2HMMB

Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmmB00
1OF5A 1Q42A 2I9WA 4HKVB 3VGNA 4HM4B 4HM8B 3B4OA 1JKGB 4MJDA 1EA2A 4HM6B 5IG0A 3VSYA 1W6YA 1OCVA 5D81A 2HMNB 3STDA 4HM0B 2QGUA 4L7KA 3EF8A 3DXOA 3GRDA 2STDA 3DM8A 3GZRA 1GS3A 6STDA 4GB5A 5IG3A 3G16A 3K7CA 1ULIB 3JUQA 5IEOA 1QMAA 4HM2B 3CNMA 4LGQA 4WP5A 3T8NA 3OWSA 4XBTA 1O7PB 3F40A 1ZO2A 4LMIA 1SJWA 3EN1B 3T8UA 3F14A 1VZZA 3JUNA 3LYGA 4HM3B 3EC9A 3OXAA 1GY6A 2BMRB 3RGRA 3B7CA 2XSOB 5AIHA 5CF1A 3GWRA 2GEXA 5IERA 8CHOA 1ISKA 3UNLA 1U5OA 3EBYA 2B1XB 3F7SA 1K41A 3K0ZA 5DRVA 3GZYB 4HZ9B 5IENA 3MYTA 2GBXB 3FSDA 3JUMA 3EJVA 3Q90A 4U13A 4X2HA 5DREA 5BVBA 3KE7A 2OWPA 3ROBA 2GXFA 1JB2A 1O7WB 1OF5B 1HKXA 1STDA 3FKAA 4IIAA 3GZXB 1Q40B 3B8LA 3EBTA 3NUVA 5AIGA 4CDLA 4RZMA 5STDA 4OVMA 5FW5A 3MG3A 5G2GA 3RGAA 2CHCA 2K54A 1Q40A 4HM1B 4XM4A 5AI1A 5D83A 1ULJB 5KP1A 1C7HA 2UX0A 3EX9A 4OUQA 3OWUA 3NBRA 1OH0A 5KP4A 3OX9A 3OWYA 1GY7A 3CPOA 3DMCA 3DZLA 2RFRA 4FCJA 4R9KA 5AEWB 5IG4A 5JPPA 5EVHA 1E97A 3HK4A 1IDPA 3F7XA 1QJGA 1JB5A 3FGYA 3JUOA 3NXJA 3HX8A 4XBXA 4HM5B 5CLKA 2RCDA 1DMMA 2GEYA 1ASKA 1CQSA 3MHEA 3FF2A 3EHCA 1E3VA 1O7HB 1OUNA 3S5CA 2HMJB 4XBYA 2IMJA 3NV0B 4N3VA 3E99A 3ECFA 3EN8A 4HM7B 1JN5B 2YFIB 1DMNA 2XRXB 3F8HA 3KZTA 3MSOA 5AIIA 3MG1A 4XDVA 3NHXA 2BMQB 3D9RA 2QIYA 3NM2A 1NDOB 3BB9A 1GYBA 2RGQA 3GZBA 3KSPA 4HVNA 2Z77A 1UUVB 3FZWA 3WMDA 5KP3A 3BLZA 3H51A 4WWUC 5AIFA 2BMOB 3F9SA 2INXA 2HMOB 5CK6A 4LEHA 2F98A 5CF2A 4K1UA 5AEUB 4HJLB 4WYKA 1TUHA 4FCMA 5IF6A 1O7NB 2W2CA 1W00A 3EQQB 1TP6A 3FLJA 4WYKB 5D82A 3MKIA 1S5AA 4R1KA 4J8TA 2XR8B 2CKFB 2YFJB 1JN5A 3DUKA 2Z76A 1OHSA 4X2OA 5IEPA 1UUWB 2HMLB 4PEJA 2JQ5A 1Z1SA 2XSHB 1EG9B 3ER7A 2YFLB 4KVHA 4XB5A 4H3UA 3LZAA 3FH1A 5CXOA 5IG5A 1OGXA 2A15A 3H3HA 1NWWA 3CU3A 3HZPA 5BXQA 2R4IA 3FF0A 1W01A 1O7GB 1OHOA 4HZBB 3IPTA 2HMKB 3JUPA 4STDA 1A2KA 1OPYA 5HGRA 1NU3A 2B24B 3I0YA 3M8CA 3OV4A 1JKGA 1WQLB 2Z7AA 2HMMB 1DMQA 3SEDA 1AR0A 2PZVA 3B4PA 3UJMA 1E3RA 4R9LA 4I4KA 4ORLA 2BNGA 4L8PA 3SOAA 4XDWA 3A76A 1JB4A 3CNXA 2GBWB 3MG2A 2F99A 4J9AA 4Q53A 1O7MB 5TGNA 4L8OA 3KKGA 4K1VA 5JPUA 3NV0A 1ZX2A 2F86B 7STDA 3G8ZA 1GY5A 3F8XA 3SOYA 1BUQA 1W02A 3G0KA 1OHPA 1OGZA
chains in the Genus database with same CATH superfamily
2CG1A 4HM8B 3NQZA 1RTUA 1JKGB 3PZWA 3SVAA 1MOLA 2CC3A 3D5GA 5IG0A 1IVXA 2P0XA 1BSCA 4HM0B 2CH9A 2OCTA 5IG3A 6STDA 4EC6A 3X3YA 3G16A 1TFOA 3V98A 4HM2B 3CNMA 4WP5A 1YIJ3 3OWSA 4XBTA 3SXXA 1ZO2A 3EN1B 4KFFA 3LYGA 2F56A 1BANA 3U97A 5AIHA 1RGFA 1RCLA 3CCR3 3BNDA 1WNHA 1U5OA 1GOUA 3WOFB 5IENA 1N8R4 3MYTA 3JUMA 1MWUA 1GSPA 1JZDA 5BVBA 3CCQ3 4NHFA 2Z6BA 3PXMA 2CWUA 1OF5B 4EBGA 4IIAA 4KFDA 2XGLA 5G1LA 1YJW3 1TIJA 3GZXB 1TRPA 3X3XA 4N6UA 3CCV3 3NUVA 1KSIA 5EEOA 1QALA 2KF6A 4IT7A 5G2GA 2K54A 2IA7A 4HM1B 1RRLA 4OUQA 1BVIA 1OH0A 1K28A 1FGQA 2CX1A 1FGRA 3AGNA 3AHSA 2H0GA 4OK0A 1PU4A 1AVLA 8RNTA 3S67A 1IDPA 1IQYA 1QJGA 1U8CB 3JUOA 3NXJA 3OW22 1V74A 2K3DA 4HM5B 3S28A 2RCDA 1DMMA 2ML5A 1R4CA 4N6LA 1I3IA 2CX0A 2ZL8A 3WA2X 1CQSA 1FW7A 1BRGA 5IW9A 3EHCA 4CJNA 3IMAB 1O7HB 1B2XA 1VQ63 2IMJA 4AEQA 2C11A 3EN8A 4HM7B 4QWTA 1DMNA 3KZTA 1IV7A 1LXEA 4XDVA 3NHXA 3G6E3 3PS8A 2RGQA 3WODG 2IYJA 1IT8A 1I0VA 1UUVB 4KFEA 1RJOA 3F9SA 2INXA 1R4YA 2BU4A 1T2HA 2HMOB 3BNCA 3CC73 1JBSA 3KSED 3BNBA 5AEUB 1EEJA 4WYKA 1TUHA 3AHWA 5IF6A 2W2CA 4HYZA 1BRJA 1IVWA 1TP6A 4NPBA 3KIIA 3WHOA 3LTAA 4R80A 2D42A 2XR8B 3DUKA 3X41A 5RNTA 3CMA3 4X2OA 5IEPA 2WO0A 2W9PA 1EG9B 2XF3A 4AKZA 1JBRA 1JZOA 3BU4A 5CXOA 1G02A 3LTCA 2CFKA 1BRNL 1US1A 2R4IA 1W01A 1OHOA 1A2VA 3IPTA 3I0YA 3M8CA 4BTWA 1WQLB 2Z7AA 1UDII 4CCVA 2KRTA 3UJMA 3NBBA 4FMCA 3FG4A 4XDWA 2CG0A 3CNXA 1IQ8A 3DGOA 1ZGXA 3CCU3 4K1VA 1N5PA 2BHMA 1ZX2A 2CFLA 2F5MA 3AGOA 7STDA 1CH0A 2L1SA 1WMNA 4WWUC 1OGZA 3J7Yd 1BU4A 1BRHA 1UCLA 2W56A 1I8VA 4HM4B 1HYFA 1YVSA 2WGOA 3CC23 1W6YA 1OCVA 2QGUA 4L7KA 2Q07A 1GD3A 2STDA 1GS3A 1NB3I 1ULIB 3LTDA 3PCRA 2OOVC 5IEOA 1N9EA 2CFDA 4LGQA 3U1WA 4TX4A 1Q824 3RGRA 1RNTA 3B7CA 4HAAA 3S27A 7GSPA 3GWRA 1RGGA 2OTL3 1ISKA 1VQK3 2BO9B 2MF7A 1M1K4 3LOYA 2JDIH 2CFWA 4HZ9B 1DVCA 2CWTA 3FSDA 4U13A 4LZIA 1YI23 5DREA 3L0RA 1C54A 1BNEA 3ROBA 4O2HA 1NJI4 2CIUA 2KF5A 1UUGB 4BL3A 1O7WB 1GOYA 1HKXA 3FKAA 4BL2A 3SYUA 3NM7A 3WOEB 4N6OB 3K5TA 3TDGA 4RZMA 2KF3A 2P0MA 3MG3A 2CHCA 1BNGA 1ULJB 1C7HA 4BTYA 1M1XB 2KAAA 3V99A 3RDEA 3OX9A 1J2BA 4FCJA 5IG4A 1QAKA 3VF1A 1YHQ3 5JPPA 1BIRA 5EVHA 4ILFA 1UI8A 1AY7A 3FGYA 3CCJ3 1RGEA 3HX8A 4XBXA 2XFSA 1I70A 3LT8A 4BIRA 1KD14 4KZ1A 4N6NB 3FF2A 4HBRA 1OUNA 2HMJB 4N3VA 3E99A 1W6GA 3ECFA 2WGQA 1JJ22 1JN5B 2XH9A 2W0QA 2XRXB 2E2VA 2YFIB 3GSPA 3CPW2 3MG1A 5ELJA 3BB9A 5M1AA 1IVUA 1GYBA 3RNTA 3FZWA 3HIIA 3BLZA 1LOYA 3CD63 1YNVX 1KC84 1UGIA 3MPHA 1EKMA 1B20A 1LOVA 4HJLB 2AAEA 4FCMA 1O7NB 3Q2PA 1PYLA 2E2UA 1VQP3 1G96A 2QA43 3MWZA 1FZUA 3D3LA 3AMOB 3VGNA 1BSEA 2YFJB 3I563 1B21A 1LOXA 1FYSA 2HMLB 1Q7HA 2CW9A 2XEPA 5JBSA 1WMPA 2YFLB 4KVHA 1VQ83 3LZAA 1LRAA 1JBTA 3WA3A 1A90A 3H3HA 1NWWA 1D6ZA 1VQ53 5BIRA 1A2KA 1OPYA 1HU9A 1UCIA 1JKGA 2IUJA 5HOHA 2HMMB 3SLUA 3SEDA 2PZVA 4BU4A 4MMXB 3A76A 1JB4A 3DH2A 3LH4A 4H61A 5BU4A 2W03A 3D5IA 2F5WA 1RHLA 2D1WA 3G8ZA 1D6UA 3F8XA 3LMLA 3SOYA 1TTOA 2C10A 3UL6A 4AKYA 1B2UA 6GSPA 3I553 2Y73A 1V57A 1OHPA 2IY2A 1OF5A 2SBLA 1Q42A 2I9WA 4HKVB 3SOAA 1DE3A 1UCJA 5ELUA 1RLSA 1QVG2 3B4OA 1WTHA 3VSYA 1EA2A 2R41A 1X1YA 4HM6B 2OQEA 3O8YA 3STDA 2HMNB 3ALAA 5AYRB 1F8NA 2IUKA 2RSXA 1CEWI 2HOHA 2K0MA 3GRDA 3DGNA 1GMRA 3DM8A 3GZRA 4GB5A 1BSDA 1RGAA 4RNZA 4JRFA 1MWTA 4N6V0 2FXTA 1QMAA 4K61A 1K734 1BNIA 1MGWA 3T8NA 1YJN3 1O7PB 1BUQA 5FGOA 3LTBA 3T8UA 3Q3FA 4HM3B 3UB1A 3G4S3 1W6CA 3EC9A 1GY6A 4GL6A 2XSOB 2BIRA 1RGHA 8CHOA 1TFKA 4N6MA 3UNLA 3F7SA 3EBYA 3DGLA 1RGKA 4GSPA 1K41A 5DRVA 3CCM3 5BXQA 1MNLA 3EJVA 1RDSA 3KE7A 3QRDA 1TJDA 2P38A 1STFI 1UGHI 2XFTA 1VQ43 1BRSA 4LSOA 1FGTA 2Y74A 2GSPA 2ZHXB 1OACA 3B8LA 3CC43 5AIGA 4CDLA 4OVMA 5FW5A 3RGAA 3X3ZA 5AI1A 1Q40A 5D83A 4DKIA 5KP1A 1IK3A 3EX9A 1AVKA 3OWUA 1BRIA 3OWYA 1GY7A 3CPOA 1LVNA 3JVCA 2RFRA 4R9KA 2C4BA 3X40A 4EXRA 1T5YA 1JNQA 1RMSA 3HK4A 5AEWB 3PYJA 1JB5A 1SIHA 1SQWA 2WOFA 3CCL3 1ASKA 1VQ73 1YIT3 1CYVA 3EE1A 3T0UA 1E3VA 1DVDA 1UCKA 3S5CA 3CME3 1ZS7A 3NV0B 1Q7Y4 4HOHA 1VQ93 3BIRA 2LQVA 4K90B 3F8HA 5AIIA 2H0HA 2OOVA 1BNJA 1D6YA 2BMQB 2XGNA 2QIYA 3D9RA 1NDOB 4LYLB 1BSBA 3GZBA 3KFQC 1VQL3 3UL5A 1YVBI 2Z77A 3WMDA 1BAOA 4FR9A 4EV2A 1A67A 4O3VA 1JRQA 5CK6A 4K1UA 1G0TA 1NO3A 1GMPA 1RN7A 1FA3A 4MMYB 3N8BA 3CCS3 2LYXA 1QVF2 2ML6A 1B2SA 2PNCA 3NQYA 4EW5A 3FLJA 3G713 1NNVA 3MKIA 1S5AA 1GMQA 2V1LA 1IVVA 4J8TA 1MGRA 5D82A 2Z76A 1OHSA 1LNIA 1NB5I 2BT3A 1MWRA 1UUWB 2L4VA 2W56B 3D79A 4PEJA 1EQKA 2UUGC 1I3FA 4XB5A 2J8XB 2YX9A 4RBNA 4WHAA 1OGXA 1L5GB 5IG5A 2A15A 1RCKA 1RGLA 2W6JH 1W5ZA 3FF0A 1O7GB 1RNBA 3JUPA 5HGRA 1SIIA 1DETA 3DGMA 4STDA 1Q864 3OV4A 3KN4A 4R4KA 1FUSA 5LC6A 1DMQA 4N6TA 1AR0A 3B4PA 1FGOA 2WOHA 3GAXA 4J5KA 1X1WA 1ROAA 1EUIC 1IQXA 1E3RA 2H0IA 4I4KA 4ORLA 1VQN3 1BNRA 4NREA 3MG2A 4Q53A 2GU3A 2GBWB 5TGNA 2F99A 4GHOA 1FUWA 4L8OA 1BSAA 3KKGA 3NBJA 2MC8A 1I2EA 2OTJ3 1RGCA 1LQMB 1GY5A 2W9QA 1W02A 1M9GA 1HZ1A 3Q1CA 1SARA 3EF8A 1RSNA 1UW1A 1LOWA 1BNSA 2M7OA 1VQM3 4MJDA 1YJ93 2E2TA 5D81A 3DXOA 4RNTA 1B27A 2F4YA 3K7CA 1X1UA 1K9M4 3JUQA 1RN4A 1K8A4 3WR2A 1JV2B 1N5HA 3F40A 4LMIA 1S723 5AYSC 1SJWA 3LXUX 3F14A 1VZZA 3JUNA 3OXAA 1VQO3 2BMRB 5CF1A 3K63A 1N8QA 2GEXA 5IERA 2B1XB 4ZM8A 1T3BA 3K0ZA 1SPUA 3GZYB 2GBXB 1TU5A 3Q90A 4X2HA 1LQGC 1I2GA 2GU1A 3N9HA 1AQZA 3LT9A 1BRKA 2OWPA 2GXFA 1T2IA 3NX0A 5LC7A 1JB2A 3PCSA 3DY5A 4J5GA 5EQLA 1STDA 3CCE3 2RNTA 2O9UX 1CYUA 2KCDA 1V58A 6RNTA 1Q40B 1BGSA 1MWSA 3EBTA 3IJEB 1N9JA 5STDA 1FGMA 1QAFA 1Y4KA 2FNQA 4O02B 2SARA 1RKYA 1KWIA 4XM4A 3BNEA 5G1KA 3X42A 2UX0A 4I5QA 1YGEA 3NBRA 5KP4A 4IPBA 3DZLA 3DMCA 3PGBA 7RNTA 1FUTA 1E97A 1ROVA 4JF8A 3F7XA 1I2FA 3FG1A 4FMBA 5M19A 2O3OA 2KXGA 5CLKA 2AADA 3N54B 4EYCA 1BUJA 4RNYA 2GEYA 4O8SA 5I97A 3HOHA 1KQS2 2RBIA 3MHEA 4BTXA 1GD4A 4XBYA 1W2B2 2CFGA 2P09A 1X1XA 5GSPA 1AV4A 1IYYA 3AMOA 1A2PA 4EV5A 4FMDA 3MSOA 1B3SA 9RNTA 2ZDJA 1IT7A 3NM2A 3URPA 3KSPA 4HVNA 1PFPA 1RRHA 1VQQA 1Q814 5KP3A 3H51A 5M18A 2CWVA 5AIFA 2BMOB 1W2ZA 2OQEC 4LEHA 2F98A 5CF2A 3HIGA 1W4NA 1IV9A 3EB8A 1B2MA 3S29A 1DYUA 1W00A 3EQQB 4WYKB 1IU7A 3FCSB 4WFOA 4R1KA 2CKFB 1W7CA 1JN5A 1M904 4FMAA 2KF4A 2JQ5A 1Z1SA 3ZG0A 1PY3A 2XSHB 3ER7A 2ZA4A 4H3UA 1TRQA 3FH1A 1B2ZA 3D4AA 3SX1A 3CU3A 3HZPA 4G1MB 3ZFZA 4HZBB 3DGYA 4KT3B 2HMKB 1NU3A 2B24B 1Q9EA 3K9MC 3V92A 3KCHA 4CPKA 2W04A 2QEX3 1I0XA 3WDGB 5A0OB 3QK9A 3ZG5A 1GOVA 1WMOA 4R9LA 2BNGA 4L8PA 4FCZA 1YGWA 2P05A 3A5EA 1LNHA 4J9AA 1O7MB 2FGTA 2CK3H 1BOXA 4MEIA 1UI7A 5JPUA 3NV0A 4MMZB 2F86B 3FG3A 3HI7A 3CXC2 2UGIA 1BNFA 3G0KA 1RN1A
chains in the Genus database with same CATH topology
2CG1A 4HM8B 3NQZA 3PZWA 1JKGB 3SVAA 1MOLA 2CC3A 5IG0A 1IVXA 2P0XA 4HM0B 2CH9A 2OCTA 5IG3A 6STDA 4EC6A 3X3YA 3G16A 1TFOA 3V98A 4HM2B 3CNMA 4WP5A 1YIJ3 3OWSA 4XBTA 3SXXA 1ZO2A 3EN1B 4KFFA 3LYGA 3U97A 5AIHA 3CCR3 3BNDA 1WNHA 1U5OA 3WOFB 5IENA 1N8R4 3MYTA 3JUMA 5BVBA 3CCQ3 4NHFA 2Z6BA 3PXMA 2CWUA 1OF5B 4EBGA 4IIAA 4KFDA 2XGLA 1YJW3 1TIJA 3GZXB 3X3XA 4N6UA 3CCV3 3NUVA 1KSIA 5EEOA 1QALA 4IT7A 5G2GA 2K54A 2IA7A 4HM1B 1RRLA 4OUQA 1OH0A 1K28A 1FGQA 1FGRA 4OK0A 1PU4A 1AVLA 3S67A 1IDPA 1IQYA 1QJGA 1U8CB 3JUOA 3NXJA 3OW22 1V74A 3S28A 4HM5B 2RCDA 1DMMA 2ML5A 1R4CA 4N6LA 3WA2X 2ZL8A 5IW9A 3EHCA 3IMAB 1O7HB 1VQ63 2IMJA 4AEQA 2C11A 3EN8A 4HM7B 4QWTA 1DMNA 3KZTA 1IV7A 1LXEA 4XDVA 3NHXA 3G6E3 3PS8A 2RGQA 3WODG 1IT8A 1UUVB 4KFEA 1RJOA 3F9SA 2INXA 3BNCA 2HMOB 3CC73 3KSED 3BNBA 5AEUB 4WYKA 1TUHA 5IF6A 2W2CA 4HYZA 1IVWA 1TP6A 3KIIA 3LTAA 4R80A 2D42A 2XR8B 3DUKA 3X41A 3CMA3 4X2OA 5IEPA 2WO0A 2W9PA 1EG9B 2XF3A 4AKZA 5CXOA 3LTCA 2CFKA 1US1A 2R4IA 1W01A 1OHOA 1A2VA 3IPTA 3I0YA 3M8CA 4BTWA 1WQLB 2Z7AA 4CCVA 2KRTA 3UJMA 3NBBA 4FMCA 3FG4A 4XDWA 2CG0A 3CNXA 1IQ8A 3DGOA 3CCU3 4K1VA 1N5PA 2BHMA 1ZX2A 2CFLA 7STDA 1WMNA 4WWUC 1OGZA 3J7Yd 3CC23 4HM4B 2W56A 2WGOA 1W6YA 1OCVA 2QGUA 4L7KA 2Q07A 1GD3A 2STDA 1GS3A 1NB3I 1ULIB 3LTDA 3PCRA 2OOVC 5IEOA 1N9EA 2CFDA 4LGQA 3U1WA 4TX4A 1Q824 3RGRA 3B7CA 3S27A 2OTL3 3GWRA 1ISKA 1VQK3 2BO9B 2MF7A 1M1K4 3LOYA 2JDIH 2CFWA 4HZ9B 1DVCA 2CWTA 3FSDA 4U13A 4LZIA 1YI23 5DREA 3L0RA 3ROBA 4O2HA 1NJI4 2CIUA 1O7WB 1HKXA 3FKAA 3NM7A 3WOEB 4N6OB 3K5TA 3TDGA 4RZMA 2P0MA 3MG3A 2CHCA 1ULJB 1C7HA 4BTYA 1M1XB 3V99A 3RDEA 3OX9A 4FCJA 5IG4A 1QAKA 3VF1A 1YHQ3 5JPPA 5EVHA 1UI8A 3FGYA 3CCJ3 3HX8A 4XBXA 2XFSA 3LT8A 1KD14 4KZ1A 4N6NB 3FF2A 4HBRA 1OUNA 2HMJB 4N3VA 3E99A 1W6GA 3ECFA 2WGQA 1JJ22 1JN5B 2XH9A 2W0QA 2XRXB 2E2VA 2YFIB 3CPW2 3MG1A 5ELJA 3BB9A 1IVUA 1GYBA 3FZWA 3HIIA 3BLZA 3CD63 1KC84 3MPHA 1EKMA 4HJLB 4FCMA 1O7NB 3Q2PA 2E2UA 1VQP3 1G96A 2QA43 3MWZA 3D3LA 3AMOB 3VGNA 2YFJB 3I563 1LOXA 2HMLB 2CW9A 2XEPA 5JBSA 1WMPA 2YFLB 4KVHA 1VQ83 3LZAA 3WA3A 1A90A 3H3HA 1NWWA 1D6ZA 1VQ53 1A2KA 1OPYA 1HU9A 1JKGA 2IUJA 2HMMB 3SLUA 3SEDA 2PZVA 4MMXB 3A76A 1JB4A 3LH4A 4H61A 2W03A 2D1WA 3G8ZA 1D6UA 3F8XA 3LMLA 3SOYA 2C10A 3UL6A 4AKYA 3I553 1S723 1VQN3 2Y73A 1OHPA 3SOAA 2SBLA 1OF5A 1Q42A 2I9WA 4HKVB 5ELUA 1QVG2 1A67A 3B4OA 1WTHA 3VSYA 1EA2A 4HM6B 2OQEA 3O8YA 3STDA 2HMNB 3ALAA 5AYRB 1F8NA 2IUKA 2RSXA 1CEWI 2K0MA 3GRDA 3DGNA 3DM8A 3GZRA 4RNZA 4GB5A 4JRFA 4N6V0 2FXTA 1QMAA 4K61A 1K734 3T8NA 1YJN3 1O7PB 1BUQA 5FGOA 3LTBA 3T8UA 4HM3B 3UB1A 3G4S3 1W6CA 3EC9A 1GY6A 4GL6A 2XSOB 8CHOA 1TFKA 4N6MA 3UNLA 3F7SA 3EBYA 3DGLA 1K41A 5DRVA 3CCM3 5BXQA 1MNLA 3EJVA 3QRDA 3KE7A 2P38A 1STFI 2XFTA 1VQ43 4LSOA 1FGTA 2Y74A 1OACA 3B8LA 3CC43 5AIGA 4CDLA 4OVMA 5FW5A 3RGAA 3X3ZA 5AI1A 1Q40A 5D83A 5KP1A 1IK3A 3EX9A 1AVKA 3OWUA 3OWYA 1GY7A 3CPOA 1LVNA 3JVCA 2RFRA 4R9KA 4EXRA 3X40A 5AEWB 1JNQA 1T5YA 3HK4A 3PYJA 1JB5A 1SIHA 1SQWA 2WOFA 3CCL3 1ASKA 1VQ73 1YIT3 1CYVA 3EE1A 3T0UA 1E3VA 1DVDA 3S5CA 3CME3 3NV0B 1Q7Y4 1VQ93 2LQVA 4K90B 3F8HA 5AIIA 2OOVA 2XGNA 1D6YA 2BMQB 3D9RA 2QIYA 1NDOB 3GZBA 3KFQC 1VQL3 3UL5A 1YVBI 2Z77A 3WMDA 4FR9A 4EV2A 4O3VA 1JRQA 5CK6A 4K1UA 1NO3A 1RN7A 1FA3A 4MMYB 3N8BA 3CCS3 2LYXA 1QVF2 2ML6A 2PNCA 3NQYA 3FLJA 3G713 5D82A 3MKIA 1S5AA 2V1LA 4J8TA 1IVVA 2Z76A 1OHSA 1NB5I 2BT3A 1UUWB 2L4VA 2W56B 4PEJA 1EQKA 4XB5A 4WHAA 2YX9A 4RBNA 1L5GB 1OGXA 5IG5A 2A15A 2W6JH 1W5ZA 3FF0A 1O7GB 3JUPA 5HGRA 1SIIA 4STDA 3DGMA 1Q864 3OV4A 3KN4A 4R4KA 5LC6A 1DMQA 4N6TA 1AR0A 3B4PA 1FGOA 2WOHA 3GAXA 1ROAA 1IQXA 1E3RA 4I4KA 4ORLA 4NREA 3MG2A 4Q53A 2GU3A 2GBWB 5TGNA 2F99A 1FUWA 4L8OA 3KKGA 3NBJA 2MC8A 2OTJ3 1GY5A 2W9QA 1W02A 1M9GA 3Q1CA 3EF8A 1UW1A 2M7OA 1VQM3 4MJDA 1YJ93 2E2TA 5D81A 3DXOA 3K7CA 1K9M4 3JUQA 1K8A4 1JV2B 1N5HA 3F40A 4LMIA 5AYSC 1SJWA 3LXUX 3F14A 1VZZA 3JUNA 3OXAA 1VQO3 2BMRB 5CF1A 3K63A 1N8QA 2GEXA 5IERA 2B1XB 4ZM8A 3K0ZA 1SPUA 3GZYB 2GBXB 1TU5A 3Q90A 4X2HA 2GU1A 3N9HA 3LT9A 2OWPA 3NX0A 2GXFA 5LC7A 1J2BA 1JB2A 3PCSA 3DY5A 5EQLA 1STDA 3CCE3 2O9UX 1CYUA 2KCDA 1Q40B 3EBTA 3IJEB 1N9JA 5STDA 1FGMA 1QAFA 1Y4KA 2FNQA 4O02B 1RKYA 1KWIA 4XM4A 3BNEA 3X42A 2UX0A 1YGEA 3NBRA 5KP4A 4IPBA 3DZLA 3DMCA 3PGBA 1E97A 1ROVA 4JF8A 3F7XA 3FG1A 4FMBA 2O3OA 2KXGA 5CLKA 3N54B 4EYCA 4RNYA 2GEYA 4O8SA 5I97A 1KQS2 3MHEA 4BTXA 1GD4A 4XBYA 1W2B2 2CFGA 2P09A 1AV4A 3AMOA 4EV5A 4FMDA 3MSOA 2ZDJA 1IT7A 3NM2A 3KSPA 4HVNA 1PFPA 1RRHA 1Q814 5KP3A 3H51A 2CWVA 5AIFA 2BMOB 1W2ZA 2OQEC 4LEHA 2F98A 5CF2A 3HIGA 1W4NA 1IV9A 3EB8A 3S29A 1DYUA 1W00A 3EQQB 4WYKB 1IU7A 3FCSB 4WFOA 4R1KA 2CKFB 1W7CA 1JN5A 1M904 4FMAA 2JQ5A 1Z1SA 2XSHB 3ER7A 4H3UA 3FH1A 3SX1A 3CU3A 3HZPA 4G1MB 4HZBB 2HMKB 1NU3A 2B24B 3K9MC 3V92A 2W04A 2QEX3 3WDGB 5A0OB 3QK9A 1WMOA 4R9LA 2BNGA 4L8PA 4FCZA 2P05A 4J9AA 1LNHA 1O7MB 2FGTA 2CK3H 4MEIA 1UI7A 5JPUA 3NV0A 4MMZB 2F86B 3FG3A 3HI7A 3CXC2 3G0KA 1CQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OF5 A;  1Q42 A;  2I9W A;  4HKV B;  3VGN A;  4HM4 B;  4HM8 B;  3B4O A;  1JKG B;  4MJD A;  1EA2 A;  4HM6 B;  5IG0 A;  3VSY A;  1W6Y A;  1OCV A;  5D81 A;  2HMN B;  3STD A;  4HM0 B;  2QGU A;  4L7K A;  3EF8 A;  3DXO A;  3GRD A;  2STD A;  3DM8 A;  3GZR A;  1GS3 A;  6STD A;  4GB5 A;  5IG3 A;  3G16 A;  3K7C A;  1ULI B;  3JUQ A;  5IEO A;  1QMA A;  4HM2 B;  3CNM A;  4LGQ A;  4WP5 A;  3T8N A;  3OWS A;  4XBT A;  1O7P B;  3F40 A;  1ZO2 A;  4LMI A;  1SJW A;  3EN1 B;  3T8U A;  3F14 A;  1VZZ A;  3JUN A;  3LYG A;  4HM3 B;  3EC9 A;  3OXA A;  1GY6 A;  2BMR B;  3RGR A;  3B7C A;  2XSO B;  5AIH A;  5CF1 A;  3GWR A;  2GEX A;  5IER A;  8CHO A;  1ISK A;  3UNL A;  1U5O A;  3EBY A;  2B1X B;  3F7S A;  1K41 A;  3K0Z A;  5DRV A;  3GZY B;  4HZ9 B;  5IEN A;  3MYT A;  2GBX B;  3FSD A;  3JUM A;  3EJV A;  3Q90 A;  4U13 A;  4X2H A;  5DRE A;  5BVB A;  3KE7 A;  2OWP A;  3ROB A;  2GXF A;  1JB2 A;  1O7W B;  1OF5 B;  1HKX A;  1STD A;  3FKA A;  4IIA A;  3GZX B;  1Q40 B;  3B8L A;  3EBT A;  3NUV A;  5AIG A;  4CDL A;  4RZM A;  5STD A;  4OVM A;  5FW5 A;  3MG3 A;  5G2G A;  3RGA A;  2CHC A;  2K54 A;  1Q40 A;  4HM1 B;  4XM4 A;  5AI1 A;  5D83 A;  1ULJ B;  5KP1 A;  1C7H A;  2UX0 A;  3EX9 A;  4OUQ A;  3OWU A;  3NBR A;  1OH0 A;  5KP4 A;  3OX9 A;  3OWY A;  1GY7 A;  3CPO A;  3DMC A;  3DZL A;  2RFR A;  4FCJ A;  4R9K A;  5AEW B;  5IG4 A;  5JPP A;  5EVH A;  1E97 A;  3HK4 A;  1IDP A;  3F7X A;  1QJG A;  1JB5 A;  3FGY A;  3JUO A;  3NXJ A;  3HX8 A;  4XBX A;  4HM5 B;  5CLK A;  2RCD A;  1DMM A;  2GEY A;  1ASK A;  1CQS A;  3MHE A;  3FF2 A;  3EHC A;  1E3V A;  1O7H B;  1OUN A;  3S5C A;  2HMJ B;  4XBY A;  2IMJ A;  3NV0 B;  4N3V A;  3E99 A;  3ECF A;  3EN8 A;  4HM7 B;  1JN5 B;  2YFI B;  1DMN A;  2XRX B;  3F8H A;  3KZT A;  3MSO A;  5AII A;  3MG1 A;  4XDV A;  3NHX A;  2BMQ B;  3D9R A;  2QIY A;  3NM2 A;  1NDO B;  3BB9 A;  1GYB A;  2RGQ A;  3GZB A;  3KSP A;  4HVN A;  2Z77 A;  1UUV B;  3FZW A;  3WMD A;  5KP3 A;  3BLZ A;  3H51 A;  4WWU C;  5AIF A;  2BMO B;  3F9S A;  2INX A;  2HMO B;  5CK6 A;  4LEH A;  2F98 A;  5CF2 A;  4K1U A;  5AEU B;  4HJL B;  4WYK A;  1TUH A;  4FCM A;  5IF6 A;  1O7N B;  2W2C A;  1W00 A;  3EQQ B;  1TP6 A;  3FLJ A;  4WYK B;  5D82 A;  3MKI A;  1S5A A;  4R1K A;  4J8T A;  2XR8 B;  2CKF B;  2YFJ B;  1JN5 A;  3DUK A;  2Z76 A;  1OHS A;  4X2O A;  5IEP A;  1UUW B;  2HML B;  4PEJ A;  2JQ5 A;  1Z1S A;  2XSH B;  1EG9 B;  3ER7 A;  2YFL B;  4KVH A;  4XB5 A;  4H3U A;  3LZA A;  3FH1 A;  5CXO A;  5IG5 A;  1OGX A;  2A15 A;  3H3H A;  1NWW A;  3CU3 A;  3HZP A;  5BXQ A;  2R4I A;  3FF0 A;  1W01 A;  1O7G B;  1OHO A;  4HZB B;  3IPT A;  2HMK B;  3JUP A;  4STD A;  1A2K A;  1OPY A;  5HGR A;  1NU3 A;  2B24 B;  3I0Y A;  3M8C A;  3OV4 A;  1JKG A;  1WQL B;  2Z7A A;  2HMM B;  1DMQ A;  3SED A;  1AR0 A;  2PZV A;  3B4P A;  3UJM A;  1E3R A;  4R9L A;  4I4K A;  4ORL A;  2BNG A;  4L8P A;  3SOA A;  4XDW A;  3A76 A;  1JB4 A;  3CNX A;  2GBW B;  3MG2 A;  2F99 A;  4J9A A;  4Q53 A;  1O7M B;  5TGN A;  4L8O A;  3KKG A;  4K1V A;  5JPU A;  3NV0 A;  1ZX2 A;  2F86 B;  7STD A;  3G8Z A;  1GY5 A;  3F8X A;  3SOY A;  1BUQ A;  1W02 A;  3G0K A;  1OHP A;  1OGZ A; 
#chains in the Genus database with same CATH topology
 2CG1 A;  4HM8 B;  3NQZ A;  1RTU A;  1JKG B;  3PZW A;  3SVA A;  1MOL A;  2CC3 A;  3D5G A;  5IG0 A;  1IVX A;  2P0X A;  1BSC A;  4HM0 B;  2CH9 A;  2OCT A;  5IG3 A;  6STD A;  4EC6 A;  3X3Y A;  3G16 A;  1TFO A;  3V98 A;  4HM2 B;  3CNM A;  4WP5 A;  1YIJ 3;  3OWS A;  4XBT A;  3SXX A;  1ZO2 A;  3EN1 B;  4KFF A;  3LYG A;  2F56 A;  1BAN A;  3U97 A;  5AIH A;  1RGF A;  1RCL A;  3CCR 3;  3BND A;  1WNH A;  1U5O A;  1GOU A;  3WOF B;  5IEN A;  1N8R 4;  3MYT A;  3JUM A;  1MWU A;  1GSP A;  1JZD A;  5BVB A;  3CCQ 3;  4NHF A;  2Z6B A;  3PXM A;  2CWU A;  1OF5 B;  4EBG A;  4IIA A;  4KFD A;  2XGL A;  5G1L A;  1YJW 3;  1TIJ A;  3GZX B;  1TRP A;  3X3X A;  4N6U A;  3CCV 3;  3NUV A;  1KSI A;  5EEO A;  1QAL A;  2KF6 A;  4IT7 A;  5G2G A;  2K54 A;  2IA7 A;  4HM1 B;  1RRL A;  4OUQ A;  1BVI A;  1OH0 A;  1K28 A;  1FGQ A;  2CX1 A;  1FGR A;  3AGN A;  3AHS A;  2H0G A;  4OK0 A;  1PU4 A;  1AVL A;  8RNT A;  3S67 A;  1IDP A;  1IQY A;  1QJG A;  1U8C B;  3JUO A;  3NXJ A;  3OW2 2;  1V74 A;  2K3D A;  4HM5 B;  3S28 A;  2RCD A;  1DMM A;  2ML5 A;  1R4C A;  4N6L A;  1I3I A;  2CX0 A;  2ZL8 A;  3WA2 X;  1CQS A;  1FW7 A;  1BRG A;  5IW9 A;  3EHC A;  4CJN A;  3IMA B;  1O7H B;  1B2X A;  1VQ6 3;  2IMJ A;  4AEQ A;  2C11 A;  3EN8 A;  4HM7 B;  4QWT A;  1DMN A;  3KZT A;  1IV7 A;  1LXE A;  4XDV A;  3NHX A;  3G6E 3;  3PS8 A;  2RGQ A;  3WOD G;  2IYJ A;  1IT8 A;  1I0V A;  1UUV B;  4KFE A;  1RJO A;  3F9S A;  2INX A;  1R4Y A;  2BU4 A;  1T2H A;  2HMO B;  3BNC A;  3CC7 3;  1JBS A;  3KSE D;  3BNB A;  5AEU B;  1EEJ A;  4WYK A;  1TUH A;  3AHW A;  5IF6 A;  2W2C A;  4HYZ A;  1BRJ A;  1IVW A;  1TP6 A;  4NPB A;  3KII A;  3WHO A;  3LTA A;  4R80 A;  2D42 A;  2XR8 B;  3DUK A;  3X41 A;  5RNT A;  3CMA 3;  4X2O A;  5IEP A;  2WO0 A;  2W9P A;  1EG9 B;  2XF3 A;  4AKZ A;  1JBR A;  1JZO A;  3BU4 A;  5CXO A;  1G02 A;  3LTC A;  2CFK A;  1BRN L;  1US1 A;  2R4I A;  1W01 A;  1OHO A;  1A2V A;  3IPT A;  3I0Y A;  3M8C A;  4BTW A;  1WQL B;  2Z7A A;  1UDI I;  4CCV A;  2KRT A;  3UJM A;  3NBB A;  4FMC A;  3FG4 A;  4XDW A;  2CG0 A;  3CNX A;  1IQ8 A;  3DGO A;  1ZGX A;  3CCU 3;  4K1V A;  1N5P A;  2BHM A;  1ZX2 A;  2CFL A;  2F5M A;  3AGO A;  7STD A;  1CH0 A;  2L1S A;  1WMN A;  4WWU C;  1OGZ A;  3J7Y d;  1BU4 A;  1BRH A;  1UCL A;  2W56 A;  1I8V A;  4HM4 B;  1HYF A;  1YVS A;  2WGO A;  3CC2 3;  1W6Y A;  1OCV A;  2QGU A;  4L7K A;  2Q07 A;  1GD3 A;  2STD A;  1GS3 A;  1NB3 I;  1ULI B;  3LTD A;  3PCR A;  2OOV C;  5IEO A;  1N9E A;  2CFD A;  4LGQ A;  3U1W A;  4TX4 A;  1Q82 4;  3RGR A;  1RNT A;  3B7C A;  4HAA A;  3S27 A;  7GSP A;  3GWR A;  1RGG A;  2OTL 3;  1ISK A;  1VQK 3;  2BO9 B;  2MF7 A;  1M1K 4;  3LOY A;  2JDI H;  2CFW A;  4HZ9 B;  1DVC A;  2CWT A;  3FSD A;  4U13 A;  4LZI A;  1YI2 3;  5DRE A;  3L0R A;  1C54 A;  1BNE A;  3ROB A;  4O2H A;  1NJI 4;  2CIU A;  2KF5 A;  1UUG B;  4BL3 A;  1O7W B;  1GOY A;  1HKX A;  3FKA A;  4BL2 A;  3SYU A;  3NM7 A;  3WOE B;  4N6O B;  3K5T A;  3TDG A;  4RZM A;  2KF3 A;  2P0M A;  3MG3 A;  2CHC A;  1BNG A;  1ULJ B;  1C7H A;  4BTY A;  1M1X B;  2KAA A;  3V99 A;  3RDE A;  3OX9 A;  1J2B A;  4FCJ A;  5IG4 A;  1QAK A;  3VF1 A;  1YHQ 3;  5JPP A;  1BIR A;  5EVH A;  4ILF A;  1UI8 A;  1AY7 A;  3FGY A;  3CCJ 3;  1RGE A;  3HX8 A;  4XBX A;  2XFS A;  1I70 A;  3LT8 A;  4BIR A;  1KD1 4;  4KZ1 A;  4N6N B;  3FF2 A;  4HBR A;  1OUN A;  2HMJ B;  4N3V A;  3E99 A;  1W6G A;  3ECF A;  2WGQ A;  1JJ2 2;  1JN5 B;  2XH9 A;  2W0Q A;  2XRX B;  2E2V A;  2YFI B;  3GSP A;  3CPW 2;  3MG1 A;  5ELJ A;  3BB9 A;  5M1A A;  1IVU A;  1GYB A;  3RNT A;  3FZW A;  3HII A;  3BLZ A;  1LOY A;  3CD6 3;  1YNV X;  1KC8 4;  1UGI A;  3MPH A;  1EKM A;  1B20 A;  1LOV A;  4HJL B;  2AAE A;  4FCM A;  1O7N B;  3Q2P A;  1PYL A;  2E2U A;  1VQP 3;  1G96 A;  2QA4 3;  3MWZ A;  1FZU A;  3D3L A;  3AMO B;  3VGN A;  1BSE A;  2YFJ B;  3I56 3;  1B21 A;  1LOX A;  1FYS A;  2HML B;  1Q7H A;  2CW9 A;  2XEP A;  5JBS A;  1WMP A;  2YFL B;  4KVH A;  1VQ8 3;  3LZA A;  1LRA A;  1JBT A;  3WA3 A;  1A90 A;  3H3H A;  1NWW A;  1D6Z A;  1VQ5 3;  5BIR A;  1A2K A;  1OPY A;  1HU9 A;  1UCI A;  1JKG A;  2IUJ A;  5HOH A;  2HMM B;  3SLU A;  3SED A;  2PZV A;  4BU4 A;  4MMX B;  3A76 A;  1JB4 A;  3DH2 A;  3LH4 A;  4H61 A;  5BU4 A;  2W03 A;  3D5I A;  2F5W A;  1RHL A;  2D1W A;  3G8Z A;  1D6U A;  3F8X A;  3LML A;  3SOY A;  1TTO A;  2C10 A;  3UL6 A;  4AKY A;  1B2U A;  6GSP A;  3I55 3;  2Y73 A;  1V57 A;  1OHP A;  2IY2 A;  1OF5 A;  2SBL A;  1Q42 A;  2I9W A;  4HKV B;  3SOA A;  1DE3 A;  1UCJ A;  5ELU A;  1RLS A;  1QVG 2;  3B4O A;  1WTH A;  3VSY A;  1EA2 A;  2R41 A;  1X1Y A;  4HM6 B;  2OQE A;  3O8Y A;  3STD A;  2HMN B;  3ALA A;  5AYR B;  1F8N A;  2IUK A;  2RSX A;  1CEW I;  2HOH A;  2K0M A;  3GRD A;  3DGN A;  1GMR A;  3DM8 A;  3GZR A;  4GB5 A;  1BSD A;  1RGA A;  4RNZ A;  4JRF A;  1MWT A;  4N6V 0;  2FXT A;  1QMA A;  4K61 A;  1K73 4;  1BNI A;  1MGW A;  3T8N A;  1YJN 3;  1O7P B;  1BUQ A;  5FGO A;  3LTB A;  3T8U A;  3Q3F A;  4HM3 B;  3UB1 A;  3G4S 3;  1W6C A;  3EC9 A;  1GY6 A;  4GL6 A;  2XSO B;  2BIR A;  1RGH A;  8CHO A;  1TFK A;  4N6M A;  3UNL A;  3F7S A;  3EBY A;  3DGL A;  1RGK A;  4GSP A;  1K41 A;  5DRV A;  3CCM 3;  5BXQ A;  1MNL A;  3EJV A;  1RDS A;  3KE7 A;  3QRD A;  1TJD A;  2P38 A;  1STF I;  1UGH I;  2XFT A;  1VQ4 3;  1BRS A;  4LSO A;  1FGT A;  2Y74 A;  2GSP A;  2ZHX B;  1OAC A;  3B8L A;  3CC4 3;  5AIG A;  4CDL A;  4OVM A;  5FW5 A;  3RGA A;  3X3Z A;  5AI1 A;  1Q40 A;  5D83 A;  4DKI A;  5KP1 A;  1IK3 A;  3EX9 A;  1AVK A;  3OWU A;  1BRI A;  3OWY A;  1GY7 A;  3CPO A;  1LVN A;  3JVC A;  2RFR A;  4R9K A;  2C4B A;  3X40 A;  4EXR A;  1T5Y A;  1JNQ A;  1RMS A;  3HK4 A;  5AEW B;  3PYJ A;  1JB5 A;  1SIH A;  1SQW A;  2WOF A;  3CCL 3;  1ASK A;  1VQ7 3;  1YIT 3;  1CYV A;  3EE1 A;  3T0U A;  1E3V A;  1DVD A;  1UCK A;  3S5C A;  3CME 3;  1ZS7 A;  3NV0 B;  1Q7Y 4;  4HOH A;  1VQ9 3;  3BIR A;  2LQV A;  4K90 B;  3F8H A;  5AII A;  2H0H A;  2OOV A;  1BNJ A;  1D6Y A;  2BMQ B;  2XGN A;  2QIY A;  3D9R A;  1NDO B;  4LYL B;  1BSB A;  3GZB A;  3KFQ C;  1VQL 3;  3UL5 A;  1YVB I;  2Z77 A;  3WMD A;  1BAO A;  4FR9 A;  4EV2 A;  1A67 A;  4O3V A;  1JRQ A;  5CK6 A;  4K1U A;  1G0T A;  1NO3 A;  1GMP A;  1RN7 A;  1FA3 A;  4MMY B;  3N8B A;  3CCS 3;  2LYX A;  1QVF 2;  2ML6 A;  1B2S A;  2PNC A;  3NQY A;  4EW5 A;  3FLJ A;  3G71 3;  1NNV A;  3MKI A;  1S5A A;  1GMQ A;  2V1L A;  1IVV A;  4J8T A;  1MGR A;  5D82 A;  2Z76 A;  1OHS A;  1LNI A;  1NB5 I;  2BT3 A;  1MWR A;  1UUW B;  2L4V A;  2W56 B;  3D79 A;  4PEJ A;  1EQK A;  2UUG C;  1I3F A;  4XB5 A;  2J8X B;  2YX9 A;  4RBN A;  4WHA A;  1OGX A;  1L5G B;  5IG5 A;  2A15 A;  1RCK A;  1RGL A;  2W6J H;  1W5Z A;  3FF0 A;  1O7G B;  1RNB A;  3JUP A;  5HGR A;  1SII A;  1DET A;  3DGM A;  4STD A;  1Q86 4;  3OV4 A;  3KN4 A;  4R4K A;  1FUS A;  5LC6 A;  1DMQ A;  4N6T A;  1AR0 A;  3B4P A;  1FGO A;  2WOH A;  3GAX A;  4J5K A;  1X1W A;  1ROA A;  1EUI C;  1IQX A;  1E3R A;  2H0I A;  4I4K A;  4ORL A;  1VQN 3;  1BNR A;  4NRE A;  3MG2 A;  4Q53 A;  2GU3 A;  2GBW B;  5TGN A;  2F99 A;  4GHO A;  1FUW A;  4L8O A;  1BSA A;  3KKG A;  3NBJ A;  2MC8 A;  1I2E A;  2OTJ 3;  1RGC A;  1LQM B;  1GY5 A;  2W9Q A;  1W02 A;  1M9G A;  1HZ1 A;  3Q1C A;  1SAR A;  3EF8 A;  1RSN A;  1UW1 A;  1LOW A;  1BNS A;  2M7O A;  1VQM 3;  4MJD A;  1YJ9 3;  2E2T A;  5D81 A;  3DXO A;  4RNT A;  1B27 A;  2F4Y A;  3K7C A;  1X1U A;  1K9M 4;  3JUQ A;  1RN4 A;  1K8A 4;  3WR2 A;  1JV2 B;  1N5H A;  3F40 A;  4LMI A;  1S72 3;  5AYS C;  1SJW A;  3LXU X;  3F14 A;  1VZZ A;  3JUN A;  3OXA A;  1VQO 3;  2BMR B;  5CF1 A;  3K63 A;  1N8Q A;  2GEX A;  5IER A;  2B1X B;  4ZM8 A;  1T3B A;  3K0Z A;  1SPU A;  3GZY B;  2GBX B;  1TU5 A;  3Q90 A;  4X2H A;  1LQG C;  1I2G A;  2GU1 A;  3N9H A;  1AQZ A;  3LT9 A;  1BRK A;  2OWP A;  2GXF A;  1T2I A;  3NX0 A;  5LC7 A;  1JB2 A;  3PCS A;  3DY5 A;  4J5G A;  5EQL A;  1STD A;  3CCE 3;  2RNT A;  2O9U X;  1CYU A;  2KCD A;  1V58 A;  6RNT A;  1Q40 B;  1BGS A;  1MWS A;  3EBT A;  3IJE B;  1N9J A;  5STD A;  1FGM A;  1QAF A;  1Y4K A;  2FNQ A;  4O02 B;  2SAR A;  1RKY A;  1KWI A;  4XM4 A;  3BNE A;  5G1K A;  3X42 A;  2UX0 A;  4I5Q A;  1YGE A;  3NBR A;  5KP4 A;  4IPB A;  3DZL A;  3DMC A;  3PGB A;  7RNT A;  1FUT A;  1E97 A;  1ROV A;  4JF8 A;  3F7X A;  1I2F A;  3FG1 A;  4FMB A;  5M19 A;  2O3O A;  2KXG A;  5CLK A;  2AAD A;  3N54 B;  4EYC A;  1BUJ A;  4RNY A;  2GEY A;  4O8S A;  5I97 A;  3HOH A;  1KQS 2;  2RBI A;  3MHE A;  4BTX A;  1GD4 A;  4XBY A;  1W2B 2;  2CFG A;  2P09 A;  1X1X A;  5GSP A;  1AV4 A;  1IYY A;  3AMO A;  1A2P A;  4EV5 A;  4FMD A;  3MSO A;  1B3S A;  9RNT A;  2ZDJ A;  1IT7 A;  3NM2 A;  3URP A;  3KSP A;  4HVN A;  1PFP A;  1RRH A;  1VQQ A;  1Q81 4;  5KP3 A;  3H51 A;  5M18 A;  2CWV A;  5AIF A;  2BMO B;  1W2Z A;  2OQE C;  4LEH A;  2F98 A;  5CF2 A;  3HIG A;  1W4N A;  1IV9 A;  3EB8 A;  1B2M A;  3S29 A;  1DYU A;  1W00 A;  3EQQ B;  4WYK B;  1IU7 A;  3FCS B;  4WFO A;  4R1K A;  2CKF B;  1W7C A;  1JN5 A;  1M90 4;  4FMA A;  2KF4 A;  2JQ5 A;  1Z1S A;  3ZG0 A;  1PY3 A;  2XSH B;  3ER7 A;  2ZA4 A;  4H3U A;  1TRQ A;  3FH1 A;  1B2Z A;  3D4A A;  3SX1 A;  3CU3 A;  3HZP A;  4G1M B;  3ZFZ A;  4HZB B;  3DGY A;  4KT3 B;  2HMK B;  1NU3 A;  2B24 B;  1Q9E A;  3K9M C;  3V92 A;  3KCH A;  4CPK A;  2W04 A;  2QEX 3;  1I0X A;  3WDG B;  5A0O B;  3QK9 A;  3ZG5 A;  1GOV A;  1WMO A;  4R9L A;  2BNG A;  4L8P A;  4FCZ A;  1YGW A;  2P05 A;  3A5E A;  1LNH A;  4J9A A;  1O7M B;  2FGT A;  2CK3 H;  1BOX A;  4MEI A;  1UI7 A;  5JPU A;  3NV0 A;  4MMZ B;  2F86 B;  3FG3 A;  3HI7 A;  3CXC 2;  2UGI A;  1BNF A;  3G0K A;  1RN1 A; 
#chains in the Genus database with same CATH homology
 2CG1 A;  4HM8 B;  3NQZ A;  3PZW A;  1JKG B;  3SVA A;  1MOL A;  2CC3 A;  5IG0 A;  1IVX A;  2P0X A;  4HM0 B;  2CH9 A;  2OCT A;  5IG3 A;  6STD A;  4EC6 A;  3X3Y A;  3G16 A;  1TFO A;  3V98 A;  4HM2 B;  3CNM A;  4WP5 A;  1YIJ 3;  3OWS A;  4XBT A;  3SXX A;  1ZO2 A;  3EN1 B;  4KFF A;  3LYG A;  3U97 A;  5AIH A;  3CCR 3;  3BND A;  1WNH A;  1U5O A;  3WOF B;  5IEN A;  1N8R 4;  3MYT A;  3JUM A;  5BVB A;  3CCQ 3;  4NHF A;  2Z6B A;  3PXM A;  2CWU A;  1OF5 B;  4EBG A;  4IIA A;  4KFD A;  2XGL A;  1YJW 3;  1TIJ A;  3GZX B;  3X3X A;  4N6U A;  3CCV 3;  3NUV A;  1KSI A;  5EEO A;  1QAL A;  4IT7 A;  5G2G A;  2K54 A;  2IA7 A;  4HM1 B;  1RRL A;  4OUQ A;  1OH0 A;  1K28 A;  1FGQ A;  1FGR A;  4OK0 A;  1PU4 A;  1AVL A;  3S67 A;  1IDP A;  1IQY A;  1QJG A;  1U8C B;  3JUO A;  3NXJ A;  3OW2 2;  1V74 A;  3S28 A;  4HM5 B;  2RCD A;  1DMM A;  2ML5 A;  1R4C A;  4N6L A;  3WA2 X;  2ZL8 A;  5IW9 A;  3EHC A;  3IMA B;  1O7H B;  1VQ6 3;  2IMJ A;  4AEQ A;  2C11 A;  3EN8 A;  4HM7 B;  4QWT A;  1DMN A;  3KZT A;  1IV7 A;  1LXE A;  4XDV A;  3NHX A;  3G6E 3;  3PS8 A;  2RGQ A;  3WOD G;  1IT8 A;  1UUV B;  4KFE A;  1RJO A;  3F9S A;  2INX A;  3BNC A;  2HMO B;  3CC7 3;  3KSE D;  3BNB A;  5AEU B;  4WYK A;  1TUH A;  5IF6 A;  2W2C A;  4HYZ A;  1IVW A;  1TP6 A;  3KII A;  3LTA A;  4R80 A;  2D42 A;  2XR8 B;  3DUK A;  3X41 A;  3CMA 3;  4X2O A;  5IEP A;  2WO0 A;  2W9P A;  1EG9 B;  2XF3 A;  4AKZ A;  5CXO A;  3LTC A;  2CFK A;  1US1 A;  2R4I A;  1W01 A;  1OHO A;  1A2V A;  3IPT A;  3I0Y A;  3M8C A;  4BTW A;  1WQL B;  2Z7A A;  4CCV A;  2KRT A;  3UJM A;  3NBB A;  4FMC A;  3FG4 A;  4XDW A;  2CG0 A;  3CNX A;  1IQ8 A;  3DGO A;  3CCU 3;  4K1V A;  1N5P A;  2BHM A;  1ZX2 A;  2CFL A;  7STD A;  1WMN A;  4WWU C;  1OGZ A;  3J7Y d;  3CC2 3;  4HM4 B;  2W56 A;  2WGO A;  1W6Y A;  1OCV A;  2QGU A;  4L7K A;  2Q07 A;  1GD3 A;  2STD A;  1GS3 A;  1NB3 I;  1ULI B;  3LTD A;  3PCR A;  2OOV C;  5IEO A;  1N9E A;  2CFD A;  4LGQ A;  3U1W A;  4TX4 A;  1Q82 4;  3RGR A;  3B7C A;  3S27 A;  2OTL 3;  3GWR A;  1ISK A;  1VQK 3;  2BO9 B;  2MF7 A;  1M1K 4;  3LOY A;  2JDI H;  2CFW A;  4HZ9 B;  1DVC A;  2CWT A;  3FSD A;  4U13 A;  4LZI A;  1YI2 3;  5DRE A;  3L0R A;  3ROB A;  4O2H A;  1NJI 4;  2CIU A;  1O7W B;  1HKX A;  3FKA A;  3NM7 A;  3WOE B;  4N6O B;  3K5T A;  3TDG A;  4RZM A;  2P0M A;  3MG3 A;  2CHC A;  1ULJ B;  1C7H A;  4BTY A;  1M1X B;  3V99 A;  3RDE A;  3OX9 A;  4FCJ A;  5IG4 A;  1QAK A;  3VF1 A;  1YHQ 3;  5JPP A;  5EVH A;  1UI8 A;  3FGY A;  3CCJ 3;  3HX8 A;  4XBX A;  2XFS A;  3LT8 A;  1KD1 4;  4KZ1 A;  4N6N B;  3FF2 A;  4HBR A;  1OUN A;  2HMJ B;  4N3V A;  3E99 A;  1W6G A;  3ECF A;  2WGQ A;  1JJ2 2;  1JN5 B;  2XH9 A;  2W0Q A;  2XRX B;  2E2V A;  2YFI B;  3CPW 2;  3MG1 A;  5ELJ A;  3BB9 A;  1IVU A;  1GYB A;  3FZW A;  3HII A;  3BLZ A;  3CD6 3;  1KC8 4;  3MPH A;  1EKM A;  4HJL B;  4FCM A;  1O7N B;  3Q2P A;  2E2U A;  1VQP 3;  1G96 A;  2QA4 3;  3MWZ A;  3D3L A;  3AMO B;  3VGN A;  2YFJ B;  3I56 3;  1LOX A;  2HML B;  2CW9 A;  2XEP A;  5JBS A;  1WMP A;  2YFL B;  4KVH A;  1VQ8 3;  3LZA A;  3WA3 A;  1A90 A;  3H3H A;  1NWW A;  1D6Z A;  1VQ5 3;  1A2K A;  1OPY A;  1HU9 A;  1JKG A;  2IUJ A;  2HMM B;  3SLU A;  3SED A;  2PZV A;  4MMX B;  3A76 A;  1JB4 A;  3LH4 A;  4H61 A;  2W03 A;  2D1W A;  3G8Z A;  1D6U A;  3F8X A;  3LML A;  3SOY A;  2C10 A;  3UL6 A;  4AKY A;  3I55 3;  1S72 3;  1VQN 3;  2Y73 A;  1OHP A;  3SOA A;  2SBL A;  1OF5 A;  1Q42 A;  2I9W A;  4HKV B;  5ELU A;  1QVG 2;  1A67 A;  3B4O A;  1WTH A;  3VSY A;  1EA2 A;  4HM6 B;  2OQE A;  3O8Y A;  3STD A;  2HMN B;  3ALA A;  5AYR B;  1F8N A;  2IUK A;  2RSX A;  1CEW I;  2K0M A;  3GRD A;  3DGN A;  3DM8 A;  3GZR A;  4RNZ A;  4GB5 A;  4JRF A;  4N6V 0;  2FXT A;  1QMA A;  4K61 A;  1K73 4;  3T8N A;  1YJN 3;  1O7P B;  1BUQ A;  5FGO A;  3LTB A;  3T8U A;  4HM3 B;  3UB1 A;  3G4S 3;  1W6C A;  3EC9 A;  1GY6 A;  4GL6 A;  2XSO B;  8CHO A;  1TFK A;  4N6M A;  3UNL A;  3F7S A;  3EBY A;  3DGL A;  1K41 A;  5DRV A;  3CCM 3;  5BXQ A;  1MNL A;  3EJV A;  3QRD A;  3KE7 A;  2P38 A;  1STF I;  2XFT A;  1VQ4 3;  4LSO A;  1FGT A;  2Y74 A;  1OAC A;  3B8L A;  3CC4 3;  5AIG A;  4CDL A;  4OVM A;  5FW5 A;  3RGA A;  3X3Z A;  5AI1 A;  1Q40 A;  5D83 A;  5KP1 A;  1IK3 A;  3EX9 A;  1AVK A;  3OWU A;  3OWY A;  1GY7 A;  3CPO A;  1LVN A;  3JVC A;  2RFR A;  4R9K A;  4EXR A;  3X40 A;  5AEW B;  1JNQ A;  1T5Y A;  3HK4 A;  3PYJ A;  1JB5 A;  1SIH A;  1SQW A;  2WOF A;  3CCL 3;  1ASK A;  1VQ7 3;  1YIT 3;  1CYV A;  3EE1 A;  3T0U A;  1E3V A;  1DVD A;  3S5C A;  3CME 3;  3NV0 B;  1Q7Y 4;  1VQ9 3;  2LQV A;  4K90 B;  3F8H A;  5AII A;  2OOV A;  2XGN A;  1D6Y A;  2BMQ B;  3D9R A;  2QIY A;  1NDO B;  3GZB A;  3KFQ C;  1VQL 3;  3UL5 A;  1YVB I;  2Z77 A;  3WMD A;  4FR9 A;  4EV2 A;  4O3V A;  1JRQ A;  5CK6 A;  4K1U A;  1NO3 A;  1RN7 A;  1FA3 A;  4MMY B;  3N8B A;  3CCS 3;  2LYX A;  1QVF 2;  2ML6 A;  2PNC A;  3NQY A;  3FLJ A;  3G71 3;  5D82 A;  3MKI A;  1S5A A;  2V1L A;  4J8T A;  1IVV A;  2Z76 A;  1OHS A;  1NB5 I;  2BT3 A;  1UUW B;  2L4V A;  2W56 B;  4PEJ A;  1EQK A;  4XB5 A;  4WHA A;  2YX9 A;  4RBN A;  1L5G B;  1OGX A;  5IG5 A;  2A15 A;  2W6J H;  1W5Z A;  3FF0 A;  1O7G B;  3JUP A;  5HGR A;  1SII A;  4STD A;  3DGM A;  1Q86 4;  3OV4 A;  3KN4 A;  4R4K A;  5LC6 A;  1DMQ A;  4N6T A;  1AR0 A;  3B4P A;  1FGO A;  2WOH A;  3GAX A;  1ROA A;  1IQX A;  1E3R A;  4I4K A;  4ORL A;  4NRE A;  3MG2 A;  4Q53 A;  2GU3 A;  2GBW B;  5TGN A;  2F99 A;  1FUW A;  4L8O A;  3KKG A;  3NBJ A;  2MC8 A;  2OTJ 3;  1GY5 A;  2W9Q A;  1W02 A;  1M9G A;  3Q1C A;  3EF8 A;  1UW1 A;  2M7O A;  1VQM 3;  4MJD A;  1YJ9 3;  2E2T A;  5D81 A;  3DXO A;  3K7C A;  1K9M 4;  3JUQ A;  1K8A 4;  1JV2 B;  1N5H A;  3F40 A;  4LMI A;  5AYS C;  1SJW A;  3LXU X;  3F14 A;  1VZZ A;  3JUN A;  3OXA A;  1VQO 3;  2BMR B;  5CF1 A;  3K63 A;  1N8Q A;  2GEX A;  5IER A;  2B1X B;  4ZM8 A;  3K0Z A;  1SPU A;  3GZY B;  2GBX B;  1TU5 A;  3Q90 A;  4X2H A;  2GU1 A;  3N9H A;  3LT9 A;  2OWP A;  3NX0 A;  2GXF A;  5LC7 A;  1J2B A;  1JB2 A;  3PCS A;  3DY5 A;  5EQL A;  1STD A;  3CCE 3;  2O9U X;  1CYU A;  2KCD A;  1Q40 B;  3EBT A;  3IJE B;  1N9J A;  5STD A;  1FGM A;  1QAF A;  1Y4K A;  2FNQ A;  4O02 B;  1RKY A;  1KWI A;  4XM4 A;  3BNE A;  3X42 A;  2UX0 A;  1YGE A;  3NBR A;  5KP4 A;  4IPB A;  3DZL A;  3DMC A;  3PGB A;  1E97 A;  1ROV A;  4JF8 A;  3F7X A;  3FG1 A;  4FMB A;  2O3O A;  2KXG A;  5CLK A;  3N54 B;  4EYC A;  4RNY A;  2GEY A;  4O8S A;  5I97 A;  1KQS 2;  3MHE A;  4BTX A;  1GD4 A;  4XBY A;  1W2B 2;  2CFG A;  2P09 A;  1AV4 A;  3AMO A;  4EV5 A;  4FMD A;  3MSO A;  2ZDJ A;  1IT7 A;  3NM2 A;  3KSP A;  4HVN A;  1PFP A;  1RRH A;  1Q81 4;  5KP3 A;  3H51 A;  2CWV A;  5AIF A;  2BMO B;  1W2Z A;  2OQE C;  4LEH A;  2F98 A;  5CF2 A;  3HIG A;  1W4N A;  1IV9 A;  3EB8 A;  3S29 A;  1DYU A;  1W00 A;  3EQQ B;  4WYK B;  1IU7 A;  3FCS B;  4WFO A;  4R1K A;  2CKF B;  1W7C A;  1JN5 A;  1M90 4;  4FMA A;  2JQ5 A;  1Z1S A;  2XSH B;  3ER7 A;  4H3U A;  3FH1 A;  3SX1 A;  3CU3 A;  3HZP A;  4G1M B;  4HZB B;  2HMK B;  1NU3 A;  2B24 B;  3K9M C;  3V92 A;  2W04 A;  2QEX 3;  3WDG B;  5A0O B;  3QK9 A;  1WMO A;  4R9L A;  2BNG A;  4L8P A;  4FCZ A;  2P05 A;  4J9A A;  1LNH A;  1O7M B;  2FGT A;  2CK3 H;  4MEI A;  1UI7 A;  5JPU A;  3NV0 A;  4MMZ B;  2F86 B;  3FG3 A;  3HI7 A;  3CXC 2;  3G0K A;  1CQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...