2HMMB

Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmmB00
4U13A 1GS3A 1OF5B 2XR8B 3IPTA 1Q40B 2F99A 2CHCA 2BMOB 4R9KA 3FF2A 3CU3A 3FSDA 2QIYA 3KZTA 1OGZA 4STDA 1STDA 5AIHA 2F86B 3T8NA 5IENA 3GZYB 4WWUC 3MG1A 1QMAA 3D9RA 3VSYA 1U5OA 3I0YA 3NBRA 1Q42A 1W01A 1JN5B 2HMNB 3HX8A 5D81A 5JPUA 1SJWA 5IF6A 5CXOA 4X2OA 3FLJA 1ULIB 1VZZA 3F8HA 3NV0A 4WP5A 4XB5A 3FZWA 5IERA 1Q40A 2GBWB 3JUNA 3NXJA 4ORLA 5DREA 2YFLB 3NM2A 3B7CA 1HKXA 2YFJB 3FH1A 1OHPA 4GB5A 4HZBB 1JN5A 3H3HA 2Z77A 4HZ9B 3RGAA 5BVBA 4HJLB 1JKGA 3B8LA 3E99A 1O7GB 3M8CA 3NUVA 4HM2B 4LMIA 3B4OA 4WYKA 3SOAA 2Z7AA 3K0ZA 4XBTA 3SOYA 1E97A 2OWPA 3MG2A 2B1XB 4LGQA 1OF5A 2A15A 4R9LA 5AIIA 3OX9A 3WMDA 1GY6A 3OV4A 2GEXA 5AEUB 5JPPA 5IG5A 2QGUA 3NV0B 4OVMA 2Z76A 5EVHA 3GZXB 1QJGA 5AIGA 3UNLA 2R4IA 1AR0A 2RGQA 2STDA 1OHSA 3LZAA 3MKIA 5TGNA 3DM8A 1JKGB 3A76A 3ECFA 3Q90A 1GYBA 4WYKB 2BNGA 2HMKB 2HMOB 3T8UA 1WQLB 4HM5B 1JB5A 3H51A 3KKGA 3EHCA 3MHEA 3GZBA 2XSHB 1DMNA 1W02A 3EQQB 3JUMA 4PEJA 2GBXB 5CK6A 4XBXA 2HMMB 4FCMA 2F98A 4HM6B 3DZLA 3K7CA 1NWWA 4HM3B 2INXA 3F40A 3CNXA 1C7HA 1ZX2A 2XSOB 3FGYA 3EN1B 5IEOA 3G0KA 2W2CA 2XRXB 3CNMA 4L7KA 4XM4A 3JUOA 4I4KA 3EBTA 1O7NB 4LEHA 1BUQA 2K54A 4HVNA 4K1VA 1A2KA 1O7PB 4L8OA 4HM4B 3OWUA 4N3VA 4R1KA 3GRDA 5DRVA 5IG3A 5KP1A 4Q53A 4K1UA 5AEWB 5CF2A 2CKFB 5BXQA 1OH0A 5CLKA 1OPYA 2I9WA 5IG4A 4H3UA 3GWRA 5AIFA 1UUWB 1OHOA 1E3VA 2B24B 3F7SA 1IDPA 1NU3A 3SEDA 1Z1SA 3B4PA 4CDLA 3NHXA 4X2HA 2BMRB 3EBYA 4HM8B 1OGXA 1ISKA 1E3RA 2GEYA 2JQ5A 3DXOA 3G8ZA 4OUQA 5FW5A 2RFRA 3DUKA 5D83A 2HMJB 2UX0A 3HK4A 5STDA 3OXAA 1O7HB 1ASKA 1EG9B 1O7MB 1TUHA 2RCDA 3DMCA 3OWYA 1O7WB 2IMJA 4HM1B 3ER7A 4L8PA 4RZMA 1K41A 5HGRA 1S5AA 1W6YA 3VGNA 7STDA 1DMQA 1ZO2A 4MJDA 3MSOA 1JB2A 3GZRA 4HM0B 8CHOA 2BMQB 1OCVA 1TP6A 1CQSA 2PZVA 3MG3A 3BLZA 3CPOA 4XDVA 3STDA 6STDA 5IEPA 3KSPA 5IG0A 5CF1A 4IIAA 3UJMA 3FF0A 4HKVB 3RGRA 1W00A 1DMMA 1ULJB 5KP4A 3EJVA 3HZPA 4KVHA 2GXFA 3EN8A 1GY7A 1OUNA 2YFIB 3JUQA 4HM7B 4J8TA 3KE7A 4J9AA 3S5CA 1GY5A 4FCJA 4XDWA 5AI1A 4XBYA 1NDOB 3F8XA 3MYTA 3F7XA 1EA2A 3JUPA 3BB9A 1JB4A 1UUVB 3G16A 3EX9A 3OWSA 5G2GA 3F14A 3FKAA 3F9SA 5D82A 2HMLB 5KP3A 3ROBA 3EC9A 3LYGA 3EF8A
chains in the Genus database with same CATH superfamily
4U13A 1BRKA 3LH4A 1HU9A 4FMCA 1BVIA 1RGCA 1Q40B 5JBSA 1MWUA 3CU3A 3KZTA 3AMOA 4K90B 9RNTA 4CCVA 4EV5A 3V99A 1QMAA 4FMBA 1U5OA 3I0YA 1Q42A 1AQZA 4GSPA 1JN5B 1UCIA 1IYYA 1SJWA 1TIJA 1YVBI 1N8R4 1VQ83 1Y4KA 3FLJA 4H61A 4XB5A 2GU1A 1ROVA 4WP5A 1K9M4 1I2GA 3JUNA 2C4BA 1RKYA 1BNGA 4ILFA 3RDEA 1KSIA 2YFLB 4IPBA 3FH1A 4K61A 1OHPA 4HZBB 3A5EA 1BIRA 1AVLA 4WYKA 3UJMA 5AEWB 2BU4A 4LMIA 1UW1A 2K3DA 3ZG0A 2Z7AA 3CC73 3CME3 1E97A 4BL3A 1OF5A 1UCLA 2BIRA 4J5KA 4MMYB 3OX9A 4R9LA 1I2EA 3WMDA 4RNYA 4EV2A 3ZG5A 1UI8A 3O8YA 1FYSA 1M1K4 3GSPA 1JV2B 5EVHA 1QJGA 3IJEB 5AIGA 3WHOA 1YNVX 2R4IA 1YJW3 1S723 3LZAA 1SIIA 1HZ1A 2IUJA 3Q2PA 4WYKB 1RCKA 2HMOB 1TRPA 1KC84 2C10A 3H51A 3LMLA 1DE3A 1IVVA 2QEX3 2J8XB 1IT7A 1W02A 3JUMA 3U1WA 3NX0A 2HMMB 2F98A 1FUWA 4WHAA 3TDGA 1NWWA 1JBTA 1W6GA 2INXA 2K0MA 1CH0A 3F40A 2P38A 1X1XA 1B21A 1BSEA 3AMOB 3KN4A 3EN1B 1YJN3 1BRNL 2W2CA 1BRIA 4XM4A 1RJOA 1A2VA 1PYLA 4RNTA 1BUQA 1R4YA 4N6MA 5KP1A 5IG3A 1T3BA 2XF3A 1EQKA 5BXQA 1UCKA 3HI7A 1OH0A 5CLKA 1OPYA 3AHWA 3D79A 3GAXA 1KD14 1IK3A 1NU3A 2KF4A 2P0MA 1W7CA 1Z1SA 3S67A 4CDLA 4EYCA 3WODG 3EBYA 1QALA 2CWTA 1K734 3D4AA 2P05A 4O2HA 2F4YA 1GMQA 1LOVA 3G713 1QAFA 3CCV3 3OW22 2RCDA 3OWYA 1ROAA 1RNBA 1B2SA 1O7WB 1SIHA 2IMJA 1BNJA 3NBBA 3VGNA 2RNTA 1S5AA 1W6YA 7STDA 1BUJA 4LYLB 4BIRA 1YHQ3 1V58A 2O9UX 3D3LA 2AADA 2XFTA 3GZRA 2CX0A 7RNTA 1KQS2 3SYUA 3KSPA 5IG0A 3CMA3 3X3YA 4IIAA 5CF1A 3CCJ3 2CFLA 5HOHA 3ALAA 3KIIA 5BU4A 2GXFA 4HM7B 4J8TA 2L4VA 4FR9A 1FGQA 5AI1A 1BOXA 4XBYA 3V92A 2KF5A 3L0RA 3BB9A 1I2FA 1JB4A 1RDSA 2CX1A 2E2VA 3EX9A 1FGTA 3ROBA 2CFWA 3BNEA 2HMLB 3F9SA 4N6OB 1WMNA 5KP3A 3X3ZA 2HOHA 1TJDA 1JNQA 3CC43 1IQXA 3IPTA 3HIIA 4ZM8A 3LOYA 2CHCA 2UGIA 2O3OA 2E2TA 1CYUA 3DH2A 1STDA 5G1KA 1RGAA 2V1LA 3CXC2 3D9RA 1VQ43 1WNHA 1UGIA 2L1SA 3NBRA 5IW9A 2W04A 1W01A 3NM7A 5D81A 2Z6BA 5IF6A 4X2OA 1BRHA 1IU7A 3F8HA 3NV0A 5IERA 4R4KA 1Q40A 3CCE3 3NXJA 4MMZB 4ORLA 1GMPA 1FA3A 4RNZA 3B7CA 1HKXA 2AAEA 1GOVA 3IMAB 5FGOA 2OOVA 2D1WA 3H3HA 2Z77A 2F56A 1B2ZA 3AGOA 3M8CA 3E99A 2CFKA 3NUVA 3SOAA 2QA43 2P09A 4XBTA 2OWPA 3MG2A 2B1XB 4LGQA 2F5WA 3N9HA 1T2IA 3KCHA 1GD3A 2F5MA 3OV4A 1BAOA 2GEXA 2GU3A 1I8VA 3KSED 4OVMA 1JJ22 4BU4A 2H0GA 3MWZA 1Q824 1GOYA 1RGGA 1LNHA 1RGEA 3Q90A 3T8UA 3ECFA 4IT7A 1D6ZA 1B3SA 1JZOA 3LTDA 3DGLA 4AEQA 1RTUA 1EKMA 2WGOA 3EE1A 3MHEA 3GZBA 4PEJA 3EQQB 2KF3A 2PNCA 3WA2X 5M18A 4HM6B 3DZLA 5BIRA 3U97A 1C7HA 3S27A 3X40A 1BRSA 3SVAA 1TU5A 1GSPA 1N5HA 1N8QA 2FXTA 2CFGA 2WOHA 2XRXB 3CNMA 3G0KA 3JUOA 1RHLA 1SQWA 3EBTA 3T0UA 3CC23 1Q864 1LXEA 2K54A 2SARA 2W9QA 2WGQA 4L8OA 3OWUA 1FGOA 5CF2A 1MNLA 4O02B 1F8NA 2CWUA 1LQGC 1G0TA 4H3UA 3GWRA 1DETA 1UUWB 1D6UA 1LVNA 3F7SA 3NQYA 3UB1A 4AKZA 3NHXA 2BMRB 3FG3A 2IA7A 5AYSC 4NPBA 4NHFA 1ISKA 2GEYA 3DXOA 3UL6A 1FGMA 3HK4A 4I5QA 5STDA 1T5YA 3OXAA 1PU4A 1G96A 3DGOA 5HGRA 1YGEA 2CW9A 3ER7A 1Q7Y4 1K41A 4HAAA 5EQLA 1QVG2 1W4NA 1DMQA 1ZO2A 1BNFA 1RGFA 4MJDA 4GL6A 3NBJA 8CHOA 2BMQB 1OCVA 1T2HA 1YGWA 3HIGA 3STDA 3BLZA 3CPOA 1AVKA 1LRAA 3CCL3 1Q9EA 2XEPA 3K9MC 3BNCA 3FF0A 4HKVB 4FMDA 5KP4A 1YI23 2ZHXB 3EJVA 1FUSA 1RN4A 2CWVA 3EN8A 3JUQA 5AYRB 4J9AA 4MEIA 1UGHI 4XDWA 1JRQA 3PYJA 1N5PA 1NJI4 5LC7A 3F7XA 1YIT3 3JUPA 1GD4A 1GOUA 1JZDA 3G16A 3FG4A 3OWSA 2JDIH 3F14A 3WR2A 3CCQ3 5D82A 1CYVA 4O3VA 2KCDA 3LYGA 1VQ73 1MWSA 3DGMA 3N8BA 1N9EA 3S29A 1UI7A 1IV7A 3KFQC 3WDGB 1W2ZA 1OF5B 2XGNA 2XR8B 3Q1CA 4MMXB 3X3XA 2F99A 1I3IA 2BMOB 4R9KA 3FF2A 1K28A 1B20A 2OQEA 1TFKA 3SX1A 2F86B 2LQVA 4GHOA 1MGWA 4WWUC 3MG1A 1JBSA 1I70A 1A2PA 1EEJA 3PS8A 2HMNB 5JPUA 2OCTA 4JF8A 1M1XB 1DVCA 1VQN3 1N9JA 3FZWA 1RGLA 2W6JH 4LSOA 3NM2A 1LOYA 2KXGA 1V74A 4GB5A 5BVBA 4HZ9B 1BNRA 3RGAA 1AV4A 4HJLB 1JKGA 1O7GB 3LTAA 3SOYA 3B4OA 1RN7A 3K0ZA 5LC6A 2A15A 2BT3A 2KRTA 3QK9A 5AEUB 2C11A 2QGUA 3NV0B 1FW7A 1JBRA 1RGKA 3GZXB 1IVWA 2CH9A 7GSPA 3UNLA 3BNDA 1AR0A 3LXUX 2RGQA 2STDA 1K8A4 3MKIA 1JKGB 3A76A 2HMKB 4RBNA 2W0QA 3LT8A 2RBIA 1JB5A 2IUKA 3G4S3 3KKGA 1BNEA 3CCM3 3EHCA 1B2MA 1HYFA 1STFI 5CK6A 4N6NB 3LTCA 4FCMA 4XBXA 1VQM3 1IVUA 1L5GB 3VF1A 4HM3B 1IQYA 2MC8A 1OACA 2XSOB 5IEOA 4L7KA 8RNTA 3HOHA 3MPHA 4LEHA 2CFDA 4K1VA 1X1UA 1A2KA 1O7PB 5GSPA 5DRVA 1UDII 3GRDA 1TRQA 1QAKA 4Q53A 3Q3FA 1Q814 1BRJA 1IT8A 1RCLA 5IG4A 1VQQA 3PZWA 1OHOA 1E3VA 1VQ53 1MWRA 3SEDA 4FMAA 3SLUA 1DYUA 1EUIC 4BTXA 3B4PA 4X2HA 1BRGA 3LT9A 2Y73A 3I553 1OGXA 1E3RA 2E2UA 2JQ5A 3G8ZA 5JPPA 4OUQA 1ZGXA 4KFEA 5FW5A 2HMJB 3DY5A 1Q7HA 4KFFA 3CD63 4BTWA 1O7HB 3WOEB 1O7MB 1NO3A 3DMCA 2CC3A 2LYXA 4L8PA 5A0OB 3D5IA 1A90A 1RLSA 1CEWI 1W6CA 2RSXA 2ZA4A 1I0XA 4NREA 1X1YA 2CK3H 2MF7A 1RGHA 3D5GA 1V57A 4HM0B 1TP6A 2PZVA 4KZ1A 4XDVA 1PY3A 3X41A 5IEPA 3WA3A 1BSDA 2FNQA 1VQL3 1W00A 1DMMA 1NNVA 1ULJB 2UUGC 4KT3B 3HZPA 4HOHA 3CCU3 1I3FA 1OUNA 3KE7A 1SARA 6RNTA 2WOFA 1KWIA 2XH9A 3MYTA 1EA2A 2FGTA 2D42A 5G2GA 3WOFB 3FG1A 3URPA 3EF8A 2OTL3 1M9GA 5M19A 1GS3A 4KFDA 3N54B 4BL2A 4EXRA 4N6UA 3FSDA 2R41A 2QIYA 4QWTA 1GMRA 4BTYA 1OGZA 4STDA 5AIHA 3T8NA 5IENA 3GZYB 3PXMA 4OK0A 1LNIA 1ZS7A 3VSYA 2BO9B 1LQMB 2IYJA 2M7OA 1BNIA 1FZUA 1US1A 3HX8A 5I97A 3CCS3 2Y74A 5CXOA 2ML5A 1ULIB 1VZZA 4EBGA 3FCSB 1BGSA 2WO0A 5ELUA 2GBWB 1FUTA 2GSPA 2OOVC 5DREA 3AHSA 1YJ93 1C54A 3PGBA 2YFJB 1B27A 1BSBA 1JN5A 1VQK3 4JRFA 4WFOA 3B8LA 2W9PA 4HM2B 1BSAA 3SXXA 1WMOA 1M904 1TFOA 3J7Yd 1VQO3 1AY7A 2H0IA 4CPKA 1I0VA 5AIIA 4EC6A 1GY6A 5IG5A 1B2XA 3X42A 2Z76A 3ZFZA 4CJNA 1VQP3 5M1AA 2W03A 2CG1A 2SBLA 1OHSA 2W56B 5TGNA 2XFSA 3DM8A 5ELJA 4N6TA 1GYBA 1RN1A 2BNGA 1NB3I 1SPUA 1WQLB 4HM5B 3NQZA 4N6LA 2H0HA 1BSCA 2XSHB 1DMNA 1U8CB 4EW5A 1YVSA 3PCRA 2GBXB 4J5GA 1QVF2 5G1LA 3K7CA 1BU4A 1RSNA 3CNXA 1FGRA 1ZX2A 3FGYA 2XGLA 1VQ93 1G02A 1RNTA 4FCZA 1O7NB 1W5ZA 4HVNA 4R1KA 3DGNA 1WMPA 4N3VA 4HM4B 1D6YA 3JVCA 4K1UA 3PCSA 3UL5A 2CKFB 4R80A 1IVXA 1NB5I 3I563 3EB8A 1B2UA 2I9WA 2ZDJA 1DVDA 5AIFA 4N6V0 2B24B 4TX4A 1YIJ3 1IDPA 1IV9A 3QRDA 6GSPA 1A67A 1BANA 1BNSA 1RRHA 2BHMA 1R4CA 4HM8B 2YX9A 1MWTA 2RFRA 1X1WA 3DUKA 2UX0A 5D83A 1LOWA 2KF6A 1ASKA 1EG9B 1TUHA 4AKYA 4RZMA 4O8SA 4HM1B 3MSOA 1JB2A 1CQSA 2ZL8A 3BNBA 3MG3A 6STDA 3K63A 1J2BA 2KAAA 2W56A 2ML6A 1UUGB 5EEOA 3BU4A 4HBRA 1RRLA 3RGRA 3LTBA 1LOXA 3S28A 3V98A 3G6E3 2OQEC 2CIUA 1UCJA 3BIRA 2IY2A 1GY7A 1MOLA 1TTOA 2YFIB 3DGYA 4KVHA 4LZIA 3S5CA 4DKIA 1IQ8A 1GY5A 4FCJA 1RMSA 2CG0A 1WTHA 4HYZA 1VQ63 1NDOB 2OTJ3 3F8XA 4G1MB 3K5TA 1UUVB 2Q07A 3CCR3 3RNTA 1PFPA 3FKAA 3CPW2 5RNTA 1W2B2 3EC9A 3AGNA 2P0XA 4I4KA 1MGRA
chains in the Genus database with same CATH topology
4U13A 3LH4A 1HU9A 4FMCA 1Q40B 5JBSA 3CU3A 3KZTA 3AMOA 4K90B 4CCVA 4EV5A 3V99A 1QMAA 4FMBA 1U5OA 3I0YA 1Q42A 1JN5B 1SJWA 1TIJA 1YVBI 1N8R4 1VQ83 1Y4KA 3FLJA 4H61A 4XB5A 2GU1A 1ROVA 4WP5A 1K9M4 3JUNA 1RKYA 3RDEA 1KSIA 2YFLB 4IPBA 3FH1A 4K61A 1OHPA 4HZBB 1AVLA 4WYKA 3UJMA 5AEWB 4LMIA 1UW1A 2Z7AA 3CC73 3CME3 1E97A 1OF5A 4MMYB 4R9LA 3OX9A 3WMDA 4RNYA 4EV2A 1UI8A 3O8YA 1M1K4 1JV2B 5EVHA 1QJGA 3IJEB 5AIGA 2R4IA 1YJW3 1S723 3LZAA 1SIIA 2IUJA 3Q2PA 4WYKB 2HMOB 1KC84 2C10A 3H51A 3LMLA 1IVVA 2QEX3 1IT7A 1W02A 3JUMA 3U1WA 3NX0A 2HMMB 2F98A 1FUWA 4WHAA 3TDGA 1NWWA 1W6GA 2INXA 2K0MA 3F40A 2P38A 3AMOB 3KN4A 3EN1B 1YJN3 2W2CA 4XM4A 1RJOA 1A2VA 1BUQA 4N6MA 5KP1A 5IG3A 2XF3A 1EQKA 5BXQA 3HI7A 1OH0A 5CLKA 1OPYA 3GAXA 1KD14 1IK3A 1NU3A 2P0MA 1W7CA 1Z1SA 3S67A 4CDLA 4EYCA 3WODG 3EBYA 1QALA 2CWTA 1K734 2P05A 4O2HA 3CCV3 3G713 1QAFA 3OW22 2RCDA 3OWYA 1ROAA 1O7WB 1SIHA 2IMJA 3NBBA 3VGNA 1S5AA 1W6YA 7STDA 1YHQ3 2O9UX 3D3LA 3GZRA 2XFTA 1KQS2 3KSPA 5IG0A 3CMA3 3X3YA 4IIAA 5CF1A 3CCJ3 2CFLA 3ALAA 3KIIA 2GXFA 4HM7B 4J8TA 2L4VA 4FR9A 1FGQA 5AI1A 3V92A 4XBYA 3L0RA 3BB9A 2E2VA 1JB4A 3EX9A 1FGTA 3ROBA 2CFWA 3BNEA 2HMLB 3F9SA 4N6OB 1WMNA 5KP3A 3X3ZA 1JNQA 3CC43 1IQXA 3IPTA 3HIIA 4ZM8A 3LOYA 2CHCA 2O3OA 2E2TA 1CYUA 1STDA 2V1LA 3CXC2 3D9RA 1VQ43 1WNHA 3NBRA 5IW9A 2W04A 1W01A 3NM7A 5D81A 2Z6BA 5IF6A 4X2OA 1IU7A 3F8HA 3NV0A 5IERA 4R4KA 1Q40A 3CCE3 3NXJA 4MMZB 4ORLA 1FA3A 4RNZA 3B7CA 1HKXA 3IMAB 2OOVA 5FGOA 2D1WA 3H3HA 2Z77A 3M8CA 3E99A 2CFKA 3NUVA 3SOAA 2QA43 2P09A 4XBTA 2OWPA 3MG2A 2B1XB 4LGQA 3N9HA 1GD3A 3OV4A 2GEXA 2GU3A 3KSED 4OVMA 1JJ22 3MWZA 1Q824 1LNHA 3Q90A 3T8UA 3ECFA 4IT7A 1D6ZA 2OTL3 3LTDA 3DGLA 4AEQA 1EKMA 2WGOA 3EE1A 3MHEA 3GZBA 4PEJA 3EQQB 2PNCA 3WA2X 4HM6B 3DZLA 3U97A 1C7HA 3S27A 3X40A 3SVAA 1TU5A 1N5HA 1N8QA 2FXTA 2CFGA 2WOHA 2XRXB 3CNMA 3G0KA 3JUOA 3T0UA 1SQWA 3EBTA 3CC23 1Q864 1LXEA 2K54A 2W9QA 2WGQA 4L8OA 3OWUA 1FGOA 5CF2A 1MNLA 4O02B 1F8NA 2CWUA 4H3UA 3GWRA 1UUWB 1D6UA 1LVNA 3F7SA 3NQYA 3UB1A 4AKZA 3NHXA 2BMRB 3FG3A 2IA7A 5AYSC 4NHFA 1ISKA 2GEYA 3DXOA 3UL6A 1FGMA 3HK4A 5STDA 1T5YA 3OXAA 1PU4A 1G96A 3DGOA 5HGRA 1YGEA 2CW9A 3ER7A 1Q7Y4 1K41A 1QVG2 5EQLA 1W4NA 1DMQA 1ZO2A 4MJDA 4GL6A 3NBJA 8CHOA 2BMQB 1OCVA 3STDA 3HIGA 3BLZA 3CPOA 1AVKA 3CCL3 2XEPA 3K9MC 3BNCA 3FF0A 4HKVB 4FMDA 5KP4A 1YI23 3EJVA 2CWVA 3EN8A 3JUQA 5AYRB 4J9AA 4MEIA 4XDWA 1JRQA 3PYJA 1N5PA 1NJI4 5LC7A 3F7XA 1YIT3 3JUPA 1GD4A 3G16A 3FG4A 3OWSA 2JDIH 3F14A 3CCQ3 5D82A 1CYVA 4O3VA 2KCDA 3LYGA 1VQ73 3DGMA 3N8BA 1N9EA 3S29A 1UI7A 1IV7A 3KFQC 3WDGB 1W2ZA 1OF5B 2XGNA 2XR8B 3Q1CA 4MMXB 3X3XA 2F99A 2BMOB 4R9KA 3FF2A 1K28A 2OQEA 1TFKA 3SX1A 2F86B 2LQVA 4WWUC 3MG1A 3PS8A 2HMNB 5JPUA 2OCTA 4JF8A 1M1XB 1DVCA 1VQN3 1N9JA 3FZWA 2W6JH 4LSOA 3NM2A 2KXGA 1V74A 4GB5A 5BVBA 4HZ9B 3RGAA 1AV4A 4HJLB 1JKGA 1O7GB 3LTAA 3SOYA 3B4OA 1RN7A 3K0ZA 5LC6A 2A15A 2BT3A 2KRTA 3QK9A 5AEUB 2C11A 2QGUA 3NV0B 3GZXB 1IVWA 2CH9A 3UNLA 3BNDA 1AR0A 3LXUX 2RGQA 2STDA 1K8A4 3MKIA 1JKGB 3A76A 2HMKB 4RBNA 2W0QA 3LT8A 1JB5A 2IUKA 3G4S3 3KKGA 3CCM3 3EHCA 1STFI 5CK6A 4N6NB 3LTCA 4FCMA 4XBXA 1VQM3 1IVUA 1L5GB 3VF1A 4HM3B 1IQYA 2MC8A 1OACA 2XSOB 5IEOA 4L7KA 3MPHA 4LEHA 2CFDA 4K1VA 1A2KA 1O7PB 5DRVA 3GRDA 1QAKA 4Q53A 1Q814 1IT8A 5IG4A 3PZWA 1OHOA 1E3VA 1VQ53 3SEDA 4FMAA 3SLUA 1DYUA 4BTXA 3B4PA 4X2HA 3LT9A 2Y73A 3I553 1OGXA 1E3RA 2E2UA 2JQ5A 3G8ZA 5JPPA 4OUQA 4KFEA 5FW5A 2HMJB 3DY5A 4KFFA 3CD63 4BTWA 1O7HB 3WOEB 3DMCA 1O7MB 1NO3A 2CC3A 2LYXA 4L8PA 5A0OB 1A90A 1W6CA 1CEWI 2RSXA 4NREA 2CK3H 2MF7A 4HM0B 1TP6A 2PZVA 4KZ1A 4XDVA 3X41A 5IEPA 3WA3A 2FNQA 1VQL3 1W00A 1DMMA 1ULJB 3HZPA 3CCU3 1OUNA 3KE7A 2WOFA 1KWIA 2XH9A 3MYTA 1EA2A 2FGTA 2D42A 5G2GA 3WOFB 3FG1A 3EF8A 1M9GA 1GS3A 4KFDA 3N54B 4EXRA 4N6UA 3FSDA 4QWTA 2QIYA 4BTYA 1OGZA 4STDA 5AIHA 3T8NA 5IENA 3GZYB 3PXMA 4OK0A 3VSYA 2BO9B 2M7OA 1US1A 3HX8A 3CCS3 5I97A 2Y74A 5CXOA 2ML5A 1ULIB 1VZZA 4EBGA 3FCSB 2WO0A 5ELUA 2GBWB 5DREA 2OOVC 1YJ93 3PGBA 2YFJB 1JN5A 1VQK3 4JRFA 4WFOA 3B8LA 2W9PA 4HM2B 3SXXA 1WMOA 1M904 1TFOA 3J7Yd 1VQO3 4EC6A 5AIIA 1GY6A 5IG5A 3X42A 2Z76A 1VQP3 2W03A 2CG1A 2SBLA 1OHSA 2W56B 5TGNA 2XFSA 3DM8A 5ELJA 4N6TA 1GYBA 1SPUA 1NB3I 2BNGA 1WQLB 4HM5B 3NQZA 4N6LA 2XSHB 1DMNA 1U8CB 3PCRA 2GBXB 1QVF2 3K7CA 3CNXA 1FGRA 1ZX2A 3FGYA 2XGLA 1VQ93 4FCZA 1O7NB 1W5ZA 4HVNA 4R1KA 3DGNA 1WMPA 4N3VA 4HM4B 1D6YA 3JVCA 4K1UA 3PCSA 3UL5A 2CKFB 4R80A 1IVXA 1NB5I 3I563 3EB8A 2I9WA 2ZDJA 1DVDA 5AIFA 4N6V0 2B24B 4TX4A 1YIJ3 1IDPA 1IV9A 3QRDA 1A67A 1RRHA 2BHMA 1R4CA 4HM8B 2YX9A 2RFRA 3DUKA 5D83A 2UX0A 1ASKA 1EG9B 1TUHA 4AKYA 4RZMA 4O8SA 4HM1B 3MSOA 1JB2A 1CQSA 2ZL8A 3BNBA 3MG3A 6STDA 3K63A 1J2BA 2W56A 2ML6A 5EEOA 4HBRA 1RRLA 3RGRA 3LTBA 1LOXA 3S28A 3V98A 3G6E3 2OQEC 2CIUA 4KVHA 4LZIA 1GY7A 1MOLA 2YFIB 3S5CA 1IQ8A 1GY5A 4FCJA 2CG0A 4HYZA 1WTHA 1VQ63 2OTJ3 1NDOB 3F8XA 4G1MB 3K5TA 1UUVB 2Q07A 3CCR3 1PFPA 3FKAA 3CPW2 1W2B2 3EC9A 2P0XA 4I4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U13 A;  1GS3 A;  1OF5 B;  2XR8 B;  3IPT A;  1Q40 B;  2F99 A;  2CHC A;  2BMO B;  4R9K A;  3FF2 A;  3CU3 A;  3FSD A;  2QIY A;  3KZT A;  1OGZ A;  4STD A;  1STD A;  5AIH A;  2F86 B;  3T8N A;  5IEN A;  3GZY B;  4WWU C;  3MG1 A;  1QMA A;  3D9R A;  3VSY A;  1U5O A;  3I0Y A;  3NBR A;  1Q42 A;  1W01 A;  1JN5 B;  2HMN B;  3HX8 A;  5D81 A;  5JPU A;  1SJW A;  5IF6 A;  5CXO A;  4X2O A;  3FLJ A;  1ULI B;  1VZZ A;  3F8H A;  3NV0 A;  4WP5 A;  4XB5 A;  3FZW A;  5IER A;  1Q40 A;  2GBW B;  3JUN A;  3NXJ A;  4ORL A;  5DRE A;  2YFL B;  3NM2 A;  3B7C A;  1HKX A;  2YFJ B;  3FH1 A;  1OHP A;  4GB5 A;  4HZB B;  1JN5 A;  3H3H A;  2Z77 A;  4HZ9 B;  3RGA A;  5BVB A;  4HJL B;  1JKG A;  3B8L A;  3E99 A;  1O7G B;  3M8C A;  3NUV A;  4HM2 B;  4LMI A;  3B4O A;  4WYK A;  3SOA A;  2Z7A A;  3K0Z A;  4XBT A;  3SOY A;  1E97 A;  2OWP A;  3MG2 A;  2B1X B;  4LGQ A;  1OF5 A;  2A15 A;  4R9L A;  5AII A;  3OX9 A;  3WMD A;  1GY6 A;  3OV4 A;  2GEX A;  5AEU B;  5JPP A;  5IG5 A;  2QGU A;  3NV0 B;  4OVM A;  2Z76 A;  5EVH A;  3GZX B;  1QJG A;  5AIG A;  3UNL A;  2R4I A;  1AR0 A;  2RGQ A;  2STD A;  1OHS A;  3LZA A;  3MKI A;  5TGN A;  3DM8 A;  1JKG B;  3A76 A;  3ECF A;  3Q90 A;  1GYB A;  4WYK B;  2BNG A;  2HMK B;  2HMO B;  3T8U A;  1WQL B;  4HM5 B;  1JB5 A;  3H51 A;  3KKG A;  3EHC A;  3MHE A;  3GZB A;  2XSH B;  1DMN A;  1W02 A;  3EQQ B;  3JUM A;  4PEJ A;  2GBX B;  5CK6 A;  4XBX A;  2HMM B;  4FCM A;  2F98 A;  4HM6 B;  3DZL A;  3K7C A;  1NWW A;  4HM3 B;  2INX A;  3F40 A;  3CNX A;  1C7H A;  1ZX2 A;  2XSO B;  3FGY A;  3EN1 B;  5IEO A;  3G0K A;  2W2C A;  2XRX B;  3CNM A;  4L7K A;  4XM4 A;  3JUO A;  4I4K A;  3EBT A;  1O7N B;  4LEH A;  1BUQ A;  2K54 A;  4HVN A;  4K1V A;  1A2K A;  1O7P B;  4L8O A;  4HM4 B;  3OWU A;  4N3V A;  4R1K A;  3GRD A;  5DRV A;  5IG3 A;  5KP1 A;  4Q53 A;  4K1U A;  5AEW B;  5CF2 A;  2CKF B;  5BXQ A;  1OH0 A;  5CLK A;  1OPY A;  2I9W A;  5IG4 A;  4H3U A;  3GWR A;  5AIF A;  1UUW B;  1OHO A;  1E3V A;  2B24 B;  3F7S A;  1IDP A;  1NU3 A;  3SED A;  1Z1S A;  3B4P A;  4CDL A;  3NHX A;  4X2H A;  2BMR B;  3EBY A;  4HM8 B;  1OGX A;  1ISK A;  1E3R A;  2GEY A;  2JQ5 A;  3DXO A;  3G8Z A;  4OUQ A;  5FW5 A;  2RFR A;  3DUK A;  5D83 A;  2HMJ B;  2UX0 A;  3HK4 A;  5STD A;  3OXA A;  1O7H B;  1ASK A;  1EG9 B;  1O7M B;  1TUH A;  2RCD A;  3DMC A;  3OWY A;  1O7W B;  2IMJ A;  4HM1 B;  3ER7 A;  4L8P A;  4RZM A;  1K41 A;  5HGR A;  1S5A A;  1W6Y A;  3VGN A;  7STD A;  1DMQ A;  1ZO2 A;  4MJD A;  3MSO A;  1JB2 A;  3GZR A;  4HM0 B;  8CHO A;  2BMQ B;  1OCV A;  1TP6 A;  1CQS A;  2PZV A;  3MG3 A;  3BLZ A;  3CPO A;  4XDV A;  3STD A;  6STD A;  5IEP A;  3KSP A;  5IG0 A;  5CF1 A;  4IIA A;  3UJM A;  3FF0 A;  4HKV B;  3RGR A;  1W00 A;  1DMM A;  1ULJ B;  5KP4 A;  3EJV A;  3HZP A;  4KVH A;  2GXF A;  3EN8 A;  1GY7 A;  1OUN A;  2YFI B;  3JUQ A;  4HM7 B;  4J8T A;  3KE7 A;  4J9A A;  3S5C A;  1GY5 A;  4FCJ A;  4XDW A;  5AI1 A;  4XBY A;  1NDO B;  3F8X A;  3MYT A;  3F7X A;  1EA2 A;  3JUP A;  3BB9 A;  1JB4 A;  1UUV B;  3G16 A;  3EX9 A;  3OWS A;  5G2G A;  3F14 A;  3FKA A;  3F9S A;  5D82 A;  2HML B;  5KP3 A;  3ROB A;  3EC9 A;  3LYG A;  3EF8 A; 
#chains in the Genus database with same CATH topology
 4U13 A;  1BRK A;  3LH4 A;  1HU9 A;  4FMC A;  1BVI A;  1RGC A;  1Q40 B;  5JBS A;  1MWU A;  3CU3 A;  3KZT A;  3AMO A;  4K90 B;  9RNT A;  4CCV A;  4EV5 A;  3V99 A;  1QMA A;  4FMB A;  1U5O A;  3I0Y A;  1Q42 A;  1AQZ A;  4GSP A;  1JN5 B;  1UCI A;  1IYY A;  1SJW A;  1TIJ A;  1YVB I;  1N8R 4;  1VQ8 3;  1Y4K A;  3FLJ A;  4H61 A;  4XB5 A;  2GU1 A;  1ROV A;  4WP5 A;  1K9M 4;  1I2G A;  3JUN A;  2C4B A;  1RKY A;  1BNG A;  4ILF A;  3RDE A;  1KSI A;  2YFL B;  4IPB A;  3FH1 A;  4K61 A;  1OHP A;  4HZB B;  3A5E A;  1BIR A;  1AVL A;  4WYK A;  3UJM A;  5AEW B;  2BU4 A;  4LMI A;  1UW1 A;  2K3D A;  3ZG0 A;  2Z7A A;  3CC7 3;  3CME 3;  1E97 A;  4BL3 A;  1OF5 A;  1UCL A;  2BIR A;  4J5K A;  4MMY B;  3OX9 A;  4R9L A;  1I2E A;  3WMD A;  4RNY A;  4EV2 A;  3ZG5 A;  1UI8 A;  3O8Y A;  1FYS A;  1M1K 4;  3GSP A;  1JV2 B;  5EVH A;  1QJG A;  3IJE B;  5AIG A;  3WHO A;  1YNV X;  2R4I A;  1YJW 3;  1S72 3;  3LZA A;  1SII A;  1HZ1 A;  2IUJ A;  3Q2P A;  4WYK B;  1RCK A;  2HMO B;  1TRP A;  1KC8 4;  2C10 A;  3H51 A;  3LML A;  1DE3 A;  1IVV A;  2QEX 3;  2J8X B;  1IT7 A;  1W02 A;  3JUM A;  3U1W A;  3NX0 A;  2HMM B;  2F98 A;  1FUW A;  4WHA A;  3TDG A;  1NWW A;  1JBT A;  1W6G A;  2INX A;  2K0M A;  1CH0 A;  3F40 A;  2P38 A;  1X1X A;  1B21 A;  1BSE A;  3AMO B;  3KN4 A;  3EN1 B;  1YJN 3;  1BRN L;  2W2C A;  1BRI A;  4XM4 A;  1RJO A;  1A2V A;  1PYL A;  4RNT A;  1BUQ A;  1R4Y A;  4N6M A;  5KP1 A;  5IG3 A;  1T3B A;  2XF3 A;  1EQK A;  5BXQ A;  1UCK A;  3HI7 A;  1OH0 A;  5CLK A;  1OPY A;  3AHW A;  3D79 A;  3GAX A;  1KD1 4;  1IK3 A;  1NU3 A;  2KF4 A;  2P0M A;  1W7C A;  1Z1S A;  3S67 A;  4CDL A;  4EYC A;  3WOD G;  3EBY A;  1QAL A;  2CWT A;  1K73 4;  3D4A A;  2P05 A;  4O2H A;  2F4Y A;  1GMQ A;  1LOV A;  3G71 3;  1QAF A;  3CCV 3;  3OW2 2;  2RCD A;  3OWY A;  1ROA A;  1RNB A;  1B2S A;  1O7W B;  1SIH A;  2IMJ A;  1BNJ A;  3NBB A;  3VGN A;  2RNT A;  1S5A A;  1W6Y A;  7STD A;  1BUJ A;  4LYL B;  4BIR A;  1YHQ 3;  1V58 A;  2O9U X;  3D3L A;  2AAD A;  2XFT A;  3GZR A;  2CX0 A;  7RNT A;  1KQS 2;  3SYU A;  3KSP A;  5IG0 A;  3CMA 3;  3X3Y A;  4IIA A;  5CF1 A;  3CCJ 3;  2CFL A;  5HOH A;  3ALA A;  3KII A;  5BU4 A;  2GXF A;  4HM7 B;  4J8T A;  2L4V A;  4FR9 A;  1FGQ A;  5AI1 A;  1BOX A;  4XBY A;  3V92 A;  2KF5 A;  3L0R A;  3BB9 A;  1I2F A;  1JB4 A;  1RDS A;  2CX1 A;  2E2V A;  3EX9 A;  1FGT A;  3ROB A;  2CFW A;  3BNE A;  2HML B;  3F9S A;  4N6O B;  1WMN A;  5KP3 A;  3X3Z A;  2HOH A;  1TJD A;  1JNQ A;  3CC4 3;  1IQX A;  3IPT A;  3HII A;  4ZM8 A;  3LOY A;  2CHC A;  2UGI A;  2O3O A;  2E2T A;  1CYU A;  3DH2 A;  1STD A;  5G1K A;  1RGA A;  2V1L A;  3CXC 2;  3D9R A;  1VQ4 3;  1WNH A;  1UGI A;  2L1S A;  3NBR A;  5IW9 A;  2W04 A;  1W01 A;  3NM7 A;  5D81 A;  2Z6B A;  5IF6 A;  4X2O A;  1BRH A;  1IU7 A;  3F8H A;  3NV0 A;  5IER A;  4R4K A;  1Q40 A;  3CCE 3;  3NXJ A;  4MMZ B;  4ORL A;  1GMP A;  1FA3 A;  4RNZ A;  3B7C A;  1HKX A;  2AAE A;  1GOV A;  3IMA B;  5FGO A;  2OOV A;  2D1W A;  3H3H A;  2Z77 A;  2F56 A;  1B2Z A;  3AGO A;  3M8C A;  3E99 A;  2CFK A;  3NUV A;  3SOA A;  2QA4 3;  2P09 A;  4XBT A;  2OWP A;  3MG2 A;  2B1X B;  4LGQ A;  2F5W A;  3N9H A;  1T2I A;  3KCH A;  1GD3 A;  2F5M A;  3OV4 A;  1BAO A;  2GEX A;  2GU3 A;  1I8V A;  3KSE D;  4OVM A;  1JJ2 2;  4BU4 A;  2H0G A;  3MWZ A;  1Q82 4;  1GOY A;  1RGG A;  1LNH A;  1RGE A;  3Q90 A;  3T8U A;  3ECF A;  4IT7 A;  1D6Z A;  1B3S A;  1JZO A;  3LTD A;  3DGL A;  4AEQ A;  1RTU A;  1EKM A;  2WGO A;  3EE1 A;  3MHE A;  3GZB A;  4PEJ A;  3EQQ B;  2KF3 A;  2PNC A;  3WA2 X;  5M18 A;  4HM6 B;  3DZL A;  5BIR A;  3U97 A;  1C7H A;  3S27 A;  3X40 A;  1BRS A;  3SVA A;  1TU5 A;  1GSP A;  1N5H A;  1N8Q A;  2FXT A;  2CFG A;  2WOH A;  2XRX B;  3CNM A;  3G0K A;  3JUO A;  1RHL A;  1SQW A;  3EBT A;  3T0U A;  3CC2 3;  1Q86 4;  1LXE A;  2K54 A;  2SAR A;  2W9Q A;  2WGQ A;  4L8O A;  3OWU A;  1FGO A;  5CF2 A;  1MNL A;  4O02 B;  1F8N A;  2CWU A;  1LQG C;  1G0T A;  4H3U A;  3GWR A;  1DET A;  1UUW B;  1D6U A;  1LVN A;  3F7S A;  3NQY A;  3UB1 A;  4AKZ A;  3NHX A;  2BMR B;  3FG3 A;  2IA7 A;  5AYS C;  4NPB A;  4NHF A;  1ISK A;  2GEY A;  3DXO A;  3UL6 A;  1FGM A;  3HK4 A;  4I5Q A;  5STD A;  1T5Y A;  3OXA A;  1PU4 A;  1G96 A;  3DGO A;  5HGR A;  1YGE A;  2CW9 A;  3ER7 A;  1Q7Y 4;  1K41 A;  4HAA A;  5EQL A;  1QVG 2;  1W4N A;  1DMQ A;  1ZO2 A;  1BNF A;  1RGF A;  4MJD A;  4GL6 A;  3NBJ A;  8CHO A;  2BMQ B;  1OCV A;  1T2H A;  1YGW A;  3HIG A;  3STD A;  3BLZ A;  3CPO A;  1AVK A;  1LRA A;  3CCL 3;  1Q9E A;  2XEP A;  3K9M C;  3BNC A;  3FF0 A;  4HKV B;  4FMD A;  5KP4 A;  1YI2 3;  2ZHX B;  3EJV A;  1FUS A;  1RN4 A;  2CWV A;  3EN8 A;  3JUQ A;  5AYR B;  4J9A A;  4MEI A;  1UGH I;  4XDW A;  1JRQ A;  3PYJ A;  1N5P A;  1NJI 4;  5LC7 A;  3F7X A;  1YIT 3;  3JUP A;  1GD4 A;  1GOU A;  1JZD A;  3G16 A;  3FG4 A;  3OWS A;  2JDI H;  3F14 A;  3WR2 A;  3CCQ 3;  5D82 A;  1CYV A;  4O3V A;  2KCD A;  3LYG A;  1VQ7 3;  1MWS A;  3DGM A;  3N8B A;  1N9E A;  3S29 A;  1UI7 A;  1IV7 A;  3KFQ C;  3WDG B;  1W2Z A;  1OF5 B;  2XGN A;  2XR8 B;  3Q1C A;  4MMX B;  3X3X A;  2F99 A;  1I3I A;  2BMO B;  4R9K A;  3FF2 A;  1K28 A;  1B20 A;  2OQE A;  1TFK A;  3SX1 A;  2F86 B;  2LQV A;  4GHO A;  1MGW A;  4WWU C;  3MG1 A;  1JBS A;  1I70 A;  1A2P A;  1EEJ A;  3PS8 A;  2HMN B;  5JPU A;  2OCT A;  4JF8 A;  1M1X B;  1DVC A;  1VQN 3;  1N9J A;  3FZW A;  1RGL A;  2W6J H;  4LSO A;  3NM2 A;  1LOY A;  2KXG A;  1V74 A;  4GB5 A;  5BVB A;  4HZ9 B;  1BNR A;  3RGA A;  1AV4 A;  4HJL B;  1JKG A;  1O7G B;  3LTA A;  3SOY A;  3B4O A;  1RN7 A;  3K0Z A;  5LC6 A;  2A15 A;  2BT3 A;  2KRT A;  3QK9 A;  5AEU B;  2C11 A;  2QGU A;  3NV0 B;  1FW7 A;  1JBR A;  1RGK A;  3GZX B;  1IVW A;  2CH9 A;  7GSP A;  3UNL A;  3BND A;  1AR0 A;  3LXU X;  2RGQ A;  2STD A;  1K8A 4;  3MKI A;  1JKG B;  3A76 A;  2HMK B;  4RBN A;  2W0Q A;  3LT8 A;  2RBI A;  1JB5 A;  2IUK A;  3G4S 3;  3KKG A;  1BNE A;  3CCM 3;  3EHC A;  1B2M A;  1HYF A;  1STF I;  5CK6 A;  4N6N B;  3LTC A;  4FCM A;  4XBX A;  1VQM 3;  1IVU A;  1L5G B;  3VF1 A;  4HM3 B;  1IQY A;  2MC8 A;  1OAC A;  2XSO B;  5IEO A;  4L7K A;  8RNT A;  3HOH A;  3MPH A;  4LEH A;  2CFD A;  4K1V A;  1X1U A;  1A2K A;  1O7P B;  5GSP A;  5DRV A;  1UDI I;  3GRD A;  1TRQ A;  1QAK A;  4Q53 A;  3Q3F A;  1Q81 4;  1BRJ A;  1IT8 A;  1RCL A;  5IG4 A;  1VQQ A;  3PZW A;  1OHO A;  1E3V A;  1VQ5 3;  1MWR A;  3SED A;  4FMA A;  3SLU A;  1DYU A;  1EUI C;  4BTX A;  3B4P A;  4X2H A;  1BRG A;  3LT9 A;  2Y73 A;  3I55 3;  1OGX A;  1E3R A;  2E2U A;  2JQ5 A;  3G8Z A;  5JPP A;  4OUQ A;  1ZGX A;  4KFE A;  5FW5 A;  2HMJ B;  3DY5 A;  1Q7H A;  4KFF A;  3CD6 3;  4BTW A;  1O7H B;  3WOE B;  1O7M B;  1NO3 A;  3DMC A;  2CC3 A;  2LYX A;  4L8P A;  5A0O B;  3D5I A;  1A90 A;  1RLS A;  1CEW I;  1W6C A;  2RSX A;  2ZA4 A;  1I0X A;  4NRE A;  1X1Y A;  2CK3 H;  2MF7 A;  1RGH A;  3D5G A;  1V57 A;  4HM0 B;  1TP6 A;  2PZV A;  4KZ1 A;  4XDV A;  1PY3 A;  3X41 A;  5IEP A;  3WA3 A;  1BSD A;  2FNQ A;  1VQL 3;  1W00 A;  1DMM A;  1NNV A;  1ULJ B;  2UUG C;  4KT3 B;  3HZP A;  4HOH A;  3CCU 3;  1I3F A;  1OUN A;  3KE7 A;  1SAR A;  6RNT A;  2WOF A;  1KWI A;  2XH9 A;  3MYT A;  1EA2 A;  2FGT A;  2D42 A;  5G2G A;  3WOF B;  3FG1 A;  3URP A;  3EF8 A;  2OTL 3;  1M9G A;  5M19 A;  1GS3 A;  4KFD A;  3N54 B;  4BL2 A;  4EXR A;  4N6U A;  3FSD A;  2R41 A;  2QIY A;  4QWT A;  1GMR A;  4BTY A;  1OGZ A;  4STD A;  5AIH A;  3T8N A;  5IEN A;  3GZY B;  3PXM A;  4OK0 A;  1LNI A;  1ZS7 A;  3VSY A;  2BO9 B;  1LQM B;  2IYJ A;  2M7O A;  1BNI A;  1FZU A;  1US1 A;  3HX8 A;  5I97 A;  3CCS 3;  2Y74 A;  5CXO A;  2ML5 A;  1ULI B;  1VZZ A;  4EBG A;  3FCS B;  1BGS A;  2WO0 A;  5ELU A;  2GBW B;  1FUT A;  2GSP A;  2OOV C;  5DRE A;  3AHS A;  1YJ9 3;  1C54 A;  3PGB A;  2YFJ B;  1B27 A;  1BSB A;  1JN5 A;  1VQK 3;  4JRF A;  4WFO A;  3B8L A;  2W9P A;  4HM2 B;  1BSA A;  3SXX A;  1WMO A;  1M90 4;  1TFO A;  3J7Y d;  1VQO 3;  1AY7 A;  2H0I A;  4CPK A;  1I0V A;  5AII A;  4EC6 A;  1GY6 A;  5IG5 A;  1B2X A;  3X42 A;  2Z76 A;  3ZFZ A;  4CJN A;  1VQP 3;  5M1A A;  2W03 A;  2CG1 A;  2SBL A;  1OHS A;  2W56 B;  5TGN A;  2XFS A;  3DM8 A;  5ELJ A;  4N6T A;  1GYB A;  1RN1 A;  2BNG A;  1NB3 I;  1SPU A;  1WQL B;  4HM5 B;  3NQZ A;  4N6L A;  2H0H A;  1BSC A;  2XSH B;  1DMN A;  1U8C B;  4EW5 A;  1YVS A;  3PCR A;  2GBX B;  4J5G A;  1QVF 2;  5G1L A;  3K7C A;  1BU4 A;  1RSN A;  3CNX A;  1FGR A;  1ZX2 A;  3FGY A;  2XGL A;  1VQ9 3;  1G02 A;  1RNT A;  4FCZ A;  1O7N B;  1W5Z A;  4HVN A;  4R1K A;  3DGN A;  1WMP A;  4N3V A;  4HM4 B;  1D6Y A;  3JVC A;  4K1U A;  3PCS A;  3UL5 A;  2CKF B;  4R80 A;  1IVX A;  1NB5 I;  3I56 3;  3EB8 A;  1B2U A;  2I9W A;  2ZDJ A;  1DVD A;  5AIF A;  4N6V 0;  2B24 B;  4TX4 A;  1YIJ 3;  1IDP A;  1IV9 A;  3QRD A;  6GSP A;  1A67 A;  1BAN A;  1BNS A;  1RRH A;  2BHM A;  1R4C A;  4HM8 B;  2YX9 A;  1MWT A;  2RFR A;  1X1W A;  3DUK A;  2UX0 A;  5D83 A;  1LOW A;  2KF6 A;  1ASK A;  1EG9 B;  1TUH A;  4AKY A;  4RZM A;  4O8S A;  4HM1 B;  3MSO A;  1JB2 A;  1CQS A;  2ZL8 A;  3BNB A;  3MG3 A;  6STD A;  3K63 A;  1J2B A;  2KAA A;  2W56 A;  2ML6 A;  1UUG B;  5EEO A;  3BU4 A;  4HBR A;  1RRL A;  3RGR A;  3LTB A;  1LOX A;  3S28 A;  3V98 A;  3G6E 3;  2OQE C;  2CIU A;  1UCJ A;  3BIR A;  2IY2 A;  1GY7 A;  1MOL A;  1TTO A;  2YFI B;  3DGY A;  4KVH A;  4LZI A;  3S5C A;  4DKI A;  1IQ8 A;  1GY5 A;  4FCJ A;  1RMS A;  2CG0 A;  1WTH A;  4HYZ A;  1VQ6 3;  1NDO B;  2OTJ 3;  3F8X A;  4G1M B;  3K5T A;  1UUV B;  2Q07 A;  3CCR 3;  3RNT A;  1PFP A;  3FKA A;  3CPW 2;  5RNT A;  1W2B 2;  3EC9 A;  3AGN A;  2P0X A;  4I4K A;  1MGR A; 
#chains in the Genus database with same CATH homology
 4U13 A;  3LH4 A;  1HU9 A;  4FMC A;  1Q40 B;  5JBS A;  3CU3 A;  3KZT A;  3AMO A;  4K90 B;  4CCV A;  4EV5 A;  3V99 A;  1QMA A;  4FMB A;  1U5O A;  3I0Y A;  1Q42 A;  1JN5 B;  1SJW A;  1TIJ A;  1YVB I;  1N8R 4;  1VQ8 3;  1Y4K A;  3FLJ A;  4H61 A;  4XB5 A;  2GU1 A;  1ROV A;  4WP5 A;  1K9M 4;  3JUN A;  1RKY A;  3RDE A;  1KSI A;  2YFL B;  4IPB A;  3FH1 A;  4K61 A;  1OHP A;  4HZB B;  1AVL A;  4WYK A;  3UJM A;  5AEW B;  4LMI A;  1UW1 A;  2Z7A A;  3CC7 3;  3CME 3;  1E97 A;  1OF5 A;  4MMY B;  4R9L A;  3OX9 A;  3WMD A;  4RNY A;  4EV2 A;  1UI8 A;  3O8Y A;  1M1K 4;  1JV2 B;  5EVH A;  1QJG A;  3IJE B;  5AIG A;  2R4I A;  1YJW 3;  1S72 3;  3LZA A;  1SII A;  2IUJ A;  3Q2P A;  4WYK B;  2HMO B;  1KC8 4;  2C10 A;  3H51 A;  3LML A;  1IVV A;  2QEX 3;  1IT7 A;  1W02 A;  3JUM A;  3U1W A;  3NX0 A;  2HMM B;  2F98 A;  1FUW A;  4WHA A;  3TDG A;  1NWW A;  1W6G A;  2INX A;  2K0M A;  3F40 A;  2P38 A;  3AMO B;  3KN4 A;  3EN1 B;  1YJN 3;  2W2C A;  4XM4 A;  1RJO A;  1A2V A;  1BUQ A;  4N6M A;  5KP1 A;  5IG3 A;  2XF3 A;  1EQK A;  5BXQ A;  3HI7 A;  1OH0 A;  5CLK A;  1OPY A;  3GAX A;  1KD1 4;  1IK3 A;  1NU3 A;  2P0M A;  1W7C A;  1Z1S A;  3S67 A;  4CDL A;  4EYC A;  3WOD G;  3EBY A;  1QAL A;  2CWT A;  1K73 4;  2P05 A;  4O2H A;  3CCV 3;  3G71 3;  1QAF A;  3OW2 2;  2RCD A;  3OWY A;  1ROA A;  1O7W B;  1SIH A;  2IMJ A;  3NBB A;  3VGN A;  1S5A A;  1W6Y A;  7STD A;  1YHQ 3;  2O9U X;  3D3L A;  3GZR A;  2XFT A;  1KQS 2;  3KSP A;  5IG0 A;  3CMA 3;  3X3Y A;  4IIA A;  5CF1 A;  3CCJ 3;  2CFL A;  3ALA A;  3KII A;  2GXF A;  4HM7 B;  4J8T A;  2L4V A;  4FR9 A;  1FGQ A;  5AI1 A;  3V92 A;  4XBY A;  3L0R A;  3BB9 A;  2E2V A;  1JB4 A;  3EX9 A;  1FGT A;  3ROB A;  2CFW A;  3BNE A;  2HML B;  3F9S A;  4N6O B;  1WMN A;  5KP3 A;  3X3Z A;  1JNQ A;  3CC4 3;  1IQX A;  3IPT A;  3HII A;  4ZM8 A;  3LOY A;  2CHC A;  2O3O A;  2E2T A;  1CYU A;  1STD A;  2V1L A;  3CXC 2;  3D9R A;  1VQ4 3;  1WNH A;  3NBR A;  5IW9 A;  2W04 A;  1W01 A;  3NM7 A;  5D81 A;  2Z6B A;  5IF6 A;  4X2O A;  1IU7 A;  3F8H A;  3NV0 A;  5IER A;  4R4K A;  1Q40 A;  3CCE 3;  3NXJ A;  4MMZ B;  4ORL A;  1FA3 A;  4RNZ A;  3B7C A;  1HKX A;  3IMA B;  2OOV A;  5FGO A;  2D1W A;  3H3H A;  2Z77 A;  3M8C A;  3E99 A;  2CFK A;  3NUV A;  3SOA A;  2QA4 3;  2P09 A;  4XBT A;  2OWP A;  3MG2 A;  2B1X B;  4LGQ A;  3N9H A;  1GD3 A;  3OV4 A;  2GEX A;  2GU3 A;  3KSE D;  4OVM A;  1JJ2 2;  3MWZ A;  1Q82 4;  1LNH A;  3Q90 A;  3T8U A;  3ECF A;  4IT7 A;  1D6Z A;  2OTL 3;  3LTD A;  3DGL A;  4AEQ A;  1EKM A;  2WGO A;  3EE1 A;  3MHE A;  3GZB A;  4PEJ A;  3EQQ B;  2PNC A;  3WA2 X;  4HM6 B;  3DZL A;  3U97 A;  1C7H A;  3S27 A;  3X40 A;  3SVA A;  1TU5 A;  1N5H A;  1N8Q A;  2FXT A;  2CFG A;  2WOH A;  2XRX B;  3CNM A;  3G0K A;  3JUO A;  3T0U A;  1SQW A;  3EBT A;  3CC2 3;  1Q86 4;  1LXE A;  2K54 A;  2W9Q A;  2WGQ A;  4L8O A;  3OWU A;  1FGO A;  5CF2 A;  1MNL A;  4O02 B;  1F8N A;  2CWU A;  4H3U A;  3GWR A;  1UUW B;  1D6U A;  1LVN A;  3F7S A;  3NQY A;  3UB1 A;  4AKZ A;  3NHX A;  2BMR B;  3FG3 A;  2IA7 A;  5AYS C;  4NHF A;  1ISK A;  2GEY A;  3DXO A;  3UL6 A;  1FGM A;  3HK4 A;  5STD A;  1T5Y A;  3OXA A;  1PU4 A;  1G96 A;  3DGO A;  5HGR A;  1YGE A;  2CW9 A;  3ER7 A;  1Q7Y 4;  1K41 A;  1QVG 2;  5EQL A;  1W4N A;  1DMQ A;  1ZO2 A;  4MJD A;  4GL6 A;  3NBJ A;  8CHO A;  2BMQ B;  1OCV A;  3STD A;  3HIG A;  3BLZ A;  3CPO A;  1AVK A;  3CCL 3;  2XEP A;  3K9M C;  3BNC A;  3FF0 A;  4HKV B;  4FMD A;  5KP4 A;  1YI2 3;  3EJV A;  2CWV A;  3EN8 A;  3JUQ A;  5AYR B;  4J9A A;  4MEI A;  4XDW A;  1JRQ A;  3PYJ A;  1N5P A;  1NJI 4;  5LC7 A;  3F7X A;  1YIT 3;  3JUP A;  1GD4 A;  3G16 A;  3FG4 A;  3OWS A;  2JDI H;  3F14 A;  3CCQ 3;  5D82 A;  1CYV A;  4O3V A;  2KCD A;  3LYG A;  1VQ7 3;  3DGM A;  3N8B A;  1N9E A;  3S29 A;  1UI7 A;  1IV7 A;  3KFQ C;  3WDG B;  1W2Z A;  1OF5 B;  2XGN A;  2XR8 B;  3Q1C A;  4MMX B;  3X3X A;  2F99 A;  2BMO B;  4R9K A;  3FF2 A;  1K28 A;  2OQE A;  1TFK A;  3SX1 A;  2F86 B;  2LQV A;  4WWU C;  3MG1 A;  3PS8 A;  2HMN B;  5JPU A;  2OCT A;  4JF8 A;  1M1X B;  1DVC A;  1VQN 3;  1N9J A;  3FZW A;  2W6J H;  4LSO A;  3NM2 A;  2KXG A;  1V74 A;  4GB5 A;  5BVB A;  4HZ9 B;  3RGA A;  1AV4 A;  4HJL B;  1JKG A;  1O7G B;  3LTA A;  3SOY A;  3B4O A;  1RN7 A;  3K0Z A;  5LC6 A;  2A15 A;  2BT3 A;  2KRT A;  3QK9 A;  5AEU B;  2C11 A;  2QGU A;  3NV0 B;  3GZX B;  1IVW A;  2CH9 A;  3UNL A;  3BND A;  1AR0 A;  3LXU X;  2RGQ A;  2STD A;  1K8A 4;  3MKI A;  1JKG B;  3A76 A;  2HMK B;  4RBN A;  2W0Q A;  3LT8 A;  1JB5 A;  2IUK A;  3G4S 3;  3KKG A;  3CCM 3;  3EHC A;  1STF I;  5CK6 A;  4N6N B;  3LTC A;  4FCM A;  4XBX A;  1VQM 3;  1IVU A;  1L5G B;  3VF1 A;  4HM3 B;  1IQY A;  2MC8 A;  1OAC A;  2XSO B;  5IEO A;  4L7K A;  3MPH A;  4LEH A;  2CFD A;  4K1V A;  1A2K A;  1O7P B;  5DRV A;  3GRD A;  1QAK A;  4Q53 A;  1Q81 4;  1IT8 A;  5IG4 A;  3PZW A;  1OHO A;  1E3V A;  1VQ5 3;  3SED A;  4FMA A;  3SLU A;  1DYU A;  4BTX A;  3B4P A;  4X2H A;  3LT9 A;  2Y73 A;  3I55 3;  1OGX A;  1E3R A;  2E2U A;  2JQ5 A;  3G8Z A;  5JPP A;  4OUQ A;  4KFE A;  5FW5 A;  2HMJ B;  3DY5 A;  4KFF A;  3CD6 3;  4BTW A;  1O7H B;  3WOE B;  3DMC A;  1O7M B;  1NO3 A;  2CC3 A;  2LYX A;  4L8P A;  5A0O B;  1A90 A;  1W6C A;  1CEW I;  2RSX A;  4NRE A;  2CK3 H;  2MF7 A;  4HM0 B;  1TP6 A;  2PZV A;  4KZ1 A;  4XDV A;  3X41 A;  5IEP A;  3WA3 A;  2FNQ A;  1VQL 3;  1W00 A;  1DMM A;  1ULJ B;  3HZP A;  3CCU 3;  1OUN A;  3KE7 A;  2WOF A;  1KWI A;  2XH9 A;  3MYT A;  1EA2 A;  2FGT A;  2D42 A;  5G2G A;  3WOF B;  3FG1 A;  3EF8 A;  1M9G A;  1GS3 A;  4KFD A;  3N54 B;  4EXR A;  4N6U A;  3FSD A;  4QWT A;  2QIY A;  4BTY A;  1OGZ A;  4STD A;  5AIH A;  3T8N A;  5IEN A;  3GZY B;  3PXM A;  4OK0 A;  3VSY A;  2BO9 B;  2M7O A;  1US1 A;  3HX8 A;  3CCS 3;  5I97 A;  2Y74 A;  5CXO A;  2ML5 A;  1ULI B;  1VZZ A;  4EBG A;  3FCS B;  2WO0 A;  5ELU A;  2GBW B;  5DRE A;  2OOV C;  1YJ9 3;  3PGB A;  2YFJ B;  1JN5 A;  1VQK 3;  4JRF A;  4WFO A;  3B8L A;  2W9P A;  4HM2 B;  3SXX A;  1WMO A;  1M90 4;  1TFO A;  3J7Y d;  1VQO 3;  4EC6 A;  5AII A;  1GY6 A;  5IG5 A;  3X42 A;  2Z76 A;  1VQP 3;  2W03 A;  2CG1 A;  2SBL A;  1OHS A;  2W56 B;  5TGN A;  2XFS A;  3DM8 A;  5ELJ A;  4N6T A;  1GYB A;  1SPU A;  1NB3 I;  2BNG A;  1WQL B;  4HM5 B;  3NQZ A;  4N6L A;  2XSH B;  1DMN A;  1U8C B;  3PCR A;  2GBX B;  1QVF 2;  3K7C A;  3CNX A;  1FGR A;  1ZX2 A;  3FGY A;  2XGL A;  1VQ9 3;  4FCZ A;  1O7N B;  1W5Z A;  4HVN A;  4R1K A;  3DGN A;  1WMP A;  4N3V A;  4HM4 B;  1D6Y A;  3JVC A;  4K1U A;  3PCS A;  3UL5 A;  2CKF B;  4R80 A;  1IVX A;  1NB5 I;  3I56 3;  3EB8 A;  2I9W A;  2ZDJ A;  1DVD A;  5AIF A;  4N6V 0;  2B24 B;  4TX4 A;  1YIJ 3;  1IDP A;  1IV9 A;  3QRD A;  1A67 A;  1RRH A;  2BHM A;  1R4C A;  4HM8 B;  2YX9 A;  2RFR A;  3DUK A;  5D83 A;  2UX0 A;  1ASK A;  1EG9 B;  1TUH A;  4AKY A;  4RZM A;  4O8S A;  4HM1 B;  3MSO A;  1JB2 A;  1CQS A;  2ZL8 A;  3BNB A;  3MG3 A;  6STD A;  3K63 A;  1J2B A;  2W56 A;  2ML6 A;  5EEO A;  4HBR A;  1RRL A;  3RGR A;  3LTB A;  1LOX A;  3S28 A;  3V98 A;  3G6E 3;  2OQE C;  2CIU A;  4KVH A;  4LZI A;  1GY7 A;  1MOL A;  2YFI B;  3S5C A;  1IQ8 A;  1GY5 A;  4FCJ A;  2CG0 A;  4HYZ A;  1WTH A;  1VQ6 3;  2OTJ 3;  1NDO B;  3F8X A;  4G1M B;  3K5T A;  1UUV B;  2Q07 A;  3CCR 3;  1PFP A;  3FKA A;  3CPW 2;  1W2B 2;  3EC9 A;  2P0X A;  4I4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...