0 A;  1A2K A;  4XDW A;  1EG9 B;  3NM2 A;  2W2C A;  1GY7 A;  3I0Y A;  1JKG A;  5AIF A;  4HVN A;  3RGR A;  3NHX A;  5DRE A;  5AI1 A;  2GEX A;  3GZB A;  1Q42 A;  3H3H A;  1OCV A;  4XM4 A;  3G16 A;  4RZM A;  1ZO2 A;  3EQQ B;  1E3V A;  1OHS A;  5IG5 A;  5DRV A;  3B7C A;  1BUQ A;  3HZP A;  3WMD A;  1JN5 B;  1W00 A;  4CDL A;  4J8T A;  4XBY A;  1NWW A;  3EJV A;  3EN1 B;  2HMJ B;  3CU3 A;  5CXO A;  2CKF B;  3JUP A;  2JQ5 A;  3B4O A;  3SED A;  5AEW B;  3MG1 A;  5BXQ A;  1E97 A;  4N3V A;  4XBT A;  4FCJ A;  3B8L A;  2HMK B;  1ULJ B;  3MKI A;  2F86 B;  5D82 A;  3BB9 A;  2Z77 A;  4FCM A;  1W01 A;  1JN5 A;  3F40 A;  3A76 A;  1O7W B;  3CNM A;  4HM5 B;  3EF8 A;  1W6Y A;  2B1X B;  1GY5 A;  4R9K A;  5BVB A;  4HZ9 B;  4HJL B;  4K1V A;  3FKA A;  2XSH B;  2HMO B;  2YFL B;  1JB4 A;  3RGA A;  3SOY A;  1GS3 A;  1NU3 A;  3FLJ A;  1O7P B;  5D83 A;  5CK6 A;  4HM4 B;  4OVM A;  1NDO B;  4WWU C;  3OWU A;  3NXJ A;  4L8P A;  5IEN A;  3JUM A;  1OF5 B;  1OPY A;  4R9L A;  2F98 A;  3EN8 A;  1SJW A;  1DMM A;  4HM3 B;  5AEU B;  6STD A;  1O7H B;  1QJG A;  3F7X A;  2GBX B;  1O7N B;  3B4P A;  3SOA A;  1OUN A;  2HMM B;  4KVH A;  3E99 A;  3FSD A;  4H3U A; 
#chains in the Genus database with same CATH topology
 1LOV A;  4O8S A;  2CX0 A;  4FMD A;  3LH4 A;  2ZA4 A;  1QMA A;  3X3Y A;  1IVW A;  4FCZ A;  3F8X A;  2LQV A;  2SBL A;  1RGC A;  3GZY B;  2WGQ A;  5BU4 A;  1FZU A;  1VQ5 3;  1YVS A;  1I3F A;  4I4K A;  1ASK A;  1DVC A;  1VQQ A;  3HX8 A;  4EXR A;  3U97 A;  1L5G B;  5IW9 A;  1DMQ A;  2IUK A;  4PEJ A;  3IMA B;  1BNI A;  3CXC 2;  1JBT A;  3D5I A;  3NM7 A;  5JPU A;  2W03 A;  3AMO B;  3EHC A;  3N8B A;  3D3L A;  1YI2 3;  1DVD A;  2XR8 B;  1CYU A;  4N6T A;  1GOV A;  1JB2 A;  3K5T A;  5EVH A;  4EV5 A;  4N6M A;  2QA4 3;  2OTJ 3;  3EBY A;  1FUW A;  1I8V A;  1NB3 I;  1BU4 A;  5HOH A;  5JPP A;  3OX9 A;  1GMQ A;  1D6U A;  2CH9 A;  2OQE C;  3G4S 3;  3LML A;  1RNB A;  1O7M B;  5AII A;  2OQE A;  1JV2 B;  1N5H A;  2BNG A;  4J9A A;  4N6L A;  2E2U A;  3JUN A;  5FGO A;  3GWR A;  2IA7 A;  2K0M A;  1RDS A;  3ALA A;  1RSN A;  3FCS B;  2KXG A;  3K0Z A;  3PZW A;  2F56 A;  3TDG A;  1OGZ A;  3DXO A;  1LQG C;  4KFF A;  5IEO A;  3BND A;  2W04 A;  4XB5 A;  1AY7 A;  1HKX A;  1V57 A;  1Q9E A;  1VZZ A;  3AGN A;  3FF2 A;  4EYC A;  1FUS A;  1SQW A;  2BHM A;  1T2H A;  1T2I A;  1PU4 A;  3NV0 B;  1STD A;  3AMO A;  3IPT A;  3DGN A;  3HK4 A;  3CCS 3;  2KF5 A;  3KE7 A;  1W7C A;  5CLK A;  1NJI 4;  1T5Y A;  1LNH A;  5D81 A;  1JB5 A;  1LNI A;  5G1L A;  1LOW A;  1BVI A;  4RNT A;  4HKV B;  1DE3 A;  1GY6 A;  3FG1 A;  1BGS A;  2CWU A;  3QK9 A;  1ZS7 A;  3BLZ A;  2P0M A;  5M19 A;  4CCV A;  3AHS A;  3CCE 3;  2CIU A;  1VQ7 3;  2P05 A;  4MJD A;  4KFD A;  4I5Q A;  1ULI B;  1W4N A;  1CYV A;  3AHW A;  5LC6 A;  4RNY A;  1RGF A;  1S5A A;  4QWT A;  3S5C A;  2RGQ A;  3F7S A;  1I0V A;  4L8O A;  1VQM 3;  7GSP A;  2H0H A;  1B21 A;  1RRH A;  3NUV A;  1A2V A;  2BMR B;  2BMQ B;  3CCM 3;  4WHA A;  1IV9 A;  4K61 A;  1ZX2 A;  1VQN 3;  2YFI B;  3NBJ A;  5JBS A;  1W5Z A;  3GZX B;  1MNL A;  1TP6 A;  1BAO A;  2Z7A A;  4L7K A;  1VQK 3;  1WQL B;  3MG3 A;  4HM2 B;  1IK3 A;  1TFO A;  1EKM A;  1WNH A;  2OOV C;  2W56 A;  3FG4 A;  3PS8 A;  2OOV A;  4HZB B;  3LTA A;  4WFO A;  3NX0 A;  1X1X A;  1IT7 A;  2O9U X;  3F9S A;  7RNT A;  1MWU A;  5IG0 A;  3BNC A;  4O02 B;  4DKI A;  1WTH A;  4HM7 B;  2C10 A;  5IER A;  3GZR A;  3KCH A;  4HM0 B;  3WDG B;  4BL2 A;  1N8R 4;  2RNT A;  3EBT A;  1Q40 B;  3G8Z A;  3K7C A;  3URP A;  1JRQ A;  1UI8 A;  1O7G B;  2LYX A;  4LMI A;  1BRN L;  4HBR A;  3ER7 A;  2F4Y A;  2Z76 A;  3MG2 A;  1BRI A;  1QVG 2;  3KSP A;  1JKG B;  1BRS A;  2P09 A;  1VQ4 3;  2RBI A;  2CFK A;  2R41 A;  3CPW 2;  1W2B 2;  3OW2 2;  2K3D A;  3CCQ 3;  3CNX A;  5HGR A;  3CPO A;  2CC3 A;  3X42 A;  2YFJ B;  3FGY A;  3VGN A;  1VQ9 3;  3G71 3;  1W6G A;  4ZM8 A;  3PYJ A;  3LTD A;  1OHP A;  2IY2 A;  1IQX A;  2KAA A;  2W0Q A;  2XFT A;  3OV4 A;  1FGM A;  2GU1 A;  3I56 3;  1RN4 A;  1R4C A;  1MWT A;  1W02 A;  3UL5 A;  3HII A;  2F99 A;  3VF1 A;  2Z6B A;  3Q3F A;  1G96 A;  7STD A;  4LEH A;  5AIG A;  1CQS A;  1BRH A;  1OF5 A;  5TGN A;  1BNE A;  2V1L A;  1BNG A;  1STF I;  3ZG5 A;  3T8U A;  1BAN A;  1BSE A;  3KKG A;  4BTX A;  4IPB A;  2GXF A;  1ISK A;  4H61 A;  1Q40 A;  1X1U A;  3LYG A;  4BIR A;  4CJN A;  3F14 A;  4KFE A;  3DGY A;  4HM1 B;  2JDI H;  4ILF A;  4K1U A;  1BSB A;  2KRT A;  4KT3 B;  3BNB A;  1LQM B;  3EX9 A;  4GB5 A;  1Q7H A;  3MHE A;  2W9Q A;  1YGE A;  4GSP A;  2XSO B;  3UNL A;  2MF7 A;  3D79 A;  1WMO A;  4LGQ A;  2BMO B;  4X2O A;  4GHO A;  1AVL A;  2QGU A;  4R1K A;  3CC7 3;  2BU4 A;  5STD A;  1M1X B;  1JBR A;  3M8C A;  3EE1 A;  1IT8 A;  3Q1C A;  1V74 A;  5GSP A;  3OWY A;  4BTY A;  3EC9 A;  3SVA A;  1Q81 4;  4MEI A;  3CD6 3;  5KP1 A;  3DGM A;  5IG4 A;  1SII A;  2GSP A;  1BSD A;  1EA2 A;  1UW1 A;  2P0X A;  2ZHX B;  3AGO A;  3NBR A;  4XDV A;  1A67 A;  1QAK A;  3GRD A;  1Y4K A;  1UUV B;  2OWP A;  3JUQ A;  3MYT A;  1BUJ A;  3N54 B;  4WYK B;  3D9R A;  1UCK A;  5IEP A;  1FYS A;  2RFR A;  4OUQ A;  2CFL A;  3JUO A;  3DZL A;  4N6O B;  1C54 A;  1GOU A;  5FW5 A;  2KF6 A;  1UI7 A;  1AVK A;  1CH0 A;  2INX A;  4XBX A;  3G0K A;  1RGE A;  2PNC A;  1EEJ A;  1LOY A;  3I55 3;  2Y74 A;  4RNZ A;  3DM8 A;  3WR2 A;  1W6C A;  3FH1 A;  2F5W A;  2PZV A;  2UGI A;  2HML B;  1K9M 4;  1FGO A;  1UCL A;  3LXU X;  3WA3 A;  1KC8 4;  1FGR A;  1A90 A;  1G02 A;  8CHO A;  1A2P A;  5IG3 A;  2OCT A;  1YNV X;  4MMZ B;  1OH0 A;  3ROB A;  1U5O A;  3ECF A;  3ZFZ A;  1UUW B;  1I2F A;  2CW9 A;  1OAC A;  2R4I A;  5AYR B;  1D6Z A;  1ZGX A;  1RGK A;  2GEY A;  2H0G A;  3PCS A;  1UUG B;  3DMC A;  4WYK A;  6GSP A;  3STD A;  4BTW A;  5IF6 A;  3IJE B;  1SPU A;  1RHL A;  1NNV A;  3T8N A;  2KF4 A;  3KFQ C;  3X3Z A;  4AKY A;  1C7H A;  1UGH I;  2ZDJ A;  4STD A;  1B2S A;  4EBG A;  2FXT A;  1IQY A;  2XRX B;  1Q86 4;  2RCD A;  1GMP A;  4IIA A;  4Q53 A;  3ZG0 A;  1K41 A;  2KCD A;  1IVV A;  2M7O A;  1GD4 A;  1BRK A;  3RNT A;  3NV0 A;  3G6E 3;  1EUI C;  3LOY A;  3KZT A;  1BSA A;  2ML6 A;  3FF0 A;  2I9W A;  3HIG A;  2CHC A;  3F8H A;  3CC2 3;  1DMN A;  1VQL 3;  3DGO A;  1RN7 A;  1G0T A;  1E3R A;  3Q90 A;  2BT3 A;  4FMC A;  4N6U A;  1WMN A;  2E2T A;  4JF8 A;  1IV7 A;  3S27 A;  1BNR A;  2IUJ A;  3H51 A;  1RTU A;  4AKZ A;  1Z1S A;  1RCL A;  2L4V A;  4BU4 A;  1TRP A;  4HYZ A;  5CF2 A;  3EB8 A;  2A15 A;  3LT8 A;  1GYB A;  1MWR A;  3S29 A;  1TFK A;  3SLU A;  3LZA A;  2IMJ A;  2CG1 A;  3V92 A;  1TIJ A;  1Q82 4;  1VQ8 3;  1IYY A;  1PYL A;  1MOL A;  1IDP A;  4N6V 0;  5AIH A;  3UJM A;  1KD1 4;  1LOX A;  4ORL A;  1B2Z A;  1AR0 A;  1HZ1 A;  1OHO A;  2CFD A;  1TUH A;  3LTB A;  3OXA A;  4O3V A;  3CCR 3;  1QVF 2;  2STD A;  4WP5 A;  5G2G A;  1PFP A;  3DUK A;  2K54 A;  4U13 A;  1M9G A;  2GU3 A;  2QIY A;  3FZW A;  1TTO A;  2KF3 A;  5KP4 A;  1K73 4;  3DY5 A;  1IVX A;  1RKY A;  5KP3 A;  3D5G A;  2B24 B;  3L0R A;  4NHF A;  3MSO A;  2CX1 A;  4K90 B;  1B20 A;  3SXX A;  1B27 A;  1YIJ 3;  4X2H A;  2AAD A;  1I2E A;  1MGW A;  5CF1 A;  2XFS A;  4HM6 B;  9RNT A;  4G1M B;  1AV4 A;  2P38 A;  4HM8 B;  3VSY A;  1UDI I;  1OGX A;  1SAR A;  2HMN B;  3V99 A;  1RRL A;  1J2B A;  3A5E A;  3CCJ 3;  2GBW B;  1FGQ A;  2HOH A;  2FNQ A;  3OWS A;  4IT7 A;  1FW7 A;  3K63 A;  2UX0 A;  3CME 3;  1A2K A;  4JRF A;  3Q2P A;  4XDW A;  1EG9 B;  3NM2 A;  1S72 3;  1TJD A;  2W2C A;  1RGA A;  2UUG C;  1LXE A;  2CWV A;  3RDE A;  1GY7 A;  3I0Y A;  4J5K A;  1JKG A;  2FGT A;  5AIF A;  1JJ2 2;  2WOH A;  4O2H A;  4HVN A;  1ROV A;  2C4B A;  5RNT A;  3RGR A;  1NO3 A;  1LRA A;  4R4K A;  3NHX A;  5DRE A;  2D42 A;  2RSX A;  3UB1 A;  3PGB A;  4LZI A;  3DH2 A;  1M1K 4;  1FA3 A;  1M90 4;  4HAA A;  3DGL A;  5AI1 A;  3CCV 3;  1N9J A;  6RNT A;  1K28 A;  2GEX A;  3GZB A;  2XGN A;  1Q42 A;  1WMP A;  1ROA A;  4NPB A;  3GSP A;  1CEW I;  3H3H A;  3X41 A;  1YIT 3;  1OCV A;  4XM4 A;  3G16 A;  4RZM A;  2Q07 A;  5EQL A;  1ZO2 A;  2BIR A;  1RN1 A;  3EQQ B;  1LVN A;  1E3V A;  3PCR A;  1N8Q A;  1OHS A;  2H0I A;  1YJ9 3;  3KSE D;  1IVU A;  5IG5 A;  3KII A;  1RJO A;  5DRV A;  1MGR A;  3B7C A;  3O8Y A;  1RGH A;  4TX4 A;  1B2X A;  1W2Z A;  4MMY B;  1BNS A;  4NRE A;  3CCL 3;  1BUQ A;  1GSP A;  1NB5 I;  1D6Y A;  2IYJ A;  3HZP A;  5ELU A;  3WMD A;  2BO9 B;  5G1K A;  1I3I A;  1HYF A;  3NQY A;  3WOF B;  1JN5 B;  1DET A;  1W00 A;  1YVB I;  4CDL A;  4J8T A;  4XBY A;  5A0O B;  1NWW A;  3EJV A;  3EN1 B;  4FR9 A;  2HMJ B;  1B2M A;  3CU3 A;  2O3O A;  3SYU A;  2E2V A;  4J5G A;  1IQ8 A;  1MWS A;  1VQ6 3;  5CXO A;  5M18 A;  2Y73 A;  2CKF B;  4MMX B;  3JUP A;  2JQ5 A;  3B4O A;  3SED A;  5AEW B;  1RLS A;  1UCI A;  3WOD G;  1KSI A;  3MG1 A;  5BXQ A;  5EEO A;  1E97 A;  1GOY A;  4N3V A;  2W6J H;  4RBN A;  1RCK A;  4FCJ A;  4XBT A;  3B8L A;  2HMK B;  1ULJ B;  3WA2 X;  1BNJ A;  3MKI A;  1BRJ A;  1V58 A;  2F86 B;  3MWZ A;  4GL6 A;  3JVC A;  3KN4 A;  4LSO A;  5D82 A;  3BB9 A;  4FMA A;  3PXM A;  1RNT A;  4BL3 A;  2F5M A;  2Z77 A;  4FCM A;  3X40 A;  1BIR A;  1YGW A;  1W01 A;  1I0X A;  2WGO A;  3J7Y d;  1JN5 A;  1B2U A;  1B3S A;  3F40 A;  3A76 A;  3CC4 3;  1O7W B;  1UGI A;  2D1W A;  3CNM A;  2W56 B;  1GMR A;  1UCJ A;  3HI7 A;  3EF8 A;  1W6Y A;  4HM5 B;  1YJN 3;  3BIR A;  2B1X B;  2XH9 A;  1FGT A;  4LYL B;  3T0U A;  1GY5 A;  4HOH A;  8RNT A;  1I2G A;  3S28 A;  3HOH A;  4R9K A;  5BVB A;  4HZ9 B;  4HJL B;  4K1V A;  2QEX 3;  3FKA A;  1BSC A;  2AAE A;  2XSH B;  1VQP 3;  4FMB A;  2HMO B;  3BNE A;  2YFL B;  3SX1 A;  1PY3 A;  3NBB A;  1BOX A;  1JB4 A;  1DYU A;  2XF3 A;  3K9M C;  1RGG A;  3WHO A;  1BRG A;  3RGA A;  2CFG A;  5LC7 A;  1RGL A;  3S67 A;  2CFW A;  1I70 A;  1F8N A;  3SOY A;  4EV2 A;  1GS3 A;  1NU3 A;  1FUT A;  4CPK A;  1BNF A;  3FLJ A;  1O7P B;  5D83 A;  1K8A 4;  5CK6 A;  4HM4 B;  4OVM A;  1RMS A;  2ML5 A;  1AQZ A;  1TRQ A;  1YJW 3;  3CMA 3;  4R80 A;  1NDO B;  2SAR A;  4WWU C;  5ELJ A;  3GAX A;  1T3B A;  3UL6 A;  3X3X A;  1GD3 A;  1US1 A;  2C11 A;  3NXJ A;  3OWU A;  1JZD A;  4L8P A;  1JZO A;  2CG0 A;  1U8C B;  5IEN A;  3JUM A;  1OF5 B;  4N6N B;  1OPY A;  2CK3 H;  4R9L A;  2F98 A;  1VQO 3;  3EN8 A;  2MC8 A;  1QAF A;  4EC6 A;  3NQZ A;  1YHQ 3;  1SJW A;  1DMM A;  3MPH A;  4HM3 B;  3V98 A;  5AEU B;  6STD A;  5I97 A;  1O7H B;  1QJG A;  3F7X A;  3LTC A;  1IU7 A;  1R4Y A;  2GBX B;  1SIH A;  2J8X B;  4KZ1 A;  3N9H A;  3LT9 A;  2ZL8 A;  1X1Y A;  1KWI A;  1QAL A;  1JNQ A;  1N9E A;  1Q7Y 4;  3U1W A;  2XGL A;  1EQK A;  2W9P A;  4AEQ A;  1O7N B;  2WOF A;  2XEP A;  3CCU 3;  1KQS 2;  2OTL 3;  2L1S A;  3B4P A;  1JBS A;  1X1W A;  3SOA A;  4EW5 A;  1TU5 A;  1OUN A;  5AYS C;  2HMM B;  5BIR A;  3BU4 A;  2CWT A;  3D4A A;  4KVH A;  1N5P A;  2WO0 A;  5M1A A;  2YX9 A;  4OK0 A;  3FG3 A;  1HU9 A;  3E99 A;  3QRD A;  3FSD A;  3WOE B;  4H3U A; 
#chains in the Genus database with same CATH homology
 4O8S A;  4FMD A;  3LH4 A;  1QMA A;  3X3Y A;  1IVW A;  4FCZ A;  3F8X A;  2LQV A;  2SBL A;  3GZY B;  2WGQ A;  1VQ5 3;  4I4K A;  1ASK A;  1DVC A;  3HX8 A;  4EXR A;  3U97 A;  1L5G B;  5IW9 A;  1DMQ A;  2IUK A;  4PEJ A;  3IMA B;  3CXC 2;  3NM7 A;  5JPU A;  2W03 A;  3AMO B;  3EHC A;  3N8B A;  3D3L A;  1YI2 3;  1DVD A;  2XR8 B;  1CYU A;  4N6T A;  1JB2 A;  3K5T A;  5EVH A;  4EV5 A;  4N6M A;  2QA4 3;  2OTJ 3;  3EBY A;  1FUW A;  1NB3 I;  5JPP A;  3OX9 A;  2CH9 A;  1D6U A;  2OQE C;  3G4S 3;  3LML A;  1O7M B;  5AII A;  2OQE A;  1JV2 B;  1N5H A;  2BNG A;  4J9A A;  4N6L A;  2E2U A;  3JUN A;  5FGO A;  3GWR A;  2IA7 A;  2K0M A;  3ALA A;  3FCS B;  3K0Z A;  3TDG A;  2KXG A;  3PZW A;  1OGZ A;  3DXO A;  4KFF A;  5IEO A;  3BND A;  2W04 A;  4XB5 A;  1HKX A;  1VZZ A;  3FF2 A;  4EYC A;  1SQW A;  2BHM A;  1PU4 A;  3NV0 B;  1STD A;  3AMO A;  3IPT A;  3DGN A;  3HK4 A;  3CCS 3;  3KE7 A;  1W7C A;  5CLK A;  1NJI 4;  1T5Y A;  1LNH A;  5D81 A;  1JB5 A;  4HKV B;  1GY6 A;  3FG1 A;  2CWU A;  3QK9 A;  3BLZ A;  2P0M A;  4CCV A;  3CCE 3;  2CIU A;  1VQ7 3;  2P05 A;  4MJD A;  4KFD A;  5LC6 A;  1ULI B;  1W4N A;  1CYV A;  4RNY A;  1S5A A;  4QWT A;  3S5C A;  2RGQ A;  3F7S A;  4L8O A;  1VQM 3;  1RRH A;  3NUV A;  1A2V A;  2BMR B;  2BMQ B;  3CCM 3;  4WHA A;  1IV9 A;  4K61 A;  1ZX2 A;  1VQN 3;  2YFI B;  3NBJ A;  5JBS A;  1W5Z A;  3GZX B;  1MNL A;  1TP6 A;  2Z7A A;  4L7K A;  1VQK 3;  1WQL B;  3MG3 A;  4HM2 B;  1IK3 A;  1TFO A;  1EKM A;  1WNH A;  2OOV C;  2W56 A;  3FG4 A;  3PS8 A;  2OOV A;  4HZB B;  3LTA A;  4WFO A;  3NX0 A;  1IT7 A;  2O9U X;  3F9S A;  5IG0 A;  3BNC A;  4O02 B;  1WTH A;  4HM7 B;  2C10 A;  5IER A;  3GZR A;  4HM0 B;  3WDG B;  1N8R 4;  3EBT A;  1Q40 B;  3G8Z A;  3K7C A;  1JRQ A;  1UI8 A;  1O7G B;  2LYX A;  4LMI A;  4HBR A;  3ER7 A;  3MG2 A;  2Z76 A;  1QVG 2;  3KSP A;  1JKG B;  2P09 A;  1VQ4 3;  2CFK A;  3CPW 2;  1W2B 2;  3OW2 2;  3CCQ 3;  3CNX A;  5HGR A;  3CPO A;  2CC3 A;  3X42 A;  2YFJ B;  3FGY A;  3VGN A;  1VQ9 3;  3G71 3;  1W6G A;  4ZM8 A;  3PYJ A;  3LTD A;  1OHP A;  2XFT A;  1IQX A;  3OV4 A;  2W0Q A;  1FGM A;  2GU1 A;  3I56 3;  1R4C A;  1W02 A;  3UL5 A;  7STD A;  3HII A;  2F99 A;  3VF1 A;  2Z6B A;  3G6E 3;  1G96 A;  4LEH A;  5AIG A;  1CQS A;  1OF5 A;  5TGN A;  2V1L A;  1STF I;  3T8U A;  3KKG A;  4BTX A;  4IPB A;  2GXF A;  1ISK A;  4H61 A;  1Q40 A;  3LYG A;  3F14 A;  4KFE A;  4K1U A;  4HM1 B;  2JDI H;  2KRT A;  3BNB A;  3EX9 A;  4GB5 A;  3MHE A;  2W9Q A;  1YGE A;  3UNL A;  2XSO B;  2MF7 A;  1WMO A;  4LGQ A;  2BMO B;  4X2O A;  1AVL A;  2QGU A;  4R1K A;  3CC7 3;  5STD A;  1M1X B;  3M8C A;  3EE1 A;  1IT8 A;  3Q1C A;  1V74 A;  1Q81 4;  3OWY A;  4BTY A;  3EC9 A;  3SVA A;  3CD6 3;  4MEI A;  5KP1 A;  3DGM A;  5IG4 A;  1SII A;  1UW1 A;  1EA2 A;  2P0X A;  3NBR A;  4XDV A;  1A67 A;  1QAK A;  3GRD A;  1Y4K A;  1UUV B;  2OWP A;  3JUQ A;  3MYT A;  3N54 B;  4WYK B;  3D9R A;  5IEP A;  2RFR A;  4OUQ A;  2CFL A;  3JUO A;  3DZL A;  4N6O B;  5FW5 A;  1UI7 A;  1AVK A;  2INX A;  4XBX A;  3G0K A;  2PNC A;  3I55 3;  2Y74 A;  4RNZ A;  3DM8 A;  1W6C A;  3FH1 A;  2PZV A;  1K9M 4;  2HML B;  1FGO A;  3LXU X;  3WA3 A;  1KC8 4;  1FGR A;  1A90 A;  8CHO A;  5IG3 A;  2OCT A;  4MMZ B;  1OH0 A;  3ROB A;  1U5O A;  3ECF A;  1UUW B;  2CW9 A;  1OAC A;  2R4I A;  5AYR B;  1D6Z A;  2GEY A;  3PCS A;  3DMC A;  4WYK A;  3STD A;  4BTW A;  5IF6 A;  3IJE B;  1SPU A;  3T8N A;  4AKY A;  3KFQ C;  3X3Z A;  1C7H A;  4STD A;  2ZDJ A;  4EBG A;  2FXT A;  1IQY A;  2XRX B;  1Q86 4;  2RCD A;  4IIA A;  4Q53 A;  1K41 A;  2KCD A;  1IVV A;  2M7O A;  1GD4 A;  3NV0 A;  3LOY A;  3KZT A;  2ML6 A;  3FF0 A;  2I9W A;  3HIG A;  2CHC A;  3F8H A;  3CC2 3;  1DMN A;  1VQL 3;  3DGO A;  1RN7 A;  3Q90 A;  1E3R A;  2BT3 A;  4FMC A;  4N6U A;  1WMN A;  2E2T A;  4JF8 A;  1IV7 A;  3S27 A;  2IUJ A;  3H51 A;  4AKZ A;  1Z1S A;  2L4V A;  4HYZ A;  5CF2 A;  3EB8 A;  2A15 A;  3LT8 A;  1GYB A;  3S29 A;  3V92 A;  1TFK A;  3SLU A;  3LZA A;  2IMJ A;  2CG1 A;  1TIJ A;  1Q82 4;  1VQ8 3;  1MOL A;  1IDP A;  4N6V 0;  5AIH A;  3UJM A;  1KD1 4;  1LOX A;  4ORL A;  1AR0 A;  1OHO A;  2CFD A;  3LTB A;  1TUH A;  4O3V A;  3OXA A;  3CCR 3;  1QVF 2;  2STD A;  4WP5 A;  5G2G A;  1PFP A;  3DUK A;  2K54 A;  4U13 A;  1M9G A;  2GU3 A;  2QIY A;  3FZW A;  5KP4 A;  1K73 4;  3DY5 A;  1IVX A;  1RKY A;  5KP3 A;  2B24 B;  3L0R A;  4NHF A;  3MSO A;  4K90 B;  3SXX A;  1YIJ 3;  4X2H A;  5CF1 A;  2XFS A;  4HM6 B;  4G1M B;  1AV4 A;  2P38 A;  4HM8 B;  3VSY A;  1OGX A;  2HMN B;  3V99 A;  1RRL A;  1J2B A;  3CCJ 3;  2GBW B;  1FGQ A;  4IT7 A;  2FNQ A;  3OWS A;  3K63 A;  2UX0 A;  3CME 3;  1A2K A;  4JRF A;  3Q2P A;  4XDW A;  1EG9 B;  3NM2 A;  1S72 3;  2W2C A;  1LXE A;  2CWV A;  3RDE A;  1GY7 A;  3I0Y A;  1JKG A;  2FGT A;  5AIF A;  1JJ2 2;  2WOH A;  4O2H A;  4HVN A;  1ROV A;  3RGR A;  1NO3 A;  4R4K A;  3NHX A;  5DRE A;  2D42 A;  2RSX A;  3UB1 A;  3PGB A;  4LZI A;  1M1K 4;  1FA3 A;  1M90 4;  3DGL A;  5AI1 A;  3CCV 3;  1N9J A;  1K28 A;  2GEX A;  3GZB A;  2XGN A;  1Q42 A;  1WMP A;  1ROA A;  1CEW I;  3H3H A;  3X41 A;  1YIT 3;  1OCV A;  4XM4 A;  3G16 A;  4RZM A;  2Q07 A;  5EQL A;  1ZO2 A;  3EQQ B;  1LVN A;  1E3V A;  3PCR A;  1N8Q A;  1OHS A;  1YJ9 3;  3KSE D;  1IVU A;  5IG5 A;  3KII A;  1RJO A;  5DRV A;  3B7C A;  3O8Y A;  4TX4 A;  1W2Z A;  4MMY B;  4NRE A;  3CCL 3;  1BUQ A;  1NB5 I;  1D6Y A;  3HZP A;  5ELU A;  3WMD A;  2BO9 B;  3NQY A;  3WOF B;  1JN5 B;  1W00 A;  1YVB I;  4CDL A;  4J8T A;  4XBY A;  5A0O B;  1NWW A;  3EJV A;  3EN1 B;  4FR9 A;  2HMJ B;  3CU3 A;  2O3O A;  2E2V A;  1IQ8 A;  1VQ6 3;  5CXO A;  2Y73 A;  2CKF B;  4MMX B;  3JUP A;  2JQ5 A;  3B4O A;  3SED A;  5AEW B;  3WOD G;  1KSI A;  3MG1 A;  5BXQ A;  5EEO A;  1E97 A;  4N3V A;  2W6J H;  4RBN A;  4FCJ A;  4XBT A;  3B8L A;  2HMK B;  1ULJ B;  3WA2 X;  3MKI A;  4GL6 A;  1EQK A;  2F86 B;  4LSO A;  3MWZ A;  5D82 A;  3JVC A;  3KN4 A;  3BB9 A;  4FMA A;  3PXM A;  2Z77 A;  4FCM A;  3X40 A;  1W01 A;  2WGO A;  3J7Y d;  1JN5 A;  3F40 A;  3A76 A;  3CC4 3;  1O7W B;  2D1W A;  3CNM A;  2W56 B;  1YJN 3;  3HI7 A;  4HM5 B;  3EF8 A;  1W6Y A;  2B1X B;  2XH9 A;  1FGT A;  3T0U A;  1GY5 A;  3S28 A;  4R9K A;  5BVB A;  4HZ9 B;  4HJL B;  4K1V A;  2QEX 3;  3FKA A;  2XSH B;  1VQP 3;  4FMB A;  2HMO B;  3BNE A;  2YFL B;  3SX1 A;  3NBB A;  1JB4 A;  2XF3 A;  1DYU A;  3K9M C;  3RGA A;  2CFG A;  5LC7 A;  3S67 A;  2CFW A;  1F8N A;  3SOY A;  4EV2 A;  1GS3 A;  1NU3 A;  1K8A 4;  3FLJ A;  1O7P B;  5D83 A;  5CK6 A;  4HM4 B;  4OVM A;  2ML5 A;  3CMA 3;  1YJW 3;  4R80 A;  1NDO B;  5ELJ A;  4WWU C;  3GAX A;  3UL6 A;  3X3X A;  1GD3 A;  1US1 A;  2C11 A;  3NXJ A;  3OWU A;  4L8P A;  2CG0 A;  1U8C B;  5IEN A;  3JUM A;  1OF5 B;  4N6N B;  1OPY A;  2CK3 H;  4R9L A;  2F98 A;  1VQO 3;  3EN8 A;  2MC8 A;  1QAF A;  4EC6 A;  3NQZ A;  1YHQ 3;  1SJW A;  1DMM A;  3MPH A;  4HM3 B;  3V98 A;  5AEU B;  6STD A;  5I97 A;  1O7H B;  1QJG A;  3F7X A;  3LTC A;  1IU7 A;  2GBX B;  1SIH A;  4KZ1 A;  3N9H A;  3LT9 A;  2ZL8 A;  1KWI A;  1QAL A;  1JNQ A;  1N9E A;  1Q7Y 4;  3U1W A;  2XGL A;  2W9P A;  4AEQ A;  1O7N B;  2WOF A;  2XEP A;  3CCU 3;  1KQS 2;  2OTL 3;  3B4P A;  3SOA A;  1TU5 A;  1OUN A;  5AYS C;  2HMM B;  2CWT A;  4KVH A;  1N5P A;  2WO0 A;  2YX9 A;  4OK0 A;  3FG3 A;  1HU9 A;  3E99 A;  3QRD A;  3FSD A;  3WOE B;  4H3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...