1JBRA

Crystal structure of the ribotoxin restrictocin and a 31-mer srd rna inhibitor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 5'-R(*GP*CP*GP*CP*UP*CP*CP*UP*CP*AP*GP*UP*AP*CP*GP*AP*GP*(A2
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbrA00
1DE3A 1LNIA 1BRNL 1JBRA 1Q9EA 2F5MA 1BRIA 1BRKA 1FW7A 1RNTA 1B2SA 1BNIA 1RGLA 2SARA 2KAAA 1CH0A 1SARA 4GHOA 4HAAA 1I2FA 3GSPA 2KF5A 1RGFA 1LOYA 1BIRA 1X1YA 1FZUA 2GSPA 1B21A 2RBIA 3BU4A 7RNTA 1I2EA 1BRSA 1BNFA 5HOHA 2BU4A 3RNTA 6RNTA 1BOXA 1BSBA 1RSNA 1RTUA 1UCIA 1BNJA 1BRHA 2KF3A 1RLSA 2F56A 5BIRA 1LOWA 1BSAA 1BNGA 5BU4A 3WHOA 3D5IA 7GSPA 1RDSA 3AGOA 3AHSA 1BRJA 1I3IA 1BSDA 1UCJA 1YVSA 5RNTA 1BANA 3AGNA 1RGEA 3SYUA 3D5GA 2C4BA 1B2MA 1GMPA 1DETA 1RNBA 3URPA 1BUJA 1TRQA 3DH2A 1RCKA 1ZGXA 1BAOA 4J5GA 1I2GA 1X1WA 2HOHA 1RGAA 1BRGA 1TRPA 1UCLA 1RGGA 1X1UA 4J5KA 2ZA4A 1BSCA 1GMQA 1I3FA 1AY7A 1UCKA 2F5WA 1MGRA 1T2IA 1GMRA 1BNEA 1RN1A 1RMSA 1YGWA 1I0XA 3AHWA 1JBTA 1B20A 1RHLA 1GOUA 1T2HA 2F4YA 9RNTA 1A2PA 3A5EA 1B2ZA 1C54A 3D4AA 4GSPA 1YNVX 1I0VA 1R4YA 1HZ1A 1I8VA 4BU4A 3WR2A 1AQZA 1BU4A 4BIRA 1HYFA 1BGSA 1BNRA 1RCLA 1FUSA 1B2UA 1B3SA 1GOVA 1RN4A 1FYSA 1TTOA 2RNTA 3BIRA 5GSPA 1GSPA 1LRAA 1PYLA 1X1XA 6GSPA 3HOHA 2KF4A 1B27A 3Q3FA 3KCHA 1RGKA 1FUTA 1BSEA 1I70A 1GOYA 1IYYA 2BIRA 1PY3A 1G02A 3DGYA 1B2XA 1RGCA 1LOVA 1RGHA 2KF6A 8RNTA 4HOHA 1BNSA 1BVIA 1MGWA 2AAEA 4RNTA 1JBSA 2AADA
chains in the Genus database with same CATH superfamily
1VQP3 1BRNL 4FR9A 1IVXA 1NNVA 2Q07A 3UNLA 1RNTA 1B2SA 3CCM3 1RGLA 1SARA 3H51A 3F40A 3WA2X 3Q1CA 2HMMB 2LYXA 5G2GA 2RCDA 5KP4A 1I2FA 2CKFB 3KZTA 3K5TA 4NREA 2YFIB 3KSED 3SOYA 3CCU3 2B1XB 1KSIA 1V74A 1EEJA 1FZUA 1X1YA 1B21A 2O3OA 3DGMA 1QVF2 3B4OA 3OWSA 1C7HA 1I2EA 3MSOA 5G1KA 4HJLB 5M1AA 1KQS2 3H3HA 2CWUA 4R9LA 4RBNA 3RNTA 1NU3A 4N6V0 5JBSA 2F98A 2H0GA 4I5QA 1YIJ3 1BRHA 5I97A 3OV4A 5BIRA 2CFWA 1W6CA 3HX8A 3KKGA 5AYSC 2INXA 3D5IA 5AIIA 2GU3A 2HMOB 2IMJA 2MC8A 4HM7B 3CXC2 1VQL3 3NV0B 4XBXA 1JKGB 2ML5A 4R80A 1YVSA 2BNGA 3X3XA 3SOAA 3MHEA 5RNTA 1QAFA 1IU7A 3SYUA 2CFKA 1LQGC 1KD14 1TJDA 2C4BA 2XEPA 1DETA 3GRDA 3K0ZA 1W6YA 4KFEA 2R4IA 5DREA 4WYKA 4LGQA 1LNHA 4CPKA 1JB4A 1GY6A 3EBTA 3GWRA 3BB9A 1VQQA 3Q90A 1G96A 1TRQA 1ZX2A 1M1K4 3S5CA 3B8LA 2W56B 3V98A 2Y73A 2K0MA 4HM0B 1I2GA 3LXUX 3CNXA 4N6NB 3DMCA 4N3VA 1BRGA 1TRPA 2GBXB 2IA7A 2WGQA 3IMAB 1FA3A 4K1UA 3FZWA 2OTL3 1K9M4 3ECFA 2ZA4A 5D81A 1OPYA 1WQLB 2K3DA 1UCKA 1AY7A 2F5WA 4EV2A 2A15A 1GMRA 1QAKA 3X3YA 4MMYB 3EE1A 3NQYA 3U97A 4KFFA 2SBLA 3F7XA 5IW9A 3G713 1ROVA 3PGBA 3ER7A 4KVHA 5CF2A 1JZOA 1B20A 1TFKA 1GOUA 1W00A 1YIT3 2F4YA 1CYVA 1Q40A 1M1XB 1EQKA 4K61A 2CG1A 4JF8A 1FUWA 4KT3B 3PCSA 4N6UA 4R9KA 1S5AA 3OWYA 2FXTA 3CCQ3 4TX4A 4OUQA 3WR2A 2XFSA 1BU4A 1JN5A 1HYFA 1BNRA 1ULJB 1WMOA 1VQK3 1B2UA 3GAXA 1IV7A 1B3SA 1OUNA 1FGTA 1FYSA 1TTOA 1RN4A 1Z1SA 3DZLA 1UUGB 1DYUA 3F14A 4RZMA 1RRHA 1IVUA 4L8PA 2M7OA 4CCVA 1Q814 3OW22 4IT7A 4L7KA 1D6YA 3L0RA 2YX9A 3JUPA 3KCHA 1RGKA 1FUTA 3QK9A 4WYKB 3O8YA 5G1LA 1VQO3 3EX9A 3PCRA 4AKZA 3FSDA 3PS8A 3EJVA 4HZ9B 4XBYA 5IENA 5D83A 1FGMA 4FMAA 1ASKA 1OCVA 3LT8A 4WHAA 2W6JH 1PY3A 1ZS7A 3NBRA 3DGYA 3CPW2 1RGCA 3F9SA 4STDA 4KFDA 1STFI 5KP3A 4LYLB 1GS3A 2BMQB 3BNBA 1K41A 4ILFA 3S67A 4EC6A 1O7WB 3SXXA 1DE3A 1IK3A 2XFTA 4XDWA 4H3UA 1WTHA 2SARA 2KAAA 1CH0A 3ROBA 3B4PA 4NHFA 4FMDA 2J8XB 3S27A 1MWTA 7STDA 1NB5I 1W6GA 4L8OA 1M9GA 3D9RA 3V99A 1AVLA 1LOYA 1RGFA 3HI7A 4MEIA 1ULIB 3MYTA 1VZZA 1O7HB 4XB5A 3LT9A 1OHOA 2V1LA 3EC9A 4GB5A 3FH1A 3CCL3 1CYUA 4OK0A 2W9QA 1W01A 1JN5B 3OXAA 4HM6B 1F8NA 4XM4A 1BOXA 1BSBA 1Y4KA 1OACA 1UCIA 1BNJA 2C10A 4MJDA 5CXOA 1YVBI 5CK6A 3MPHA 4N6MA 3CD63 2F99A 4BTXA 2BMRB 2XRXB 1BSAA 3WODG 1GD4A 1JRQA 4HM2B 4HZBB 1R4CA 2QIYA 3D3LA 1YHQ3 1M904 1WMPA 4MMXB 2XR8B 1TIJA 4RNYA 7GSPA 5AIHA 3N54B 2RSXA 3AHSA 3PXMA 1I3IA 1UCJA 1BSDA 4ZM8A 1VQ93 1BANA 3JUQA 1IV9A 3MKIA 2E2UA 1MWRA 1GMPA 4GL6A 2CK3H 3HK4A 2F86B 2CC3A 2MF7A 1BUJA 3G0KA 3WOEB 2P05A 5AI1A 3GZYB 3D79A 4J5GA 1YJ93 4LEHA 2HOHA 4IPBA 2Z6BA 1RGAA 1UCLA 1V58A 5A0OB 4QWTA 2HMNB 5ELUA 1X1UA 2K54A 1BSCA 2XGNA 5IG3A 2LQVA 1MGRA 1CQSA 2KCDA 3BNDA 4HM5B 4EW5A 1W02A 1ISKA 5HGRA 3ZG0A 3DGLA 1RN1A 3F8HA 1O7NB 4WFOA 3DGNA 1I0XA 3AHWA 4X2HA 1JBTA 1MNLA 3BNCA 4AEQA 3N8BA 9RNTA 2W03A 3PZWA 1YJN3 3GZRA 3SLUA 2FNQA 3V92A 4GSPA 1R4YA 3CCR3 1OGXA 1LOXA 2IY2A 3E99A 1HZ1A 1I8VA 1OHPA 4BU4A 5IERA 1AQZA 2W0QA 1PFPA 2CX0A 4BIRA 3HIGA 2Y74A 2CWTA 1FUSA 3LOYA 2RFRA 3FG3A 1GOVA 5STDA 2P0MA 1LQMB 1SJWA 1AR0A 3BIRA 1GSPA 3EF8A 1LXEA 3OWUA 1DMNA 1N9JA 1UI7A 3FG1A 1GYBA 1UGHI 1MOLA 2KF4A 5CF1A 5IEPA 4EXRA 1RJOA 2WGOA 1WNHA 1SPUA 3A76A 4XBTA 2KXGA 1GOYA 3AMOA 1EA2A 2QGUA 2CWVA 3CPOA 3VSYA 1K8A4 3UL6A 4N6LA 1UI8A 4CDLA 8CHOA 2HMJB 1LOVA 3KE7A 3CCJ3 4HOHA 1JB2A 2GU1A 4HM3B 1W2ZA 3RGAA 1O7GB 4G1MB 1Q9EA 2UUGC 1UUVB 4I4KA 2UGIA 1IDPA 2W9PA 1BNIA 1NO3A 5AEWB 2Z77A 4GHOA 2D1WA 1IVVA 1VQ63 4HAAA 1RRLA 3GSPA 1Q7HA 1BIRA 1JJ22 2CFLA 4CJNA 3MWZA 3BNEA 1FGOA 5AYRB 2GSPA 3DM8A 2RBIA 1EUIC 3NX0A 1D6ZA 5IF6A 3T0UA 3G8ZA 3G4S3 1SIIA 5AIFA 3K7CA 1NWWA 2BU4A 1RSNA 1SQWA 1N5PA 1RTUA 4RNZA 1PU4A 1O7MB 2XH9A 1IQYA 1RLSA 5BVBA 3KIIA 2ZL8A 3EBYA 1OGZA 3ALAA 4BL2A 1K734 5FW5A 1BNGA 2W2CA 3NQZA 3SEDA 3WHOA 1UDII 2GEYA 1CEWI 3JUNA 3UB1A 2ZHXB 3X41A 1RDSA 3AGOA 3LTBA 4MMZB 1VQ53 3X3ZA 3AMOB 3TDGA 1IQ8A 5IG4A 1OHSA 1K28A 1Q40B 3D5GA 3DXOA 3LMLA 1B2MA 3K63A 1TU5A 2BHMA 2GXFA 3PYJA 3URPA 1RNBA 3CC23 3LZAA 2XSHB 3UL5A 1U5OA 4FCJA 1RCKA 1ZGXA 2KRTA 1BAOA 3I553 3FKAA 1KWIA 4O8SA 2XGLA 3DY5A 1IT8A 3IJEB 4IIAA 1QVG2 4J5KA 1MWUA 4XDVA 4PEJA 5BXQA 1Q824 1KC84 1N8R4 1EKMA 2RGQA 1IT7A 1GY7A 1GD3A 1GMQA 1UUWB 4O3VA 1SIHA 1RN7A 1T2IA 1S723 3BLZA 1NDOB 4ORLA 5ELJA 1RKYA 3FCSB 4HM8B 5EQLA 2CG0A 1RMSA 2CHCA 2YFLB 4J9AA 2CFDA 2HMLB 2OOVC 3FG4A 1YGWA 1JKGA 3LYGA 1DMMA 1MWSA 2R41A 3NBJA 3ZG5A 3CMA3 1WMNA 2IYJA 5IEOA 1A2KA 1E3VA 5EVHA 3X42A 3F7SA 1A2PA 3NM7A 4Q53A 2CFGA 3A5EA 4LZIA 1B2ZA 5JPUA 3D4AA 1C54A 1YNVX 1DMQA 1I0VA 1STDA 1NJI4 3FF2A 3HZPA 1Q864 2WOFA 2P38A 2QEX3 1A2VA 3S28A 1A90A 1IVWA 5LC7A 3WA3A 1N9EA 4O2HA 1Q42A 1V57A 1UW1A 1UGIA 1JB5A 1NB3I 4BTYA 2RNTA 2CX1A 2OWPA 4OVMA 5GSPA 3NBBA 5CLKA 1VQM3 1JNQA 1X1XA 4DKIA 4EV5A 2XF3A 5AIGA 3Q3FA 3GZBA 4K1VA 1YJW3 5D82A 1N5HA 3J7Yd 1Q7Y4 1LVNA 3MG3A 5IG0A 1HU9A 2OOVA 2Z7AA 1OF5A 1G0TA 1W2B2 3LTCA 4WP5A 3G16A 1T5YA 3VF1A 1RGHA 2KF6A 8RNTA 3CNMA 1JBSA 1BVIA 2AAEA 1QMAA 1JBRA 1AV4A 1TP6A 1QJGA 3RDEA 3B7CA 4HYZA 3F8XA 1LNIA 3EHCA 2D42A 2F5MA 1BRIA 3CCE3 2FGTA 1BRKA 2C11A 1FW7A 4O02B 3STDA 1U8CB 3KFQC 1YI23 2L1SA 3FF0A 4AKYA 1J2BA 1JZDA 2H0HA 5AEUB 2KF5A 2UX0A 4K90B 3OX9A 4FMCA 1W7CA 1JV2B 4LSOA 3WOFB 1DVDA 6STDA 1ZO2A 2PZVA 2WOHA 3EN8A 4H61A 1FGRA 2BT3A 3BU4A 3DGOA 1DVCA 4HVNA 2O9UX 7RNTA 3CU3A 3JUMA 1BRSA 1EG9B 1BNFA 5HOHA 6RNTA 2E2VA 1N8QA 3QRDA 4FCZA 2KF3A 2F56A 1LOWA 1QALA 3I0YA 3FGYA 2IUKA 2P0XA 5BU4A 3CC73 4J8TA 2I9WA 3X40A 3JUOA 1GY5A 4NPBA 3T8UA 1BRJA 3VGNA 3NHXA 3GZXB 5FGOA 3EQQB 4FMBA 3AGNA 1RGEA 2L4VA 3S29A 3EN1B 3CME3 3U1WA 1OF5B 1TUHA 2GEXA 5EEOA 2OQEC 4BL3A 3DH2A 4KZ1A 3I563 2CW9A 2JDIH 2OTJ3 3DUKA 1X1WA 5M19A 2JQ5A 4HM1B 1RGGA 2CH9A 2QA43 2H0IA 4HBRA 2YFJB 3WMDA 1W4NA 5M18A 2GBWB 2W04A 1D6UA 3NM2A 4HKVB 3Q2PA 1E3RA 1I3FA 4JRFA 2XSOB 1W5ZA 1TFOA 1BNEA 2HMKB 4R1KA 2OCTA 3G6E3 3SVAA 4X2OA 3KN4A 3T8NA 1A67A 3UJMA 2IUJA 5DRVA 2CIUA 2PNCA 1RHLA 1T2HA 2STDA 3IPTA 3LH4A 3MG2A 3JVCA 1VQ43 2P09A 1O7PB 3K9MC 2BMOB 5TGNA 3CCS3 1L5GB 4HM4B 2WO0A 5LC6A 4BTWA 4R4KA 1HKXA 1FGQA 2ML6A 3MG1A 2OQEA 1IQXA 1BGSA 1ROAA 3FLJA 1RCLA 1VQ73 2ZDJA 3LTAA 1E97A 1US1A 3NUVA 1VQ83 3RGRA 1LRAA 1PYLA 3CC43 3N9HA 6GSPA 3SX1A 1YGEA 3HOHA 1OH0A 3M8CA 1B27A 1T3BA 2Z76A 3KSPA 3LTDA 4N6OB 5KP1A 1BSEA 3NV0A 1I70A 4FCMA 3WDGB 1IYYA 5IG5A 2BIRA 3EB8A 4N6TA 4EYCA 4WWUC 1BUQA 1G02A 2B24B 4U13A 3CCV3 3HIIA 1B2XA 3ZFZA 4EBGA 1VQN3 5JPPA 1AVKA 2BO9B 1BNSA 1MGWA 2W56A 2E2TA 3NXJA 4LMIA 4RNTA 2AADA
chains in the Genus database with same CATH topology
1DE3A 1LNIA 1BRNL 1JBRA 1Q9EA 2F5MA 1BRIA 1BRKA 1FW7A 1RNTA 1B2SA 1BNIA 1RGLA 2SARA 2KAAA 1CH0A 1SARA 4GHOA 4HAAA 1I2FA 3GSPA 2KF5A 1RGFA 1LOYA 1BIRA 1X1YA 1FZUA 2GSPA 1B21A 2RBIA 3BU4A 7RNTA 1I2EA 1BRSA 1BNFA 5HOHA 2BU4A 3RNTA 6RNTA 1BOXA 1BSBA 1RSNA 1RTUA 1UCIA 1BNJA 1BRHA 2KF3A 1RLSA 2F56A 5BIRA 1LOWA 1BSAA 1BNGA 5BU4A 3WHOA 3D5IA 7GSPA 1RDSA 3AGOA 3AHSA 1BRJA 1I3IA 1BSDA 1UCJA 1YVSA 5RNTA 1BANA 3AGNA 1RGEA 3SYUA 3D5GA 2C4BA 1B2MA 1GMPA 1DETA 1RNBA 3URPA 1BUJA 1TRQA 3DH2A 1RCKA 1ZGXA 1BAOA 4J5GA 1I2GA 1X1WA 2HOHA 1RGAA 1BRGA 1TRPA 1UCLA 1RGGA 1X1UA 4J5KA 2ZA4A 1BSCA 1GMQA 1I3FA 1AY7A 1UCKA 2F5WA 1MGRA 1T2IA 1GMRA 1BNEA 1RN1A 1RMSA 1YGWA 1I0XA 3AHWA 1JBTA 1B20A 1RHLA 1GOUA 1T2HA 2F4YA 9RNTA 1A2PA 3A5EA 1B2ZA 1C54A 3D4AA 4GSPA 1YNVX 1I0VA 1R4YA 1HZ1A 1I8VA 4BU4A 3WR2A 1AQZA 1BU4A 4BIRA 1HYFA 1BGSA 1BNRA 1RCLA 1FUSA 1B2UA 1B3SA 1GOVA 1RN4A 1FYSA 1TTOA 2RNTA 3BIRA 5GSPA 1GSPA 1LRAA 1PYLA 1X1XA 6GSPA 3HOHA 2KF4A 1B27A 3Q3FA 3KCHA 1RGKA 1FUTA 1BSEA 1I70A 1GOYA 1IYYA 2BIRA 1PY3A 1G02A 3DGYA 1B2XA 1RGCA 1LOVA 1RGHA 2KF6A 8RNTA 4HOHA 1BNSA 1BVIA 1MGWA 2AAEA 4RNTA 1JBSA 2AADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE3 A;  1LNI A;  1BRN L;  1JBR A;  1Q9E A;  2F5M A;  1BRI A;  1BRK A;  1FW7 A;  1RNT A;  1B2S A;  1BNI A;  1RGL A;  2SAR A;  2KAA A;  1CH0 A;  1SAR A;  4GHO A;  4HAA A;  1I2F A;  3GSP A;  2KF5 A;  1RGF A;  1LOY A;  1BIR A;  1X1Y A;  1FZU A;  2GSP A;  1B21 A;  2RBI A;  3BU4 A;  7RNT A;  1I2E A;  1BRS A;  1BNF A;  5HOH A;  2BU4 A;  3RNT A;  6RNT A;  1BOX A;  1BSB A;  1RSN A;  1RTU A;  1UCI A;  1BNJ A;  1BRH A;  2KF3 A;  1RLS A;  2F56 A;  5BIR A;  1LOW A;  1BSA A;  1BNG A;  5BU4 A;  3WHO A;  3D5I A;  7GSP A;  1RDS A;  3AGO A;  3AHS A;  1BRJ A;  1I3I A;  1BSD A;  1UCJ A;  1YVS A;  5RNT A;  1BAN A;  3AGN A;  1RGE A;  3SYU A;  3D5G A;  2C4B A;  1B2M A;  1GMP A;  1DET A;  1RNB A;  3URP A;  1BUJ A;  1TRQ A;  3DH2 A;  1RCK A;  1ZGX A;  1BAO A;  4J5G A;  1I2G A;  1X1W A;  2HOH A;  1RGA A;  1BRG A;  1TRP A;  1UCL A;  1RGG A;  1X1U A;  4J5K A;  2ZA4 A;  1BSC A;  1GMQ A;  1I3F A;  1AY7 A;  1UCK A;  2F5W A;  1MGR A;  1T2I A;  1GMR A;  1BNE A;  1RN1 A;  1RMS A;  1YGW A;  1I0X A;  3AHW A;  1JBT A;  1B20 A;  1RHL A;  1GOU A;  1T2H A;  2F4Y A;  9RNT A;  1A2P A;  3A5E A;  1B2Z A;  1C54 A;  3D4A A;  4GSP A;  1YNV X;  1I0V A;  1R4Y A;  1HZ1 A;  1I8V A;  4BU4 A;  3WR2 A;  1AQZ A;  1BU4 A;  4BIR A;  1HYF A;  1BGS A;  1BNR A;  1RCL A;  1FUS A;  1B2U A;  1B3S A;  1GOV A;  1RN4 A;  1FYS A;  1TTO A;  2RNT A;  3BIR A;  5GSP A;  1GSP A;  1LRA A;  1PYL A;  1X1X A;  6GSP A;  3HOH A;  2KF4 A;  1B27 A;  3Q3F A;  3KCH A;  1RGK A;  1FUT A;  1BSE A;  1I70 A;  1GOY A;  1IYY A;  2BIR A;  1PY3 A;  1G02 A;  3DGY A;  1B2X A;  1RGC A;  1LOV A;  1RGH A;  2KF6 A;  8RNT A;  4HOH A;  1BNS A;  1BVI A;  1MGW A;  2AAE A;  4RNT A;  1JBS A;  2AAD A; 
#chains in the Genus database with same CATH topology
 1VQP 3;  1BRN L;  4FR9 A;  1IVX A;  1NNV A;  2Q07 A;  3UNL A;  1RNT A;  1B2S A;  3CCM 3;  1RGL A;  1SAR A;  3H51 A;  3F40 A;  3WA2 X;  3Q1C A;  2HMM B;  2LYX A;  5G2G A;  2RCD A;  5KP4 A;  1I2F A;  2CKF B;  3KZT A;  3K5T A;  4NRE A;  2YFI B;  3KSE D;  3SOY A;  3CCU 3;  2B1X B;  1KSI A;  1V74 A;  1EEJ A;  1FZU A;  1X1Y A;  1B21 A;  2O3O A;  3DGM A;  1QVF 2;  3B4O A;  3OWS A;  1C7H A;  1I2E A;  3MSO A;  5G1K A;  4HJL B;  5M1A A;  1KQS 2;  3H3H A;  2CWU A;  4R9L A;  4RBN A;  3RNT A;  1NU3 A;  4N6V 0;  5JBS A;  2F98 A;  2H0G A;  4I5Q A;  1YIJ 3;  1BRH A;  5I97 A;  3OV4 A;  5BIR A;  2CFW A;  1W6C A;  3HX8 A;  3KKG A;  5AYS C;  2INX A;  3D5I A;  5AII A;  2GU3 A;  2HMO B;  2IMJ A;  2MC8 A;  4HM7 B;  3CXC 2;  1VQL 3;  3NV0 B;  4XBX A;  1JKG B;  2ML5 A;  4R80 A;  1YVS A;  2BNG A;  3X3X A;  3SOA A;  3MHE A;  5RNT A;  1QAF A;  1IU7 A;  3SYU A;  2CFK A;  1LQG C;  1KD1 4;  1TJD A;  2C4B A;  2XEP A;  1DET A;  3GRD A;  3K0Z A;  1W6Y A;  4KFE A;  2R4I A;  5DRE A;  4WYK A;  4LGQ A;  1LNH A;  4CPK A;  1JB4 A;  1GY6 A;  3EBT A;  3GWR A;  3BB9 A;  1VQQ A;  3Q90 A;  1G96 A;  1TRQ A;  1ZX2 A;  1M1K 4;  3S5C A;  3B8L A;  2W56 B;  3V98 A;  2Y73 A;  2K0M A;  4HM0 B;  1I2G A;  3LXU X;  3CNX A;  4N6N B;  3DMC A;  4N3V A;  1BRG A;  1TRP A;  2GBX B;  2IA7 A;  2WGQ A;  3IMA B;  1FA3 A;  4K1U A;  3FZW A;  2OTL 3;  1K9M 4;  3ECF A;  2ZA4 A;  5D81 A;  1OPY A;  1WQL B;  2K3D A;  1UCK A;  1AY7 A;  2F5W A;  4EV2 A;  2A15 A;  1GMR A;  1QAK A;  3X3Y A;  4MMY B;  3EE1 A;  3NQY A;  3U97 A;  4KFF A;  2SBL A;  3F7X A;  5IW9 A;  3G71 3;  1ROV A;  3PGB A;  3ER7 A;  4KVH A;  5CF2 A;  1JZO A;  1B20 A;  1TFK A;  1GOU A;  1W00 A;  1YIT 3;  2F4Y A;  1CYV A;  1Q40 A;  1M1X B;  1EQK A;  4K61 A;  2CG1 A;  4JF8 A;  1FUW A;  4KT3 B;  3PCS A;  4N6U A;  4R9K A;  1S5A A;  3OWY A;  2FXT A;  3CCQ 3;  4TX4 A;  4OUQ A;  3WR2 A;  2XFS A;  1BU4 A;  1JN5 A;  1HYF A;  1BNR A;  1ULJ B;  1WMO A;  1VQK 3;  1B2U A;  3GAX A;  1IV7 A;  1B3S A;  1OUN A;  1FGT A;  1FYS A;  1TTO A;  1RN4 A;  1Z1S A;  3DZL A;  1UUG B;  1DYU A;  3F14 A;  4RZM A;  1RRH A;  1IVU A;  4L8P A;  2M7O A;  4CCV A;  1Q81 4;  3OW2 2;  4IT7 A;  4L7K A;  1D6Y A;  3L0R A;  2YX9 A;  3JUP A;  3KCH A;  1RGK A;  1FUT A;  3QK9 A;  4WYK B;  3O8Y A;  5G1L A;  1VQO 3;  3EX9 A;  3PCR A;  4AKZ A;  3FSD A;  3PS8 A;  3EJV A;  4HZ9 B;  4XBY A;  5IEN A;  5D83 A;  1FGM A;  4FMA A;  1ASK A;  1OCV A;  3LT8 A;  4WHA A;  2W6J H;  1PY3 A;  1ZS7 A;  3NBR A;  3DGY A;  3CPW 2;  1RGC A;  3F9S A;  4STD A;  4KFD A;  1STF I;  5KP3 A;  4LYL B;  1GS3 A;  2BMQ B;  3BNB A;  1K41 A;  4ILF A;  3S67 A;  4EC6 A;  1O7W B;  3SXX A;  1DE3 A;  1IK3 A;  2XFT A;  4XDW A;  4H3U A;  1WTH A;  2SAR A;  2KAA A;  1CH0 A;  3ROB A;  3B4P A;  4NHF A;  4FMD A;  2J8X B;  3S27 A;  1MWT A;  7STD A;  1NB5 I;  1W6G A;  4L8O A;  1M9G A;  3D9R A;  3V99 A;  1AVL A;  1LOY A;  1RGF A;  3HI7 A;  4MEI A;  1ULI B;  3MYT A;  1VZZ A;  1O7H B;  4XB5 A;  3LT9 A;  1OHO A;  2V1L A;  3EC9 A;  4GB5 A;  3FH1 A;  3CCL 3;  1CYU A;  4OK0 A;  2W9Q A;  1W01 A;  1JN5 B;  3OXA A;  4HM6 B;  1F8N A;  4XM4 A;  1BOX A;  1BSB A;  1Y4K A;  1OAC A;  1UCI A;  1BNJ A;  2C10 A;  4MJD A;  5CXO A;  1YVB I;  5CK6 A;  3MPH A;  4N6M A;  3CD6 3;  2F99 A;  4BTX A;  2BMR B;  2XRX B;  1BSA A;  3WOD G;  1GD4 A;  1JRQ A;  4HM2 B;  4HZB B;  1R4C A;  2QIY A;  3D3L A;  1YHQ 3;  1M90 4;  1WMP A;  4MMX B;  2XR8 B;  1TIJ A;  4RNY A;  7GSP A;  5AIH A;  3N54 B;  2RSX A;  3AHS A;  3PXM A;  1I3I A;  1UCJ A;  1BSD A;  4ZM8 A;  1VQ9 3;  1BAN A;  3JUQ A;  1IV9 A;  3MKI A;  2E2U A;  1MWR A;  1GMP A;  4GL6 A;  2CK3 H;  3HK4 A;  2F86 B;  2CC3 A;  2MF7 A;  1BUJ A;  3G0K A;  3WOE B;  2P05 A;  5AI1 A;  3GZY B;  3D79 A;  4J5G A;  1YJ9 3;  4LEH A;  2HOH A;  4IPB A;  2Z6B A;  1RGA A;  1UCL A;  1V58 A;  5A0O B;  4QWT A;  2HMN B;  5ELU A;  1X1U A;  2K54 A;  1BSC A;  2XGN A;  5IG3 A;  2LQV A;  1MGR A;  1CQS A;  2KCD A;  3BND A;  4HM5 B;  4EW5 A;  1W02 A;  1ISK A;  5HGR A;  3ZG0 A;  3DGL A;  1RN1 A;  3F8H A;  1O7N B;  4WFO A;  3DGN A;  1I0X A;  3AHW A;  4X2H A;  1JBT A;  1MNL A;  3BNC A;  4AEQ A;  3N8B A;  9RNT A;  2W03 A;  3PZW A;  1YJN 3;  3GZR A;  3SLU A;  2FNQ A;  3V92 A;  4GSP A;  1R4Y A;  3CCR 3;  1OGX A;  1LOX A;  2IY2 A;  3E99 A;  1HZ1 A;  1I8V A;  1OHP A;  4BU4 A;  5IER A;  1AQZ A;  2W0Q A;  1PFP A;  2CX0 A;  4BIR A;  3HIG A;  2Y74 A;  2CWT A;  1FUS A;  3LOY A;  2RFR A;  3FG3 A;  1GOV A;  5STD A;  2P0M A;  1LQM B;  1SJW A;  1AR0 A;  3BIR A;  1GSP A;  3EF8 A;  1LXE A;  3OWU A;  1DMN A;  1N9J A;  1UI7 A;  3FG1 A;  1GYB A;  1UGH I;  1MOL A;  2KF4 A;  5CF1 A;  5IEP A;  4EXR A;  1RJO A;  2WGO A;  1WNH A;  1SPU A;  3A76 A;  4XBT A;  2KXG A;  1GOY A;  3AMO A;  1EA2 A;  2QGU A;  2CWV A;  3CPO A;  3VSY A;  1K8A 4;  3UL6 A;  4N6L A;  1UI8 A;  4CDL A;  8CHO A;  2HMJ B;  1LOV A;  3KE7 A;  3CCJ 3;  4HOH A;  1JB2 A;  2GU1 A;  4HM3 B;  1W2Z A;  3RGA A;  1O7G B;  4G1M B;  1Q9E A;  2UUG C;  1UUV B;  4I4K A;  2UGI A;  1IDP A;  2W9P A;  1BNI A;  1NO3 A;  5AEW B;  2Z77 A;  4GHO A;  2D1W A;  1IVV A;  1VQ6 3;  4HAA A;  1RRL A;  3GSP A;  1Q7H A;  1BIR A;  1JJ2 2;  2CFL A;  4CJN A;  3MWZ A;  3BNE A;  1FGO A;  5AYR B;  2GSP A;  3DM8 A;  2RBI A;  1EUI C;  3NX0 A;  1D6Z A;  5IF6 A;  3T0U A;  3G8Z A;  3G4S 3;  1SII A;  5AIF A;  3K7C A;  1NWW A;  2BU4 A;  1RSN A;  1SQW A;  1N5P A;  1RTU A;  4RNZ A;  1PU4 A;  1O7M B;  2XH9 A;  1IQY A;  1RLS A;  5BVB A;  3KII A;  2ZL8 A;  3EBY A;  1OGZ A;  3ALA A;  4BL2 A;  1K73 4;  5FW5 A;  1BNG A;  2W2C A;  3NQZ A;  3SED A;  3WHO A;  1UDI I;  2GEY A;  1CEW I;  3JUN A;  3UB1 A;  2ZHX B;  3X41 A;  1RDS A;  3AGO A;  3LTB A;  4MMZ B;  1VQ5 3;  3X3Z A;  3AMO B;  3TDG A;  1IQ8 A;  5IG4 A;  1OHS A;  1K28 A;  1Q40 B;  3D5G A;  3DXO A;  3LML A;  1B2M A;  3K63 A;  1TU5 A;  2BHM A;  2GXF A;  3PYJ A;  3URP A;  1RNB A;  3CC2 3;  3LZA A;  2XSH B;  3UL5 A;  1U5O A;  4FCJ A;  1RCK A;  1ZGX A;  2KRT A;  1BAO A;  3I55 3;  3FKA A;  1KWI A;  4O8S A;  2XGL A;  3DY5 A;  1IT8 A;  3IJE B;  4IIA A;  1QVG 2;  4J5K A;  1MWU A;  4XDV A;  4PEJ A;  5BXQ A;  1Q82 4;  1KC8 4;  1N8R 4;  1EKM A;  2RGQ A;  1IT7 A;  1GY7 A;  1GD3 A;  1GMQ A;  1UUW B;  4O3V A;  1SIH A;  1RN7 A;  1T2I A;  1S72 3;  3BLZ A;  1NDO B;  4ORL A;  5ELJ A;  1RKY A;  3FCS B;  4HM8 B;  5EQL A;  2CG0 A;  1RMS A;  2CHC A;  2YFL B;  4J9A A;  2CFD A;  2HML B;  2OOV C;  3FG4 A;  1YGW A;  1JKG A;  3LYG A;  1DMM A;  1MWS A;  2R41 A;  3NBJ A;  3ZG5 A;  3CMA 3;  1WMN A;  2IYJ A;  5IEO A;  1A2K A;  1E3V A;  5EVH A;  3X42 A;  3F7S A;  1A2P A;  3NM7 A;  4Q53 A;  2CFG A;  3A5E A;  4LZI A;  1B2Z A;  5JPU A;  3D4A A;  1C54 A;  1YNV X;  1DMQ A;  1I0V A;  1STD A;  1NJI 4;  3FF2 A;  3HZP A;  1Q86 4;  2WOF A;  2P38 A;  2QEX 3;  1A2V A;  3S28 A;  1A90 A;  1IVW A;  5LC7 A;  3WA3 A;  1N9E A;  4O2H A;  1Q42 A;  1V57 A;  1UW1 A;  1UGI A;  1JB5 A;  1NB3 I;  4BTY A;  2RNT A;  2CX1 A;  2OWP A;  4OVM A;  5GSP A;  3NBB A;  5CLK A;  1VQM 3;  1JNQ A;  1X1X A;  4DKI A;  4EV5 A;  2XF3 A;  5AIG A;  3Q3F A;  3GZB A;  4K1V A;  1YJW 3;  5D82 A;  1N5H A;  3J7Y d;  1Q7Y 4;  1LVN A;  3MG3 A;  5IG0 A;  1HU9 A;  2OOV A;  2Z7A A;  1OF5 A;  1G0T A;  1W2B 2;  3LTC A;  4WP5 A;  3G16 A;  1T5Y A;  3VF1 A;  1RGH A;  2KF6 A;  8RNT A;  3CNM A;  1JBS A;  1BVI A;  2AAE A;  1QMA A;  1JBR A;  1AV4 A;  1TP6 A;  1QJG A;  3RDE A;  3B7C A;  4HYZ A;  3F8X A;  1LNI A;  3EHC A;  2D42 A;  2F5M A;  1BRI A;  3CCE 3;  2FGT A;  1BRK A;  2C11 A;  1FW7 A;  4O02 B;  3STD A;  1U8C B;  3KFQ C;  1YI2 3;  2L1S A;  3FF0 A;  4AKY A;  1J2B A;  1JZD A;  2H0H A;  5AEU B;  2KF5 A;  2UX0 A;  4K90 B;  3OX9 A;  4FMC A;  1W7C A;  1JV2 B;  4LSO A;  3WOF B;  1DVD A;  6STD A;  1ZO2 A;  2PZV A;  2WOH A;  3EN8 A;  4H61 A;  1FGR A;  2BT3 A;  3BU4 A;  3DGO A;  1DVC A;  4HVN A;  2O9U X;  7RNT A;  3CU3 A;  3JUM A;  1BRS A;  1EG9 B;  1BNF A;  5HOH A;  6RNT A;  2E2V A;  1N8Q A;  3QRD A;  4FCZ A;  2KF3 A;  2F56 A;  1LOW A;  1QAL A;  3I0Y A;  3FGY A;  2IUK A;  2P0X A;  5BU4 A;  3CC7 3;  4J8T A;  2I9W A;  3X40 A;  3JUO A;  1GY5 A;  4NPB A;  3T8U A;  1BRJ A;  3VGN A;  3NHX A;  3GZX B;  5FGO A;  3EQQ B;  4FMB A;  3AGN A;  1RGE A;  2L4V A;  3S29 A;  3EN1 B;  3CME 3;  3U1W A;  1OF5 B;  1TUH A;  2GEX A;  5EEO A;  2OQE C;  4BL3 A;  3DH2 A;  4KZ1 A;  3I56 3;  2CW9 A;  2JDI H;  2OTJ 3;  3DUK A;  1X1W A;  5M19 A;  2JQ5 A;  4HM1 B;  1RGG A;  2CH9 A;  2QA4 3;  2H0I A;  4HBR A;  2YFJ B;  3WMD A;  1W4N A;  5M18 A;  2GBW B;  2W04 A;  1D6U A;  3NM2 A;  4HKV B;  3Q2P A;  1E3R A;  1I3F A;  4JRF A;  2XSO B;  1W5Z A;  1TFO A;  1BNE A;  2HMK B;  4R1K A;  2OCT A;  3G6E 3;  3SVA A;  4X2O A;  3KN4 A;  3T8N A;  1A67 A;  3UJM A;  2IUJ A;  5DRV A;  2CIU A;  2PNC A;  1RHL A;  1T2H A;  2STD A;  3IPT A;  3LH4 A;  3MG2 A;  3JVC A;  1VQ4 3;  2P09 A;  1O7P B;  3K9M C;  2BMO B;  5TGN A;  3CCS 3;  1L5G B;  4HM4 B;  2WO0 A;  5LC6 A;  4BTW A;  4R4K A;  1HKX A;  1FGQ A;  2ML6 A;  3MG1 A;  2OQE A;  1IQX A;  1BGS A;  1ROA A;  3FLJ A;  1RCL A;  1VQ7 3;  2ZDJ A;  3LTA A;  1E97 A;  1US1 A;  3NUV A;  1VQ8 3;  3RGR A;  1LRA A;  1PYL A;  3CC4 3;  3N9H A;  6GSP A;  3SX1 A;  1YGE A;  3HOH A;  1OH0 A;  3M8C A;  1B27 A;  1T3B A;  2Z76 A;  3KSP A;  3LTD A;  4N6O B;  5KP1 A;  1BSE A;  3NV0 A;  1I70 A;  4FCM A;  3WDG B;  1IYY A;  5IG5 A;  2BIR A;  3EB8 A;  4N6T A;  4EYC A;  4WWU C;  1BUQ A;  1G02 A;  2B24 B;  4U13 A;  3CCV 3;  3HII A;  1B2X A;  3ZFZ A;  4EBG A;  1VQN 3;  5JPP A;  1AVK A;  2BO9 B;  1BNS A;  1MGW A;  2W56 A;  2E2T A;  3NXJ A;  4LMI A;  4RNT A;  2AAD A; 
#chains in the Genus database with same CATH homology
 1DE3 A;  1LNI A;  1BRN L;  1JBR A;  1Q9E A;  2F5M A;  1BRI A;  1BRK A;  1FW7 A;  1RNT A;  1B2S A;  1BNI A;  1RGL A;  2SAR A;  2KAA A;  1CH0 A;  1SAR A;  4GHO A;  4HAA A;  1I2F A;  3GSP A;  2KF5 A;  1RGF A;  1LOY A;  1BIR A;  1X1Y A;  1FZU A;  2GSP A;  1B21 A;  2RBI A;  3BU4 A;  7RNT A;  1I2E A;  1BRS A;  1BNF A;  5HOH A;  2BU4 A;  3RNT A;  6RNT A;  1BOX A;  1BSB A;  1RSN A;  1RTU A;  1UCI A;  1BNJ A;  1BRH A;  2KF3 A;  1RLS A;  2F56 A;  5BIR A;  1LOW A;  1BSA A;  1BNG A;  5BU4 A;  3WHO A;  3D5I A;  7GSP A;  1RDS A;  3AGO A;  3AHS A;  1BRJ A;  1I3I A;  1BSD A;  1UCJ A;  1YVS A;  5RNT A;  1BAN A;  3AGN A;  1RGE A;  3SYU A;  3D5G A;  2C4B A;  1B2M A;  1GMP A;  1DET A;  1RNB A;  3URP A;  1BUJ A;  1TRQ A;  3DH2 A;  1RCK A;  1ZGX A;  1BAO A;  4J5G A;  1I2G A;  1X1W A;  2HOH A;  1RGA A;  1BRG A;  1TRP A;  1UCL A;  1RGG A;  1X1U A;  4J5K A;  2ZA4 A;  1BSC A;  1GMQ A;  1I3F A;  1AY7 A;  1UCK A;  2F5W A;  1MGR A;  1T2I A;  1GMR A;  1BNE A;  1RN1 A;  1RMS A;  1YGW A;  1I0X A;  3AHW A;  1JBT A;  1B20 A;  1RHL A;  1GOU A;  1T2H A;  2F4Y A;  9RNT A;  1A2P A;  3A5E A;  1B2Z A;  1C54 A;  3D4A A;  4GSP A;  1YNV X;  1I0V A;  1R4Y A;  1HZ1 A;  1I8V A;  4BU4 A;  3WR2 A;  1AQZ A;  1BU4 A;  4BIR A;  1HYF A;  1BGS A;  1BNR A;  1RCL A;  1FUS A;  1B2U A;  1B3S A;  1GOV A;  1RN4 A;  1FYS A;  1TTO A;  2RNT A;  3BIR A;  5GSP A;  1GSP A;  1LRA A;  1PYL A;  1X1X A;  6GSP A;  3HOH A;  2KF4 A;  1B27 A;  3Q3F A;  3KCH A;  1RGK A;  1FUT A;  1BSE A;  1I70 A;  1GOY A;  1IYY A;  2BIR A;  1PY3 A;  1G02 A;  3DGY A;  1B2X A;  1RGC A;  1LOV A;  1RGH A;  2KF6 A;  8RNT A;  4HOH A;  1BNS A;  1BVI A;  1MGW A;  2AAE A;  4RNT A;  1JBS A;  2AAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...