2HMMB

Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 59
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmmB00
4IIAA 3MKIA 2R4IA 3NV0A 4HZBB 3JUQA 3G0KA 3I0YA 3F9SA 2RGQA 3MSOA 1EG9B 2GBWB 4HM4B 1AR0A 1TP6A 5IEOA 2STDA 8CHOA 1NWWA 3S5CA 2XSHB 5JPPA 4HM1B 3NBRA 3GZXB 3EN1B 6STDA 3K7CA 3JUOA 5AIGA 2A15A 3OX9A 1W02A 3T8UA 3F8XA 3GZRA 1QMAA 3B4PA 2I9WA 1W01A 2HMJB 1OF5B 3SOAA 5AEWB 1E97A 1JKGA 2QGUA 3CNXA 7STDA 3VSYA 5HGRA 2Z7AA 3EBYA 5IG5A 4HZ9B 1JKGB 3SEDA 5CLKA 2YFIB 1O7PB 3FF2A 3B8LA 1O7WB 4MJDA 1CQSA 2RCDA 3RGAA 4ORLA 4HM8B 3EF8A 3KE7A 2GXFA 2YFJB 3JUPA 4L8OA 5BXQA 1O7NB 3OWYA 5BVBA 3CU3A 2GEXA 3A76A 3GZYB 4HM2B 4K1VA 4FCMA 4XDVA 1ZO2A 4L8PA 4XBTA 1SJWA 3MHEA 3DUKA 4X2HA 1ULIB 4X2OA 1JN5B 1WQLB 3OWUA 3EBTA 5D81A 3KKGA 3FKAA 2HMKB 3DXOA 2F99A 3G8ZA 3ER7A 3NV0B 3VGNA 1GY6A 1Z1SA 2JQ5A 2BMRB 3M8CA 2GEYA 4HM0B 2BMOB 3FSDA 1OPYA 3H3HA 5CK6A 3B7CA 5AEUB 1U5OA 5AIHA 1ISKA 1C7HA 2QIYA 4GB5A 3EHCA 1GY7A 2XR8B 1O7HB 4J9AA 1EA2A 2PZVA 3CNMA 4LMIA 5TGNA 3D9RA 4XB5A 4Q53A 3K0ZA 4J8TA 1UUWB 2B24B 1ASKA 5FW5A 4WP5A 3T8NA 3WMDA 3F7XA 3FH1A 3MG1A 1GS3A 2YFLB 1ZX2A 3DZLA 2BNGA 3ECFA 3LYGA 5CF1A 4HKVB 4KVHA 3F8HA 2Z76A 3F40A 3FLJA 3GWRA 3NXJA 3OWSA 5IERA 3GZBA 3JUNA 3BB9A 5AI1A 1DMMA 4L7KA 4OUQA 3ROBA 1OGZA 3OXAA 4XBYA 3G16A 5STDA 3GRDA 1QJGA 1K41A 5D82A 3EN8A 1GY5A 3F14A 4WYKA 3DM8A 1VZZA 4HVNA 4I4KA 5KP4A 3NHXA 4WWUC 4PEJA 4K1UA 1JB5A 5AIFA 3MYTA 4H3UA 2GBXB 2RFRA 1UUVB 4XDWA 4U13A 1OCVA 4HM5B 5DRVA 3FZWA 1IDPA 2F86B 4XM4A 4STDA 2XRXB 3STDA 2BMQB 3EC9A 1OGXA 3JUMA 4HM7B 3MG3A 3EX9A 4HJLB 1OUNA 4R1KA 1HKXA 5IF6A 3H51A 3Q90A 3HK4A 4XBXA 1JB2A 1STDA 3NUVA 1NDOB 2HMOB 3MG2A 2Z77A 1OHOA 3E99A 5G2GA 4RZMA 5IENA 5D83A 1O7GB 4HM3B 4R9KA 5IG0A 3FF0A 5JPUA 2CKFB 4R9LA 2W2CA 3UNLA 1OF5A 2CHCA 2HMMB 2B1XB 1JB4A 3HZPA 4LEHA 1ULJB 3KSPA 3CPOA 2HMLB 2HMNB 1NU3A 1W00A 3NM2A 3FGYA 3KZTA 1Q42A 5EVHA 4OVMA 5KP1A 1Q40A 2UX0A 2K54A 4LGQA 1W6YA 3B4OA 5IG3A 3SOYA 5CXOA 1OHPA 3BLZA 2F98A 3HX8A 3RGRA 1DMNA 1Q40B 5KP3A 1OHSA 1E3RA 1O7MB 1E3VA 4CDLA 3EQQB 4N3VA 2INXA 2OWPA 3IPTA 5AIIA 3DMCA 4HM6B 5DREA 1OH0A 1S5AA 5IG4A 3UJMA 5IEPA 3LZAA 4FCJA 5CF2A 3OV4A 3F7SA 2IMJA 3EJVA 1JN5A 4WYKB 1BUQA 1A2KA 1GYBA 1DMQA 2XSOB 1TUHA
chains in the Genus database with same CATH superfamily
3SYUA 1VQ93 3S28A 1UCKA 2CC3A 1BRSA 3EB8A 4LZIA 2OQEC 4IIAA 4O02B 3I553 3VF1A 3MKIA 2CFDA 4EV2A 2XFTA 3V92A 1ZS7A 1B27A 2R4IA 3NV0A 1BSBA 7GSPA 1HYFA 4HZBB 3UB1A 3ZG5A 3CPW2 1A67A 3WODG 2CG0A 3JUQA 1IQ8A 2CX1A 3AMOA 1L5GB 3G0KA 2QEX3 3I0YA 4MMZB 2XGLA 2RGQA 3F9SA 1BANA 3MSOA 4JF8A 1RGEA 1EG9B 1GOYA 1V57A 3RDEA 3WDGB 4KZ1A 1UUGB 2GBWB 1WMPA 4HM4B 1JZDA 1AR0A 1TP6A 5IEOA 1BUJA 1Q7Y4 2STDA 1MNLA 8CHOA 1NWWA 3J7Yd 1BNFA 3S5CA 4AEQA 5HOHA 2UUGC 1B2ZA 2MC8A 1M1K4 2XSHB 3AHSA 1T3BA 5JPPA 4LYLB 2OQEA 3ALAA 4HM1B 3Q3FA 1BNIA 1EQKA 1TFKA 3NBRA 3GZXB 1RNBA 3EN1B 6STDA 1DETA 3K7CA 2ZL8A 1N8QA 1BOXA 3D4AA 3CC23 1YIT3 3JUOA 5AIGA 2AADA 1T5YA 2A15A 2CK3H 1D6ZA 1X1YA 1RNTA 5I97A 1FA3A 4BU4A 1BNRA 2OTL3 2P0XA 1EEJA 1I3IA 3BNEA 3K9MC 4EC6A 1R4CA 1B20A 3OX9A 1OACA 2W56A 3AGNA 1W02A 2P05A 3T8UA 4GHOA 1D6YA 3F8XA 3GZRA 1X1WA 2IYJA 4HAAA 4IPBA 5AYSC 1QMAA 3WOEB 3B4PA 2I9WA 1W01A 2HMJB 3MWZA 1OF5B 3Q2PA 4I5QA 3SOAA 5AEWB 3CD63 3KN4A 4ILFA 3PS8A 2O9UX 2XFSA 1BSEA 1E97A 1D6UA 1LXEA 2IY2A 1GOVA 1IK3A 2CWVA 1JKGA 1M904 2QGUA 3ZG0A 2IUKA 4O3VA 2WOHA 3GSPA 4CPKA 1IVWA 3CNXA 4GSPA 7STDA 3K5TA 3V99A 2WGQA 5M1AA 4QWTA 3A5EA 3VSYA 5HGRA 2CFWA 2Z7AA 3EBYA 5IG5A 1Q824 3LMLA 4HZ9B 1JKGB 4J5GA 1BSAA 3SEDA 5CLKA 2YFIB 1O7PB 3N9HA 1RHLA 1RRHA 2GU1A 4CJNA 3FF2A 3B8LA 1O7WB 1KSIA 1AV4A 1TIJA 4MJDA 1FYSA 3HI7A 5EQLA 1W4NA 1CQSA 2RCDA 3ZFZA 3RGAA 2QA43 2CX0A 3AGOA 4ORLA 4HM8B 4KFDA 3EF8A 3KE7A 1G96A 1B21A 2GXFA 3SVAA 4DKIA 4LSOA 2YFJB 2CFKA 1I0XA 1LNHA 3JUPA 3CCU3 3HIGA 4L8OA 5BXQA 3CCE3 3PCSA 2CFLA 2KF3A 4ZM8A 1Q7HA 1VQN3 1FGRA 1O7NB 4EBGA 3OWYA 3PZWA 3X41A 2ML6A 5BVBA 5KP3A 1PFPA 3LTBA 1T2IA 2GEXA 3CU3A 3X42A 2W03A 3A76A 3CMA3 1YGWA 1I2FA 2E2TA 3X40A 3GZYB 1K9M4 4HM2B 1MGRA 1BRHA 4K1VA 1KWIA 1JJ22 2L1SA 4FCMA 4XDVA 4N6MA 1YNVX 1RLSA 1ZO2A 4L8PA 4XBTA 1TRQA 3U97A 1UCLA 1VQQA 2SARA 3CME3 1SJWA 1CYUA 3MHEA 2R41A 1MWSA 3PGBA 3DUKA 4X2HA 1RMSA 3G6E3 3BIRA 1ULIB 4TX4A 9RNTA 4X2OA 1NO3A 3QK9A 1JN5B 2H0HA 1B2SA 1IYYA 1YJW3 1BRNL 1RRLA 1RGHA 3DGNA 1FGTA 4HYZA 3WOFB 3QRDA 1F8NA 1JNQA 1FUTA 1WQLB 4N6TA 1TU5A 3X3YA 2K3DA 1WMNA 1FGOA 1BRJA 3OWUA 1BNGA 4FMAA 1PY3A 3EBTA 1IVVA 1RGLA 3KKGA 5D81A 2E2UA 3NQZA 3FKAA 2OOVC 2OTJ3 2HMKB 3DXOA 1NB3I 2F99A 8RNTA 2L4VA 3G8ZA 4BTWA 2Q07A 3ER7A 1LOWA 3URPA 1SQWA 1B2MA 1WMOA 2CWTA 3NV0B 3DGYA 3VGNA 1GY6A 1Z1SA 1YJN3 3GAXA 2JQ5A 5JBSA 2BMRB 3AMOB 3M8CA 3BU4A 1DE3A 1RGFA 2FNQA 1MWTA 1IV9A 1V74A 1QALA 1MWUA 2C11A 2GEYA 2IA7A 2W6JH 4FMCA 2BMOB 4HM0B 4MEIA 1BRIA 1IVUA 3FSDA 3D5IA 3LTDA 5AYRB 2P09A 1OPYA 4EV5A 2AAEA 3H3HA 5CK6A 2LQVA 1N9JA 3B7CA 2UGIA 1BAOA 2WO0A 5AEUB 1U5OA 5AIHA 1ISKA 2HOHA 1AQZA 1C7HA 1G02A 1N9EA 3D3LA 4BIRA 4R4KA 4NHFA 1LNIA 1LOXA 3SLUA 2QIYA 4GB5A 3EHCA 4BTYA 1GY7A 2XR8B 1W6GA 1J2BA 1O7HB 1A2VA 1AVLA 1UCJA 4J9AA 1EA2A 1RSNA 1FGQA 2PZVA 3BNCA 1VQL3 1FGMA 1UDII 5G1KA 2CH9A 3OW22 3CC43 3CNMA 4LMIA 1BRGA 1R4YA 1IQXA 5TGNA 1RKYA 3CCJ3 1VQ43 2JDIH 3Q1CA 3D9RA 3LT9A 4XB5A 1QVF2 1NJI4 4Q53A 3AHWA 1N8R4 3DH2A 1QAKA 1DVDA 1LQMB 2W56B 1RGKA 3K0ZA 4J8TA 1UUWB 3LTCA 3S67A 1FUWA 2B24B 1ASKA 2H0GA 5FW5A 2Y74A 4WP5A 2C10A 3T8NA 4IT7A 2KF6A 1BVIA 4KFFA 3F7XA 1G0TA 3WMDA 1UGHI 3CCV3 3N8BA 3FH1A 3MG1A 1GS3A 3K63A 2YFLB 1FW7A 2KRTA 1ZX2A 1UI8A 3DZLA 2BNGA 4NREA 1UCIA 3ECFA 3LYGA 1X1XA 4FR9A 3WA2X 5CF1A 1GMRA 3N54B 4HKVB 1UI7A 4KVHA 4CCVA 2KCDA 3FCSB 3F8HA 1VQP3 1A2PA 1RGGA 1ROAA 1RGCA 5BU4A 1TJDA 2Z76A 1YVBI 4RNZA 3F40A 1QVG2 3FLJA 3T0UA 1WNHA 4AKYA 3GWRA 3NXJA 3KFQC 1GD3A 1B2UA 3LTAA 3OWSA 1YGEA 5LC6A 1GOUA 5IERA 1WTHA 2BO9B 1NB5I 2F4YA 4O2HA 1HZ1A 1DYUA 3CXC2 1CEWI 1LQGC 1I3FA 2CW9A 3GZBA 3JUNA 4FMDA 3FG1A 1BNSA 1ZGXA 3BB9A 5AI1A 1DMMA 3CCR3 1KC84 4L7KA 4OUQA 3ROBA 5FGOA 1IT7A 1OGZA 3OXAA 4XBYA 3G16A 5STDA 3GRDA 1QJGA 1W7CA 1K41A 1SARA 1B3SA 4HBRA 5D82A 1S723 3NBJA 1K734 3EN8A 3IJEB 2LYXA 3DGLA 4BL2A 5BIRA 1VQO3 1FUSA 1GY5A 1JBRA 1JRQA 2BIRA 3F14A 1W2ZA 3PCRA 3DM8A 4WYKA 5IW9A 1VZZA 4HVNA 1PYLA 3PXMA 4I4KA 5KP4A 3DGMA 2BHMA 1BSDA 1STFI 2GSPA 3NHXA 2XH9A 2KXGA 3LT8A 4WWUC 3V98A 3X3XA 4PEJA 2F5MA 4K1UA 1JB5A 1U8CB 2D42A 1TFOA 2V1LA 1X1UA 3NM7A 6RNTA 1IVXA 3DY5A 5AIFA 3MYTA 4H3UA 2GBXB 6GSPA 4RNTA 4N6UA 3UL6A 1KQS2 4WFOA 2RFRA 4EW5A 1UUVB 4XDWA 4U13A 1OCVA 4HM5B 5DRVA 1YHQ3 3FZWA 3CC73 1IDPA 1M9GA 2F86B 4XM4A 4STDA 2XRXB 3STDA 4BTXA 2ZA4A 2WOFA 2BMQB 3EC9A 1OGXA 3JUMA 4HM7B 2XGNA 4MMXB 1Q864 3MG3A 4WHAA 4NPBA 1M1XB 3EX9A 1CYVA 1SIHA 3D79A 3SXXA 2PNCA 4GL6A 2J8XB 4HJLB 1OUNA 4R1KA 1HKXA 1SPUA 5IF6A 4J5KA 3H51A 4EXRA 1TRPA 1YIJ3 1Q814 1ROVA 2ML5A 3Q90A 1W6CA 1IQYA 3HK4A 4XBXA 1JBSA 2XEPA 3WHOA 1LOVA 4N6OB 1JB2A 2BU4A 2RSXA 1STDA 1AY7A 3NUVA 2BT3A 3MPHA 3G713 3LH4A 1UGIA 2ZDJA 1NDOB 2OOVA 3NX0A 1K8A4 2HMOB 3CCS3 3MG2A 1VQM3 2Z77A 3CCM3 3LXUX 2CG1A 1N5PA 1OHOA 5ELUA 5M19A 1MWRA 2CWUA 1GSPA 1TTOA 2W9PA 3PYJA 3EE1A 3E99A 1I2GA 1W5ZA 5G2GA 2OCTA 4RZMA 2P38A 2RNTA 2W04A 5D83A 5IENA 3I563 1O7GB 2H0IA 3D5GA 3WA3A 1SIIA 4HM3B 1A90A 1BNJA 2KF5A 4K90B 4R9KA 3S29A 4AKZA 1RTUA 5IG0A 3FF0A 5JPUA 1KD14 1VQ73 2CKFB 4KT3B 4R9LA 2W2CA 4N6LA 1BRKA 3CCL3 1LVNA 1OF5A 3UNLA 2CHCA 2HMMB 1JV2B 2RBIA 2B1XB 4HOHA 2K0MA 1JZOA 2M7OA 1NNVA 1BGSA 5M18A 2IUJA 2W0QA 1JB4A 3S27A 1US1A 3HZPA 4LEHA 1ULJB 5A0OB 3BNBA 3CCQ3 3KSPA 1RCLA 1EUIC 3CPOA 3FG4A 2HMLB 2HMNB 4N6NB 1NU3A 3BNDA 3JVCA 1W00A 3HOHA 3NQYA 3NM2A 1IT8A 3FGYA 3G4S3 3KZTA 1Q42A 1QAFA 1FZUA 5EVHA 1DVCA 4OVMA 4H61A 5KP1A 1Q40A 2UX0A 1BNEA 5IG4A 2K54A 4LGQA 1RCKA 1W6YA 3B4OA 5IG3A 3SOYA 1C54A 3HIIA 3NBBA 1IU7A 2F56A 1AVKA 2FGTA 1RN1A 2KAAA 4R80A 5CXOA 1OHPA 3BLZA 2YX9A 1VQ53 2W9QA 1I70A 1LOYA 1T2HA 3FG3A 4FCZA 2F98A 4JRFA 1GMPA 2CIUA 3TDGA 3HX8A 3RGRA 1PU4A 1DMNA 1GD4A 1RJOA 1Q40B 1MOLA 1E3RA 1IV7A 1OHSA 1O7MB 1MGWA 4MMYB 4N6V0 4RBNA 5EEOA 3DGOA 1E3VA 1YJ93 3U1WA 4CDLA 2XF3A 4OK0A 2MF7A 2SBLA 2ZHXB 1VQK3 1YI23 3EQQB 2WGOA 2CFGA 4N3VA 2O3OA 2INXA 1VQ63 3O8YA 2Z6BA 3KSED 2OWPA 3IPTA 1N5HA 1YVSA 3KCHA 5AIIA 1V58A 3DMCA 2P0MA 2F5WA 1Q9EA 1I8VA 2FXTA 2C4BA 1LRAA 1RN4A 1OH0A 1S5AA 4HM6B 1BSCA 5DREA 3UJMA 3WR2A 1CH0A 1I2EA 5G1LA 3SX1A 4K61A 1EKMA 4RNYA 1HU9A 7RNTA 5IEPA 3LZAA 2D1WA 4FCJA 3X3ZA 4EYCA 1W2B2 5GSPA 5ELJA 4G1MB 5CF2A 3OV4A 1BU4A 4KFEA 1K28A 3F7SA 3IMAB 3RNTA 1RN7A 1GMQA 4FMBA 2Y73A 1RGAA 2IMJA 3LOYA 3EJVA 2E2VA 4O8SA 5LC7A 1UW1A 1JN5A 1Y4KA 2KF4A 3KIIA 1A2KA 3L0RA 4WYKB 1BUQA 1GYBA 1DMQA 2XSOB 1B2XA 1VQ83 5RNTA 1JBTA 4BL3A 1BIRA 2GU3A 3UL5A 1RDSA 1I0VA 1TUHA
chains in the Genus database with same CATH topology
1VQ93 3S28A 2CC3A 3EB8A 4LZIA 2OQEC 4IIAA 4O02B 3I553 3VF1A 3MKIA 2CFDA 4EV2A 2XFTA 3V92A 2R4IA 3NV0A 3UB1A 4HZBB 3CPW2 1A67A 3WODG 2CG0A 3JUQA 1IQ8A 1L5GB 3AMOA 3G0KA 2QEX3 3I0YA 4MMZB 2XGLA 2RGQA 3F9SA 3MSOA 4JF8A 1EG9B 3RDEA 3WDGB 4KZ1A 2GBWB 1WMPA 4HM4B 1AR0A 1TP6A 5IEOA 1Q7Y4 2STDA 1MNLA 8CHOA 1NWWA 3J7Yd 3S5CA 4AEQA 2MC8A 1M1K4 2XSHB 5JPPA 1EQKA 2OQEA 3ALAA 4HM1B 1TFKA 3NBRA 3GZXB 3EN1B 6STDA 3K7CA 2ZL8A 1N8QA 3CC23 1YIT3 3JUOA 5AIGA 1T5YA 2A15A 2CK3H 1D6ZA 5I97A 1FA3A 2OTL3 2P0XA 3BNEA 3K9MC 4EC6A 1R4CA 3OX9A 1OACA 2W56A 1W02A 2P05A 3T8UA 1D6YA 3F8XA 3GZRA 4IPBA 5AYSC 1QMAA 3WOEB 3B4PA 2I9WA 1W01A 2HMJB 3MWZA 1OF5B 3Q2PA 3SOAA 5AEWB 3CD63 3KN4A 3PS8A 2O9UX 2XFSA 1E97A 1D6UA 1LXEA 1IK3A 2CWVA 1JKGA 1M904 2QGUA 2IUKA 4O3VA 2WOHA 1IVWA 3CNXA 7STDA 3K5TA 3V99A 2WGQA 4QWTA 3VSYA 5HGRA 2CFWA 2Z7AA 3EBYA 5IG5A 1Q824 3LMLA 4HZ9B 1JKGB 3SEDA 5CLKA 2YFIB 1O7PB 3N9HA 1RRHA 2GU1A 3FF2A 3B8LA 1O7WB 1KSIA 1AV4A 1TIJA 4MJDA 3HI7A 5EQLA 1W4NA 1CQSA 2RCDA 3RGAA 2QA43 4ORLA 4HM8B 4KFDA 3EF8A 3KE7A 1G96A 2GXFA 3SVAA 4LSOA 2YFJB 2CFKA 1LNHA 3JUPA 3CCU3 3HIGA 4L8OA 5BXQA 3CCE3 3PCSA 2CFLA 4ZM8A 1VQN3 1FGRA 1O7NB 4EBGA 3OWYA 3PZWA 3X41A 2ML6A 5BVBA 1PFPA 3LTBA 3CU3A 2GEXA 3X42A 2W03A 3A76A 3CMA3 2E2TA 3X40A 3GZYB 1K9M4 4HM2B 4K1VA 1KWIA 1JJ22 4FCMA 4XDVA 4N6MA 1ZO2A 4L8PA 4XBTA 3U97A 3CME3 1CYUA 1SJWA 3MHEA 3PGBA 3DUKA 4X2HA 3G6E3 1ULIB 4TX4A 4X2OA 1NO3A 3QK9A 1JN5B 1YJW3 1RRLA 3DGNA 1FGTA 4HYZA 3WOFB 3QRDA 1F8NA 1JNQA 1WQLB 4N6TA 1TU5A 3X3YA 1WMNA 1FGOA 3OWUA 4FMAA 3EBTA 1IVVA 5D81A 3KKGA 2E2UA 3NQZA 3FKAA 2OOVC 2OTJ3 2HMKB 3DXOA 1NB3I 2F99A 2L4VA 3G8ZA 4BTWA 2Q07A 3ER7A 1SQWA 1WMOA 2CWTA 3NV0B 3VGNA 1GY6A 1Z1SA 1YJN3 3GAXA 2JQ5A 5JBSA 2BMRB 3AMOB 3M8CA 2FNQA 1V74A 1IV9A 2GEYA 1QALA 2IA7A 2W6JH 2C11A 4FMCA 4HM0B 4MEIA 2BMOB 4N6V0 5AYRB 1IVUA 3FSDA 3LTDA 2P09A 1OPYA 4EV5A 3H3HA 5CK6A 2LQVA 1N9JA 3B7CA 2WO0A 5AEUB 1U5OA 5AIHA 1ISKA 1C7HA 1N9EA 3D3LA 4R4KA 4NHFA 1LOXA 3SLUA 2QIYA 4GB5A 3EHCA 4BTYA 1GY7A 2XR8B 1W6GA 1J2BA 1O7HB 1A2VA 1AVLA 4J9AA 1EA2A 1FGQA 2PZVA 3BNCA 1VQL3 1FGMA 3OW22 2CH9A 3CC43 3CNMA 4LMIA 3CCJ3 1IQXA 5TGNA 1RKYA 1VQ43 2JDIH 3Q1CA 3D9RA 3LT9A 4XB5A 1QVF2 1NJI4 4Q53A 1N8R4 1QAKA 1DVDA 2W56B 3K0ZA 4J8TA 1FUWA 1UUWB 3LTCA 3S67A 2B24B 1ASKA 5FW5A 2Y74A 4WP5A 2C10A 3T8NA 4IT7A 4KFFA 3WMDA 3CCV3 3F7XA 3N8BA 3FH1A 3MG1A 1GS3A 3K63A 2YFLB 2KRTA 1ZX2A 1UI8A 3DZLA 2BNGA 4NREA 3ECFA 3LYGA 4FR9A 3WA2X 5CF1A 3N54B 4HKVB 1UI7A 4KVHA 4CCVA 2KCDA 3FCSB 3F8HA 1VQP3 1ROAA 2Z76A 1YVBI 4RNZA 3F40A 1QVG2 3FLJA 3T0UA 1WNHA 4AKYA 3GWRA 3NXJA 3KFQC 1GD3A 3LTAA 3OWSA 1YGEA 5LC6A 5IERA 1WTHA 2BO9B 1NB5I 4O2HA 1DYUA 3CXC2 1CEWI 2CW9A 3GZBA 3JUNA 4FMDA 3FG1A 3BB9A 5AI1A 1DMMA 3CCR3 1KC84 4L7KA 4OUQA 3ROBA 5FGOA 1IT7A 1OGZA 3OXAA 4XBYA 3G16A 5STDA 3GRDA 1QJGA 1W7CA 1K41A 4HBRA 5D82A 1S723 1K734 3NBJA 3EN8A 3IJEB 2LYXA 3DGLA 1VQO3 1GY5A 1JRQA 3F14A 1W2ZA 3PCRA 3DM8A 4WYKA 5IW9A 1VZZA 4HVNA 3PXMA 4I4KA 5KP4A 3DGMA 2BHMA 3NHXA 1STFI 2XH9A 2KXGA 3LT8A 4WWUC 3V98A 3X3XA 4PEJA 4K1UA 1JB5A 1U8CB 2D42A 1TFOA 2V1LA 3NM7A 1IVXA 3DY5A 5AIFA 3MYTA 4H3UA 2GBXB 4N6UA 3UL6A 1KQS2 4WFOA 2RFRA 1UUVB 4XDWA 4U13A 1OCVA 4HM5B 5DRVA 1YHQ3 3FZWA 3CC73 1IDPA 1M9GA 2F86B 4XM4A 4STDA 2XRXB 3STDA 4BTXA 2WOFA 2BMQB 3EC9A 1OGXA 3JUMA 4HM7B 2XGNA 4MMXB 1Q864 3MG3A 4WHAA 1M1XB 3EX9A 1CYVA 1SIHA 3SXXA 2PNCA 4GL6A 4HJLB 1OUNA 4R1KA 1HKXA 1SPUA 5IF6A 3H51A 4EXRA 1YIJ3 1Q814 1ROVA 2ML5A 3Q90A 1W6CA 1IQYA 3HK4A 4XBXA 2XEPA 4N6OB 1JB2A 2RSXA 1STDA 3NUVA 3G713 2BT3A 3MPHA 3LH4A 2OOVA 2ZDJA 1NDOB 3NX0A 1K8A4 2HMOB 3CCS3 3MG2A 1VQM3 2Z77A 3CCM3 3LXUX 2CG1A 1N5PA 1OHOA 5ELUA 2CWUA 2W9PA 3PYJA 3EE1A 3E99A 1W5ZA 5G2GA 2OCTA 4RZMA 2P38A 5D83A 2W04A 5IENA 3I563 1O7GB 3WA3A 1SIIA 4HM3B 1A90A 4R9KA 4K90B 4AKZA 3S29A 5IG0A 3FF0A 5JPUA 1KD14 1VQ73 2CKFB 4R9LA 2W2CA 4N6LA 3CCL3 1LVNA 1OF5A 3UNLA 2CHCA 2HMMB 1JV2B 2B1XB 2K0MA 2M7OA 2IUJA 2W0QA 1JB4A 3S27A 1US1A 3HZPA 4LEHA 1ULJB 5A0OB 3BNBA 3CCQ3 3KSPA 3FG4A 3CPOA 2HMLB 2HMNB 4N6NB 1NU3A 3BNDA 3JVCA 1W00A 3NQYA 3NM2A 1IT8A 3FGYA 3G4S3 3KZTA 1Q42A 1QAFA 5EVHA 1DVCA 4OVMA 4H61A 5KP1A 1Q40A 2UX0A 2K54A 4LGQA 1W6YA 3B4OA 5IG3A 3SOYA 3HIIA 3NBBA 1IU7A 2FGTA 1AVKA 4R80A 5CXOA 1OHPA 3BLZA 2YX9A 1VQ53 2W9QA 4FCZA 4JRFA 3FG3A 3TDGA 2F98A 2CIUA 3HX8A 3RGRA 1PU4A 1DMNA 1GD4A 1Q40B 1RJOA 1MOLA 1E3RA 1IV7A 1OHSA 1O7MB 4MMYB 4RBNA 5EEOA 5KP3A 3DGOA 1E3VA 1YJ93 3U1WA 4CDLA 2XF3A 4OK0A 2MF7A 2SBLA 1VQK3 1YI23 3EQQB 2WGOA 2CFGA 4N3VA 2O3OA 2INXA 1VQ63 3O8YA 2Z6BA 3KSED 2OWPA 3IPTA 1N5HA 5AIIA 3DMCA 2P0MA 2FXTA 4HM6B 5DREA 1OH0A 1S5AA 5IG4A 3UJMA 3SX1A 4K61A 1EKMA 4RNYA 1HU9A 5IEPA 3LZAA 2D1WA 4FCJA 3X3ZA 4EYCA 1W2B2 5ELJA 4G1MB 5CF2A 3OV4A 4KFEA 1K28A 3F7SA 3IMAB 1RN7A 4FMBA 2Y73A 2IMJA 3LOYA 3EJVA 2E2VA 4O8SA 5LC7A 1UW1A 1JN5A 1Y4KA 3KIIA 3L0RA 1A2KA 4WYKB 1BUQA 1GYBA 1DMQA 2XSOB 1VQ83 2GU3A 3UL5A 1TUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIA A;  3MKI A;  2R4I A;  3NV0 A;  4HZB B;  3JUQ A;  3G0K A;  3I0Y A;  3F9S A;  2RGQ A;  3MSO A;  1EG9 B;  2GBW B;  4HM4 B;  1AR0 A;  1TP6 A;  5IEO A;  2STD A;  8CHO A;  1NWW A;  3S5C A;  2XSH B;  5JPP A;  4HM1 B;  3NBR A;  3GZX B;  3EN1 B;  6STD A;  3K7C A;  3JUO A;  5AIG A;  2A15 A;  3OX9 A;  1W02 A;  3T8U A;  3F8X A;  3GZR A;  1QMA A;  3B4P A;  2I9W A;  1W01 A;  2HMJ B;  1OF5 B;  3SOA A;  5AEW B;  1E97 A;  1JKG A;  2QGU A;  3CNX A;  7STD A;  3VSY A;  5HGR A;  2Z7A A;  3EBY A;  5IG5 A;  4HZ9 B;  1JKG B;  3SED A;  5CLK A;  2YFI B;  1O7P B;  3FF2 A;  3B8L A;  1O7W B;  4MJD A;  1CQS A;  2RCD A;  3RGA A;  4ORL A;  4HM8 B;  3EF8 A;  3KE7 A;  2GXF A;  2YFJ B;  3JUP A;  4L8O A;  5BXQ A;  1O7N B;  3OWY A;  5BVB A;  3CU3 A;  2GEX A;  3A76 A;  3GZY B;  4HM2 B;  4K1V A;  4FCM A;  4XDV A;  1ZO2 A;  4L8P A;  4XBT A;  1SJW A;  3MHE A;  3DUK A;  4X2H A;  1ULI B;  4X2O A;  1JN5 B;  1WQL B;  3OWU A;  3EBT A;  5D81 A;  3KKG A;  3FKA A;  2HMK B;  3DXO A;  2F99 A;  3G8Z A;  3ER7 A;  3NV0 B;  3VGN A;  1GY6 A;  1Z1S A;  2JQ5 A;  2BMR B;  3M8C A;  2GEY A;  4HM0 B;  2BMO B;  3FSD A;  1OPY A;  3H3H A;  5CK6 A;  3B7C A;  5AEU B;  1U5O A;  5AIH A;  1ISK A;  1C7H A;  2QIY A;  4GB5 A;  3EHC A;  1GY7 A;  2XR8 B;  1O7H B;  4J9A A;  1EA2 A;  2PZV A;  3CNM A;  4LMI A;  5TGN A;  3D9R A;  4XB5 A;  4Q53 A;  3K0Z A;  4J8T A;  1UUW B;  2B24 B;  1ASK A;  5FW5 A;  4WP5 A;  3T8N A;  3WMD A;  3F7X A;  3FH1 A;  3MG1 A;  1GS3 A;  2YFL B;  1ZX2 A;  3DZL A;  2BNG A;  3ECF A;  3LYG A;  5CF1 A;  4HKV B;  4KVH A;  3F8H A;  2Z76 A;  3F40 A;  3FLJ A;  3GWR A;  3NXJ A;  3OWS A;  5IER A;  3GZB A;  3JUN A;  3BB9 A;  5AI1 A;  1DMM A;  4L7K A;  4OUQ A;  3ROB A;  1OGZ A;  3OXA A;  4XBY A;  3G16 A;  5STD A;  3GRD A;  1QJG A;  1K41 A;  5D82 A;  3EN8 A;  1GY5 A;  3F14 A;  4WYK A;  3DM8 A;  1VZZ A;  4HVN A;  4I4K A;  5KP4 A;  3NHX A;  4WWU C;  4PEJ A;  4K1U A;  1JB5 A;  5AIF A;  3MYT A;  4H3U A;  2GBX B;  2RFR A;  1UUV B;  4XDW A;  4U13 A;  1OCV A;  4HM5 B;  5DRV A;  3FZW A;  1IDP A;  2F86 B;  4XM4 A;  4STD A;  2XRX B;  3STD A;  2BMQ B;  3EC9 A;  1OGX A;  3JUM A;  4HM7 B;  3MG3 A;  3EX9 A;  4HJL B;  1OUN A;  4R1K A;  1HKX A;  5IF6 A;  3H51 A;  3Q90 A;  3HK4 A;  4XBX A;  1JB2 A;  1STD A;  3NUV A;  1NDO B;  2HMO B;  3MG2 A;  2Z77 A;  1OHO A;  3E99 A;  5G2G A;  4RZM A;  5IEN A;  5D83 A;  1O7G B;  4HM3 B;  4R9K A;  5IG0 A;  3FF0 A;  5JPU A;  2CKF B;  4R9L A;  2W2C A;  3UNL A;  1OF5 A;  2CHC A;  2HMM B;  2B1X B;  1JB4 A;  3HZP A;  4LEH A;  1ULJ B;  3KSP A;  3CPO A;  2HML B;  2HMN B;  1NU3 A;  1W00 A;  3NM2 A;  3FGY A;  3KZT A;  1Q42 A;  5EVH A;  4OVM A;  5KP1 A;  1Q40 A;  2UX0 A;  2K54 A;  4LGQ A;  1W6Y A;  3B4O A;  5IG3 A;  3SOY A;  5CXO A;  1OHP A;  3BLZ A;  2F98 A;  3HX8 A;  3RGR A;  1DMN A;  1Q40 B;  5KP3 A;  1OHS A;  1E3R A;  1O7M B;  1E3V A;  4CDL A;  3EQQ B;  4N3V A;  2INX A;  2OWP A;  3IPT A;  5AII A;  3DMC A;  4HM6 B;  5DRE A;  1OH0 A;  1S5A A;  5IG4 A;  3UJM A;  5IEP A;  3LZA A;  4FCJ A;  5CF2 A;  3OV4 A;  3F7S A;  2IMJ A;  3EJV A;  1JN5 A;  4WYK B;  1BUQ A;  1A2K A;  1GYB A;  1DMQ A;  2XSO B;  1TUH A; 
#chains in the Genus database with same CATH topology
 3SYU A;  1VQ9 3;  3S28 A;  1UCK A;  2CC3 A;  1BRS A;  3EB8 A;  4LZI A;  2OQE C;  4IIA A;  4O02 B;  3I55 3;  3VF1 A;  3MKI A;  2CFD A;  4EV2 A;  2XFT A;  3V92 A;  1ZS7 A;  1B27 A;  2R4I A;  3NV0 A;  1BSB A;  7GSP A;  1HYF A;  4HZB B;  3UB1 A;  3ZG5 A;  3CPW 2;  1A67 A;  3WOD G;  2CG0 A;  3JUQ A;  1IQ8 A;  2CX1 A;  3AMO A;  1L5G B;  3G0K A;  2QEX 3;  3I0Y A;  4MMZ B;  2XGL A;  2RGQ A;  3F9S A;  1BAN A;  3MSO A;  4JF8 A;  1RGE A;  1EG9 B;  1GOY A;  1V57 A;  3RDE A;  3WDG B;  4KZ1 A;  1UUG B;  2GBW B;  1WMP A;  4HM4 B;  1JZD A;  1AR0 A;  1TP6 A;  5IEO A;  1BUJ A;  1Q7Y 4;  2STD A;  1MNL A;  8CHO A;  1NWW A;  3J7Y d;  1BNF A;  3S5C A;  4AEQ A;  5HOH A;  2UUG C;  1B2Z A;  2MC8 A;  1M1K 4;  2XSH B;  3AHS A;  1T3B A;  5JPP A;  4LYL B;  2OQE A;  3ALA A;  4HM1 B;  3Q3F A;  1BNI A;  1EQK A;  1TFK A;  3NBR A;  3GZX B;  1RNB A;  3EN1 B;  6STD A;  1DET A;  3K7C A;  2ZL8 A;  1N8Q A;  1BOX A;  3D4A A;  3CC2 3;  1YIT 3;  3JUO A;  5AIG A;  2AAD A;  1T5Y A;  2A15 A;  2CK3 H;  1D6Z A;  1X1Y A;  1RNT A;  5I97 A;  1FA3 A;  4BU4 A;  1BNR A;  2OTL 3;  2P0X A;  1EEJ A;  1I3I A;  3BNE A;  3K9M C;  4EC6 A;  1R4C A;  1B20 A;  3OX9 A;  1OAC A;  2W56 A;  3AGN A;  1W02 A;  2P05 A;  3T8U A;  4GHO A;  1D6Y A;  3F8X A;  3GZR A;  1X1W A;  2IYJ A;  4HAA A;  4IPB A;  5AYS C;  1QMA A;  3WOE B;  3B4P A;  2I9W A;  1W01 A;  2HMJ B;  3MWZ A;  1OF5 B;  3Q2P A;  4I5Q A;  3SOA A;  5AEW B;  3CD6 3;  3KN4 A;  4ILF A;  3PS8 A;  2O9U X;  2XFS A;  1BSE A;  1E97 A;  1D6U A;  1LXE A;  2IY2 A;  1GOV A;  1IK3 A;  2CWV A;  1JKG A;  1M90 4;  2QGU A;  3ZG0 A;  2IUK A;  4O3V A;  2WOH A;  3GSP A;  4CPK A;  1IVW A;  3CNX A;  4GSP A;  7STD A;  3K5T A;  3V99 A;  2WGQ A;  5M1A A;  4QWT A;  3A5E A;  3VSY A;  5HGR A;  2CFW A;  2Z7A A;  3EBY A;  5IG5 A;  1Q82 4;  3LML A;  4HZ9 B;  1JKG B;  4J5G A;  1BSA A;  3SED A;  5CLK A;  2YFI B;  1O7P B;  3N9H A;  1RHL A;  1RRH A;  2GU1 A;  4CJN A;  3FF2 A;  3B8L A;  1O7W B;  1KSI A;  1AV4 A;  1TIJ A;  4MJD A;  1FYS A;  3HI7 A;  5EQL A;  1W4N A;  1CQS A;  2RCD A;  3ZFZ A;  3RGA A;  2QA4 3;  2CX0 A;  3AGO A;  4ORL A;  4HM8 B;  4KFD A;  3EF8 A;  3KE7 A;  1G96 A;  1B21 A;  2GXF A;  3SVA A;  4DKI A;  4LSO A;  2YFJ B;  2CFK A;  1I0X A;  1LNH A;  3JUP A;  3CCU 3;  3HIG A;  4L8O A;  5BXQ A;  3CCE 3;  3PCS A;  2CFL A;  2KF3 A;  4ZM8 A;  1Q7H A;  1VQN 3;  1FGR A;  1O7N B;  4EBG A;  3OWY A;  3PZW A;  3X41 A;  2ML6 A;  5BVB A;  5KP3 A;  1PFP A;  3LTB A;  1T2I A;  2GEX A;  3CU3 A;  3X42 A;  2W03 A;  3A76 A;  3CMA 3;  1YGW A;  1I2F A;  2E2T A;  3X40 A;  3GZY B;  1K9M 4;  4HM2 B;  1MGR A;  1BRH A;  4K1V A;  1KWI A;  1JJ2 2;  2L1S A;  4FCM A;  4XDV A;  4N6M A;  1YNV X;  1RLS A;  1ZO2 A;  4L8P A;  4XBT A;  1TRQ A;  3U97 A;  1UCL A;  1VQQ A;  2SAR A;  3CME 3;  1SJW A;  1CYU A;  3MHE A;  2R41 A;  1MWS A;  3PGB A;  3DUK A;  4X2H A;  1RMS A;  3G6E 3;  3BIR A;  1ULI B;  4TX4 A;  9RNT A;  4X2O A;  1NO3 A;  3QK9 A;  1JN5 B;  2H0H A;  1B2S A;  1IYY A;  1YJW 3;  1BRN L;  1RRL A;  1RGH A;  3DGN A;  1FGT A;  4HYZ A;  3WOF B;  3QRD A;  1F8N A;  1JNQ A;  1FUT A;  1WQL B;  4N6T A;  1TU5 A;  3X3Y A;  2K3D A;  1WMN A;  1FGO A;  1BRJ A;  3OWU A;  1BNG A;  4FMA A;  1PY3 A;  3EBT A;  1IVV A;  1RGL A;  3KKG A;  5D81 A;  2E2U A;  3NQZ A;  3FKA A;  2OOV C;  2OTJ 3;  2HMK B;  3DXO A;  1NB3 I;  2F99 A;  8RNT A;  2L4V A;  3G8Z A;  4BTW A;  2Q07 A;  3ER7 A;  1LOW A;  3URP A;  1SQW A;  1B2M A;  1WMO A;  2CWT A;  3NV0 B;  3DGY A;  3VGN A;  1GY6 A;  1Z1S A;  1YJN 3;  3GAX A;  2JQ5 A;  5JBS A;  2BMR B;  3AMO B;  3M8C A;  3BU4 A;  1DE3 A;  1RGF A;  2FNQ A;  1MWT A;  1IV9 A;  1V74 A;  1QAL A;  1MWU A;  2C11 A;  2GEY A;  2IA7 A;  2W6J H;  4FMC A;  2BMO B;  4HM0 B;  4MEI A;  1BRI A;  1IVU A;  3FSD A;  3D5I A;  3LTD A;  5AYR B;  2P09 A;  1OPY A;  4EV5 A;  2AAE A;  3H3H A;  5CK6 A;  2LQV A;  1N9J A;  3B7C A;  2UGI A;  1BAO A;  2WO0 A;  5AEU B;  1U5O A;  5AIH A;  1ISK A;  2HOH A;  1AQZ A;  1C7H A;  1G02 A;  1N9E A;  3D3L A;  4BIR A;  4R4K A;  4NHF A;  1LNI A;  1LOX A;  3SLU A;  2QIY A;  4GB5 A;  3EHC A;  4BTY A;  1GY7 A;  2XR8 B;  1W6G A;  1J2B A;  1O7H B;  1A2V A;  1AVL A;  1UCJ A;  4J9A A;  1EA2 A;  1RSN A;  1FGQ A;  2PZV A;  3BNC A;  1VQL 3;  1FGM A;  1UDI I;  5G1K A;  2CH9 A;  3OW2 2;  3CC4 3;  3CNM A;  4LMI A;  1BRG A;  1R4Y A;  1IQX A;  5TGN A;  1RKY A;  3CCJ 3;  1VQ4 3;  2JDI H;  3Q1C A;  3D9R A;  3LT9 A;  4XB5 A;  1QVF 2;  1NJI 4;  4Q53 A;  3AHW A;  1N8R 4;  3DH2 A;  1QAK A;  1DVD A;  1LQM B;  2W56 B;  1RGK A;  3K0Z A;  4J8T A;  1UUW B;  3LTC A;  3S67 A;  1FUW A;  2B24 B;  1ASK A;  2H0G A;  5FW5 A;  2Y74 A;  4WP5 A;  2C10 A;  3T8N A;  4IT7 A;  2KF6 A;  1BVI A;  4KFF A;  3F7X A;  1G0T A;  3WMD A;  1UGH I;  3CCV 3;  3N8B A;  3FH1 A;  3MG1 A;  1GS3 A;  3K63 A;  2YFL B;  1FW7 A;  2KRT A;  1ZX2 A;  1UI8 A;  3DZL A;  2BNG A;  4NRE A;  1UCI A;  3ECF A;  3LYG A;  1X1X A;  4FR9 A;  3WA2 X;  5CF1 A;  1GMR A;  3N54 B;  4HKV B;  1UI7 A;  4KVH A;  4CCV A;  2KCD A;  3FCS B;  3F8H A;  1VQP 3;  1A2P A;  1RGG A;  1ROA A;  1RGC A;  5BU4 A;  1TJD A;  2Z76 A;  1YVB I;  4RNZ A;  3F40 A;  1QVG 2;  3FLJ A;  3T0U A;  1WNH A;  4AKY A;  3GWR A;  3NXJ A;  3KFQ C;  1GD3 A;  1B2U A;  3LTA A;  3OWS A;  1YGE A;  5LC6 A;  1GOU A;  5IER A;  1WTH A;  2BO9 B;  1NB5 I;  2F4Y A;  4O2H A;  1HZ1 A;  1DYU A;  3CXC 2;  1CEW I;  1LQG C;  1I3F A;  2CW9 A;  3GZB A;  3JUN A;  4FMD A;  3FG1 A;  1BNS A;  1ZGX A;  3BB9 A;  5AI1 A;  1DMM A;  3CCR 3;  1KC8 4;  4L7K A;  4OUQ A;  3ROB A;  5FGO A;  1IT7 A;  1OGZ A;  3OXA A;  4XBY A;  3G16 A;  5STD A;  3GRD A;  1QJG A;  1W7C A;  1K41 A;  1SAR A;  1B3S A;  4HBR A;  5D82 A;  1S72 3;  3NBJ A;  1K73 4;  3EN8 A;  3IJE B;  2LYX A;  3DGL A;  4BL2 A;  5BIR A;  1VQO 3;  1FUS A;  1GY5 A;  1JBR A;  1JRQ A;  2BIR A;  3F14 A;  1W2Z A;  3PCR A;  3DM8 A;  4WYK A;  5IW9 A;  1VZZ A;  4HVN A;  1PYL A;  3PXM A;  4I4K A;  5KP4 A;  3DGM A;  2BHM A;  1BSD A;  1STF I;  2GSP A;  3NHX A;  2XH9 A;  2KXG A;  3LT8 A;  4WWU C;  3V98 A;  3X3X A;  4PEJ A;  2F5M A;  4K1U A;  1JB5 A;  1U8C B;  2D42 A;  1TFO A;  2V1L A;  1X1U A;  3NM7 A;  6RNT A;  1IVX A;  3DY5 A;  5AIF A;  3MYT A;  4H3U A;  2GBX B;  6GSP A;  4RNT A;  4N6U A;  3UL6 A;  1KQS 2;  4WFO A;  2RFR A;  4EW5 A;  1UUV B;  4XDW A;  4U13 A;  1OCV A;  4HM5 B;  5DRV A;  1YHQ 3;  3FZW A;  3CC7 3;  1IDP A;  1M9G A;  2F86 B;  4XM4 A;  4STD A;  2XRX B;  3STD A;  4BTX A;  2ZA4 A;  2WOF A;  2BMQ B;  3EC9 A;  1OGX A;  3JUM A;  4HM7 B;  2XGN A;  4MMX B;  1Q86 4;  3MG3 A;  4WHA A;  4NPB A;  1M1X B;  3EX9 A;  1CYV A;  1SIH A;  3D79 A;  3SXX A;  2PNC A;  4GL6 A;  2J8X B;  4HJL B;  1OUN A;  4R1K A;  1HKX A;  1SPU A;  5IF6 A;  4J5K A;  3H51 A;  4EXR A;  1TRP A;  1YIJ 3;  1Q81 4;  1ROV A;  2ML5 A;  3Q90 A;  1W6C A;  1IQY A;  3HK4 A;  4XBX A;  1JBS A;  2XEP A;  3WHO A;  1LOV A;  4N6O B;  1JB2 A;  2BU4 A;  2RSX A;  1STD A;  1AY7 A;  3NUV A;  2BT3 A;  3MPH A;  3G71 3;  3LH4 A;  1UGI A;  2ZDJ A;  1NDO B;  2OOV A;  3NX0 A;  1K8A 4;  2HMO B;  3CCS 3;  3MG2 A;  1VQM 3;  2Z77 A;  3CCM 3;  3LXU X;  2CG1 A;  1N5P A;  1OHO A;  5ELU A;  5M19 A;  1MWR A;  2CWU A;  1GSP A;  1TTO A;  2W9P A;  3PYJ A;  3EE1 A;  3E99 A;  1I2G A;  1W5Z A;  5G2G A;  2OCT A;  4RZM A;  2P38 A;  2RNT A;  2W04 A;  5D83 A;  5IEN A;  3I56 3;  1O7G B;  2H0I A;  3D5G A;  3WA3 A;  1SII A;  4HM3 B;  1A90 A;  1BNJ A;  2KF5 A;  4K90 B;  4R9K A;  3S29 A;  4AKZ A;  1RTU A;  5IG0 A;  3FF0 A;  5JPU A;  1KD1 4;  1VQ7 3;  2CKF B;  4KT3 B;  4R9L A;  2W2C A;  4N6L A;  1BRK A;  3CCL 3;  1LVN A;  1OF5 A;  3UNL A;  2CHC A;  2HMM B;  1JV2 B;  2RBI A;  2B1X B;  4HOH A;  2K0M A;  1JZO A;  2M7O A;  1NNV A;  1BGS A;  5M18 A;  2IUJ A;  2W0Q A;  1JB4 A;  3S27 A;  1US1 A;  3HZP A;  4LEH A;  1ULJ B;  5A0O B;  3BNB A;  3CCQ 3;  3KSP A;  1RCL A;  1EUI C;  3CPO A;  3FG4 A;  2HML B;  2HMN B;  4N6N B;  1NU3 A;  3BND A;  3JVC A;  1W00 A;  3HOH A;  3NQY A;  3NM2 A;  1IT8 A;  3FGY A;  3G4S 3;  3KZT A;  1Q42 A;  1QAF A;  1FZU A;  5EVH A;  1DVC A;  4OVM A;  4H61 A;  5KP1 A;  1Q40 A;  2UX0 A;  1BNE A;  5IG4 A;  2K54 A;  4LGQ A;  1RCK A;  1W6Y A;  3B4O A;  5IG3 A;  3SOY A;  1C54 A;  3HII A;  3NBB A;  1IU7 A;  2F56 A;  1AVK A;  2FGT A;  1RN1 A;  2KAA A;  4R80 A;  5CXO A;  1OHP A;  3BLZ A;  2YX9 A;  1VQ5 3;  2W9Q A;  1I70 A;  1LOY A;  1T2H A;  3FG3 A;  4FCZ A;  2F98 A;  4JRF A;  1GMP A;  2CIU A;  3TDG A;  3HX8 A;  3RGR A;  1PU4 A;  1DMN A;  1GD4 A;  1RJO A;  1Q40 B;  1MOL A;  1E3R A;  1IV7 A;  1OHS A;  1O7M B;  1MGW A;  4MMY B;  4N6V 0;  4RBN A;  5EEO A;  3DGO A;  1E3V A;  1YJ9 3;  3U1W A;  4CDL A;  2XF3 A;  4OK0 A;  2MF7 A;  2SBL A;  2ZHX B;  1VQK 3;  1YI2 3;  3EQQ B;  2WGO A;  2CFG A;  4N3V A;  2O3O A;  2INX A;  1VQ6 3;  3O8Y A;  2Z6B A;  3KSE D;  2OWP A;  3IPT A;  1N5H A;  1YVS A;  3KCH A;  5AII A;  1V58 A;  3DMC A;  2P0M A;  2F5W A;  1Q9E A;  1I8V A;  2FXT A;  2C4B A;  1LRA A;  1RN4 A;  1OH0 A;  1S5A A;  4HM6 B;  1BSC A;  5DRE A;  3UJM A;  3WR2 A;  1CH0 A;  1I2E A;  5G1L A;  3SX1 A;  4K61 A;  1EKM A;  4RNY A;  1HU9 A;  7RNT A;  5IEP A;  3LZA A;  2D1W A;  4FCJ A;  3X3Z A;  4EYC A;  1W2B 2;  5GSP A;  5ELJ A;  4G1M B;  5CF2 A;  3OV4 A;  1BU4 A;  4KFE A;  1K28 A;  3F7S A;  3IMA B;  3RNT A;  1RN7 A;  1GMQ A;  4FMB A;  2Y73 A;  1RGA A;  2IMJ A;  3LOY A;  3EJV A;  2E2V A;  4O8S A;  5LC7 A;  1UW1 A;  1JN5 A;  1Y4K A;  2KF4 A;  3KII A;  1A2K A;  3L0R A;  4WYK B;  1BUQ A;  1GYB A;  1DMQ A;  2XSO B;  1B2X A;  1VQ8 3;  5RNT A;  1JBT A;  4BL3 A;  1BIR A;  2GU3 A;  3UL5 A;  1RDS A;  1I0V A;  1TUH A; 
#chains in the Genus database with same CATH homology
 1VQ9 3;  3S28 A;  2CC3 A;  3EB8 A;  4LZI A;  2OQE C;  4IIA A;  4O02 B;  3I55 3;  3VF1 A;  3MKI A;  2CFD A;  4EV2 A;  2XFT A;  3V92 A;  2R4I A;  3NV0 A;  3UB1 A;  4HZB B;  3CPW 2;  1A67 A;  3WOD G;  2CG0 A;  3JUQ A;  1IQ8 A;  1L5G B;  3AMO A;  3G0K A;  2QEX 3;  3I0Y A;  4MMZ B;  2XGL A;  2RGQ A;  3F9S A;  3MSO A;  4JF8 A;  1EG9 B;  3RDE A;  3WDG B;  4KZ1 A;  2GBW B;  1WMP A;  4HM4 B;  1AR0 A;  1TP6 A;  5IEO A;  1Q7Y 4;  2STD A;  1MNL A;  8CHO A;  1NWW A;  3J7Y d;  3S5C A;  4AEQ A;  2MC8 A;  1M1K 4;  2XSH B;  5JPP A;  1EQK A;  2OQE A;  3ALA A;  4HM1 B;  1TFK A;  3NBR A;  3GZX B;  3EN1 B;  6STD A;  3K7C A;  2ZL8 A;  1N8Q A;  3CC2 3;  1YIT 3;  3JUO A;  5AIG A;  1T5Y A;  2A15 A;  2CK3 H;  1D6Z A;  5I97 A;  1FA3 A;  2OTL 3;  2P0X A;  3BNE A;  3K9M C;  4EC6 A;  1R4C A;  3OX9 A;  1OAC A;  2W56 A;  1W02 A;  2P05 A;  3T8U A;  1D6Y A;  3F8X A;  3GZR A;  4IPB A;  5AYS C;  1QMA A;  3WOE B;  3B4P A;  2I9W A;  1W01 A;  2HMJ B;  3MWZ A;  1OF5 B;  3Q2P A;  3SOA A;  5AEW B;  3CD6 3;  3KN4 A;  3PS8 A;  2O9U X;  2XFS A;  1E97 A;  1D6U A;  1LXE A;  1IK3 A;  2CWV A;  1JKG A;  1M90 4;  2QGU A;  2IUK A;  4O3V A;  2WOH A;  1IVW A;  3CNX A;  7STD A;  3K5T A;  3V99 A;  2WGQ A;  4QWT A;  3VSY A;  5HGR A;  2CFW A;  2Z7A A;  3EBY A;  5IG5 A;  1Q82 4;  3LML A;  4HZ9 B;  1JKG B;  3SED A;  5CLK A;  2YFI B;  1O7P B;  3N9H A;  1RRH A;  2GU1 A;  3FF2 A;  3B8L A;  1O7W B;  1KSI A;  1AV4 A;  1TIJ A;  4MJD A;  3HI7 A;  5EQL A;  1W4N A;  1CQS A;  2RCD A;  3RGA A;  2QA4 3;  4ORL A;  4HM8 B;  4KFD A;  3EF8 A;  3KE7 A;  1G96 A;  2GXF A;  3SVA A;  4LSO A;  2YFJ B;  2CFK A;  1LNH A;  3JUP A;  3CCU 3;  3HIG A;  4L8O A;  5BXQ A;  3CCE 3;  3PCS A;  2CFL A;  4ZM8 A;  1VQN 3;  1FGR A;  1O7N B;  4EBG A;  3OWY A;  3PZW A;  3X41 A;  2ML6 A;  5BVB A;  1PFP A;  3LTB A;  3CU3 A;  2GEX A;  3X42 A;  2W03 A;  3A76 A;  3CMA 3;  2E2T A;  3X40 A;  3GZY B;  1K9M 4;  4HM2 B;  4K1V A;  1KWI A;  1JJ2 2;  4FCM A;  4XDV A;  4N6M A;  1ZO2 A;  4L8P A;  4XBT A;  3U97 A;  3CME 3;  1CYU A;  1SJW A;  3MHE A;  3PGB A;  3DUK A;  4X2H A;  3G6E 3;  1ULI B;  4TX4 A;  4X2O A;  1NO3 A;  3QK9 A;  1JN5 B;  1YJW 3;  1RRL A;  3DGN A;  1FGT A;  4HYZ A;  3WOF B;  3QRD A;  1F8N A;  1JNQ A;  1WQL B;  4N6T A;  1TU5 A;  3X3Y A;  1WMN A;  1FGO A;  3OWU A;  4FMA A;  3EBT A;  1IVV A;  5D81 A;  3KKG A;  2E2U A;  3NQZ A;  3FKA A;  2OOV C;  2OTJ 3;  2HMK B;  3DXO A;  1NB3 I;  2F99 A;  2L4V A;  3G8Z A;  4BTW A;  2Q07 A;  3ER7 A;  1SQW A;  1WMO A;  2CWT A;  3NV0 B;  3VGN A;  1GY6 A;  1Z1S A;  1YJN 3;  3GAX A;  2JQ5 A;  5JBS A;  2BMR B;  3AMO B;  3M8C A;  2FNQ A;  1V74 A;  1IV9 A;  2GEY A;  1QAL A;  2IA7 A;  2W6J H;  2C11 A;  4FMC A;  4HM0 B;  4MEI A;  2BMO B;  4N6V 0;  5AYR B;  1IVU A;  3FSD A;  3LTD A;  2P09 A;  1OPY A;  4EV5 A;  3H3H A;  5CK6 A;  2LQV A;  1N9J A;  3B7C A;  2WO0 A;  5AEU B;  1U5O A;  5AIH A;  1ISK A;  1C7H A;  1N9E A;  3D3L A;  4R4K A;  4NHF A;  1LOX A;  3SLU A;  2QIY A;  4GB5 A;  3EHC A;  4BTY A;  1GY7 A;  2XR8 B;  1W6G A;  1J2B A;  1O7H B;  1A2V A;  1AVL A;  4J9A A;  1EA2 A;  1FGQ A;  2PZV A;  3BNC A;  1VQL 3;  1FGM A;  3OW2 2;  2CH9 A;  3CC4 3;  3CNM A;  4LMI A;  3CCJ 3;  1IQX A;  5TGN A;  1RKY A;  1VQ4 3;  2JDI H;  3Q1C A;  3D9R A;  3LT9 A;  4XB5 A;  1QVF 2;  1NJI 4;  4Q53 A;  1N8R 4;  1QAK A;  1DVD A;  2W56 B;  3K0Z A;  4J8T A;  1FUW A;  1UUW B;  3LTC A;  3S67 A;  2B24 B;  1ASK A;  5FW5 A;  2Y74 A;  4WP5 A;  2C10 A;  3T8N A;  4IT7 A;  4KFF A;  3WMD A;  3CCV 3;  3F7X A;  3N8B A;  3FH1 A;  3MG1 A;  1GS3 A;  3K63 A;  2YFL B;  2KRT A;  1ZX2 A;  1UI8 A;  3DZL A;  2BNG A;  4NRE A;  3ECF A;  3LYG A;  4FR9 A;  3WA2 X;  5CF1 A;  3N54 B;  4HKV B;  1UI7 A;  4KVH A;  4CCV A;  2KCD A;  3FCS B;  3F8H A;  1VQP 3;  1ROA A;  2Z76 A;  1YVB I;  4RNZ A;  3F40 A;  1QVG 2;  3FLJ A;  3T0U A;  1WNH A;  4AKY A;  3GWR A;  3NXJ A;  3KFQ C;  1GD3 A;  3LTA A;  3OWS A;  1YGE A;  5LC6 A;  5IER A;  1WTH A;  2BO9 B;  1NB5 I;  4O2H A;  1DYU A;  3CXC 2;  1CEW I;  2CW9 A;  3GZB A;  3JUN A;  4FMD A;  3FG1 A;  3BB9 A;  5AI1 A;  1DMM A;  3CCR 3;  1KC8 4;  4L7K A;  4OUQ A;  3ROB A;  5FGO A;  1IT7 A;  1OGZ A;  3OXA A;  4XBY A;  3G16 A;  5STD A;  3GRD A;  1QJG A;  1W7C A;  1K41 A;  4HBR A;  5D82 A;  1S72 3;  1K73 4;  3NBJ A;  3EN8 A;  3IJE B;  2LYX A;  3DGL A;  1VQO 3;  1GY5 A;  1JRQ A;  3F14 A;  1W2Z A;  3PCR A;  3DM8 A;  4WYK A;  5IW9 A;  1VZZ A;  4HVN A;  3PXM A;  4I4K A;  5KP4 A;  3DGM A;  2BHM A;  3NHX A;  1STF I;  2XH9 A;  2KXG A;  3LT8 A;  4WWU C;  3V98 A;  3X3X A;  4PEJ A;  4K1U A;  1JB5 A;  1U8C B;  2D42 A;  1TFO A;  2V1L A;  3NM7 A;  1IVX A;  3DY5 A;  5AIF A;  3MYT A;  4H3U A;  2GBX B;  4N6U A;  3UL6 A;  1KQS 2;  4WFO A;  2RFR A;  1UUV B;  4XDW A;  4U13 A;  1OCV A;  4HM5 B;  5DRV A;  1YHQ 3;  3FZW A;  3CC7 3;  1IDP A;  1M9G A;  2F86 B;  4XM4 A;  4STD A;  2XRX B;  3STD A;  4BTX A;  2WOF A;  2BMQ B;  3EC9 A;  1OGX A;  3JUM A;  4HM7 B;  2XGN A;  4MMX B;  1Q86 4;  3MG3 A;  4WHA A;  1M1X B;  3EX9 A;  1CYV A;  1SIH A;  3SXX A;  2PNC A;  4GL6 A;  4HJL B;  1OUN A;  4R1K A;  1HKX A;  1SPU A;  5IF6 A;  3H51 A;  4EXR A;  1YIJ 3;  1Q81 4;  1ROV A;  2ML5 A;  3Q90 A;  1W6C A;  1IQY A;  3HK4 A;  4XBX A;  2XEP A;  4N6O B;  1JB2 A;  2RSX A;  1STD A;  3NUV A;  3G71 3;  2BT3 A;  3MPH A;  3LH4 A;  2OOV A;  2ZDJ A;  1NDO B;  3NX0 A;  1K8A 4;  2HMO B;  3CCS 3;  3MG2 A;  1VQM 3;  2Z77 A;  3CCM 3;  3LXU X;  2CG1 A;  1N5P A;  1OHO A;  5ELU A;  2CWU A;  2W9P A;  3PYJ A;  3EE1 A;  3E99 A;  1W5Z A;  5G2G A;  2OCT A;  4RZM A;  2P38 A;  5D83 A;  2W04 A;  5IEN A;  3I56 3;  1O7G B;  3WA3 A;  1SII A;  4HM3 B;  1A90 A;  4R9K A;  4K90 B;  4AKZ A;  3S29 A;  5IG0 A;  3FF0 A;  5JPU A;  1KD1 4;  1VQ7 3;  2CKF B;  4R9L A;  2W2C A;  4N6L A;  3CCL 3;  1LVN A;  1OF5 A;  3UNL A;  2CHC A;  2HMM B;  1JV2 B;  2B1X B;  2K0M A;  2M7O A;  2IUJ A;  2W0Q A;  1JB4 A;  3S27 A;  1US1 A;  3HZP A;  4LEH A;  1ULJ B;  5A0O B;  3BNB A;  3CCQ 3;  3KSP A;  3FG4 A;  3CPO A;  2HML B;  2HMN B;  4N6N B;  1NU3 A;  3BND A;  3JVC A;  1W00 A;  3NQY A;  3NM2 A;  1IT8 A;  3FGY A;  3G4S 3;  3KZT A;  1Q42 A;  1QAF A;  5EVH A;  1DVC A;  4OVM A;  4H61 A;  5KP1 A;  1Q40 A;  2UX0 A;  2K54 A;  4LGQ A;  1W6Y A;  3B4O A;  5IG3 A;  3SOY A;  3HII A;  3NBB A;  1IU7 A;  2FGT A;  1AVK A;  4R80 A;  5CXO A;  1OHP A;  3BLZ A;  2YX9 A;  1VQ5 3;  2W9Q A;  4FCZ A;  4JRF A;  3FG3 A;  3TDG A;  2F98 A;  2CIU A;  3HX8 A;  3RGR A;  1PU4 A;  1DMN A;  1GD4 A;  1Q40 B;  1RJO A;  1MOL A;  1E3R A;  1IV7 A;  1OHS A;  1O7M B;  4MMY B;  4RBN A;  5EEO A;  5KP3 A;  3DGO A;  1E3V A;  1YJ9 3;  3U1W A;  4CDL A;  2XF3 A;  4OK0 A;  2MF7 A;  2SBL A;  1VQK 3;  1YI2 3;  3EQQ B;  2WGO A;  2CFG A;  4N3V A;  2O3O A;  2INX A;  1VQ6 3;  3O8Y A;  2Z6B A;  3KSE D;  2OWP A;  3IPT A;  1N5H A;  5AII A;  3DMC A;  2P0M A;  2FXT A;  4HM6 B;  5DRE A;  1OH0 A;  1S5A A;  5IG4 A;  3UJM A;  3SX1 A;  4K61 A;  1EKM A;  4RNY A;  1HU9 A;  5IEP A;  3LZA A;  2D1W A;  4FCJ A;  3X3Z A;  4EYC A;  1W2B 2;  5ELJ A;  4G1M B;  5CF2 A;  3OV4 A;  4KFE A;  1K28 A;  3F7S A;  3IMA B;  1RN7 A;  4FMB A;  2Y73 A;  2IMJ A;  3LOY A;  3EJV A;  2E2V A;  4O8S A;  5LC7 A;  1UW1 A;  1JN5 A;  1Y4K A;  3KII A;  3L0R A;  1A2K A;  4WYK B;  1BUQ A;  1GYB A;  1DMQ A;  2XSO B;  1VQ8 3;  2GU3 A;  3UL5 A;  1TUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...