3SEDA

Crystal structure of ketosteroid isomerase variant m105a from pseudomonos putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNQPCALDVIDVARFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title A tale of two isomerases: compact versus extended active sites in ketosteroid isomerase and phosphoglucose isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 34
structure length 124
sequence length 125
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3sedA00
3DUKA 5AI1A 1GS3A 3G16A 2GXFA 1U5OA 6STDA 2R4IA 2I9WA 3F40A 3D9RA 3GRDA 4N3VA 2F98A 4X2HA 3HK4A 3FF2A 3KE7A 3G8ZA 1W00A 1E3VA 3JUOA 5AIIA 1OHPA 5KP4A 2YFIB 2HMKB 1JN5B 4R9KA 1JKGA 2IMJA 5D81A 3CNMA 3OWUA 5IEOA 3NBRA 1GYBA 3F14A 5JPPA 1OH0A 3F9SA 3ECFA 1UUVB 5KP3A 2QIYA 1Z1SA 1QMAA 3DXOA 4K1VA 4FCJA 5IG3A 2GEXA 4HM2B 5IF6A 4XDVA 1O7NB 1JB5A 5BXQA 3OWYA 2Z7AA 1DMMA 5IERA 3KSPA 3A76A 3RGAA 3EHCA 4WYKA 5CF1A 4I4KA 1GY5A 4XDWA 2QGUA 1OHOA 2B24B 3NM2A 4CDLA 4XBYA 3EX9A 2Z77A 2F99A 1O7MB 1ASKA 3E99A 1OHSA 4L8PA 3OXAA 5IG4A 3WMDA 1JN5A 3MHEA 4U13A 4X2OA 3NV0B 7STDA 2RGQA 2Z76A 3F7SA 4OUQA 3EC9A 1O7GB 3B7CA 4LEHA 3FLJA 1SJWA 2HMOB 4KVHA 2INXA 5DRVA 5CK6A 3GZRA 1IDPA 1DMNA 4J9AA 3M8CA 1STDA 1OF5B 3HZPA 1NDOB 5AIHA 1OGZA 4PEJA 3JUNA 5IENA 5TGNA 3VGNA 2K54A 1HKXA 5KP1A 3SOYA 1GY7A 3EBYA 5IG5A 1W6YA 3MSOA 1NWWA 1W01A 2YFJB 1EA2A 3MG1A 5AIGA 5AEUB 8CHOA 4H3UA 2JQ5A 4R1KA 5CF2A 3K0ZA 2F86B 2BNGA 4GB5A 4HM8B 1TUHA 4HZ9B 1C7HA 4LGQA 3F7XA 2XSOB 5EVHA 5HGRA 3MG3A 3EJVA 1GY6A 3NV0A 1E3RA 4HKVB 5G2GA 5STDA 3T8UA 3FF0A 3K7CA 1Q40B 1JB2A 2HMJB 3MG2A 2HMMB 1OF5A 3B4OA 1O7WB 3H3HA 1ISKA 1DMQA 3BLZA 3FH1A 3JUQA 1ZX2A 2RFRA 3B4PA 4HM6B 1O7PB 2GBWB 3H51A 2XR8B 2W2CA 4L7KA 3DMCA 4RZMA 4HM4B 1NU3A 3EN1B 3EN8A 1OGXA 4J8TA 1BUQA 4FCMA 4HJLB 4R9LA 2PZVA 1QJGA 3STDA 3LZAA 5FW5A 4XBXA 1ZO2A 1TP6A 4HM3B 4WWUC 3F8XA 3DM8A 4HZBB 3HX8A 1OUNA 1W02A 3MYTA 3UNLA 3OWSA 4OVMA 1Q40A 1E97A 2BMOB 4HM0B 3GZBA 4HM7B 4WYKB 5IG0A 2B1XB 1AR0A 1Q42A 3LYGA 3GZXB 2RCDA 2GEYA 1OPYA 3EBTA 3EQQB 4WP5A 1OCVA 1A2KA 2GBXB 1ULIB 4STDA 5CXOA 5D82A 4HVNA 4LMIA 2CKFB 3GWRA 3JUMA 3ROBA 5CLKA 5IEPA 3B8LA 3MKIA 3SEDA 3ER7A 1JB4A 1CQSA 3NXJA 3GZYB 3S5CA 3IPTA 2STDA 3SOAA 5AIFA 3Q90A 3T8NA 5JPUA 2XRXB 4XM4A 2BMRB 4L8OA 3RGRA 2HMNB 3NHXA 5D83A 4XBTA 1VZZA 4XB5A 3F8HA 3OX9A 1UUWB 4HM1B 1O7HB 3DZLA 2HMLB 3CNXA 3NUVA 3UJMA 3I0YA 1JKGB 3FZWA 3FGYA 2YFLB 3FKAA 2A15A 3EF8A 1S5AA 3OV4A 3CPOA 4ORLA 3JUPA 4K1UA 3G0KA 4HM5B 4MJDA 1ULJB 2UX0A 3BB9A 3CU3A 3FSDA 1WQLB 4Q53A 5DREA 2BMQB 4IIAA 2CHCA 1EG9B 5BVBA 2OWPA 2XSHB 1K41A 3KKGA 3KZTA 5AEWB 3VSYA
chains in the Genus database with same CATH superfamily
3DH2A 3DUKA 5AI1A 5IW9A 1GS3A 4O8SA 1KSIA 3G16A 4N6LA 1W5ZA 4EXRA 2GXFA 4KFFA 1MGRA 1U5OA 6STDA 3NQZA 1YGWA 4HYZA 2R4IA 4J5GA 3AGOA 1VQ83 1GD3A 2I9WA 3CCJ3 3F40A 3CME3 2P09A 3LTAA 1IQYA 3LTDA 2FNQA 3D9RA 1RRLA 1UUGB 3GRDA 4N3VA 2WO0A 1RSNA 2F98A 1RNTA 3NQYA 1LNIA 4X2HA 2CFKA 3LTCA 1EQKA 3HK4A 3PGBA 1V74A 1PU4A 3A5EA 3CC73 1W2ZA 3N54B 3FF2A 2CIUA 2CFLA 1BU4A 1JNQA 2WGQA 3KE7A 4FMDA 1UDII 3PCSA 1X1XA 1EUIC 3CCV3 2SBLA 2MF7A 3G8ZA 5M18A 1ZGXA 5M19A 1W00A 2KF3A 1E3VA 3JUOA 1X1WA 1OHPA 4OK0A 5AIIA 1JV2B 1BRGA 1FGOA 5KP4A 1ZS7A 2C4BA 2KCDA 1JBSA 1LRAA 2W9PA 2Y73A 4N6V0 7GSPA 2YFIB 2HMKB 1CYVA 1NJI4 1RRHA 1JN5B 4R9KA 2PNCA 3NX0A 2W56B 4GHOA 1VQ63 2WOHA 1JKGA 3L0RA 1BSEA 3D79A 3KCHA 1A2VA 4K90B 3K63A 2IMJA 4BTXA 1AVKA 2W04A 5D81A 3CNMA 3OWUA 2IUKA 1K734 1NB5I 3AMOB 5IEOA 3NBRA 1GYBA 3F14A 1EEJA 4RNYA 2F56A 5JPPA 8RNTA 1OH0A 3RDEA 3VF1A 1VQ43 4CCVA 1SIHA 2F4YA 1DETA 3F9SA 3ECFA 4RNZA 1UUVB 5KP3A 1K28A 2IY2A 2W0QA 4LSOA 2QIYA 1RHLA 1Z1SA 1QMAA 1TRPA 3KSED 4O2HA 1I2FA 3DXOA 1BUJA 3WR2A 3D5GA 4N6OB 4K1VA 1WMOA 1RLSA 1RGEA 2C11A 2GEXA 4FCJA 5IG3A 3CC43 1JBRA 4HM2B 1HYFA 3K5TA 1VQM3 5IF6A 2R41A 3X3YA 2KAAA 6GSPA 4XDVA 1W2B2 2UGIA 1O7NB 1JB5A 4MMXB 5BXQA 1BSCA 1TFKA 3NM7A 3OW22 1VQK3 3AHWA 3OWYA 1W6CA 2Z7AA 1DMMA 1VQL3 4NHFA 3KSPA 5IERA 1YVSA 3A76A 3X3XA 2L1SA 5G1LA 4N6MA 1UCKA 3RGAA 1SIIA 5ELJA 1GOYA 4K61A 2AADA 3DGOA 1UI8A 2W6JH 3EHCA 1RGAA 3Q1CA 3GSPA 2QEX3 2RBIA 4RNTA 1BRIA 1QALA 4WYKA 1RTUA 1EKMA 5CF1A 1B2MA 1WMNA 1T2HA 4I4KA 1J2BA 1GY5A 1I0XA 4XDWA 3BU4A 3EB8A 2QGUA 3IJEB 1B2UA 1OHOA 1FUSA 2CH9A 2B24B 3NM2A 4CDLA 4XBYA 1ROVA 2Y74A 3EX9A 2Z77A 4CPKA 3CCU3 1YIJ3 1BOXA 2F99A 9RNTA 4CJNA 3VSYA 1O7MB 5GSPA 5EQLA 1ASKA 3E99A 3LTBA 1RCLA 1OHSA 4L8PA 1YJ93 1FGMA 3OXAA 5IG4A 4BTYA 1I8VA 4BL3A 3WMDA 1JN5A 3MHEA 4U13A 4JF8A 4X2OA 3NV0B 1M1K4 2XH9A 7STDA 2RGQA 2Z76A 3F7SA 4OUQA 2MC8A 3EC9A 3Q3FA 1JRQA 1U8CB 1O7GB 3B7CA 4FMCA 4LEHA 3WA3A 2WGOA 1RGLA 1SJWA 3AMOA 2IA7A 2HMOB 2XGLA 3D3LA 1W6GA 3FLJA 4FMAA 3WHOA 4KVHA 1KWIA 2INXA 5DRVA 5CK6A 1BNSA 3GZRA 1F8NA 1MWTA 1D6YA 1IDPA 6RNTA 1BRJA 1DMNA 1I0VA 2H0IA 3HI7A 2KF6A 2Z6BA 4J9AA 3M8CA 1BANA 2M7OA 2P38A 1STDA 2RSXA 3G4S3 2OTL3 1FW7A 1OF5B 1SQWA 1YNVX 3HZPA 1NDOB 1RGKA 5AIHA 1OGZA 1Q7HA 1DVCA 1BRNL 1N9JA 3JUNA 4PEJA 1QVF2 1BNEA 1X1UA 1SPUA 5RNTA 3J7Yd 3CCM3 5IENA 1MGWA 2CG0A 1MNLA 3GAXA 5TGNA 2LYXA 1GMQA 1B3SA 3URPA 3VGNA 4WHAA 3FG1A 2K54A 2BU4A 5HOHA 2KF5A 1HKXA 1YJN3 1RGCA 5KP1A 3KFQC 3SOYA 3QRDA 1VQP3 1GY7A 3HOHA 1A90A 2XFSA 3EBYA 2H0HA 3D4AA 3DGMA 5IG5A 2OCTA 1BNIA 1B2XA 1GSPA 1MWUA 2FXTA 1S723 1W6YA 1JBTA 1IYYA 1W7CA 4O02B 3D5IA 1PY3A 1I2GA 3MSOA 1QAKA 1NWWA 5JBSA 3V92A 1UW1A 1W01A 3BIRA 4FMBA 1UCJA 3G6E3 2OOVA 2YFJB 3X41A 1EA2A 2E2UA 3MG1A 5AIGA 2KXGA 4ILFA 5AEUB 8CHOA 4H3UA 2JQ5A 1D6UA 3CCR3 4R1KA 5CF2A 1RNBA 3K0ZA 5BU4A 2F86B 1G96A 4GL6A 2BNGA 2UUGC 3KIIA 4GB5A 5AYSC 1YGEA 4HM8B 1TUHA 4HZ9B 1GMRA 3LOYA 1C7HA 4N6TA 3S29A 4LGQA 3TDGA 4AEQA 3LXUX 3F7XA 3CCL3 3FCSB 3EE1A 1RN1A 2XSOB 2CWUA 3SVAA 2BIRA 1UI7A 3JVCA 5EVHA 3S28A 2F5WA 1HZ1A 2YX9A 3EJVA 1GY6A 1GOVA 3MG3A 3NV0A 5HGRA 4EW5A 1CH0A 5LC7A 3BNBA 1RKYA 1K8A4 2BHMA 1UCIA 3CCE3 1FYSA 1E3RA 1DYUA 2OOVC 4IPBA 1VQO3 3AHSA 3KN4A 3X40A 1KD14 4HKVB 5G2GA 1TTOA 1LOWA 4G1MB 2FGTA 4HBRA 5STDA 2E2TA 3T8UA 2Q07A 3FG4A 3K9MC 3LT8A 3CXC2 3FF0A 3K7CA 1Q40B 4IT7A 4EBGA 1YHQ3 1BNJA 1JB2A 4I5QA 1TU5A 2CFWA 1BAOA 2HMJB 1BSAA 1N8QA 1V58A 3UL5A 1TJDA 2K3DA 7RNTA 2LQVA 3MG2A 2ZDJA 3CPW2 2HMMB 1OF5A 5EEOA 1Q7Y4 1GD4A 1JZDA 2JDIH 3G713 3B4OA 1O7WB 3X3ZA 3BNEA 4QWTA 5LC6A 3WDGB 3ZG5A 3CC23 2KRTA 4FCZA 4EV5A 1FA3A 1LOXA 3ALAA 3H3HA 1VQ73 2P0XA 1STFI 2RNTA 1BNRA 1YJW3 1BRKA 1ISKA 1DMQA 4R4KA 4DKIA 2W03A 4NPBA 4NREA 3LMLA 3BLZA 4N6UA 2XGNA 2ZHXB 3FH1A 2ZL8A 4EV2A 2K0MA 1Y4KA 2BO9B 3JUQA 1NNVA 2CWTA 3N9HA 1ZX2A 4BL2A 2W56A 2RFRA 1L5GB 4AKYA 1K9M4 3B4PA 4HM6B 1Q814 1SARA 1O7PB 1B27A 2GBWB 1IK3A 3H51A 1B20A 1FZUA 2XR8B 1BNFA 1JZOA 1Q864 2W2CA 2ML5A 4L7KA 1IVVA 1WTHA 4EYCA 1X1YA 2QA43 3DMCA 3HIGA 4RZMA 1G0TA 1TFOA 4HM4B 4KFEA 1NU3A 1Q824 1DE3A 1QAFA 3EN1B 3EN8A 1NO3A 1WMPA 1B2ZA 1OGXA 2C10A 4J8TA 1BUQA 4FCMA 3AGNA 4HJLB 1ROAA 4R9LA 2KF4A 2PZVA 1RN4A 2GSPA 1RCKA 3V99A 1M9GA 1NB3I 3MWZA 1QJGA 3STDA 1A67A 4JRFA 2XEPA 4ZM8A 3LZAA 5FW5A 1BNGA 2CC3A 1PYLA 2P05A 4KFDA 1FUTA 1TP6A 1ZO2A 1AVLA 2CX0A 4XBXA 4HM3B 3S27A 1M904 1MOLA 1I70A 3F8XA 4WWUC 3X42A 1FGTA 3DM8A 4LZIA 4HZBB 3HX8A 1OUNA 1MWRA 1W02A 1VQ53 1PFPA 1LVNA 2F5MA 3MYTA 1G02A 2D42A 3UNLA 2CFGA 2V1LA 3I553 1KC84 3OWSA 5BIRA 4OVMA 1VQ93 1Q40A 1E97A 2BMOB 3IMAB 4HM0B 3GZBA 4HM7B 4WYKB 2CW9A 4AKZA 1UGHI 5IG0A 1LXEA 1YVBI 2B1XB 1AR0A 1CEWI 2SARA 3FG3A 1W4NA 1Q42A 3LYGA 5ELUA 3LT9A 4HOHA 3CCS3 1BGSA 3GZXB 4O3VA 2IYJA 1VQN3 1KQS2 1DVDA 2HOHA 2RCDA 3PXMA 1I3IA 2GEYA 5I97A 3ZFZA 1OPYA 3S67A 1IU7A 3CCQ3 3EBTA 4FR9A 5A0OB 1N8R4 1GOUA 3EQQB 4WP5A 2E2VA 3UL6A 1LQMB 1LOVA 1OCVA 1A2KA 2L4VA 3WA2X 2GBXB 1ULIB 4KT3B 4MMZB 2CWVA 3BNDA 4STDA 5CXOA 5D82A 3PS8A 1BSDA 1N9EA 2H0GA 4HVNA 3SYUA 1YI23 1IT7A 4LMIA 2CKFB 1M1XB 3CMA3 1CYUA 3NBBA 3PYJA 3GWRA 3O8YA 3JUMA 3ROBA 3ZG0A 3WOFB 5CLKA 5IEPA 1AY7A 1RGHA 3B8LA 3MKIA 4TX4A 3SEDA 1BRSA 2O9UX 2CG1A 1AQZA 1YIT3 3ER7A 1JB4A 1TRQA 1T5YA 1CQSA 4R80A 3I563 3NXJA 2W9QA 1UCLA 3SLUA 3GZYB 1BSBA 1VQQA 3S5CA 4BU4A 3IPTA 2STDA 3QK9A 2D1WA 3SOAA 1BVIA 2CFDA 5AIFA 2ML6A 2OQEA 1RN7A 3Q90A 2O3OA 2OTJ3 2GU3A 3T8NA 3HIIA 1IV9A 5AYRB 5JPUA 2XRXB 4HAAA 4N6NB 4XM4A 2BMRB 4L8OA 2IUJA 3RGRA 3U1WA 2HMNB 1R4CA 2BT3A 3NHXA 2ZA4A 5D83A 4XBTA 3T0UA 1VZZA 5FGOA 1AV4A 3UB1A 1FUWA 1JJ22 4RBNA 3RNTA 4XB5A 3DGLA 3CD63 1IT8A 3F8HA 3PZWA 3OX9A 2GU1A 1I3FA 1UUWB 3Q2PA 4HM1B 4MEIA 1O7HB 1IVWA 1GMPA 4BTWA 3DZLA 1T2IA 2HMLB 1BRHA 1TIJA 1LQGC 1N5HA 2AAEA 3CNXA 1RGFA 3NUVA 3WODG 4WFOA 3UJMA 3I0YA 4EC6A 1JKGB 3FZWA 1WNHA 3FGYA 2YFLB 1RGGA 1UGIA 1D6ZA 2OQEC 1BIRA 3FKAA 2A15A 3EF8A 3DGNA 2CK3H 1C54A 2J8XB 3PCRA 1IVXA 3SXXA 1S5AA 1RMSA 1B2SA 3OV4A 1FGQA 1IQXA 3CPOA 4ORLA 3JUPA 4J5KA 4K1UA 3G0KA 3LH4A 3DGYA 4HM5B 3BNCA 3N8BA 5M1AA 4MJDA 1RDSA 1ULJB 1MWSA 2UX0A 3BB9A 1R4YA 3CU3A 3MPHA 3FSDA 1WQLB 1V57A 4LYLB 4Q53A 2P0MA 1IQ8A 2BMQB 4H61A 4IIAA 2XFTA 5DREA 4BIRA 1HU9A 4KZ1A 4MMYB 2CHCA 1I2EA 3NBJA 4GSPA 1A2PA 1EG9B 2CX1A 3SX1A 1IV7A 2WOFA 5G1KA 3U97A 5BVBA 2OWPA 1RJOA 1B21A 1IVUA 1N5PA 3DY5A 3V98A 2XSHB 1K41A 3KKGA 3WOEB 1QVG2 1LNHA 1LOYA 1OACA 1T3BA 3KZTA 5AEWB 2XF3A 1US1A 1Q9EA 1FGRA
chains in the Genus database with same CATH topology
3DUKA 5AI1A 5IW9A 1GS3A 4O8SA 1KSIA 3G16A 4N6LA 1W5ZA 4EXRA 2GXFA 4KFFA 1U5OA 6STDA 3NQZA 4HYZA 2R4IA 1VQ83 1GD3A 2I9WA 3CCJ3 3F40A 3CME3 2P09A 3LTAA 1IQYA 3LTDA 2FNQA 3D9RA 1RRLA 3GRDA 4N3VA 2WO0A 2F98A 3NQYA 4X2HA 2CFKA 3LTCA 1EQKA 3HK4A 3PGBA 1V74A 1PU4A 3CC73 1W2ZA 3N54B 3FF2A 2CIUA 2CFLA 1JNQA 2WGQA 3KE7A 4FMDA 3PCSA 3CCV3 2SBLA 2MF7A 3G8ZA 1W00A 1E3VA 3JUOA 4OK0A 1OHPA 5AIIA 5KP4A 1JV2B 1FGOA 2KCDA 2W9PA 2Y73A 4N6V0 2YFIB 2HMKB 1CYVA 1NJI4 1RRHA 1JN5B 4R9KA 2PNCA 3NX0A 2W56B 1VQ63 2WOHA 1JKGA 3L0RA 4K90B 1A2VA 4BTXA 3K63A 2IMJA 1AVKA 2W04A 5D81A 3CNMA 3OWUA 2IUKA 1K734 1NB5I 3AMOB 5IEOA 3NBRA 1GYBA 3F14A 4RNYA 5JPPA 1OH0A 3RDEA 3VF1A 1VQ43 4CCVA 1SIHA 3F9SA 3ECFA 4RNZA 1UUVB 5KP3A 1K28A 2W0QA 4LSOA 2QIYA 1Z1SA 1QMAA 3KSED 4O2HA 3DXOA 4N6OB 4K1VA 1WMOA 4FCJA 2C11A 2GEXA 5IG3A 3CC43 4HM2B 3K5TA 1VQM3 5IF6A 3X3YA 4XDVA 1W2B2 1O7NB 1JB5A 4MMXB 5BXQA 1TFKA 3NM7A 3OW22 1VQK3 3OWYA 1W6CA 2Z7AA 1DMMA 1VQL3 4NHFA 3KSPA 5IERA 3A76A 3X3XA 4N6MA 3RGAA 1SIIA 5ELJA 4K61A 3DGOA 1UI8A 2W6JH 3EHCA 3Q1CA 2QEX3 1QALA 4WYKA 1J2BA 1EKMA 5CF1A 1WMNA 4I4KA 1GY5A 4XDWA 3EB8A 2QGUA 3IJEB 1OHOA 2CH9A 2B24B 3NM2A 4CDLA 4XBYA 1ROVA 2Y74A 3EX9A 2Z77A 3CCU3 1YIJ3 2F99A 3VSYA 1O7MB 5EQLA 1ASKA 3E99A 3LTBA 1OHSA 4L8PA 1YJ93 1FGMA 3OXAA 5IG4A 4BTYA 3WMDA 1JN5A 3MHEA 4U13A 4JF8A 4X2OA 3NV0B 1M1K4 2XH9A 7STDA 2RGQA 2Z76A 3F7SA 4OUQA 2MC8A 3EC9A 1JRQA 1U8CB 1O7GB 3B7CA 4FMCA 4LEHA 3WA3A 2WGOA 3AMOA 1SJWA 3FLJA 2IA7A 2HMOB 2XGLA 3D3LA 1W6GA 4FMAA 4KVHA 1KWIA 2INXA 5DRVA 5CK6A 3GZRA 1F8NA 1D6YA 1IDPA 1DMNA 3HI7A 2Z6BA 4J9AA 3M8CA 2M7OA 2P38A 2RSXA 1STDA 3G4S3 2OTL3 1OF5B 1SQWA 3HZPA 1NDOB 5AIHA 1OGZA 1DVCA 1N9JA 3JUNA 4PEJA 1QVF2 1SPUA 3J7Yd 3CCM3 5IENA 2CG0A 1MNLA 3GAXA 5TGNA 2LYXA 3VGNA 4WHAA 3FG1A 2K54A 1HKXA 1YJN3 5KP1A 3KFQC 3SOYA 3QRDA 1VQP3 1GY7A 1A90A 2XFSA 3EBYA 3DGMA 5IG5A 2OCTA 2FXTA 1S723 1W6YA 1W7CA 4O02B 3MSOA 1QAKA 1NWWA 5JBSA 3V92A 1UW1A 1W01A 4FMBA 3G6E3 2OOVA 2YFJB 3X41A 1EA2A 2E2UA 3MG1A 5AIGA 2KXGA 5AEUB 8CHOA 4H3UA 2JQ5A 1D6UA 3CCR3 4R1KA 5CF2A 3K0ZA 2F86B 1G96A 4GL6A 2BNGA 3KIIA 4GB5A 5AYSC 1YGEA 4HM8B 1TUHA 4HZ9B 3LOYA 1C7HA 4N6TA 3S29A 4LGQA 3TDGA 4AEQA 3LXUX 3F7XA 3CCL3 3FCSB 3EE1A 2XSOB 2CWUA 3SVAA 1UI7A 3JVCA 5EVHA 3S28A 2YX9A 3EJVA 3MG3A 1GY6A 3NV0A 5HGRA 5LC7A 3BNBA 1RKYA 1K8A4 2BHMA 3CCE3 2OOVC 1E3RA 1DYUA 4IPBA 1VQO3 3KN4A 3X40A 1KD14 4HKVB 5G2GA 4G1MB 2FGTA 4HBRA 5STDA 2E2TA 3T8UA 2Q07A 3FG4A 3K9MC 3LT8A 3CXC2 3FF0A 3K7CA 1Q40B 4IT7A 4EBGA 1YHQ3 1JB2A 1TU5A 2CFWA 3UL5A 2HMJB 1N8QA 2LQVA 3MG2A 2ZDJA 3CPW2 2HMMB 1OF5A 5EEOA 1Q7Y4 1GD4A 2JDIH 3G713 3B4OA 1O7WB 3X3ZA 3BNEA 4QWTA 5LC6A 3WDGB 3CC23 2KRTA 4FCZA 4EV5A 1FA3A 1LOXA 3ALAA 3H3HA 1VQ73 2P0XA 1STFI 1YJW3 1ISKA 1DMQA 4R4KA 2W03A 4NREA 3LMLA 3BLZA 4N6UA 2XGNA 3FH1A 2ZL8A 4EV2A 2K0MA 1Y4KA 2BO9B 3JUQA 2CWTA 3N9HA 1ZX2A 2W56A 2RFRA 1L5GB 4AKYA 1K9M4 3B4PA 4HM6B 1Q814 1O7PB 2GBWB 1IK3A 3H51A 2XR8B 1Q864 2W2CA 2ML5A 4L7KA 1IVVA 1WTHA 4EYCA 2QA43 3DMCA 3HIGA 4RZMA 1TFOA 4HM4B 4KFEA 1NU3A 1Q824 1QAFA 3EN1B 3EN8A 1NO3A 1WMPA 1OGXA 2C10A 4J8TA 1BUQA 4FCMA 4HJLB 1ROAA 4R9LA 2PZVA 3V99A 1M9GA 1NB3I 3MWZA 1QJGA 3STDA 1A67A 4JRFA 2XEPA 4ZM8A 3LZAA 5FW5A 4KFDA 2CC3A 2P05A 4XBXA 1ZO2A 1TP6A 1AVLA 4HM3B 3S27A 1M904 1MOLA 4WWUC 3F8XA 3X42A 1FGTA 3DM8A 4LZIA 4HZBB 3HX8A 1OUNA 1W02A 1VQ53 1PFPA 1LVNA 3MYTA 3UNLA 2D42A 2CFGA 2V1LA 3I553 1KC84 3OWSA 1VQ93 4OVMA 1Q40A 1E97A 2BMOB 3IMAB 4HM0B 3GZBA 4HM7B 4WYKB 2CW9A 4AKZA 5IG0A 1LXEA 1YVBI 2B1XB 1AR0A 1CEWI 3FG3A 1W4NA 1Q42A 3LYGA 5ELUA 3LT9A 3CCS3 3GZXB 4O3VA 1VQN3 1KQS2 1DVDA 2RCDA 3PXMA 2GEYA 5I97A 1OPYA 3S67A 1IU7A 3CCQ3 3EBTA 4FR9A 5A0OB 1N8R4 3EQQB 4WP5A 2E2VA 3UL6A 1OCVA 1A2KA 2L4VA 3WA2X 2GBXB 1ULIB 4MMZB 2CWVA 3BNDA 4STDA 5CXOA 5D82A 3PS8A 1N9EA 4HVNA 1YI23 1IT7A 4LMIA 2CKFB 1M1XB 3CMA3 1CYUA 3NBBA 3PYJA 3GWRA 3O8YA 3JUMA 3ROBA 3WOFB 5CLKA 5IEPA 3B8LA 3MKIA 4TX4A 3SEDA 2O9UX 2CG1A 1YIT3 3ER7A 1JB4A 1T5YA 1CQSA 4R80A 3I563 3NXJA 2W9QA 3SLUA 3GZYB 3S5CA 3IPTA 2STDA 3QK9A 2D1WA 3SOAA 5AIFA 2CFDA 2ML6A 2OQEA 1RN7A 3Q90A 2O3OA 2OTJ3 2GU3A 3T8NA 3HIIA 1IV9A 5AYRB 5JPUA 2XRXB 4N6NB 4XM4A 2BMRB 4L8OA 2IUJA 3RGRA 3U1WA 2HMNB 1R4CA 2BT3A 3NHXA 5D83A 4XBTA 3T0UA 1VZZA 5FGOA 1AV4A 3UB1A 1FUWA 1JJ22 4RBNA 4XB5A 3DGLA 3CD63 1IT8A 3F8HA 3PZWA 3OX9A 2GU1A 1UUWB 3Q2PA 4HM1B 4MEIA 1O7HB 1IVWA 4BTWA 3DZLA 2HMLB 1TIJA 1N5HA 3CNXA 3NUVA 3WODG 4WFOA 3UJMA 3I0YA 4EC6A 1JKGB 3FZWA 1WNHA 3FGYA 2YFLB 1D6ZA 2OQEC 3FKAA 2A15A 3EF8A 3DGNA 2CK3H 3PCRA 1IVXA 3SXXA 1S5AA 3OV4A 1FGQA 1IQXA 3CPOA 4ORLA 3JUPA 4K1UA 3G0KA 3LH4A 4HM5B 3BNCA 3N8BA 4MJDA 1ULJB 2UX0A 3BB9A 3MPHA 3CU3A 3FSDA 1WQLB 4Q53A 2P0MA 1IQ8A 2BMQB 4H61A 4IIAA 2XFTA 5DREA 1HU9A 4KZ1A 4MMYB 2CHCA 3NBJA 1EG9B 3SX1A 1IV7A 2WOFA 3U97A 5BVBA 2OWPA 1RJOA 1IVUA 1N5PA 3DY5A 3V98A 2XSHB 1K41A 3KKGA 3WOEB 1QVG2 1LNHA 1OACA 3KZTA 5AEWB 2XF3A 1US1A 1FGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DUK A;  5AI1 A;  1GS3 A;  3G16 A;  2GXF A;  1U5O A;  6STD A;  2R4I A;  2I9W A;  3F40 A;  3D9R A;  3GRD A;  4N3V A;  2F98 A;  4X2H A;  3HK4 A;  3FF2 A;  3KE7 A;  3G8Z A;  1W00 A;  1E3V A;  3JUO A;  5AII A;  1OHP A;  5KP4 A;  2YFI B;  2HMK B;  1JN5 B;  4R9K A;  1JKG A;  2IMJ A;  5D81 A;  3CNM A;  3OWU A;  5IEO A;  3NBR A;  1GYB A;  3F14 A;  5JPP A;  1OH0 A;  3F9S A;  3ECF A;  1UUV B;  5KP3 A;  2QIY A;  1Z1S A;  1QMA A;  3DXO A;  4K1V A;  4FCJ A;  5IG3 A;  2GEX A;  4HM2 B;  5IF6 A;  4XDV A;  1O7N B;  1JB5 A;  5BXQ A;  3OWY A;  2Z7A A;  1DMM A;  5IER A;  3KSP A;  3A76 A;  3RGA A;  3EHC A;  4WYK A;  5CF1 A;  4I4K A;  1GY5 A;  4XDW A;  2QGU A;  1OHO A;  2B24 B;  3NM2 A;  4CDL A;  4XBY A;  3EX9 A;  2Z77 A;  2F99 A;  1O7M B;  1ASK A;  3E99 A;  1OHS A;  4L8P A;  3OXA A;  5IG4 A;  3WMD A;  1JN5 A;  3MHE A;  4U13 A;  4X2O A;  3NV0 B;  7STD A;  2RGQ A;  2Z76 A;  3F7S A;  4OUQ A;  3EC9 A;  1O7G B;  3B7C A;  4LEH A;  3FLJ A;  1SJW A;  2HMO B;  4KVH A;  2INX A;  5DRV A;  5CK6 A;  3GZR A;  1IDP A;  1DMN A;  4J9A A;  3M8C A;  1STD A;  1OF5 B;  3HZP A;  1NDO B;  5AIH A;  1OGZ A;  4PEJ A;  3JUN A;  5IEN A;  5TGN A;  3VGN A;  2K54 A;  1HKX A;  5KP1 A;  3SOY A;  1GY7 A;  3EBY A;  5IG5 A;  1W6Y A;  3MSO A;  1NWW A;  1W01 A;  2YFJ B;  1EA2 A;  3MG1 A;  5AIG A;  5AEU B;  8CHO A;  4H3U A;  2JQ5 A;  4R1K A;  5CF2 A;  3K0Z A;  2F86 B;  2BNG A;  4GB5 A;  4HM8 B;  1TUH A;  4HZ9 B;  1C7H A;  4LGQ A;  3F7X A;  2XSO B;  5EVH A;  5HGR A;  3MG3 A;  3EJV A;  1GY6 A;  3NV0 A;  1E3R A;  4HKV B;  5G2G A;  5STD A;  3T8U A;  3FF0 A;  3K7C A;  1Q40 B;  1JB2 A;  2HMJ B;  3MG2 A;  2HMM B;  1OF5 A;  3B4O A;  1O7W B;  3H3H A;  1ISK A;  1DMQ A;  3BLZ A;  3FH1 A;  3JUQ A;  1ZX2 A;  2RFR A;  3B4P A;  4HM6 B;  1O7P B;  2GBW B;  3H51 A;  2XR8 B;  2W2C A;  4L7K A;  3DMC A;  4RZM A;  4HM4 B;  1NU3 A;  3EN1 B;  3EN8 A;  1OGX A;  4J8T A;  1BUQ A;  4FCM A;  4HJL B;  4R9L A;  2PZV A;  1QJG A;  3STD A;  3LZA A;  5FW5 A;  4XBX A;  1ZO2 A;  1TP6 A;  4HM3 B;  4WWU C;  3F8X A;  3DM8 A;  4HZB B;  3HX8 A;  1OUN A;  1W02 A;  3MYT A;  3UNL A;  3OWS A;  4OVM A;  1Q40 A;  1E97 A;  2BMO B;  4HM0 B;  3GZB A;  4HM7 B;  4WYK B;  5IG0 A;  2B1X B;  1AR0 A;  1Q42 A;  3LYG A;  3GZX B;  2RCD A;  2GEY A;  1OPY A;  3EBT A;  3EQQ B;  4WP5 A;  1OCV A;  1A2K A;  2GBX B;  1ULI B;  4STD A;  5CXO A;  5D82 A;  4HVN A;  4LMI A;  2CKF B;  3GWR A;  3JUM A;  3ROB A;  5CLK A;  5IEP A;  3B8L A;  3MKI A;  3SED A;  3ER7 A;  1JB4 A;  1CQS A;  3NXJ A;  3GZY B;  3S5C A;  3IPT A;  2STD A;  3SOA A;  5AIF A;  3Q90 A;  3T8N A;  5JPU A;  2XRX B;  4XM4 A;  2BMR B;  4L8O A;  3RGR A;  2HMN B;  3NHX A;  5D83 A;  4XBT A;  1VZZ A;  4XB5 A;  3F8H A;  3OX9 A;  1UUW B;  4HM1 B;  1O7H B;  3DZL A;  2HML B;  3CNX A;  3NUV A;  3UJM A;  3I0Y A;  1JKG B;  3FZW A;  3FGY A;  2YFL B;  3FKA A;  2A15 A;  3EF8 A;  1S5A A;  3OV4 A;  3CPO A;  4ORL A;  3JUP A;  4K1U A;  3G0K A;  4HM5 B;  4MJD A;  1ULJ B;  2UX0 A;  3BB9 A;  3CU3 A;  3FSD A;  1WQL B;  4Q53 A;  5DRE A;  2BMQ B;  4IIA A;  2CHC A;  1EG9 B;  5BVB A;  2OWP A;  2XSH B;  1K41 A;  3KKG A;  3KZT A;  5AEW B;  3VSY A; 
#chains in the Genus database with same CATH topology
 3DH2 A;  3DUK A;  5AI1 A;  5IW9 A;  1GS3 A;  4O8S A;  1KSI A;  3G16 A;  4N6L A;  1W5Z A;  4EXR A;  2GXF A;  4KFF A;  1MGR A;  1U5O A;  6STD A;  3NQZ A;  1YGW A;  4HYZ A;  2R4I A;  4J5G A;  3AGO A;  1VQ8 3;  1GD3 A;  2I9W A;  3CCJ 3;  3F40 A;  3CME 3;  2P09 A;  3LTA A;  1IQY A;  3LTD A;  2FNQ A;  3D9R A;  1RRL A;  1UUG B;  3GRD A;  4N3V A;  2WO0 A;  1RSN A;  2F98 A;  1RNT A;  3NQY A;  1LNI A;  4X2H A;  2CFK A;  3LTC A;  1EQK A;  3HK4 A;  3PGB A;  1V74 A;  1PU4 A;  3A5E A;  3CC7 3;  1W2Z A;  3N54 B;  3FF2 A;  2CIU A;  2CFL A;  1BU4 A;  1JNQ A;  2WGQ A;  3KE7 A;  4FMD A;  1UDI I;  3PCS A;  1X1X A;  1EUI C;  3CCV 3;  2SBL A;  2MF7 A;  3G8Z A;  5M18 A;  1ZGX A;  5M19 A;  1W00 A;  2KF3 A;  1E3V A;  3JUO A;  1X1W A;  1OHP A;  4OK0 A;  5AII A;  1JV2 B;  1BRG A;  1FGO A;  5KP4 A;  1ZS7 A;  2C4B A;  2KCD A;  1JBS A;  1LRA A;  2W9P A;  2Y73 A;  4N6V 0;  7GSP A;  2YFI B;  2HMK B;  1CYV A;  1NJI 4;  1RRH A;  1JN5 B;  4R9K A;  2PNC A;  3NX0 A;  2W56 B;  4GHO A;  1VQ6 3;  2WOH A;  1JKG A;  3L0R A;  1BSE A;  3D79 A;  3KCH A;  1A2V A;  4K90 B;  3K63 A;  2IMJ A;  4BTX A;  1AVK A;  2W04 A;  5D81 A;  3CNM A;  3OWU A;  2IUK A;  1K73 4;  1NB5 I;  3AMO B;  5IEO A;  3NBR A;  1GYB A;  3F14 A;  1EEJ A;  4RNY A;  2F56 A;  5JPP A;  8RNT A;  1OH0 A;  3RDE A;  3VF1 A;  1VQ4 3;  4CCV A;  1SIH A;  2F4Y A;  1DET A;  3F9S A;  3ECF A;  4RNZ A;  1UUV B;  5KP3 A;  1K28 A;  2IY2 A;  2W0Q A;  4LSO A;  2QIY A;  1RHL A;  1Z1S A;  1QMA A;  1TRP A;  3KSE D;  4O2H A;  1I2F A;  3DXO A;  1BUJ A;  3WR2 A;  3D5G A;  4N6O B;  4K1V A;  1WMO A;  1RLS A;  1RGE A;  2C11 A;  2GEX A;  4FCJ A;  5IG3 A;  3CC4 3;  1JBR A;  4HM2 B;  1HYF A;  3K5T A;  1VQM 3;  5IF6 A;  2R41 A;  3X3Y A;  2KAA A;  6GSP A;  4XDV A;  1W2B 2;  2UGI A;  1O7N B;  1JB5 A;  4MMX B;  5BXQ A;  1BSC A;  1TFK A;  3NM7 A;  3OW2 2;  1VQK 3;  3AHW A;  3OWY A;  1W6C A;  2Z7A A;  1DMM A;  1VQL 3;  4NHF A;  3KSP A;  5IER A;  1YVS A;  3A76 A;  3X3X A;  2L1S A;  5G1L A;  4N6M A;  1UCK A;  3RGA A;  1SII A;  5ELJ A;  1GOY A;  4K61 A;  2AAD A;  3DGO A;  1UI8 A;  2W6J H;  3EHC A;  1RGA A;  3Q1C A;  3GSP A;  2QEX 3;  2RBI A;  4RNT A;  1BRI A;  1QAL A;  4WYK A;  1RTU A;  1EKM A;  5CF1 A;  1B2M A;  1WMN A;  1T2H A;  4I4K A;  1J2B A;  1GY5 A;  1I0X A;  4XDW A;  3BU4 A;  3EB8 A;  2QGU A;  3IJE B;  1B2U A;  1OHO A;  1FUS A;  2CH9 A;  2B24 B;  3NM2 A;  4CDL A;  4XBY A;  1ROV A;  2Y74 A;  3EX9 A;  2Z77 A;  4CPK A;  3CCU 3;  1YIJ 3;  1BOX A;  2F99 A;  9RNT A;  4CJN A;  3VSY A;  1O7M B;  5GSP A;  5EQL A;  1ASK A;  3E99 A;  3LTB A;  1RCL A;  1OHS A;  4L8P A;  1YJ9 3;  1FGM A;  3OXA A;  5IG4 A;  4BTY A;  1I8V A;  4BL3 A;  3WMD A;  1JN5 A;  3MHE A;  4U13 A;  4JF8 A;  4X2O A;  3NV0 B;  1M1K 4;  2XH9 A;  7STD A;  2RGQ A;  2Z76 A;  3F7S A;  4OUQ A;  2MC8 A;  3EC9 A;  3Q3F A;  1JRQ A;  1U8C B;  1O7G B;  3B7C A;  4FMC A;  4LEH A;  3WA3 A;  2WGO A;  1RGL A;  1SJW A;  3AMO A;  2IA7 A;  2HMO B;  2XGL A;  3D3L A;  1W6G A;  3FLJ A;  4FMA A;  3WHO A;  4KVH A;  1KWI A;  2INX A;  5DRV A;  5CK6 A;  1BNS A;  3GZR A;  1F8N A;  1MWT A;  1D6Y A;  1IDP A;  6RNT A;  1BRJ A;  1DMN A;  1I0V A;  2H0I A;  3HI7 A;  2KF6 A;  2Z6B A;  4J9A A;  3M8C A;  1BAN A;  2M7O A;  2P38 A;  1STD A;  2RSX A;  3G4S 3;  2OTL 3;  1FW7 A;  1OF5 B;  1SQW A;  1YNV X;  3HZP A;  1NDO B;  1RGK A;  5AIH A;  1OGZ A;  1Q7H A;  1DVC A;  1BRN L;  1N9J A;  3JUN A;  4PEJ A;  1QVF 2;  1BNE A;  1X1U A;  1SPU A;  5RNT A;  3J7Y d;  3CCM 3;  5IEN A;  1MGW A;  2CG0 A;  1MNL A;  3GAX A;  5TGN A;  2LYX A;  1GMQ A;  1B3S A;  3URP A;  3VGN A;  4WHA A;  3FG1 A;  2K54 A;  2BU4 A;  5HOH A;  2KF5 A;  1HKX A;  1YJN 3;  1RGC A;  5KP1 A;  3KFQ C;  3SOY A;  3QRD A;  1VQP 3;  1GY7 A;  3HOH A;  1A90 A;  2XFS A;  3EBY A;  2H0H A;  3D4A A;  3DGM A;  5IG5 A;  2OCT A;  1BNI A;  1B2X A;  1GSP A;  1MWU A;  2FXT A;  1S72 3;  1W6Y A;  1JBT A;  1IYY A;  1W7C A;  4O02 B;  3D5I A;  1PY3 A;  1I2G A;  3MSO A;  1QAK A;  1NWW A;  5JBS A;  3V92 A;  1UW1 A;  1W01 A;  3BIR A;  4FMB A;  1UCJ A;  3G6E 3;  2OOV A;  2YFJ B;  3X41 A;  1EA2 A;  2E2U A;  3MG1 A;  5AIG A;  2KXG A;  4ILF A;  5AEU B;  8CHO A;  4H3U A;  2JQ5 A;  1D6U A;  3CCR 3;  4R1K A;  5CF2 A;  1RNB A;  3K0Z A;  5BU4 A;  2F86 B;  1G96 A;  4GL6 A;  2BNG A;  2UUG C;  3KII A;  4GB5 A;  5AYS C;  1YGE A;  4HM8 B;  1TUH A;  4HZ9 B;  1GMR A;  3LOY A;  1C7H A;  4N6T A;  3S29 A;  4LGQ A;  3TDG A;  4AEQ A;  3LXU X;  3F7X A;  3CCL 3;  3FCS B;  3EE1 A;  1RN1 A;  2XSO B;  2CWU A;  3SVA A;  2BIR A;  1UI7 A;  3JVC A;  5EVH A;  3S28 A;  2F5W A;  1HZ1 A;  2YX9 A;  3EJV A;  1GY6 A;  1GOV A;  3MG3 A;  3NV0 A;  5HGR A;  4EW5 A;  1CH0 A;  5LC7 A;  3BNB A;  1RKY A;  1K8A 4;  2BHM A;  1UCI A;  3CCE 3;  1FYS A;  1E3R A;  1DYU A;  2OOV C;  4IPB A;  1VQO 3;  3AHS A;  3KN4 A;  3X40 A;  1KD1 4;  4HKV B;  5G2G A;  1TTO A;  1LOW A;  4G1M B;  2FGT A;  4HBR A;  5STD A;  2E2T A;  3T8U A;  2Q07 A;  3FG4 A;  3K9M C;  3LT8 A;  3CXC 2;  3FF0 A;  3K7C A;  1Q40 B;  4IT7 A;  4EBG A;  1YHQ 3;  1BNJ A;  1JB2 A;  4I5Q A;  1TU5 A;  2CFW A;  1BAO A;  2HMJ B;  1BSA A;  1N8Q A;  1V58 A;  3UL5 A;  1TJD A;  2K3D A;  7RNT A;  2LQV A;  3MG2 A;  2ZDJ A;  3CPW 2;  2HMM B;  1OF5 A;  5EEO A;  1Q7Y 4;  1GD4 A;  1JZD A;  2JDI H;  3G71 3;  3B4O A;  1O7W B;  3X3Z A;  3BNE A;  4QWT A;  5LC6 A;  3WDG B;  3ZG5 A;  3CC2 3;  2KRT A;  4FCZ A;  4EV5 A;  1FA3 A;  1LOX A;  3ALA A;  3H3H A;  1VQ7 3;  2P0X A;  1STF I;  2RNT A;  1BNR A;  1YJW 3;  1BRK A;  1ISK A;  1DMQ A;  4R4K A;  4DKI A;  2W03 A;  4NPB A;  4NRE A;  3LML A;  3BLZ A;  4N6U A;  2XGN A;  2ZHX B;  3FH1 A;  2ZL8 A;  4EV2 A;  2K0M A;  1Y4K A;  2BO9 B;  3JUQ A;  1NNV A;  2CWT A;  3N9H A;  1ZX2 A;  4BL2 A;  2W56 A;  2RFR A;  1L5G B;  4AKY A;  1K9M 4;  3B4P A;  4HM6 B;  1Q81 4;  1SAR A;  1O7P B;  1B27 A;  2GBW B;  1IK3 A;  3H51 A;  1B20 A;  1FZU A;  2XR8 B;  1BNF A;  1JZO A;  1Q86 4;  2W2C A;  2ML5 A;  4L7K A;  1IVV A;  1WTH A;  4EYC A;  1X1Y A;  2QA4 3;  3DMC A;  3HIG A;  4RZM A;  1G0T A;  1TFO A;  4HM4 B;  4KFE A;  1NU3 A;  1Q82 4;  1DE3 A;  1QAF A;  3EN1 B;  3EN8 A;  1NO3 A;  1WMP A;  1B2Z A;  1OGX A;  2C10 A;  4J8T A;  1BUQ A;  4FCM A;  3AGN A;  4HJL B;  1ROA A;  4R9L A;  2KF4 A;  2PZV A;  1RN4 A;  2GSP A;  1RCK A;  3V99 A;  1M9G A;  1NB3 I;  3MWZ A;  1QJG A;  3STD A;  1A67 A;  4JRF A;  2XEP A;  4ZM8 A;  3LZA A;  5FW5 A;  1BNG A;  2CC3 A;  1PYL A;  2P05 A;  4KFD A;  1FUT A;  1TP6 A;  1ZO2 A;  1AVL A;  2CX0 A;  4XBX A;  4HM3 B;  3S27 A;  1M90 4;  1MOL A;  1I70 A;  3F8X A;  4WWU C;  3X42 A;  1FGT A;  3DM8 A;  4LZI A;  4HZB B;  3HX8 A;  1OUN A;  1MWR A;  1W02 A;  1VQ5 3;  1PFP A;  1LVN A;  2F5M A;  3MYT A;  1G02 A;  2D42 A;  3UNL A;  2CFG A;  2V1L A;  3I55 3;  1KC8 4;  3OWS A;  5BIR A;  4OVM A;  1VQ9 3;  1Q40 A;  1E97 A;  2BMO B;  3IMA B;  4HM0 B;  3GZB A;  4HM7 B;  4WYK B;  2CW9 A;  4AKZ A;  1UGH I;  5IG0 A;  1LXE A;  1YVB I;  2B1X B;  1AR0 A;  1CEW I;  2SAR A;  3FG3 A;  1W4N A;  1Q42 A;  3LYG A;  5ELU A;  3LT9 A;  4HOH A;  3CCS 3;  1BGS A;  3GZX B;  4O3V A;  2IYJ A;  1VQN 3;  1KQS 2;  1DVD A;  2HOH A;  2RCD A;  3PXM A;  1I3I A;  2GEY A;  5I97 A;  3ZFZ A;  1OPY A;  3S67 A;  1IU7 A;  3CCQ 3;  3EBT A;  4FR9 A;  5A0O B;  1N8R 4;  1GOU A;  3EQQ B;  4WP5 A;  2E2V A;  3UL6 A;  1LQM B;  1LOV A;  1OCV A;  1A2K A;  2L4V A;  3WA2 X;  2GBX B;  1ULI B;  4KT3 B;  4MMZ B;  2CWV A;  3BND A;  4STD A;  5CXO A;  5D82 A;  3PS8 A;  1BSD A;  1N9E A;  2H0G A;  4HVN A;  3SYU A;  1YI2 3;  1IT7 A;  4LMI A;  2CKF B;  1M1X B;  3CMA 3;  1CYU A;  3NBB A;  3PYJ A;  3GWR A;  3O8Y A;  3JUM A;  3ROB A;  3ZG0 A;  3WOF B;  5CLK A;  5IEP A;  1AY7 A;  1RGH A;  3B8L A;  3MKI A;  4TX4 A;  3SED A;  1BRS A;  2O9U X;  2CG1 A;  1AQZ A;  1YIT 3;  3ER7 A;  1JB4 A;  1TRQ A;  1T5Y A;  1CQS A;  4R80 A;  3I56 3;  3NXJ A;  2W9Q A;  1UCL A;  3SLU A;  3GZY B;  1BSB A;  1VQQ A;  3S5C A;  4BU4 A;  3IPT A;  2STD A;  3QK9 A;  2D1W A;  3SOA A;  1BVI A;  2CFD A;  5AIF A;  2ML6 A;  2OQE A;  1RN7 A;  3Q90 A;  2O3O A;  2OTJ 3;  2GU3 A;  3T8N A;  3HII A;  1IV9 A;  5AYR B;  5JPU A;  2XRX B;  4HAA A;  4N6N B;  4XM4 A;  2BMR B;  4L8O A;  2IUJ A;  3RGR A;  3U1W A;  2HMN B;  1R4C A;  2BT3 A;  3NHX A;  2ZA4 A;  5D83 A;  4XBT A;  3T0U A;  1VZZ A;  5FGO A;  1AV4 A;  3UB1 A;  1FUW A;  1JJ2 2;  4RBN A;  3RNT A;  4XB5 A;  3DGL A;  3CD6 3;  1IT8 A;  3F8H A;  3PZW A;  3OX9 A;  2GU1 A;  1I3F A;  1UUW B;  3Q2P A;  4HM1 B;  4MEI A;  1O7H B;  1IVW A;  1GMP A;  4BTW A;  3DZL A;  1T2I A;  2HML B;  1BRH A;  1TIJ A;  1LQG C;  1N5H A;  2AAE A;  3CNX A;  1RGF A;  3NUV A;  3WOD G;  4WFO A;  3UJM A;  3I0Y A;  4EC6 A;  1JKG B;  3FZW A;  1WNH A;  3FGY A;  2YFL B;  1RGG A;  1UGI A;  1D6Z A;  2OQE C;  1BIR A;  3FKA A;  2A15 A;  3EF8 A;  3DGN A;  2CK3 H;  1C54 A;  2J8X B;  3PCR A;  1IVX A;  3SXX A;  1S5A A;  1RMS A;  1B2S A;  3OV4 A;  1FGQ A;  1IQX A;  3CPO A;  4ORL A;  3JUP A;  4J5K A;  4K1U A;  3G0K A;  3LH4 A;  3DGY A;  4HM5 B;  3BNC A;  3N8B A;  5M1A A;  4MJD A;  1RDS A;  1ULJ B;  1MWS A;  2UX0 A;  3BB9 A;  1R4Y A;  3CU3 A;  3MPH A;  3FSD A;  1WQL B;  1V57 A;  4LYL B;  4Q53 A;  2P0M A;  1IQ8 A;  2BMQ B;  4H61 A;  4IIA A;  2XFT A;  5DRE A;  4BIR A;  1HU9 A;  4KZ1 A;  4MMY B;  2CHC A;  1I2E A;  3NBJ A;  4GSP A;  1A2P A;  1EG9 B;  2CX1 A;  3SX1 A;  1IV7 A;  2WOF A;  5G1K A;  3U97 A;  5BVB A;  2OWP A;  1RJO A;  1B21 A;  1IVU A;  1N5P A;  3DY5 A;  3V98 A;  2XSH B;  1K41 A;  3KKG A;  3WOE B;  1QVG 2;  1LNH A;  1LOY A;  1OAC A;  1T3B A;  3KZT A;  5AEW B;  2XF3 A;  1US1 A;  1Q9E A;  1FGR A; 
#chains in the Genus database with same CATH homology
 3DUK A;  5AI1 A;  5IW9 A;  1GS3 A;  4O8S A;  1KSI A;  3G16 A;  4N6L A;  1W5Z A;  4EXR A;  2GXF A;  4KFF A;  1U5O A;  6STD A;  3NQZ A;  4HYZ A;  2R4I A;  1VQ8 3;  1GD3 A;  2I9W A;  3CCJ 3;  3F40 A;  3CME 3;  2P09 A;  3LTA A;  1IQY A;  3LTD A;  2FNQ A;  3D9R A;  1RRL A;  3GRD A;  4N3V A;  2WO0 A;  2F98 A;  3NQY A;  4X2H A;  2CFK A;  3LTC A;  1EQK A;  3HK4 A;  3PGB A;  1V74 A;  1PU4 A;  3CC7 3;  1W2Z A;  3N54 B;  3FF2 A;  2CIU A;  2CFL A;  1JNQ A;  2WGQ A;  3KE7 A;  4FMD A;  3PCS A;  3CCV 3;  2SBL A;  2MF7 A;  3G8Z A;  1W00 A;  1E3V A;  3JUO A;  4OK0 A;  1OHP A;  5AII A;  5KP4 A;  1JV2 B;  1FGO A;  2KCD A;  2W9P A;  2Y73 A;  4N6V 0;  2YFI B;  2HMK B;  1CYV A;  1NJI 4;  1RRH A;  1JN5 B;  4R9K A;  2PNC A;  3NX0 A;  2W56 B;  1VQ6 3;  2WOH A;  1JKG A;  3L0R A;  4K90 B;  1A2V A;  4BTX A;  3K63 A;  2IMJ A;  1AVK A;  2W04 A;  5D81 A;  3CNM A;  3OWU A;  2IUK A;  1K73 4;  1NB5 I;  3AMO B;  5IEO A;  3NBR A;  1GYB A;  3F14 A;  4RNY A;  5JPP A;  1OH0 A;  3RDE A;  3VF1 A;  1VQ4 3;  4CCV A;  1SIH A;  3F9S A;  3ECF A;  4RNZ A;  1UUV B;  5KP3 A;  1K28 A;  2W0Q A;  4LSO A;  2QIY A;  1Z1S A;  1QMA A;  3KSE D;  4O2H A;  3DXO A;  4N6O B;  4K1V A;  1WMO A;  4FCJ A;  2C11 A;  2GEX A;  5IG3 A;  3CC4 3;  4HM2 B;  3K5T A;  1VQM 3;  5IF6 A;  3X3Y A;  4XDV A;  1W2B 2;  1O7N B;  1JB5 A;  4MMX B;  5BXQ A;  1TFK A;  3NM7 A;  3OW2 2;  1VQK 3;  3OWY A;  1W6C A;  2Z7A A;  1DMM A;  1VQL 3;  4NHF A;  3KSP A;  5IER A;  3A76 A;  3X3X A;  4N6M A;  3RGA A;  1SII A;  5ELJ A;  4K61 A;  3DGO A;  1UI8 A;  2W6J H;  3EHC A;  3Q1C A;  2QEX 3;  1QAL A;  4WYK A;  1J2B A;  1EKM A;  5CF1 A;  1WMN A;  4I4K A;  1GY5 A;  4XDW A;  3EB8 A;  2QGU A;  3IJE B;  1OHO A;  2CH9 A;  2B24 B;  3NM2 A;  4CDL A;  4XBY A;  1ROV A;  2Y74 A;  3EX9 A;  2Z77 A;  3CCU 3;  1YIJ 3;  2F99 A;  3VSY A;  1O7M B;  5EQL A;  1ASK A;  3E99 A;  3LTB A;  1OHS A;  4L8P A;  1YJ9 3;  1FGM A;  3OXA A;  5IG4 A;  4BTY A;  3WMD A;  1JN5 A;  3MHE A;  4U13 A;  4JF8 A;  4X2O A;  3NV0 B;  1M1K 4;  2XH9 A;  7STD A;  2RGQ A;  2Z76 A;  3F7S A;  4OUQ A;  2MC8 A;  3EC9 A;  1JRQ A;  1U8C B;  1O7G B;  3B7C A;  4FMC A;  4LEH A;  3WA3 A;  2WGO A;  3AMO A;  1SJW A;  3FLJ A;  2IA7 A;  2HMO B;  2XGL A;  3D3L A;  1W6G A;  4FMA A;  4KVH A;  1KWI A;  2INX A;  5DRV A;  5CK6 A;  3GZR A;  1F8N A;  1D6Y A;  1IDP A;  1DMN A;  3HI7 A;  2Z6B A;  4J9A A;  3M8C A;  2M7O A;  2P38 A;  2RSX A;  1STD A;  3G4S 3;  2OTL 3;  1OF5 B;  1SQW A;  3HZP A;  1NDO B;  5AIH A;  1OGZ A;  1DVC A;  1N9J A;  3JUN A;  4PEJ A;  1QVF 2;  1SPU A;  3J7Y d;  3CCM 3;  5IEN A;  2CG0 A;  1MNL A;  3GAX A;  5TGN A;  2LYX A;  3VGN A;  4WHA A;  3FG1 A;  2K54 A;  1HKX A;  1YJN 3;  5KP1 A;  3KFQ C;  3SOY A;  3QRD A;  1VQP 3;  1GY7 A;  1A90 A;  2XFS A;  3EBY A;  3DGM A;  5IG5 A;  2OCT A;  2FXT A;  1S72 3;  1W6Y A;  1W7C A;  4O02 B;  3MSO A;  1QAK A;  1NWW A;  5JBS A;  3V92 A;  1UW1 A;  1W01 A;  4FMB A;  3G6E 3;  2OOV A;  2YFJ B;  3X41 A;  1EA2 A;  2E2U A;  3MG1 A;  5AIG A;  2KXG A;  5AEU B;  8CHO A;  4H3U A;  2JQ5 A;  1D6U A;  3CCR 3;  4R1K A;  5CF2 A;  3K0Z A;  2F86 B;  1G96 A;  4GL6 A;  2BNG A;  3KII A;  4GB5 A;  5AYS C;  1YGE A;  4HM8 B;  1TUH A;  4HZ9 B;  3LOY A;  1C7H A;  4N6T A;  3S29 A;  4LGQ A;  3TDG A;  4AEQ A;  3LXU X;  3F7X A;  3CCL 3;  3FCS B;  3EE1 A;  2XSO B;  2CWU A;  3SVA A;  1UI7 A;  3JVC A;  5EVH A;  3S28 A;  2YX9 A;  3EJV A;  3MG3 A;  1GY6 A;  3NV0 A;  5HGR A;  5LC7 A;  3BNB A;  1RKY A;  1K8A 4;  2BHM A;  3CCE 3;  2OOV C;  1E3R A;  1DYU A;  4IPB A;  1VQO 3;  3KN4 A;  3X40 A;  1KD1 4;  4HKV B;  5G2G A;  4G1M B;  2FGT A;  4HBR A;  5STD A;  2E2T A;  3T8U A;  2Q07 A;  3FG4 A;  3K9M C;  3LT8 A;  3CXC 2;  3FF0 A;  3K7C A;  1Q40 B;  4IT7 A;  4EBG A;  1YHQ 3;  1JB2 A;  1TU5 A;  2CFW A;  3UL5 A;  2HMJ B;  1N8Q A;  2LQV A;  3MG2 A;  2ZDJ A;  3CPW 2;  2HMM B;  1OF5 A;  5EEO A;  1Q7Y 4;  1GD4 A;  2JDI H;  3G71 3;  3B4O A;  1O7W B;  3X3Z A;  3BNE A;  4QWT A;  5LC6 A;  3WDG B;  3CC2 3;  2KRT A;  4FCZ A;  4EV5 A;  1FA3 A;  1LOX A;  3ALA A;  3H3H A;  1VQ7 3;  2P0X A;  1STF I;  1YJW 3;  1ISK A;  1DMQ A;  4R4K A;  2W03 A;  4NRE A;  3LML A;  3BLZ A;  4N6U A;  2XGN A;  3FH1 A;  2ZL8 A;  4EV2 A;  2K0M A;  1Y4K A;  2BO9 B;  3JUQ A;  2CWT A;  3N9H A;  1ZX2 A;  2W56 A;  2RFR A;  1L5G B;  4AKY A;  1K9M 4;  3B4P A;  4HM6 B;  1Q81 4;  1O7P B;  2GBW B;  1IK3 A;  3H51 A;  2XR8 B;  1Q86 4;  2W2C A;  2ML5 A;  4L7K A;  1IVV A;  1WTH A;  4EYC A;  2QA4 3;  3DMC A;  3HIG A;  4RZM A;  1TFO A;  4HM4 B;  4KFE A;  1NU3 A;  1Q82 4;  1QAF A;  3EN1 B;  3EN8 A;  1NO3 A;  1WMP A;  1OGX A;  2C10 A;  4J8T A;  1BUQ A;  4FCM A;  4HJL B;  1ROA A;  4R9L A;  2PZV A;  3V99 A;  1M9G A;  1NB3 I;  3MWZ A;  1QJG A;  3STD A;  1A67 A;  4JRF A;  2XEP A;  4ZM8 A;  3LZA A;  5FW5 A;  4KFD A;  2CC3 A;  2P05 A;  4XBX A;  1ZO2 A;  1TP6 A;  1AVL A;  4HM3 B;  3S27 A;  1M90 4;  1MOL A;  4WWU C;  3F8X A;  3X42 A;  1FGT A;  3DM8 A;  4LZI A;  4HZB B;  3HX8 A;  1OUN A;  1W02 A;  1VQ5 3;  1PFP A;  1LVN A;  3MYT A;  3UNL A;  2D42 A;  2CFG A;  2V1L A;  3I55 3;  1KC8 4;  3OWS A;  1VQ9 3;  4OVM A;  1Q40 A;  1E97 A;  2BMO B;  3IMA B;  4HM0 B;  3GZB A;  4HM7 B;  4WYK B;  2CW9 A;  4AKZ A;  5IG0 A;  1LXE A;  1YVB I;  2B1X B;  1AR0 A;  1CEW I;  3FG3 A;  1W4N A;  1Q42 A;  3LYG A;  5ELU A;  3LT9 A;  3CCS 3;  3GZX B;  4O3V A;  1VQN 3;  1KQS 2;  1DVD A;  2RCD A;  3PXM A;  2GEY A;  5I97 A;  1OPY A;  3S67 A;  1IU7 A;  3CCQ 3;  3EBT A;  4FR9 A;  5A0O B;  1N8R 4;  3EQQ B;  4WP5 A;  2E2V A;  3UL6 A;  1OCV A;  1A2K A;  2L4V A;  3WA2 X;  2GBX B;  1ULI B;  4MMZ B;  2CWV A;  3BND A;  4STD A;  5CXO A;  5D82 A;  3PS8 A;  1N9E A;  4HVN A;  1YI2 3;  1IT7 A;  4LMI A;  2CKF B;  1M1X B;  3CMA 3;  1CYU A;  3NBB A;  3PYJ A;  3GWR A;  3O8Y A;  3JUM A;  3ROB A;  3WOF B;  5CLK A;  5IEP A;  3B8L A;  3MKI A;  4TX4 A;  3SED A;  2O9U X;  2CG1 A;  1YIT 3;  3ER7 A;  1JB4 A;  1T5Y A;  1CQS A;  4R80 A;  3I56 3;  3NXJ A;  2W9Q A;  3SLU A;  3GZY B;  3S5C A;  3IPT A;  2STD A;  3QK9 A;  2D1W A;  3SOA A;  5AIF A;  2CFD A;  2ML6 A;  2OQE A;  1RN7 A;  3Q90 A;  2O3O A;  2OTJ 3;  2GU3 A;  3T8N A;  3HII A;  1IV9 A;  5AYR B;  5JPU A;  2XRX B;  4N6N B;  4XM4 A;  2BMR B;  4L8O A;  2IUJ A;  3RGR A;  3U1W A;  2HMN B;  1R4C A;  2BT3 A;  3NHX A;  5D83 A;  4XBT A;  3T0U A;  1VZZ A;  5FGO A;  1AV4 A;  3UB1 A;  1FUW A;  1JJ2 2;  4RBN A;  4XB5 A;  3DGL A;  3CD6 3;  1IT8 A;  3F8H A;  3PZW A;  3OX9 A;  2GU1 A;  1UUW B;  3Q2P A;  4HM1 B;  4MEI A;  1O7H B;  1IVW A;  4BTW A;  3DZL A;  2HML B;  1TIJ A;  1N5H A;  3CNX A;  3NUV A;  3WOD G;  4WFO A;  3UJM A;  3I0Y A;  4EC6 A;  1JKG B;  3FZW A;  1WNH A;  3FGY A;  2YFL B;  1D6Z A;  2OQE C;  3FKA A;  2A15 A;  3EF8 A;  3DGN A;  2CK3 H;  3PCR A;  1IVX A;  3SXX A;  1S5A A;  3OV4 A;  1FGQ A;  1IQX A;  3CPO A;  4ORL A;  3JUP A;  4K1U A;  3G0K A;  3LH4 A;  4HM5 B;  3BNC A;  3N8B A;  4MJD A;  1ULJ B;  2UX0 A;  3BB9 A;  3MPH A;  3CU3 A;  3FSD A;  1WQL B;  4Q53 A;  2P0M A;  1IQ8 A;  2BMQ B;  4H61 A;  4IIA A;  2XFT A;  5DRE A;  1HU9 A;  4KZ1 A;  4MMY B;  2CHC A;  3NBJ A;  1EG9 B;  3SX1 A;  1IV7 A;  2WOF A;  3U97 A;  5BVB A;  2OWP A;  1RJO A;  1IVU A;  1N5P A;  3DY5 A;  3V98 A;  2XSH B;  1K41 A;  3KKG A;  3WOE B;  1QVG 2;  1LNH A;  1OAC A;  3KZT A;  5AEW B;  2XF3 A;  1US1 A;  1FGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...