1JBRA

Crystal structure of the ribotoxin restrictocin and a 31-mer srd rna inhibitor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*CP*GP*CP*UP*CP*CP*UP*CP*AP*GP*UP*AP*CP*GP*AP*GP*(A2
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
molecule tags Hydrolase/rna
total genus 35
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbrA00
2F5MA 1ZGXA 1RGKA 2KF4A 5HOHA 1B2MA 1BNIA 1FZUA 1YVSA 1I70A 1LOWA 1X1YA 4HOHA 1RCLA 3D5IA 1SARA 1LOYA 1BRNL 3Q3FA 1GOUA 1RSNA 1JBSA 1RGEA 1GOVA 2F5WA 1BRSA 1BNRA 1BNFA 1B2XA 1BNJA 3D4AA 1GMRA 1X1WA 3BU4A 1LNIA 1B21A 1JBTA 1I0XA 1BRIA 4GHOA 1BRJA 8RNTA 1B2SA 1BSBA 1BGSA 1FUSA 5GSPA 3RNTA 1RMSA 1BNSA 1B3SA 3BIRA 1GMPA 3DH2A 1UCLA 1FUTA 2RNTA 3GSPA 2RBIA 3A5EA 1LRAA 1FW7A 3WHOA 1I8VA 1TRPA 1BANA 1RNTA 5BU4A 1G02A 4J5KA 1B2UA 1BNEA 1Q9EA 1RN1A 1BSAA 1PYLA 1T2HA 1UCKA 6RNTA 7GSPA 1MGWA 1I0VA 1B27A 1BU4A 1BRKA 1GSPA 1C54A 2AAEA 3KCHA 2KAAA 1B2ZA 1T2IA 3AGOA 5BIRA 1I2FA 7RNTA 1BRHA 6GSPA 1RGHA 4RNTA 2F4YA 9RNTA 1I2EA 1PY3A 1YGWA 4GSPA 1RGFA 1CH0A 1BSEA 2C4BA 1DETA 5RNTA 2F56A 1HYFA 2BU4A 1BIRA 1TRQA 1B20A 1HZ1A 1UCIA 2KF3A 2KF6A 1YNVX 3SYUA 1TTOA 1A2PA 1MGRA 1X1XA 1X1UA 3AHSA 4BU4A 2KF5A 1UCJA 1BSCA 1BUJA 1RHLA 1BSDA 1RGCA 1GOYA 1BNGA 1RGLA 1BAOA 1FYSA 3AGNA 3DGYA 3D5GA 1I3FA 1RGAA 1RLSA 1RTUA 4HAAA 1I2GA 1RGGA 3HOHA 1RN4A 1BVIA 2SARA 1BOXA 1AY7A 3AHWA 3WR2A 1DE3A 2AADA 1RNBA 4BIRA 1IYYA 2HOHA 1LOVA 2ZA4A 2GSPA 1R4YA 1JBRA 3URPA 1BRGA 2BIRA 1AQZA 1RCKA 1RDSA 1I3IA 4J5GA 1GMQA
chains in the Genus database with same CATH superfamily
3HIIA 5CXOA 3SX1A 2BHMA 2F99A 1G96A 3EBTA 4HM1B 2RFRA 3MWZA 1SIHA 3OXAA 1W6YA 4CJNA 3JUNA 3CCM3 2UGIA 1SARA 1BRNL 1Q7HA 5STDA 1FGQA 1ZO2A 4R9KA 2WO0A 1JBSA 4HYZA 3F40A 1BNRA 3Q2PA 5M1AA 2F86B 3D4AA 3NXJA 1NB5I 1R4CA 1SQWA 2PZVA 4K90B 2Y74A 1JRQA 1OCVA 1BRIA 3OWSA 1BRJA 2BO9B 3DGLA 1RKYA 3CCS3 1FGOA 2FGTA 2FNQA 4U13A 3GZYB 1WTHA 3N8BA 1BGSA 3DY5A 5KP3A 4CDLA 4N6MA 3WA3A 2CFGA 2F98A 2XGNA 3EJVA 3RNTA 3HZPA 3SEDA 2Y73A 1STDA 3NBRA 2RNTA 3GSPA 2RBIA 1LRAA 3EE1A 1S723 1ZX2A 4N6NB 3CD63 1LVNA 3GAXA 5BU4A 3CCV3 1Q864 1MWTA 2GBWB 1B2UA 1UCKA 3KKGA 4RZMA 1BSAA 1PYLA 2RCDA 3RDEA 2OOVC 3KIIA 2CKFB 1VQP3 1ASKA 1RRLA 3H51A 1MGWA 2RSXA 5AEWB 2CHCA 1BU4A 4MEIA 2GEXA 1KQS2 3CCE3 4H61A 1IQYA 3G0KA 3EBYA 4XBXA 1MNLA 3WMDA 3B7CA 4MJDA 1B2ZA 1YJN3 2GU3A 2IYJA 3ZFZA 7RNTA 2ML6A 2XF3A 1T5YA 1BRHA 1ULIB 3JUQA 3MHEA 4L8OA 3ZG5A 4RNTA 4KFEA 2UUGC 4WWUC 3MPHA 4GSPA 3FGYA 1RGFA 1CYUA 1GY7A 2C4BA 1TP6A 2YFIB 1Q42A 3JUPA 1LNHA 2P05A 3G6E3 1VQ73 1O7MB 2KXGA 1VQ93 2P0MA 1JB4A 4N6V0 4K1VA 2OCTA 2ZDJA 3F7SA 3FCSB 3KN4A 4Q53A 4PEJA 2KF3A 2LQVA 5FGOA 1RRHA 2CC3A 1W2ZA 1ROVA 2OWPA 3LTBA 1TTOA 2Q07A 4GL6A 3CME3 3NBJA 1IK3A 3AMOA 1X1XA 3HX8A 2R4IA 1A2KA 2KF5A 3FSDA 1LQMB 2IMJA 3ZG0A 1VQ53 1BSCA 4HM2B 1F8NA 5AIFA 1GOYA 2HMKB 3U1WA 3AGNA 1ZS7A 1NB3I 3BNEA 3K9MC 1RTUA 2W03A 1W02A 3HOHA 4BTWA 3DGNA 1JN5A 2XSOB 1GY6A 1W01A 3KZTA 3NV0A 4O2HA 3LXUX 2SARA 4NHFA 1L5GB 3DMCA 1AY7A 3WR2A 3UL5A 3J7Yd 1BUQA 3KFQC 2AADA 1STFI 4BIRA 2ZA4A 2CX0A 4J8TA 1QVF2 1JKGB 3X42A 2YFJB 3CC43 4EXRA 1OGZA 1OACA 2OQEC 2BIRA 3NM7A 5FW5A 3GRDA 1RCKA 2CFDA 2W56A 4J5GA 1IQXA 1US1A 3MKIA 2BMRB 4QWTA 4WFOA 4FCJA 3S67A 1W2B2 2JDIH 1OHSA 1RGKA 2KF4A 4FCZA 1ROAA 4R4KA 3S29A 1V58A 2J8XB 4XDWA 1YVSA 4STDA 2BNGA 3I0YA 1LOWA 5LC6A 3BB9A 1IDPA 4HOHA 1RCLA 3D5IA 3TDGA 1IQ8A 1LOYA 1GOUA 5IG3A 1FA3A 2Z76A 3T8UA 5DRVA 1UUVB 2P09A 3DGMA 1V57A 1UGHI 3CNMA 1N5PA 1RGEA 3X41A 2F5WA 3D9RA 4L8PA 1Q40B 2CWVA 3FH1A 5LC7A 3K0ZA 2HMOB 2IY2A 1B21A 4LGQA 4LMIA 1I0XA 4G1MB 4MMZB 1W7CA 8RNTA 3K63A 5D83A 3PYJA 3CCL3 4MMYB 3UB1A 3DM8A 1KD14 1BSBA 3NQZA 3G4S3 2WGOA 3HK4A 3CXC2 2WOHA 1YI23 1RMSA 3N54B 3T8NA 1M904 3L0RA 1TFKA 2CH9A 1VQ43 3ROBA 1FGTA 1WNHA 1SJWA 4KFDA 1GMPA 1CQSA 5CK6A 3SXXA 1UCLA 1FUTA 2KCDA 4WYKB 2CIUA 3WHOA 4IIAA 1TRPA 1OUNA 2CW9A 1U5OA 3EN1B 4K61A 4FR9A 4HJLB 5CLKA 2BMQB 1I0VA 5IG4A 1OF5B 4EV2A 2QIYA 2ML5A 2IA7A 3G713 1VZZA 2KAAA 3AGOA 4HM7B 4HZ9B 1UUGB 2O3OA 3HIGA 2CG1A 4ILFA 3UL6A 1JB5A 1W5ZA 3EHCA 5BIRA 1VQQA 1WMOA 1QAFA 3LZAA 4RNZA 3V99A 5IF6A 1PY3A 1YIJ3 1O7GB 1A67A 3CPOA 1BSEA 3BNCA 1DETA 3EB8A 3QK9A 2F56A 1DYUA 4K1UA 2HMJB 1J2BA 1T3BA 4OVMA 5AIHA 1C7HA 1GD3A 3SOYA 1B20A 1VQ63 1UCIA 1YVBI 3S5CA 4RNYA 3FF2A 4HKVB 4R80A 3QRDA 4ORLA 1YNVX 5G1LA 3SYUA 1K8A4 4ZM8A 1ULJB 2H0GA 1X1UA 1DMNA 2QA43 2QGUA 1OH0A 5A0OB 1PFPA 4WHAA 2RGQA 4X2OA 1BUJA 3KSED 1VQM3 1YGEA 2BMOB 1VQL3 3EQQB 1FYSA 3B4PA 2C10A 1RGAA 4XM4A 3PXMA 4LSOA 1I2GA 1QALA 1UI8A 1BVIA 3JUOA 3MG2A 2P0XA 1JNQA 3ALAA 3GWRA 1N8R4 1M1K4 3AHWA 3BLZA 3H3HA 4H3UA 3UJMA 5G2GA 4RBNA 2CK3H 1K28A 4NREA 4DKIA 1RNBA 2HOHA 1LOVA 4XBTA 1R4YA 3PCSA 5AI1A 3KE7A 2ZL8A 1FUWA 1EUIC 4FMBA 4MMXB 2SBLA 2YFLB 1RDSA 2R41A 2Z7AA 1JV2B 1LQGC 4HAAA 3N9HA 3NQYA 4BL2A 1WQLB 5HOHA 1NJI4 3OV4A 1I70A 3X3ZA 4X2HA 1AV4A 5JPUA 3V98A 4EYCA 3RGRA 3EN8A 1IVUA 2W9PA 4BTYA 1Q824 3B8LA 8CHOA 3NUVA 3K7CA 1GOVA 4FMAA 3KSPA 2K0MA 1BRSA 1K734 1B2XA 1AVLA 4R1KA 5CF1A 3PGBA 1KC84 1BNJA 1IU7A 3DGOA 3FF0A 1GMRA 2YX9A 2OTL3 3BU4A 1O7HB 5D81A 1W6CA 2W04A 1OPYA 2HMNB 5TGNA 3V92A 2CG0A 2JQ5A 2D42A 3FKAA 1FUSA 1RN7A 2XRXB 5GSPA 3OWYA 4J9AA 4O3VA 1BNSA 3FG4A 3NM2A 2MC8A 2XSHB 1VQN3 3STDA 2CFKA 4HVNA 3DH2A 1KWIA 1DVCA 2CFLA 1BANA 1AVKA 1Z1SA 1DMMA 3FZWA 1BNEA 1K41A 3IMAB 3IJEB 1T2HA 4XBYA 4KVHA 1D6ZA 1GYBA 2GXFA 3HI7A 4KFFA 1JB2A 1GSPA 5AIIA 5HGRA 3X3XA 3VSYA 3BNBA 1A2VA 2LYXA 5IENA 1N9EA 1I2FA 3AMOB 1QMAA 1VQK3 1M9GA 3OWUA 3SLUA 1YHQ3 6GSPA 1RGHA 4LYLB 4JF8A 9RNTA 1IV9A 1E3VA 5ELJA 4I4KA 3EF8A 1O7WB 3Q1CA 1Q7Y4 1CH0A 4HM3B 1SPUA 4R9LA 4HM0B 5IW9A 5RNTA 1MOLA 1UGIA 1AR0A 2WGQA 1HYFA 2V1LA 3DZLA 1JN5B 1HKXA 1NWWA 5DREA 2GBXB 5JPPA 5IG5A 3NV0B 2L1SA 4FMCA 4N6TA 2Z77A 3BNDA 4AKZA 4HM4B 3WODG 1A2PA 3LTCA 1MGRA 3AHSA 4BU4A 5IEOA 3E99A 1QJGA 1UCJA 2M7OA 2O9UX 1EEJA 3OX9A 5EVHA 1EQKA 2CWTA 2UX0A 3CCJ3 1RGCA 5IG0A 4BL3A 1RGLA 2W56B 3DGYA 3MG3A 4OUQA 3D5GA 4TX4A 1I3FA 3LTAA 2B1XB 1RGGA 1TU5A 1RN4A 1WMNA 2IUKA 2K54A 1IT8A 4L7KA 1RJOA 4KT3B 1OHOA 3CCR3 3G8ZA 3DXOA 1BOXA 1N9JA 4HM8B 2XFTA 2XFSA 3RGAA 3LYGA 4IPBA 4LZIA 1D6YA 3CCQ3 3LMLA 1JJ22 1IYYA 3SVAA 3F8HA 3MSOA 1D6UA 2XR8B 3URPA 2CWUA 4CCVA 1AQZA 2GU1A 1M1XB 3NX0A 1IT7A 1U8CB 4AEQA 1MWUA 5G1KA 1QVG2 4N6LA 1I3IA 2K3DA 3MG1A 3WDGB 1O7NB 3SOAA 5IERA 2F5MA 5JBSA 1W6GA 1S5AA 3M8CA 1JZDA 1ZGXA 5ELUA 3CC73 1B2MA 1BNIA 1FZUA 1LOXA 3OW22 3PS8A 1X1YA 3WA2X 4I5QA 3I563 5I97A 3S28A 3Q3FA 3LT9A 1RSNA 1V74A 3GZBA 3LH4A 4O8SA 2L4VA 5AYSC 3ER7A 3DUKA 2XEPA 1JKGA 1VQ83 2C11A 1IVWA 1UW1A 2A15A 1BNFA 2INXA 3T0UA 4HBRA 1SIIA 4HM5B 3VGNA 1X1WA 1GS3A 3X3YA 5M18A 3CMA3 2OOVA 1LNIA 4IT7A 4LEHA 3GZXB 4NPBA 3I553 1JBTA 2I9WA 4GHOA 4O02B 1N5HA 4CPKA 2Z6BA 1B2SA 2CX1A 2MF7A 1YIT3 1EA2A 2WOFA 1UI7A 2FXTA 1IV7A 4HZBB 4WP5A 2D1WA 2H0HA 1B3SA 1CYVA 1EG9B 3BIRA 3WOFB 3FG1A 3WOEB 3UNLA 3A5EA 5EEOA 1QAKA 1TUHA 1FW7A 2XH9A 1I8VA 1MWRA 1RNTA 3F9SA 1Q40A 1G02A 3PCRA 4J5KA 1W4NA 2E2UA 1RN1A 2ZHXB 1Q9EA 7GSPA 6RNTA 3S27A 1TJDA 3D3LA 2HMMB 4EW5A 2KRTA 3GZRA 3K5TA 1DVDA 2XGLA 1B27A 1TFOA 2IUJA 1BRKA 1G0TA 2W6JH 5EQLA 1K9M4 1C54A 3FG3A 2AAEA 1OGXA 3PZWA 1E3RA 3KCHA 1DMQA 1T2IA 3EX9A 3CPW2 4OK0A 3O8YA 1IVVA 1VQO3 1UUWB 2F4YA 5BVBA 1I2EA 2OTJ3 1MWSA 4HM6B 3EC9A 1YGWA 2STDA 2W9QA 2W2CA 1TIJA 4WYKA 2QEX3 1HU9A 3LT8A 1Q814 1YJW3 1GD4A 1FGMA 3IPTA 4GB5A 7STDA 3CC23 2BU4A 4BTXA 2B24B 3D79A 1BIRA 1TRQA 4EV5A 1HZ1A 1JZOA 3A76A 1OF5A 2KF6A 3F7XA 1NNVA 1EKMA 2CFWA 2H0IA 1PU4A 1IVXA 2PNCA 3CNXA 3G16A 1NO3A 1CEWI 1LXEA 1OHPA 1Y4KA 2E2VA 4EBGA 3NHXA 4N6UA 5KP1A 1UDII 2P38A 4EC6A 2OQEA 1RHLA 3B4OA 3JVCA 1E97A 3LTDA 1BSDA 1BNGA 5IEPA 1BAOA 5AIGA 5BXQA 1YJ93 3JUMA 5M19A 1WMPA 3MYTA 1RLSA 1A90A 1FGRA 4N3VA 2HMLB 3NBBA 3CU3A 1W00A 1ISKA 4XB5A 2GEYA 3LOYA 3FLJA 3CCU3 1NU3A 1O7PB 4JRFA 3Q90A 1DE3A 4FMDA 5AYRB 6STDA 4XDVA 4KZ1A 3X40A 4AKYA 2GSPA 3ECFA 5AEUB 1JBRA 5KP4A 1BRGA 2BT3A 3U97A 4FCMA 1N8QA 2E2TA 1NDOB 3F14A 3F8XA 5CF2A 5D82A 4N6OB 2W0QA 1KSIA 3VF1A 1GY5A 1GMQA
chains in the Genus database with same CATH topology
2F5MA 1ZGXA 1RGKA 2KF4A 5HOHA 1B2MA 1BNIA 1FZUA 1YVSA 1I70A 1LOWA 1X1YA 4HOHA 1RCLA 3D5IA 1SARA 1LOYA 1BRNL 3Q3FA 1GOUA 1RSNA 1JBSA 1RGEA 1GOVA 2F5WA 1BRSA 1BNRA 1BNFA 1B2XA 1BNJA 3D4AA 1GMRA 1X1WA 3BU4A 1LNIA 1B21A 1JBTA 1I0XA 1BRIA 4GHOA 1BRJA 8RNTA 1B2SA 1BSBA 1BGSA 1FUSA 5GSPA 3RNTA 1RMSA 1BNSA 1B3SA 3BIRA 1GMPA 3DH2A 1UCLA 1FUTA 2RNTA 3GSPA 2RBIA 3A5EA 1LRAA 1FW7A 3WHOA 1I8VA 1TRPA 1BANA 1RNTA 5BU4A 1G02A 4J5KA 1B2UA 1BNEA 1Q9EA 1RN1A 1BSAA 1PYLA 1T2HA 1UCKA 6RNTA 7GSPA 1MGWA 1I0VA 1B27A 1BU4A 1BRKA 1GSPA 1C54A 2AAEA 3KCHA 2KAAA 1B2ZA 1T2IA 3AGOA 5BIRA 1I2FA 7RNTA 1BRHA 6GSPA 1RGHA 4RNTA 2F4YA 9RNTA 1I2EA 1PY3A 1YGWA 4GSPA 1RGFA 1CH0A 1BSEA 2C4BA 1DETA 5RNTA 2F56A 1HYFA 2BU4A 1BIRA 1TRQA 1B20A 1HZ1A 1UCIA 2KF3A 2KF6A 1YNVX 3SYUA 1TTOA 1A2PA 1MGRA 1X1XA 1X1UA 3AHSA 4BU4A 2KF5A 1UCJA 1BSCA 1BUJA 1RHLA 1BSDA 1RGCA 1GOYA 1BNGA 1RGLA 1BAOA 1FYSA 3AGNA 3DGYA 3D5GA 1I3FA 1RGAA 1RLSA 1RTUA 4HAAA 1I2GA 1RGGA 3HOHA 1RN4A 1BVIA 2SARA 1BOXA 1AY7A 3AHWA 3WR2A 1DE3A 2AADA 1RNBA 4BIRA 1IYYA 2HOHA 1LOVA 2ZA4A 2GSPA 1R4YA 1JBRA 3URPA 1BRGA 2BIRA 1AQZA 1RCKA 1RDSA 1I3IA 4J5GA 1GMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5M A;  1ZGX A;  1RGK A;  2KF4 A;  5HOH A;  1B2M A;  1BNI A;  1FZU A;  1YVS A;  1I70 A;  1LOW A;  1X1Y A;  4HOH A;  1RCL A;  3D5I A;  1SAR A;  1LOY A;  1BRN L;  3Q3F A;  1GOU A;  1RSN A;  1JBS A;  1RGE A;  1GOV A;  2F5W A;  1BRS A;  1BNR A;  1BNF A;  1B2X A;  1BNJ A;  3D4A A;  1GMR A;  1X1W A;  3BU4 A;  1LNI A;  1B21 A;  1JBT A;  1I0X A;  1BRI A;  4GHO A;  1BRJ A;  8RNT A;  1B2S A;  1BSB A;  1BGS A;  1FUS A;  5GSP A;  3RNT A;  1RMS A;  1BNS A;  1B3S A;  3BIR A;  1GMP A;  3DH2 A;  1UCL A;  1FUT A;  2RNT A;  3GSP A;  2RBI A;  3A5E A;  1LRA A;  1FW7 A;  3WHO A;  1I8V A;  1TRP A;  1BAN A;  1RNT A;  5BU4 A;  1G02 A;  4J5K A;  1B2U A;  1BNE A;  1Q9E A;  1RN1 A;  1BSA A;  1PYL A;  1T2H A;  1UCK A;  6RNT A;  7GSP A;  1MGW A;  1I0V A;  1B27 A;  1BU4 A;  1BRK A;  1GSP A;  1C54 A;  2AAE A;  3KCH A;  2KAA A;  1B2Z A;  1T2I A;  3AGO A;  5BIR A;  1I2F A;  7RNT A;  1BRH A;  6GSP A;  1RGH A;  4RNT A;  2F4Y A;  9RNT A;  1I2E A;  1PY3 A;  1YGW A;  4GSP A;  1RGF A;  1CH0 A;  1BSE A;  2C4B A;  1DET A;  5RNT A;  2F56 A;  1HYF A;  2BU4 A;  1BIR A;  1TRQ A;  1B20 A;  1HZ1 A;  1UCI A;  2KF3 A;  2KF6 A;  1YNV X;  3SYU A;  1TTO A;  1A2P A;  1MGR A;  1X1X A;  1X1U A;  3AHS A;  4BU4 A;  2KF5 A;  1UCJ A;  1BSC A;  1BUJ A;  1RHL A;  1BSD A;  1RGC A;  1GOY A;  1BNG A;  1RGL A;  1BAO A;  1FYS A;  3AGN A;  3DGY A;  3D5G A;  1I3F A;  1RGA A;  1RLS A;  1RTU A;  4HAA A;  1I2G A;  1RGG A;  3HOH A;  1RN4 A;  1BVI A;  2SAR A;  1BOX A;  1AY7 A;  3AHW A;  3WR2 A;  1DE3 A;  2AAD A;  1RNB A;  4BIR A;  1IYY A;  2HOH A;  1LOV A;  2ZA4 A;  2GSP A;  1R4Y A;  1JBR A;  3URP A;  1BRG A;  2BIR A;  1AQZ A;  1RCK A;  1RDS A;  1I3I A;  4J5G A;  1GMQ A; 
#chains in the Genus database with same CATH topology
 3HII A;  5CXO A;  3SX1 A;  2BHM A;  2F99 A;  1G96 A;  3EBT A;  4HM1 B;  2RFR A;  3MWZ A;  1SIH A;  3OXA A;  1W6Y A;  4CJN A;  3JUN A;  3CCM 3;  2UGI A;  1SAR A;  1BRN L;  1Q7H A;  5STD A;  1FGQ A;  1ZO2 A;  4R9K A;  2WO0 A;  1JBS A;  4HYZ A;  3F40 A;  1BNR A;  3Q2P A;  5M1A A;  2F86 B;  3D4A A;  3NXJ A;  1NB5 I;  1R4C A;  1SQW A;  2PZV A;  4K90 B;  2Y74 A;  1JRQ A;  1OCV A;  1BRI A;  3OWS A;  1BRJ A;  2BO9 B;  3DGL A;  1RKY A;  3CCS 3;  1FGO A;  2FGT A;  2FNQ A;  4U13 A;  3GZY B;  1WTH A;  3N8B A;  1BGS A;  3DY5 A;  5KP3 A;  4CDL A;  4N6M A;  3WA3 A;  2CFG A;  2F98 A;  2XGN A;  3EJV A;  3RNT A;  3HZP A;  3SED A;  2Y73 A;  1STD A;  3NBR A;  2RNT A;  3GSP A;  2RBI A;  1LRA A;  3EE1 A;  1S72 3;  1ZX2 A;  4N6N B;  3CD6 3;  1LVN A;  3GAX A;  5BU4 A;  3CCV 3;  1Q86 4;  1MWT A;  2GBW B;  1B2U A;  1UCK A;  3KKG A;  4RZM A;  1BSA A;  1PYL A;  2RCD A;  3RDE A;  2OOV C;  3KII A;  2CKF B;  1VQP 3;  1ASK A;  1RRL A;  3H51 A;  1MGW A;  2RSX A;  5AEW B;  2CHC A;  1BU4 A;  4MEI A;  2GEX A;  1KQS 2;  3CCE 3;  4H61 A;  1IQY A;  3G0K A;  3EBY A;  4XBX A;  1MNL A;  3WMD A;  3B7C A;  4MJD A;  1B2Z A;  1YJN 3;  2GU3 A;  2IYJ A;  3ZFZ A;  7RNT A;  2ML6 A;  2XF3 A;  1T5Y A;  1BRH A;  1ULI B;  3JUQ A;  3MHE A;  4L8O A;  3ZG5 A;  4RNT A;  4KFE A;  2UUG C;  4WWU C;  3MPH A;  4GSP A;  3FGY A;  1RGF A;  1CYU A;  1GY7 A;  2C4B A;  1TP6 A;  2YFI B;  1Q42 A;  3JUP A;  1LNH A;  2P05 A;  3G6E 3;  1VQ7 3;  1O7M B;  2KXG A;  1VQ9 3;  2P0M A;  1JB4 A;  4N6V 0;  4K1V A;  2OCT A;  2ZDJ A;  3F7S A;  3FCS B;  3KN4 A;  4Q53 A;  4PEJ A;  2KF3 A;  2LQV A;  5FGO A;  1RRH A;  2CC3 A;  1W2Z A;  1ROV A;  2OWP A;  3LTB A;  1TTO A;  2Q07 A;  4GL6 A;  3CME 3;  3NBJ A;  1IK3 A;  3AMO A;  1X1X A;  3HX8 A;  2R4I A;  1A2K A;  2KF5 A;  3FSD A;  1LQM B;  2IMJ A;  3ZG0 A;  1VQ5 3;  1BSC A;  4HM2 B;  1F8N A;  5AIF A;  1GOY A;  2HMK B;  3U1W A;  3AGN A;  1ZS7 A;  1NB3 I;  3BNE A;  3K9M C;  1RTU A;  2W03 A;  1W02 A;  3HOH A;  4BTW A;  3DGN A;  1JN5 A;  2XSO B;  1GY6 A;  1W01 A;  3KZT A;  3NV0 A;  4O2H A;  3LXU X;  2SAR A;  4NHF A;  1L5G B;  3DMC A;  1AY7 A;  3WR2 A;  3UL5 A;  3J7Y d;  1BUQ A;  3KFQ C;  2AAD A;  1STF I;  4BIR A;  2ZA4 A;  2CX0 A;  4J8T A;  1QVF 2;  1JKG B;  3X42 A;  2YFJ B;  3CC4 3;  4EXR A;  1OGZ A;  1OAC A;  2OQE C;  2BIR A;  3NM7 A;  5FW5 A;  3GRD A;  1RCK A;  2CFD A;  2W56 A;  4J5G A;  1IQX A;  1US1 A;  3MKI A;  2BMR B;  4QWT A;  4WFO A;  4FCJ A;  3S67 A;  1W2B 2;  2JDI H;  1OHS A;  1RGK A;  2KF4 A;  4FCZ A;  1ROA A;  4R4K A;  3S29 A;  1V58 A;  2J8X B;  4XDW A;  1YVS A;  4STD A;  2BNG A;  3I0Y A;  1LOW A;  5LC6 A;  3BB9 A;  1IDP A;  4HOH A;  1RCL A;  3D5I A;  3TDG A;  1IQ8 A;  1LOY A;  1GOU A;  5IG3 A;  1FA3 A;  2Z76 A;  3T8U A;  5DRV A;  1UUV B;  2P09 A;  3DGM A;  1V57 A;  1UGH I;  3CNM A;  1N5P A;  1RGE A;  3X41 A;  2F5W A;  3D9R A;  4L8P A;  1Q40 B;  2CWV A;  3FH1 A;  5LC7 A;  3K0Z A;  2HMO B;  2IY2 A;  1B21 A;  4LGQ A;  4LMI A;  1I0X A;  4G1M B;  4MMZ B;  1W7C A;  8RNT A;  3K63 A;  5D83 A;  3PYJ A;  3CCL 3;  4MMY B;  3UB1 A;  3DM8 A;  1KD1 4;  1BSB A;  3NQZ A;  3G4S 3;  2WGO A;  3HK4 A;  3CXC 2;  2WOH A;  1YI2 3;  1RMS A;  3N54 B;  3T8N A;  1M90 4;  3L0R A;  1TFK A;  2CH9 A;  1VQ4 3;  3ROB A;  1FGT A;  1WNH A;  1SJW A;  4KFD A;  1GMP A;  1CQS A;  5CK6 A;  3SXX A;  1UCL A;  1FUT A;  2KCD A;  4WYK B;  2CIU A;  3WHO A;  4IIA A;  1TRP A;  1OUN A;  2CW9 A;  1U5O A;  3EN1 B;  4K61 A;  4FR9 A;  4HJL B;  5CLK A;  2BMQ B;  1I0V A;  5IG4 A;  1OF5 B;  4EV2 A;  2QIY A;  2ML5 A;  2IA7 A;  3G71 3;  1VZZ A;  2KAA A;  3AGO A;  4HM7 B;  4HZ9 B;  1UUG B;  2O3O A;  3HIG A;  2CG1 A;  4ILF A;  3UL6 A;  1JB5 A;  1W5Z A;  3EHC A;  5BIR A;  1VQQ A;  1WMO A;  1QAF A;  3LZA A;  4RNZ A;  3V99 A;  5IF6 A;  1PY3 A;  1YIJ 3;  1O7G B;  1A67 A;  3CPO A;  1BSE A;  3BNC A;  1DET A;  3EB8 A;  3QK9 A;  2F56 A;  1DYU A;  4K1U A;  2HMJ B;  1J2B A;  1T3B A;  4OVM A;  5AIH A;  1C7H A;  1GD3 A;  3SOY A;  1B20 A;  1VQ6 3;  1UCI A;  1YVB I;  3S5C A;  4RNY A;  3FF2 A;  4HKV B;  4R80 A;  3QRD A;  4ORL A;  1YNV X;  5G1L A;  3SYU A;  1K8A 4;  4ZM8 A;  1ULJ B;  2H0G A;  1X1U A;  1DMN A;  2QA4 3;  2QGU A;  1OH0 A;  5A0O B;  1PFP A;  4WHA A;  2RGQ A;  4X2O A;  1BUJ A;  3KSE D;  1VQM 3;  1YGE A;  2BMO B;  1VQL 3;  3EQQ B;  1FYS A;  3B4P A;  2C10 A;  1RGA A;  4XM4 A;  3PXM A;  4LSO A;  1I2G A;  1QAL A;  1UI8 A;  1BVI A;  3JUO A;  3MG2 A;  2P0X A;  1JNQ A;  3ALA A;  3GWR A;  1N8R 4;  1M1K 4;  3AHW A;  3BLZ A;  3H3H A;  4H3U A;  3UJM A;  5G2G A;  4RBN A;  2CK3 H;  1K28 A;  4NRE A;  4DKI A;  1RNB A;  2HOH A;  1LOV A;  4XBT A;  1R4Y A;  3PCS A;  5AI1 A;  3KE7 A;  2ZL8 A;  1FUW A;  1EUI C;  4FMB A;  4MMX B;  2SBL A;  2YFL B;  1RDS A;  2R41 A;  2Z7A A;  1JV2 B;  1LQG C;  4HAA A;  3N9H A;  3NQY A;  4BL2 A;  1WQL B;  5HOH A;  1NJI 4;  3OV4 A;  1I70 A;  3X3Z A;  4X2H A;  1AV4 A;  5JPU A;  3V98 A;  4EYC A;  3RGR A;  3EN8 A;  1IVU A;  2W9P A;  4BTY A;  1Q82 4;  3B8L A;  8CHO A;  3NUV A;  3K7C A;  1GOV A;  4FMA A;  3KSP A;  2K0M A;  1BRS A;  1K73 4;  1B2X A;  1AVL A;  4R1K A;  5CF1 A;  3PGB A;  1KC8 4;  1BNJ A;  1IU7 A;  3DGO A;  3FF0 A;  1GMR A;  2YX9 A;  2OTL 3;  3BU4 A;  1O7H B;  5D81 A;  1W6C A;  2W04 A;  1OPY A;  2HMN B;  5TGN A;  3V92 A;  2CG0 A;  2JQ5 A;  2D42 A;  3FKA A;  1FUS A;  1RN7 A;  2XRX B;  5GSP A;  3OWY A;  4J9A A;  4O3V A;  1BNS A;  3FG4 A;  3NM2 A;  2MC8 A;  2XSH B;  1VQN 3;  3STD A;  2CFK A;  4HVN A;  3DH2 A;  1KWI A;  1DVC A;  2CFL A;  1BAN A;  1AVK A;  1Z1S A;  1DMM A;  3FZW A;  1BNE A;  1K41 A;  3IMA B;  3IJE B;  1T2H A;  4XBY A;  4KVH A;  1D6Z A;  1GYB A;  2GXF A;  3HI7 A;  4KFF A;  1JB2 A;  1GSP A;  5AII A;  5HGR A;  3X3X A;  3VSY A;  3BNB A;  1A2V A;  2LYX A;  5IEN A;  1N9E A;  1I2F A;  3AMO B;  1QMA A;  1VQK 3;  1M9G A;  3OWU A;  3SLU A;  1YHQ 3;  6GSP A;  1RGH A;  4LYL B;  4JF8 A;  9RNT A;  1IV9 A;  1E3V A;  5ELJ A;  4I4K A;  3EF8 A;  1O7W B;  3Q1C A;  1Q7Y 4;  1CH0 A;  4HM3 B;  1SPU A;  4R9L A;  4HM0 B;  5IW9 A;  5RNT A;  1MOL A;  1UGI A;  1AR0 A;  2WGQ A;  1HYF A;  2V1L A;  3DZL A;  1JN5 B;  1HKX A;  1NWW A;  5DRE A;  2GBX B;  5JPP A;  5IG5 A;  3NV0 B;  2L1S A;  4FMC A;  4N6T A;  2Z77 A;  3BND A;  4AKZ A;  4HM4 B;  3WOD G;  1A2P A;  3LTC A;  1MGR A;  3AHS A;  4BU4 A;  5IEO A;  3E99 A;  1QJG A;  1UCJ A;  2M7O A;  2O9U X;  1EEJ A;  3OX9 A;  5EVH A;  1EQK A;  2CWT A;  2UX0 A;  3CCJ 3;  1RGC A;  5IG0 A;  4BL3 A;  1RGL A;  2W56 B;  3DGY A;  3MG3 A;  4OUQ A;  3D5G A;  4TX4 A;  1I3F A;  3LTA A;  2B1X B;  1RGG A;  1TU5 A;  1RN4 A;  1WMN A;  2IUK A;  2K54 A;  1IT8 A;  4L7K A;  1RJO A;  4KT3 B;  1OHO A;  3CCR 3;  3G8Z A;  3DXO A;  1BOX A;  1N9J A;  4HM8 B;  2XFT A;  2XFS A;  3RGA A;  3LYG A;  4IPB A;  4LZI A;  1D6Y A;  3CCQ 3;  3LML A;  1JJ2 2;  1IYY A;  3SVA A;  3F8H A;  3MSO A;  1D6U A;  2XR8 B;  3URP A;  2CWU A;  4CCV A;  1AQZ A;  2GU1 A;  1M1X B;  3NX0 A;  1IT7 A;  1U8C B;  4AEQ A;  1MWU A;  5G1K A;  1QVG 2;  4N6L A;  1I3I A;  2K3D A;  3MG1 A;  3WDG B;  1O7N B;  3SOA A;  5IER A;  2F5M A;  5JBS A;  1W6G A;  1S5A A;  3M8C A;  1JZD A;  1ZGX A;  5ELU A;  3CC7 3;  1B2M A;  1BNI A;  1FZU A;  1LOX A;  3OW2 2;  3PS8 A;  1X1Y A;  3WA2 X;  4I5Q A;  3I56 3;  5I97 A;  3S28 A;  3Q3F A;  3LT9 A;  1RSN A;  1V74 A;  3GZB A;  3LH4 A;  4O8S A;  2L4V A;  5AYS C;  3ER7 A;  3DUK A;  2XEP A;  1JKG A;  1VQ8 3;  2C11 A;  1IVW A;  1UW1 A;  2A15 A;  1BNF A;  2INX A;  3T0U A;  4HBR A;  1SII A;  4HM5 B;  3VGN A;  1X1W A;  1GS3 A;  3X3Y A;  5M18 A;  3CMA 3;  2OOV A;  1LNI A;  4IT7 A;  4LEH A;  3GZX B;  4NPB A;  3I55 3;  1JBT A;  2I9W A;  4GHO A;  4O02 B;  1N5H A;  4CPK A;  2Z6B A;  1B2S A;  2CX1 A;  2MF7 A;  1YIT 3;  1EA2 A;  2WOF A;  1UI7 A;  2FXT A;  1IV7 A;  4HZB B;  4WP5 A;  2D1W A;  2H0H A;  1B3S A;  1CYV A;  1EG9 B;  3BIR A;  3WOF B;  3FG1 A;  3WOE B;  3UNL A;  3A5E A;  5EEO A;  1QAK A;  1TUH A;  1FW7 A;  2XH9 A;  1I8V A;  1MWR A;  1RNT A;  3F9S A;  1Q40 A;  1G02 A;  3PCR A;  4J5K A;  1W4N A;  2E2U A;  1RN1 A;  2ZHX B;  1Q9E A;  7GSP A;  6RNT A;  3S27 A;  1TJD A;  3D3L A;  2HMM B;  4EW5 A;  2KRT A;  3GZR A;  3K5T A;  1DVD A;  2XGL A;  1B27 A;  1TFO A;  2IUJ A;  1BRK A;  1G0T A;  2W6J H;  5EQL A;  1K9M 4;  1C54 A;  3FG3 A;  2AAE A;  1OGX A;  3PZW A;  1E3R A;  3KCH A;  1DMQ A;  1T2I A;  3EX9 A;  3CPW 2;  4OK0 A;  3O8Y A;  1IVV A;  1VQO 3;  1UUW B;  2F4Y A;  5BVB A;  1I2E A;  2OTJ 3;  1MWS A;  4HM6 B;  3EC9 A;  1YGW A;  2STD A;  2W9Q A;  2W2C A;  1TIJ A;  4WYK A;  2QEX 3;  1HU9 A;  3LT8 A;  1Q81 4;  1YJW 3;  1GD4 A;  1FGM A;  3IPT A;  4GB5 A;  7STD A;  3CC2 3;  2BU4 A;  4BTX A;  2B24 B;  3D79 A;  1BIR A;  1TRQ A;  4EV5 A;  1HZ1 A;  1JZO A;  3A76 A;  1OF5 A;  2KF6 A;  3F7X A;  1NNV A;  1EKM A;  2CFW A;  2H0I A;  1PU4 A;  1IVX A;  2PNC A;  3CNX A;  3G16 A;  1NO3 A;  1CEW I;  1LXE A;  1OHP A;  1Y4K A;  2E2V A;  4EBG A;  3NHX A;  4N6U A;  5KP1 A;  1UDI I;  2P38 A;  4EC6 A;  2OQE A;  1RHL A;  3B4O A;  3JVC A;  1E97 A;  3LTD A;  1BSD A;  1BNG A;  5IEP A;  1BAO A;  5AIG A;  5BXQ A;  1YJ9 3;  3JUM A;  5M19 A;  1WMP A;  3MYT A;  1RLS A;  1A90 A;  1FGR A;  4N3V A;  2HML B;  3NBB A;  3CU3 A;  1W00 A;  1ISK A;  4XB5 A;  2GEY A;  3LOY A;  3FLJ A;  3CCU 3;  1NU3 A;  1O7P B;  4JRF A;  3Q90 A;  1DE3 A;  4FMD A;  5AYR B;  6STD A;  4XDV A;  4KZ1 A;  3X40 A;  4AKY A;  2GSP A;  3ECF A;  5AEU B;  1JBR A;  5KP4 A;  1BRG A;  2BT3 A;  3U97 A;  4FCM A;  1N8Q A;  2E2T A;  1NDO B;  3F14 A;  3F8X A;  5CF2 A;  5D82 A;  4N6O B;  2W0Q A;  1KSI A;  3VF1 A;  1GY5 A;  1GMQ A; 
#chains in the Genus database with same CATH homology
 2F5M A;  1ZGX A;  1RGK A;  2KF4 A;  5HOH A;  1B2M A;  1BNI A;  1FZU A;  1YVS A;  1I70 A;  1LOW A;  1X1Y A;  4HOH A;  1RCL A;  3D5I A;  1SAR A;  1LOY A;  1BRN L;  3Q3F A;  1GOU A;  1RSN A;  1JBS A;  1RGE A;  1GOV A;  2F5W A;  1BRS A;  1BNR A;  1BNF A;  1B2X A;  1BNJ A;  3D4A A;  1GMR A;  1X1W A;  3BU4 A;  1LNI A;  1B21 A;  1JBT A;  1I0X A;  1BRI A;  4GHO A;  1BRJ A;  8RNT A;  1B2S A;  1BSB A;  1BGS A;  1FUS A;  5GSP A;  3RNT A;  1RMS A;  1BNS A;  1B3S A;  3BIR A;  1GMP A;  3DH2 A;  1UCL A;  1FUT A;  2RNT A;  3GSP A;  2RBI A;  3A5E A;  1LRA A;  1FW7 A;  3WHO A;  1I8V A;  1TRP A;  1BAN A;  1RNT A;  5BU4 A;  1G02 A;  4J5K A;  1B2U A;  1BNE A;  1Q9E A;  1RN1 A;  1BSA A;  1PYL A;  1T2H A;  1UCK A;  6RNT A;  7GSP A;  1MGW A;  1I0V A;  1B27 A;  1BU4 A;  1BRK A;  1GSP A;  1C54 A;  2AAE A;  3KCH A;  2KAA A;  1B2Z A;  1T2I A;  3AGO A;  5BIR A;  1I2F A;  7RNT A;  1BRH A;  6GSP A;  1RGH A;  4RNT A;  2F4Y A;  9RNT A;  1I2E A;  1PY3 A;  1YGW A;  4GSP A;  1RGF A;  1CH0 A;  1BSE A;  2C4B A;  1DET A;  5RNT A;  2F56 A;  1HYF A;  2BU4 A;  1BIR A;  1TRQ A;  1B20 A;  1HZ1 A;  1UCI A;  2KF3 A;  2KF6 A;  1YNV X;  3SYU A;  1TTO A;  1A2P A;  1MGR A;  1X1X A;  1X1U A;  3AHS A;  4BU4 A;  2KF5 A;  1UCJ A;  1BSC A;  1BUJ A;  1RHL A;  1BSD A;  1RGC A;  1GOY A;  1BNG A;  1RGL A;  1BAO A;  1FYS A;  3AGN A;  3DGY A;  3D5G A;  1I3F A;  1RGA A;  1RLS A;  1RTU A;  4HAA A;  1I2G A;  1RGG A;  3HOH A;  1RN4 A;  1BVI A;  2SAR A;  1BOX A;  1AY7 A;  3AHW A;  3WR2 A;  1DE3 A;  2AAD A;  1RNB A;  4BIR A;  1IYY A;  2HOH A;  1LOV A;  2ZA4 A;  2GSP A;  1R4Y A;  1JBR A;  3URP A;  1BRG A;  2BIR A;  1AQZ A;  1RCK A;  1RDS A;  1I3I A;  4J5G A;  1GMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...