3SEDA

Crystal structure of ketosteroid isomerase variant m105a from pseudomonos putida
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
124
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNQPCALDVIDVARFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title A tale of two isomerases: compact versus extended active sites in ketosteroid isomerase and phosphoglucose isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 34
structure length 124
sequence length 125
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3sedA00
4WYKA 3F40A 2PZVA 4Q53A 3JUNA 5HGRA 3A76A 4GB5A 1QJGA 3OWYA 3OWUA 4OVMA 1SJWA 1UUWB 4HM1B 2HMOB 3B8LA 4ORLA 1E3RA 5BXQA 5KP3A 4U13A 4XB5A 2Z77A 4FCJA 3G0KA 4K1UA 3CU3A 3KSPA 4PEJA 1JKGB 5AEUB 5AEWB 4J8TA 2GBWB 1NDOB 5EVHA 1OPYA 3HK4A 2RGQA 2R4IA 2JQ5A 5CK6A 3EQQB 4HM7B 1S5AA 5DRVA 3NHXA 1O7NB 5D83A 1ZO2A 2F86B 2IMJA 2STDA 2XSHB 3JUOA 4HM8B 1UUVB 4XDWA 3FGYA 2CKFB 4WYKB 5IF6A 5AIFA 1DMNA 4I4KA 3D9RA 1W00A 1STDA 3EJVA 3GZYB 1GY7A 1VZZA 3SOAA 5AI1A 1E97A 1OHOA 3ECFA 2K54A 4N3VA 3CPOA 1OGZA 5IG4A 3VSYA 1Q40B 5CLKA 3G8ZA 3E99A 3DZLA 8CHOA 4HM4B 4WWUC 3OWSA 3ROBA 1OGXA 1W6YA 3MHEA 1EA2A 3EN8A 3T8UA 4J9AA 3MG1A 4HM0B 1NU3A 2B24B 5KP4A 4XBYA 5AIHA 3DXOA 4MJDA 4X2HA 1OUNA 3S5CA 3M8CA 1BUQA 3I0YA 1ULJB 5JPUA 1OH0A 3EBYA 4FCMA 2GEXA 4HKVB 1OF5A 2UX0A 1QMAA 1O7PB 1O7GB 2YFIB 3EHCA 3UNLA 5IG3A 3K7CA 1U5OA 1Z1SA 5G2GA 1JN5A 3OX9A 3MKIA 3RGAA 5IEPA 3JUQA 2OWPA 5CF1A 3H51A 4HM2B 3SEDA 3CNMA 3STDA 5JPPA 3JUMA 1AR0A 5IERA 3EF8A 1GY5A 2HMJB 3VGNA 7STDA 3KE7A 3LYGA 4XDVA 1O7WB 1GS3A 2W2CA 2HMKB 3KKGA 4HZ9B 3FLJA 3F8HA 1ISKA 5IEOA 3KZTA 2F99A 3MYTA 4H3UA 1IDPA 4RZMA 4R9KA 5TGNA 3NXJA 4K1VA 3GZRA 3GZXB 5BVBA 4HM6B 2HMNB 2GBXB 4L7KA 3Q90A 3F7SA 1JN5B 3NUVA 1O7HB 2I9WA 1TP6A 3G16A 1OHSA 5CXOA 3WMDA 3NV0A 2XRXB 1DMQA 1EG9B 3EBTA 2RCDA 1ASKA 1W01A 1NWWA 5AIGA 2YFLB 1CQSA 6STDA 2F98A 3B4OA 1OCVA 3MSOA 4STDA 2BMOB 3DUKA 3OXAA 5STDA 5FW5A 4HM3B 1JB5A 1JB2A 4WP5A 4LMIA 3HZPA 3BLZA 2INXA 3FH1A 3FSDA 2HMLB 3GRDA 2QIYA 4HJLB 1Q42A 3T8NA 4X2OA 3HX8A 4XBTA 3SOYA 3IPTA 3MG2A 4LGQA 3FZWA 1Q40A 1TUHA 1DMMA 2RFRA 3H3HA 3ER7A 4LEHA 3F14A 3EX9A 3GWRA 2XSOB 2HMMB 1E3VA 2XR8B 4IIAA 4R9LA 4L8PA 3NV0B 4XM4A 5AIIA 5IENA 3K0ZA 1O7MB 5D82A 3B4PA 3BB9A 1JB4A 3OV4A 2BNGA 2BMRB 2GXFA 2Z76A 3F9SA 5DREA 3NBRA 3DMCA 3FKAA 2BMQB 3FF2A 3FF0A 3UJMA 1GY6A 3MG3A 4XBXA 2A15A 3RGRA 5KP1A 3NM2A 1OF5B 1A2KA 2CHCA 5IG0A 2B1XB 1JKGA 2YFJB 1W02A 4HVNA 3EN1B 2GEYA 1C7HA 3CNXA 1ZX2A 4HM5B 4CDLA 3B7CA 4OUQA 2QGUA 5D81A 5IG5A 3F7XA 4HZBB 1HKXA 1ULIB 3DM8A 4KVHA 1GYBA 4L8OA 1WQLB 5CF2A 3LZAA 2Z7AA 3JUPA 3EC9A 3F8XA 1K41A 4R1KA 3GZBA 1OHPA
chains in the Genus database with same CATH superfamily
3DGYA 4WYKA 3F40A 2XGLA 2PZVA 3PZWA 4Q53A 4R80A 3JUNA 4HAAA 3CXC2 2ZL8A 5HGRA 1IVWA 1C54A 3A76A 1GMRA 1SIHA 4GB5A 2FGTA 1IU7A 1TU5A 1GOUA 1LNIA 1QJGA 2UGIA 1BAOA 2D42A 1G0TA 4NHFA 4NPBA 3OWYA 3OWUA 3J7Yd 3SXXA 4OVMA 3NQYA 4EXRA 2C4BA 3Q2PA 1SJWA 1BNGA 1UUWB 2XEPA 4HM1B 2F5MA 2HMOB 3B8LA 4ORLA 3OW22 1VQ93 1BNFA 1E3RA 5BXQA 4FR9A 5KP3A 4U13A 1R4CA 2IUKA 1EUIC 1LOYA 4XB5A 2Z77A 4FCJA 4ZM8A 6RNTA 3AHWA 3SLUA 1B2SA 1HYFA 3G0KA 4K1UA 3CU3A 2CWTA 3KSPA 3PCRA 3SVAA 1I3FA 1JKGB 4PEJA 5AEUB 5AEWB 3CCQ3 1IVXA 4J8TA 2O3OA 2GBWB 2XH9A 1BGSA 2KF5A 4BTWA 4RNYA 1YJN3 3CC43 1NDOB 2KF4A 1KSIA 2XFSA 5EVHA 1OPYA 1SQWA 1MWTA 4FMBA 4BIRA 1QVG2 2O9UX 1UCIA 2GU1A 1RJOA 1GMQA 3MWZA 1TJDA 3HK4A 1N8R4 4HOHA 2Y73A 3RNTA 1VQ73 3NBJA 3VF1A 2ZDJA 2RGQA 1T2IA 2R4IA 4EV5A 2JDIH 2JQ5A 4BTYA 2QEX3 4DKIA 1RKYA 1D6ZA 5CK6A 3WDGB 2CFGA 3G713 1NB5I 3EQQB 1LQGC 1S5AA 1CEWI 2CFWA 4HM7B 5DRVA 3X41A 1K9M4 1VQ63 3NHXA 2P05A 2ML6A 1O7NB 5D83A 3EB8A 1ZO2A 2F86B 2IMJA 4KFDA 4KZ1A 4OK0A 1RCLA 2STDA 3LMLA 4CJNA 1DETA 2LYXA 2XSHB 1A2PA 1ZS7A 2M7OA 3JUOA 1VQM3 1I70A 4HM8B 1UUVB 8RNTA 4XDWA 1YHQ3 3FGYA 1KD14 2CKFB 2R41A 1B2XA 5M19A 1VQK3 4WYKB 5IF6A 2F56A 1TIJA 3QRDA 1DMNA 1TFKA 4I4KA 5AIFA 3D9RA 1W00A 1STDA 1QAFA 4LSOA 1IYYA 1BOXA 2UUGC 4RBNA 1NJI4 2FXTA 1BU4A 1CYVA 3EJVA 3CME3 3GZYB 1I2EA 1GY7A 1VZZA 3SOAA 5AI1A 1Y4KA 1E97A 1K28A 1OHOA 2WOFA 3ECFA 1NB3I 1JBRA 3HIIA 1IV7A 2OTL3 4IPBA 1M9GA 2ML5A 2K54A 3G4S3 4N3VA 4EW5A 2CX1A 2KXGA 4QWTA 3CPOA 4N6TA 1OGZA 1RCKA 4O8SA 5IG4A 2RNTA 3VSYA 1YGWA 4O02B 1UCKA 1FGQA 1I0XA 1JZDA 1Q40B 5CLKA 1VQ43 3G8ZA 1RGAA 3HI7A 2OQEC 1YVBI 3DZLA 3E99A 8CHOA 4HM4B 4WWUC 1FGRA 1UI8A 4G1MB 1BNSA 3OWSA 5ELJA 2CFKA 3ROBA 1OGXA 2Q07A 1RGGA 2V1LA 1N8QA 4ILFA 1W6YA 5ELUA 5AYRB 2CG1A 1MGRA 3MHEA 1EA2A 4FMDA 1W5ZA 2SBLA 1F8NA 2MF7A 3EN8A 4AEQA 1I2FA 1N5HA 3NM7A 3T8UA 3JVCA 2K0MA 3CCR3 2KF6A 4GL6A 1LNHA 4J9AA 1QVF2 3ZG0A 3MG1A 4HM0B 5M1AA 1V57A 1NU3A 4R4KA 2Y74A 1X1XA 4BU4A 3CCM3 1RN1A 2W03A 1Q814 1VQL3 1YIT3 2B24B 5KP4A 1RNTA 4XBYA 5AIHA 3S29A 5LC6A 1LRAA 1UDII 3DXOA 4MJDA 3UB1A 4X2HA 5BU4A 5G1LA 1OUNA 4MMXB 3S5CA 3M8CA 1AVLA 1BUQA 2WO0A 1RN7A 1JRQA 3I0YA 1ULJB 4TX4A 1CYUA 5JPUA 3CMA3 1MWUA 1OH0A 1T3BA 2CX0A 1UI7A 2P09A 3EBYA 4FCMA 2GEXA 1BSBA 1W7CA 3CC23 1BNJA 1RGHA 1UGIA 1WTHA 3DGMA 1GOVA 4HKVB 1J2BA 1X1WA 1WNHA 4JF8A 1JV2B 1BANA 1OF5A 2UX0A 1QMAA 3Q3FA 1O7PB 1STFI 1O7GB 1LQMB 3S67A 1FGOA 1TRQA 1UGHI 2YFIB 3EHCA 4FMCA 1BNRA 2PNCA 4BL3A 1GOYA 1U8CB 1UUGB 1UCJA 1A90A 2J8XB 1IQYA 3CD63 3WHOA 4BTXA 1PU4A 3BNCA 3UNLA 5IG3A 3K7CA 4O3VA 1Q824 1U5OA 1N5PA 2W56A 1S723 1Q7HA 2MC8A 1IT7A 1GD4A 1PYLA 1Z1SA 2KAAA 3BNBA 3KCHA 1RLSA 4N6NB 3PXMA 1GSPA 5G2GA 2CFLA 4GSPA 1JN5A 4EV2A 1B27A 1T2HA 1JBTA 4CPKA 1RNBA 3OX9A 3NBBA 2OTJ3 3MKIA 1I8VA 3RGAA 5IEPA 5JBSA 2XF3A 1W6CA 3JUQA 3S28A 2RSXA 3PS8A 1B2MA 2BIRA 2OOVA 2OWPA 1FA3A 5CF1A 3H51A 2ZHXB 1JZOA 4HM2B 3SEDA 3U97A 3CNMA 3AGOA 3STDA 7RNTA 5JPPA 5BIRA 3JUMA 1I2GA 1RRHA 2AADA 4LYLB 6GSPA 1B3SA 3CCJ3 1RHLA 1FW7A 1AR0A 1LOVA 1B2UA 1UW1A 5IERA 1FUTA 3EF8A 1GY5A 3PYJA 2IA7A 1RMSA 1RGFA 1D6YA 2BT3A 2HMJB 3DGLA 1EKMA 2L1SA 3VGNA 7STDA 1ZGXA 4N6UA 3WODG 5G1KA 1DVDA 3KE7A 3LYGA 2YX9A 2CH9A 5A0OB 4EBGA 1MWRA 1I3IA 1BSEA 4XDVA 1O7WB 2BHMA 1GD3A 3D79A 1GS3A 2W2CA 2HMKB 2ZA4A 3V92A 3KFQC 1RDSA 3KKGA 1D6UA 3N8BA 4K61A 1RGLA 1BSCA 1RTUA 4HZ9B 5LC7A 4N6OB 2HOHA 3AMOA 3U1WA 3FLJA 2RBIA 3I563 3F8HA 3LTAA 3WR2A 3LTBA 1TFOA 2KCDA 4O2HA 1BVIA 3CPW2 1X1UA 1ISKA 5IEOA 3MPHA 1KC84 1FYSA 2P0MA 3KZTA 2F99A 3V99A 2CG0A 3MYTA 2KRTA 4H3UA 1RRLA 1IDPA 1VQQA 3RDEA 1SARA 1IQXA 1YVSA 3DGOA 2KF3A 1A67A 4RZMA 1BIRA 1W6GA 2GU3A 4R9KA 1SPUA 5TGNA 1EEJA 1AVKA 3NXJA 1IK3A 1KWIA 1LOWA 4K1VA 1IVUA 5RNTA 3GZRA 2H0GA 3GZXB 4N6MA 1VQ53 1Q9EA 5BVBA 2F4YA 4J5KA 1FUWA 1M904 4HM6B 3CC73 1BRIA 4AKYA 3GAXA 2HMNB 2W56B 1RSNA 2GBXB 4L7KA 3Q90A 4GHOA 1W2B2 3F7SA 4N6LA 3DY5A 1MNLA 1JN5B 1B2ZA 3NUVA 3SX1A 1BNEA 1O7HB 2I9WA 1TP6A 1FGTA 1OHSA 3G16A 5CXOA 3WMDA 3NV0A 2OCTA 1IVVA 2W6JH 3KN4A 1LXEA 1KQS2 3KSED 3CCE3 2XRXB 2CWVA 1MOLA 1DMQA 3HOHA 3IJEB 1EG9B 3EBTA 5EEOA 1FUSA 1MGWA 1DYUA 2RCDA 3K63A 1ASKA 1W01A 4MMZB 1NWWA 5AIGA 1B20A 1PY3A 2YFLB 2SARA 1CQSA 6STDA 1DE3A 4RNTA 4FMAA 1I0VA 3GSPA 2F98A 1JJ22 1AQZA 4LZIA 2CFDA 1GMPA 1QALA 2IYJA 3B4OA 3HIGA 3X40A 1YGEA 1AV4A 2XFTA 1OCVA 3MSOA 4STDA 2BMOB 4I5QA 3DUKA 3CCL3 3WA2X 3OXAA 2E2VA 1BSAA 3X3XA 1N9EA 2W0QA 3DH2A 2Z6BA 1WMPA 3Q1CA 5STDA 5FW5A 1YI23 1YIJ3 2WGQA 4EC6A 4HM3B 1JB5A 1JB2A 4WP5A 5EQLA 3WOEB 3ZG5A 4LMIA 1K734 3HZPA 3K9MC 5FGOA 3BLZA 4KFEA 1US1A 2INXA 3AMOB 3FH1A 2XGNA 1YJW3 1FZUA 2K3DA 1VQ83 3FSDA 4HYZA 4K90B 1LOXA 2HMLB 4MEIA 1HZ1A 2CC3A 2QIYA 3GRDA 4HJLB 1X1YA 3AGNA 1L5GB 1Q42A 1JBSA 3PCSA 3T8NA 2W9QA 1K8A4 5I97A 1RGKA 4X2OA 4CCVA 3AHSA 5HOHA 3HX8A 4H61A 3LH4A 5M18A 1RGEA 1AY7A 3FG1A 4XBTA 2CWUA 3WOFB 3ALAA 1NO3A 3SOYA 4AKZA 3IPTA 1G96A 3MG2A 4LGQA 4RNZA 2E2UA 3FZWA 1BNIA 1Q40A 1TUHA 1W2ZA 3K5TA 2FNQA 1IT8A 2OOVC 1VQN3 1DMMA 2RFRA 3FG3A 3H3HA 3ER7A 4LEHA 2CW9A 3F14A 1TTOA 1V58A 1PFPA 4J5GA 3G6E3 3EX9A 3D5IA 3GWRA 2XSOB 4EYCA 2HMMB 1E3VA 3EE1A 1IQ8A 4FCZA 2L4VA 2XR8B 1QAKA 4IIAA 4R9LA 2AAEA 4L8PA 1UCLA 3NV0B 4XM4A 3X3YA 1VQP3 5AIIA 1BRHA 2H0HA 3IMAB 5IENA 2W9PA 1YJ93 3K0ZA 1WMOA 2E2TA 1O7MB 2IUJA 1RGCA 1R4YA 3LTDA 3LOYA 3PGBA 5D82A 1BRKA 3B4PA 3BB9A 1JB4A 3LTCA 3OV4A 2BNGA 2BMRB 4HBRA 2H0IA 4KT3B 3WA3A 1EQKA 2GXFA 1V74A 1BSDA 1SIIA 2Z76A 3F9SA 5DREA 1BRNL 1DVCA 3NBRA 3DMCA 3I553 3FKAA 2BMQB 2C11A 3FF2A 3BNDA 1Q7Y4 3BIRA 1BRSA 1G02A 3FF0A 1GY6A 3UJMA 3A5EA 1B21A 3BU4A 3MG3A 4XBXA 2A15A 3RGRA 5KP1A 3O8YA 3CCV3 3NM2A 1OF5B 1A2KA 1YNVX 2CHCA 5IG0A 3X3ZA 2C10A 2CK3H 3D4AA 1NNVA 2WOHA 4KFFA 4NREA 3LT9A 1OACA 4WFOA 2B1XB 2WGOA 1JKGA 3T0UA 3TDGA 4BL2A 2IY2A 3UL5A 1N9JA 4MMYB 2YFJB 3NX0A 4WHAA 9RNTA 1W02A 3QK9A 4HVNA 2GSPA 3ZFZA 2LQVA 1ROAA 3KIIA 3LT8A 1JNQA 3EN1B 1BUJA 2GEYA 1C7HA 3CNXA 1TRPA 1ZX2A 1M1XB 2P0XA 2W04A 4HM5B 3NQZA 2BO9B 1IV9A 4IT7A 1RN4A 3LXUX 4JRFA 2D1WA 2QA43 3UL6A 2P38A 2OQEA 4CDLA 3B7CA 1M1K4 1A2VA 4OUQA 1CH0A 3N54B 3S27A 1FGMA 1T5YA 2QGUA 5D81A 5IG5A 3CCS3 5GSPA 2F5WA 2CIUA 1LVNA 3X42A 3F7XA 3FCSB 5IW9A 4HZBB 3D3LA 1HKXA 1ULIB 3DM8A 2BU4A 1BRJA 3L0RA 1MWSA 4KVHA 3BNEA 3FG4A 1VQO3 1BRGA 1GYBA 4L8OA 1WQLB 5CF2A 5AYSC 4N6V0 3LZAA 3DGNA 1WMNA 2Z7AA 7GSPA 3CCU3 3N9HA 3JUPA 3D5GA 3EC9A 1HU9A 3F8XA 3V98A 1K41A 1W4NA 1Q864 1ROVA 4R1KA 3SYUA 3URPA 3GZBA 1OHPA
chains in the Genus database with same CATH topology
4WYKA 3F40A 2XGLA 2PZVA 3PZWA 4Q53A 4R80A 3JUNA 3CXC2 2ZL8A 5HGRA 1IVWA 3A76A 1SIHA 4GB5A 2FGTA 1IU7A 1TU5A 1QJGA 2D42A 4NHFA 3J7Yd 3OWYA 3OWUA 3SXXA 4OVMA 3NQYA 4EXRA 3Q2PA 1SJWA 1UUWB 2XEPA 4HM1B 2HMOB 3B8LA 4ORLA 3OW22 1VQ93 1E3RA 5BXQA 4FR9A 5KP3A 4U13A 1R4CA 2IUKA 4XB5A 2Z77A 4FCJA 4ZM8A 3SLUA 3G0KA 4K1UA 3CU3A 2CWTA 3KSPA 3PCRA 3SVAA 4PEJA 1JKGB 5AEUB 5AEWB 3CCQ3 1IVXA 4J8TA 2O3OA 2GBWB 2XH9A 4BTWA 4RNYA 1YJN3 3CC43 1NDOB 1KSIA 2XFSA 5EVHA 1OPYA 1SQWA 4FMBA 1QVG2 2O9UX 2GU1A 1RJOA 3MWZA 3HK4A 1N8R4 2Y73A 1VQ73 3NBJA 3VF1A 2ZDJA 2RGQA 2R4IA 4EV5A 2JDIH 2JQ5A 4BTYA 2QEX3 1RKYA 1D6ZA 5CK6A 3WDGB 2CFGA 3G713 1NB5I 3EQQB 2CFWA 1S5AA 1CEWI 4HM7B 5DRVA 1K9M4 3X41A 1VQ63 3NHXA 2P05A 2ML6A 1O7NB 5D83A 3EB8A 1ZO2A 2F86B 2IMJA 4KFDA 4KZ1A 4OK0A 2STDA 3LMLA 2LYXA 2XSHB 2M7OA 3JUOA 1VQM3 4HM8B 1UUVB 1KD14 4XDWA 1YHQ3 3FGYA 2CKFB 1VQK3 4WYKB 5IF6A 3QRDA 1TIJA 1DMNA 1TFKA 4I4KA 5AIFA 3D9RA 1W00A 1STDA 1QAFA 4LSOA 4RBNA 2FXTA 1CYVA 3EJVA 3CME3 3GZYB 1GY7A 1VZZA 3SOAA 5AI1A 1Y4KA 1E97A 1K28A 1OHOA 2WOFA 3ECFA 1NB3I 3HIIA 1IV7A 2OTL3 4IPBA 1M9GA 2ML5A 2K54A 3G4S3 4N3VA 2KXGA 4QWTA 3CPOA 4N6TA 1OGZA 4O8SA 5IG4A 3VSYA 4O02B 1FGQA 1VQ43 1Q40B 5CLKA 3G8ZA 3HI7A 2OQEC 1YVBI 3DZLA 3E99A 8CHOA 4HM4B 4WWUC 1FGRA 1UI8A 4G1MB 3OWSA 5ELJA 2CFKA 3ROBA 1OGXA 2Q07A 2V1LA 1N8QA 1W6YA 5ELUA 5AYRB 2CG1A 3MHEA 1EA2A 4FMDA 1W5ZA 2SBLA 1F8NA 2MF7A 3EN8A 4AEQA 1N5HA 3NM7A 3T8UA 3JVCA 2K0MA 3CCR3 4GL6A 1LNHA 4J9AA 1QVF2 3MG1A 4HM0B 1NU3A 4R4KA 2Y74A 3CCM3 1Q814 2W03A 1VQL3 1YIT3 2B24B 5KP4A 4XBYA 5AIHA 3S29A 5LC6A 3DXOA 4MJDA 3UB1A 4X2HA 1OUNA 4MMXB 3S5CA 3M8CA 1AVLA 1BUQA 2WO0A 1RN7A 1JRQA 3I0YA 1ULJB 4TX4A 1CYUA 5JPUA 3CMA3 1OH0A 2P09A 3EBYA 1UI7A 4FCMA 3CC23 2GEXA 1W7CA 1WTHA 4HKVB 1J2BA 3DGMA 1WNHA 4JF8A 1JV2B 1OF5A 2UX0A 1QMAA 1O7PB 1STFI 1O7GB 3S67A 1FGOA 2YFIB 4FMCA 3EHCA 2PNCA 1U8CB 1A90A 1IQYA 3CD63 4BTXA 1PU4A 3BNCA 3UNLA 5IG3A 3K7CA 4O3VA 1Q824 1U5OA 1N5PA 2W56A 1S723 2MC8A 1IT7A 1GD4A 1Z1SA 3BNBA 4N6NB 3PXMA 5G2GA 2CFLA 1JN5A 4EV2A 3OX9A 3NBBA 2OTJ3 3MKIA 3RGAA 5IEPA 5JBSA 2XF3A 1W6CA 3JUQA 3S28A 2RSXA 3PS8A 2OOVA 2OWPA 1FA3A 5CF1A 3H51A 4HM2B 3SEDA 3U97A 3CNMA 3STDA 5JPPA 3JUMA 1RRHA 3CCJ3 1AR0A 1UW1A 5IERA 3EF8A 1GY5A 3PYJA 2IA7A 2BT3A 1D6YA 2HMJB 3DGLA 3VGNA 1EKMA 7STDA 3WODG 4N6UA 1DVDA 3KE7A 3LYGA 2YX9A 2CH9A 5A0OB 4EBGA 4XDVA 1O7WB 2BHMA 1GD3A 1GS3A 2W2CA 2HMKB 3V92A 3KFQC 3KKGA 1D6UA 3N8BA 4K61A 5LC7A 4HZ9B 4N6OB 3AMOA 3U1WA 3FLJA 3I563 3F8HA 3LTAA 3LTBA 1TFOA 2KCDA 4O2HA 3CPW2 1ISKA 5IEOA 3MPHA 1KC84 2P0MA 3KZTA 2F99A 3V99A 2CG0A 3MYTA 2KRTA 4H3UA 1RRLA 1IDPA 3RDEA 1IQXA 3DGOA 1A67A 4RZMA 2GU3A 1W6GA 4R9KA 1SPUA 5TGNA 1AVKA 3NXJA 1IK3A 1KWIA 4K1VA 1IVUA 3GZRA 3GZXB 4N6MA 1VQ53 5BVBA 1FUWA 1M904 4HM6B 3CC73 4AKYA 3GAXA 2HMNB 2W56B 2GBXB 4L7KA 3Q90A 1W2B2 3F7SA 4N6LA 3DY5A 1MNLA 1JN5B 3NUVA 3SX1A 1O7HB 2I9WA 1TP6A 1FGTA 1OHSA 3G16A 5CXOA 3WMDA 3NV0A 2OCTA 1IVVA 2W6JH 3KN4A 1LXEA 1KQS2 3KSED 3CCE3 2XRXB 2CWVA 1MOLA 1DMQA 3IJEB 1EG9B 3EBTA 5EEOA 3K63A 1DYUA 2RCDA 1ASKA 1W01A 4MMZB 1NWWA 5AIGA 2YFLB 1CQSA 6STDA 4FMAA 2F98A 1JJ22 4LZIA 2CFDA 1QALA 3B4OA 3HIGA 1NJI4 3X40A 1YGEA 1AV4A 2XFTA 1OCVA 3MSOA 4STDA 2BMOB 3DUKA 3CCL3 3WA2X 3OXAA 2E2VA 3X3XA 1N9EA 2W0QA 2Z6BA 1WMPA 3Q1CA 5STDA 5FW5A 1YI23 1YIJ3 2WGQA 4EC6A 4HM3B 1JB5A 1JB2A 4WP5A 5EQLA 3WOEB 4LMIA 1K734 3HZPA 3K9MC 5FGOA 3BLZA 4KFEA 1US1A 2INXA 3AMOB 3FH1A 2XGNA 1YJW3 1VQ83 3FSDA 4HYZA 4K90B 1LOXA 2HMLB 4MEIA 2CC3A 3GRDA 2QIYA 4HJLB 1L5GB 1Q42A 3PCSA 3T8NA 2W9QA 1K8A4 5I97A 4X2OA 4CCVA 3HX8A 4H61A 3LH4A 3FG1A 4XBTA 2CWUA 3WOFB 3ALAA 1NO3A 3SOYA 4AKZA 3IPTA 1G96A 3MG2A 4LGQA 4RNZA 2E2UA 3FZWA 1Q40A 1TUHA 1W2ZA 3K5TA 2FNQA 1IT8A 2OOVC 1VQN3 1DMMA 2RFRA 3FG3A 3H3HA 3ER7A 4LEHA 2CW9A 3F14A 1PFPA 3G6E3 3EX9A 3GWRA 2XSOB 4EYCA 2HMMB 1E3VA 3EE1A 1IQ8A 4FCZA 2L4VA 2XR8B 1QAKA 4IIAA 4R9LA 4L8PA 3NV0B 4XM4A 3X3YA 1VQP3 5AIIA 3IMAB 5IENA 2W9PA 1YJ93 3K0ZA 1WMOA 2E2TA 1O7MB 2IUJA 3LTDA 3PGBA 3LOYA 5D82A 3B4PA 3BB9A 1JB4A 3LTCA 3OV4A 2BNGA 2BMRB 4HBRA 3WA3A 1EQKA 2GXFA 1V74A 1SIIA 2Z76A 3F9SA 5DREA 1DVCA 3NBRA 3DMCA 3I553 3FKAA 2BMQB 2C11A 3FF2A 3BNDA 1Q7Y4 3FF0A 3UJMA 1GY6A 3MG3A 4XBXA 2A15A 3RGRA 5KP1A 3O8YA 3CCV3 3NM2A 1OF5B 1A2KA 2CHCA 5IG0A 3X3ZA 2C10A 2CK3H 2WOHA 4KFFA 4NREA 3LT9A 1OACA 4WFOA 2B1XB 2WGOA 1JKGA 3T0UA 3TDGA 3UL5A 1N9JA 4MMYB 2YFJB 3NX0A 4WHAA 1W02A 3QK9A 4HVNA 2LQVA 1ROAA 3KIIA 3LT8A 1JNQA 3EN1B 2GEYA 1C7HA 3CNXA 1ZX2A 1M1XB 2P0XA 2W04A 4HM5B 3NQZA 2BO9B 1IV9A 4IT7A 3LXUX 4JRFA 2D1WA 2QA43 3UL6A 2P38A 2OQEA 4CDLA 3B7CA 1M1K4 1A2VA 4OUQA 3N54B 3S27A 1FGMA 1T5YA 2QGUA 5D81A 5IG5A 3CCS3 2CIUA 1LVNA 3X42A 3F7XA 3FCSB 5IW9A 4HZBB 3D3LA 1HKXA 1ULIB 3DM8A 3L0RA 4KVHA 3BNEA 3FG4A 1VQO3 1GYBA 4L8OA 1WQLB 5CF2A 5AYSC 4N6V0 3LZAA 3DGNA 1WMNA 2Z7AA 3CCU3 3N9HA 3JUPA 3EC9A 1HU9A 3F8XA 3V98A 1K41A 1W4NA 1Q864 1ROVA 4R1KA 3GZBA 1OHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYK A;  3F40 A;  2PZV A;  4Q53 A;  3JUN A;  5HGR A;  3A76 A;  4GB5 A;  1QJG A;  3OWY A;  3OWU A;  4OVM A;  1SJW A;  1UUW B;  4HM1 B;  2HMO B;  3B8L A;  4ORL A;  1E3R A;  5BXQ A;  5KP3 A;  4U13 A;  4XB5 A;  2Z77 A;  4FCJ A;  3G0K A;  4K1U A;  3CU3 A;  3KSP A;  4PEJ A;  1JKG B;  5AEU B;  5AEW B;  4J8T A;  2GBW B;  1NDO B;  5EVH A;  1OPY A;  3HK4 A;  2RGQ A;  2R4I A;  2JQ5 A;  5CK6 A;  3EQQ B;  4HM7 B;  1S5A A;  5DRV A;  3NHX A;  1O7N B;  5D83 A;  1ZO2 A;  2F86 B;  2IMJ A;  2STD A;  2XSH B;  3JUO A;  4HM8 B;  1UUV B;  4XDW A;  3FGY A;  2CKF B;  4WYK B;  5IF6 A;  5AIF A;  1DMN A;  4I4K A;  3D9R A;  1W00 A;  1STD A;  3EJV A;  3GZY B;  1GY7 A;  1VZZ A;  3SOA A;  5AI1 A;  1E97 A;  1OHO A;  3ECF A;  2K54 A;  4N3V A;  3CPO A;  1OGZ A;  5IG4 A;  3VSY A;  1Q40 B;  5CLK A;  3G8Z A;  3E99 A;  3DZL A;  8CHO A;  4HM4 B;  4WWU C;  3OWS A;  3ROB A;  1OGX A;  1W6Y A;  3MHE A;  1EA2 A;  3EN8 A;  3T8U A;  4J9A A;  3MG1 A;  4HM0 B;  1NU3 A;  2B24 B;  5KP4 A;  4XBY A;  5AIH A;  3DXO A;  4MJD A;  4X2H A;  1OUN A;  3S5C A;  3M8C A;  1BUQ A;  3I0Y A;  1ULJ B;  5JPU A;  1OH0 A;  3EBY A;  4FCM A;  2GEX A;  4HKV B;  1OF5 A;  2UX0 A;  1QMA A;  1O7P B;  1O7G B;  2YFI B;  3EHC A;  3UNL A;  5IG3 A;  3K7C A;  1U5O A;  1Z1S A;  5G2G A;  1JN5 A;  3OX9 A;  3MKI A;  3RGA A;  5IEP A;  3JUQ A;  2OWP A;  5CF1 A;  3H51 A;  4HM2 B;  3SED A;  3CNM A;  3STD A;  5JPP A;  3JUM A;  1AR0 A;  5IER A;  3EF8 A;  1GY5 A;  2HMJ B;  3VGN A;  7STD A;  3KE7 A;  3LYG A;  4XDV A;  1O7W B;  1GS3 A;  2W2C A;  2HMK B;  3KKG A;  4HZ9 B;  3FLJ A;  3F8H A;  1ISK A;  5IEO A;  3KZT A;  2F99 A;  3MYT A;  4H3U A;  1IDP A;  4RZM A;  4R9K A;  5TGN A;  3NXJ A;  4K1V A;  3GZR A;  3GZX B;  5BVB A;  4HM6 B;  2HMN B;  2GBX B;  4L7K A;  3Q90 A;  3F7S A;  1JN5 B;  3NUV A;  1O7H B;  2I9W A;  1TP6 A;  3G16 A;  1OHS A;  5CXO A;  3WMD A;  3NV0 A;  2XRX B;  1DMQ A;  1EG9 B;  3EBT A;  2RCD A;  1ASK A;  1W01 A;  1NWW A;  5AIG A;  2YFL B;  1CQS A;  6STD A;  2F98 A;  3B4O A;  1OCV A;  3MSO A;  4STD A;  2BMO B;  3DUK A;  3OXA A;  5STD A;  5FW5 A;  4HM3 B;  1JB5 A;  1JB2 A;  4WP5 A;  4LMI A;  3HZP A;  3BLZ A;  2INX A;  3FH1 A;  3FSD A;  2HML B;  3GRD A;  2QIY A;  4HJL B;  1Q42 A;  3T8N A;  4X2O A;  3HX8 A;  4XBT A;  3SOY A;  3IPT A;  3MG2 A;  4LGQ A;  3FZW A;  1Q40 A;  1TUH A;  1DMM A;  2RFR A;  3H3H A;  3ER7 A;  4LEH A;  3F14 A;  3EX9 A;  3GWR A;  2XSO B;  2HMM B;  1E3V A;  2XR8 B;  4IIA A;  4R9L A;  4L8P A;  3NV0 B;  4XM4 A;  5AII A;  5IEN A;  3K0Z A;  1O7M B;  5D82 A;  3B4P A;  3BB9 A;  1JB4 A;  3OV4 A;  2BNG A;  2BMR B;  2GXF A;  2Z76 A;  3F9S A;  5DRE A;  3NBR A;  3DMC A;  3FKA A;  2BMQ B;  3FF2 A;  3FF0 A;  3UJM A;  1GY6 A;  3MG3 A;  4XBX A;  2A15 A;  3RGR A;  5KP1 A;  3NM2 A;  1OF5 B;  1A2K A;  2CHC A;  5IG0 A;  2B1X B;  1JKG A;  2YFJ B;  1W02 A;  4HVN A;  3EN1 B;  2GEY A;  1C7H A;  3CNX A;  1ZX2 A;  4HM5 B;  4CDL A;  3B7C A;  4OUQ A;  2QGU A;  5D81 A;  5IG5 A;  3F7X A;  4HZB B;  1HKX A;  1ULI B;  3DM8 A;  4KVH A;  1GYB A;  4L8O A;  1WQL B;  5CF2 A;  3LZA A;  2Z7A A;  3JUP A;  3EC9 A;  3F8X A;  1K41 A;  4R1K A;  3GZB A;  1OHP A; 
#chains in the Genus database with same CATH topology
 3DGY A;  4WYK A;  3F40 A;  2XGL A;  2PZV A;  3PZW A;  4Q53 A;  4R80 A;  3JUN A;  4HAA A;  3CXC 2;  2ZL8 A;  5HGR A;  1IVW A;  1C54 A;  3A76 A;  1GMR A;  1SIH A;  4GB5 A;  2FGT A;  1IU7 A;  1TU5 A;  1GOU A;  1LNI A;  1QJG A;  2UGI A;  1BAO A;  2D42 A;  1G0T A;  4NHF A;  4NPB A;  3OWY A;  3OWU A;  3J7Y d;  3SXX A;  4OVM A;  3NQY A;  4EXR A;  2C4B A;  3Q2P A;  1SJW A;  1BNG A;  1UUW B;  2XEP A;  4HM1 B;  2F5M A;  2HMO B;  3B8L A;  4ORL A;  3OW2 2;  1VQ9 3;  1BNF A;  1E3R A;  5BXQ A;  4FR9 A;  5KP3 A;  4U13 A;  1R4C A;  2IUK A;  1EUI C;  1LOY A;  4XB5 A;  2Z77 A;  4FCJ A;  4ZM8 A;  6RNT A;  3AHW A;  3SLU A;  1B2S A;  1HYF A;  3G0K A;  4K1U A;  3CU3 A;  2CWT A;  3KSP A;  3PCR A;  3SVA A;  1I3F A;  1JKG B;  4PEJ A;  5AEU B;  5AEW B;  3CCQ 3;  1IVX A;  4J8T A;  2O3O A;  2GBW B;  2XH9 A;  1BGS A;  2KF5 A;  4BTW A;  4RNY A;  1YJN 3;  3CC4 3;  1NDO B;  2KF4 A;  1KSI A;  2XFS A;  5EVH A;  1OPY A;  1SQW A;  1MWT A;  4FMB A;  4BIR A;  1QVG 2;  2O9U X;  1UCI A;  2GU1 A;  1RJO A;  1GMQ A;  3MWZ A;  1TJD A;  3HK4 A;  1N8R 4;  4HOH A;  2Y73 A;  3RNT A;  1VQ7 3;  3NBJ A;  3VF1 A;  2ZDJ A;  2RGQ A;  1T2I A;  2R4I A;  4EV5 A;  2JDI H;  2JQ5 A;  4BTY A;  2QEX 3;  4DKI A;  1RKY A;  1D6Z A;  5CK6 A;  3WDG B;  2CFG A;  3G71 3;  1NB5 I;  3EQQ B;  1LQG C;  1S5A A;  1CEW I;  2CFW A;  4HM7 B;  5DRV A;  3X41 A;  1K9M 4;  1VQ6 3;  3NHX A;  2P05 A;  2ML6 A;  1O7N B;  5D83 A;  3EB8 A;  1ZO2 A;  2F86 B;  2IMJ A;  4KFD A;  4KZ1 A;  4OK0 A;  1RCL A;  2STD A;  3LML A;  4CJN A;  1DET A;  2LYX A;  2XSH B;  1A2P A;  1ZS7 A;  2M7O A;  3JUO A;  1VQM 3;  1I70 A;  4HM8 B;  1UUV B;  8RNT A;  4XDW A;  1YHQ 3;  3FGY A;  1KD1 4;  2CKF B;  2R41 A;  1B2X A;  5M19 A;  1VQK 3;  4WYK B;  5IF6 A;  2F56 A;  1TIJ A;  3QRD A;  1DMN A;  1TFK A;  4I4K A;  5AIF A;  3D9R A;  1W00 A;  1STD A;  1QAF A;  4LSO A;  1IYY A;  1BOX A;  2UUG C;  4RBN A;  1NJI 4;  2FXT A;  1BU4 A;  1CYV A;  3EJV A;  3CME 3;  3GZY B;  1I2E A;  1GY7 A;  1VZZ A;  3SOA A;  5AI1 A;  1Y4K A;  1E97 A;  1K28 A;  1OHO A;  2WOF A;  3ECF A;  1NB3 I;  1JBR A;  3HII A;  1IV7 A;  2OTL 3;  4IPB A;  1M9G A;  2ML5 A;  2K54 A;  3G4S 3;  4N3V A;  4EW5 A;  2CX1 A;  2KXG A;  4QWT A;  3CPO A;  4N6T A;  1OGZ A;  1RCK A;  4O8S A;  5IG4 A;  2RNT A;  3VSY A;  1YGW A;  4O02 B;  1UCK A;  1FGQ A;  1I0X A;  1JZD A;  1Q40 B;  5CLK A;  1VQ4 3;  3G8Z A;  1RGA A;  3HI7 A;  2OQE C;  1YVB I;  3DZL A;  3E99 A;  8CHO A;  4HM4 B;  4WWU C;  1FGR A;  1UI8 A;  4G1M B;  1BNS A;  3OWS A;  5ELJ A;  2CFK A;  3ROB A;  1OGX A;  2Q07 A;  1RGG A;  2V1L A;  1N8Q A;  4ILF A;  1W6Y A;  5ELU A;  5AYR B;  2CG1 A;  1MGR A;  3MHE A;  1EA2 A;  4FMD A;  1W5Z A;  2SBL A;  1F8N A;  2MF7 A;  3EN8 A;  4AEQ A;  1I2F A;  1N5H A;  3NM7 A;  3T8U A;  3JVC A;  2K0M A;  3CCR 3;  2KF6 A;  4GL6 A;  1LNH A;  4J9A A;  1QVF 2;  3ZG0 A;  3MG1 A;  4HM0 B;  5M1A A;  1V57 A;  1NU3 A;  4R4K A;  2Y74 A;  1X1X A;  4BU4 A;  3CCM 3;  1RN1 A;  2W03 A;  1Q81 4;  1VQL 3;  1YIT 3;  2B24 B;  5KP4 A;  1RNT A;  4XBY A;  5AIH A;  3S29 A;  5LC6 A;  1LRA A;  1UDI I;  3DXO A;  4MJD A;  3UB1 A;  4X2H A;  5BU4 A;  5G1L A;  1OUN A;  4MMX B;  3S5C A;  3M8C A;  1AVL A;  1BUQ A;  2WO0 A;  1RN7 A;  1JRQ A;  3I0Y A;  1ULJ B;  4TX4 A;  1CYU A;  5JPU A;  3CMA 3;  1MWU A;  1OH0 A;  1T3B A;  2CX0 A;  1UI7 A;  2P09 A;  3EBY A;  4FCM A;  2GEX A;  1BSB A;  1W7C A;  3CC2 3;  1BNJ A;  1RGH A;  1UGI A;  1WTH A;  3DGM A;  1GOV A;  4HKV B;  1J2B A;  1X1W A;  1WNH A;  4JF8 A;  1JV2 B;  1BAN A;  1OF5 A;  2UX0 A;  1QMA A;  3Q3F A;  1O7P B;  1STF I;  1O7G B;  1LQM B;  3S67 A;  1FGO A;  1TRQ A;  1UGH I;  2YFI B;  3EHC A;  4FMC A;  1BNR A;  2PNC A;  4BL3 A;  1GOY A;  1U8C B;  1UUG B;  1UCJ A;  1A90 A;  2J8X B;  1IQY A;  3CD6 3;  3WHO A;  4BTX A;  1PU4 A;  3BNC A;  3UNL A;  5IG3 A;  3K7C A;  4O3V A;  1Q82 4;  1U5O A;  1N5P A;  2W56 A;  1S72 3;  1Q7H A;  2MC8 A;  1IT7 A;  1GD4 A;  1PYL A;  1Z1S A;  2KAA A;  3BNB A;  3KCH A;  1RLS A;  4N6N B;  3PXM A;  1GSP A;  5G2G A;  2CFL A;  4GSP A;  1JN5 A;  4EV2 A;  1B27 A;  1T2H A;  1JBT A;  4CPK A;  1RNB A;  3OX9 A;  3NBB A;  2OTJ 3;  3MKI A;  1I8V A;  3RGA A;  5IEP A;  5JBS A;  2XF3 A;  1W6C A;  3JUQ A;  3S28 A;  2RSX A;  3PS8 A;  1B2M A;  2BIR A;  2OOV A;  2OWP A;  1FA3 A;  5CF1 A;  3H51 A;  2ZHX B;  1JZO A;  4HM2 B;  3SED A;  3U97 A;  3CNM A;  3AGO A;  3STD A;  7RNT A;  5JPP A;  5BIR A;  3JUM A;  1I2G A;  1RRH A;  2AAD A;  4LYL B;  6GSP A;  1B3S A;  3CCJ 3;  1RHL A;  1FW7 A;  1AR0 A;  1LOV A;  1B2U A;  1UW1 A;  5IER A;  1FUT A;  3EF8 A;  1GY5 A;  3PYJ A;  2IA7 A;  1RMS A;  1RGF A;  1D6Y A;  2BT3 A;  2HMJ B;  3DGL A;  1EKM A;  2L1S A;  3VGN A;  7STD A;  1ZGX A;  4N6U A;  3WOD G;  5G1K A;  1DVD A;  3KE7 A;  3LYG A;  2YX9 A;  2CH9 A;  5A0O B;  4EBG A;  1MWR A;  1I3I A;  1BSE A;  4XDV A;  1O7W B;  2BHM A;  1GD3 A;  3D79 A;  1GS3 A;  2W2C A;  2HMK B;  2ZA4 A;  3V92 A;  3KFQ C;  1RDS A;  3KKG A;  1D6U A;  3N8B A;  4K61 A;  1RGL A;  1BSC A;  1RTU A;  4HZ9 B;  5LC7 A;  4N6O B;  2HOH A;  3AMO A;  3U1W A;  3FLJ A;  2RBI A;  3I56 3;  3F8H A;  3LTA A;  3WR2 A;  3LTB A;  1TFO A;  2KCD A;  4O2H A;  1BVI A;  3CPW 2;  1X1U A;  1ISK A;  5IEO A;  3MPH A;  1KC8 4;  1FYS A;  2P0M A;  3KZT A;  2F99 A;  3V99 A;  2CG0 A;  3MYT A;  2KRT A;  4H3U A;  1RRL A;  1IDP A;  1VQQ A;  3RDE A;  1SAR A;  1IQX A;  1YVS A;  3DGO A;  2KF3 A;  1A67 A;  4RZM A;  1BIR A;  1W6G A;  2GU3 A;  4R9K A;  1SPU A;  5TGN A;  1EEJ A;  1AVK A;  3NXJ A;  1IK3 A;  1KWI A;  1LOW A;  4K1V A;  1IVU A;  5RNT A;  3GZR A;  2H0G A;  3GZX B;  4N6M A;  1VQ5 3;  1Q9E A;  5BVB A;  2F4Y A;  4J5K A;  1FUW A;  1M90 4;  4HM6 B;  3CC7 3;  1BRI A;  4AKY A;  3GAX A;  2HMN B;  2W56 B;  1RSN A;  2GBX B;  4L7K A;  3Q90 A;  4GHO A;  1W2B 2;  3F7S A;  4N6L A;  3DY5 A;  1MNL A;  1JN5 B;  1B2Z A;  3NUV A;  3SX1 A;  1BNE A;  1O7H B;  2I9W A;  1TP6 A;  1FGT A;  1OHS A;  3G16 A;  5CXO A;  3WMD A;  3NV0 A;  2OCT A;  1IVV A;  2W6J H;  3KN4 A;  1LXE A;  1KQS 2;  3KSE D;  3CCE 3;  2XRX B;  2CWV A;  1MOL A;  1DMQ A;  3HOH A;  3IJE B;  1EG9 B;  3EBT A;  5EEO A;  1FUS A;  1MGW A;  1DYU A;  2RCD A;  3K63 A;  1ASK A;  1W01 A;  4MMZ B;  1NWW A;  5AIG A;  1B20 A;  1PY3 A;  2YFL B;  2SAR A;  1CQS A;  6STD A;  1DE3 A;  4RNT A;  4FMA A;  1I0V A;  3GSP A;  2F98 A;  1JJ2 2;  1AQZ A;  4LZI A;  2CFD A;  1GMP A;  1QAL A;  2IYJ A;  3B4O A;  3HIG A;  3X40 A;  1YGE A;  1AV4 A;  2XFT A;  1OCV A;  3MSO A;  4STD A;  2BMO B;  4I5Q A;  3DUK A;  3CCL 3;  3WA2 X;  3OXA A;  2E2V A;  1BSA A;  3X3X A;  1N9E A;  2W0Q A;  3DH2 A;  2Z6B A;  1WMP A;  3Q1C A;  5STD A;  5FW5 A;  1YI2 3;  1YIJ 3;  2WGQ A;  4EC6 A;  4HM3 B;  1JB5 A;  1JB2 A;  4WP5 A;  5EQL A;  3WOE B;  3ZG5 A;  4LMI A;  1K73 4;  3HZP A;  3K9M C;  5FGO A;  3BLZ A;  4KFE A;  1US1 A;  2INX A;  3AMO B;  3FH1 A;  2XGN A;  1YJW 3;  1FZU A;  2K3D A;  1VQ8 3;  3FSD A;  4HYZ A;  4K90 B;  1LOX A;  2HML B;  4MEI A;  1HZ1 A;  2CC3 A;  2QIY A;  3GRD A;  4HJL B;  1X1Y A;  3AGN A;  1L5G B;  1Q42 A;  1JBS A;  3PCS A;  3T8N A;  2W9Q A;  1K8A 4;  5I97 A;  1RGK A;  4X2O A;  4CCV A;  3AHS A;  5HOH A;  3HX8 A;  4H61 A;  3LH4 A;  5M18 A;  1RGE A;  1AY7 A;  3FG1 A;  4XBT A;  2CWU A;  3WOF B;  3ALA A;  1NO3 A;  3SOY A;  4AKZ A;  3IPT A;  1G96 A;  3MG2 A;  4LGQ A;  4RNZ A;  2E2U A;  3FZW A;  1BNI A;  1Q40 A;  1TUH A;  1W2Z A;  3K5T A;  2FNQ A;  1IT8 A;  2OOV C;  1VQN 3;  1DMM A;  2RFR A;  3FG3 A;  3H3H A;  3ER7 A;  4LEH A;  2CW9 A;  3F14 A;  1TTO A;  1V58 A;  1PFP A;  4J5G A;  3G6E 3;  3EX9 A;  3D5I A;  3GWR A;  2XSO B;  4EYC A;  2HMM B;  1E3V A;  3EE1 A;  1IQ8 A;  4FCZ A;  2L4V A;  2XR8 B;  1QAK A;  4IIA A;  4R9L A;  2AAE A;  4L8P A;  1UCL A;  3NV0 B;  4XM4 A;  3X3Y A;  1VQP 3;  5AII A;  1BRH A;  2H0H A;  3IMA B;  5IEN A;  2W9P A;  1YJ9 3;  3K0Z A;  1WMO A;  2E2T A;  1O7M B;  2IUJ A;  1RGC A;  1R4Y A;  3LTD A;  3LOY A;  3PGB A;  5D82 A;  1BRK A;  3B4P A;  3BB9 A;  1JB4 A;  3LTC A;  3OV4 A;  2BNG A;  2BMR B;  4HBR A;  2H0I A;  4KT3 B;  3WA3 A;  1EQK A;  2GXF A;  1V74 A;  1BSD A;  1SII A;  2Z76 A;  3F9S A;  5DRE A;  1BRN L;  1DVC A;  3NBR A;  3DMC A;  3I55 3;  3FKA A;  2BMQ B;  2C11 A;  3FF2 A;  3BND A;  1Q7Y 4;  3BIR A;  1BRS A;  1G02 A;  3FF0 A;  1GY6 A;  3UJM A;  3A5E A;  1B21 A;  3BU4 A;  3MG3 A;  4XBX A;  2A15 A;  3RGR A;  5KP1 A;  3O8Y A;  3CCV 3;  3NM2 A;  1OF5 B;  1A2K A;  1YNV X;  2CHC A;  5IG0 A;  3X3Z A;  2C10 A;  2CK3 H;  3D4A A;  1NNV A;  2WOH A;  4KFF A;  4NRE A;  3LT9 A;  1OAC A;  4WFO A;  2B1X B;  2WGO A;  1JKG A;  3T0U A;  3TDG A;  4BL2 A;  2IY2 A;  3UL5 A;  1N9J A;  4MMY B;  2YFJ B;  3NX0 A;  4WHA A;  9RNT A;  1W02 A;  3QK9 A;  4HVN A;  2GSP A;  3ZFZ A;  2LQV A;  1ROA A;  3KII A;  3LT8 A;  1JNQ A;  3EN1 B;  1BUJ A;  2GEY A;  1C7H A;  3CNX A;  1TRP A;  1ZX2 A;  1M1X B;  2P0X A;  2W04 A;  4HM5 B;  3NQZ A;  2BO9 B;  1IV9 A;  4IT7 A;  1RN4 A;  3LXU X;  4JRF A;  2D1W A;  2QA4 3;  3UL6 A;  2P38 A;  2OQE A;  4CDL A;  3B7C A;  1M1K 4;  1A2V A;  4OUQ A;  1CH0 A;  3N54 B;  3S27 A;  1FGM A;  1T5Y A;  2QGU A;  5D81 A;  5IG5 A;  3CCS 3;  5GSP A;  2F5W A;  2CIU A;  1LVN A;  3X42 A;  3F7X A;  3FCS B;  5IW9 A;  4HZB B;  3D3L A;  1HKX A;  1ULI B;  3DM8 A;  2BU4 A;  1BRJ A;  3L0R A;  1MWS A;  4KVH A;  3BNE A;  3FG4 A;  1VQO 3;  1BRG A;  1GYB A;  4L8O A;  1WQL B;  5CF2 A;  5AYS C;  4N6V 0;  3LZA A;  3DGN A;  1WMN A;  2Z7A A;  7GSP A;  3CCU 3;  3N9H A;  3JUP A;  3D5G A;  3EC9 A;  1HU9 A;  3F8X A;  3V98 A;  1K41 A;  1W4N A;  1Q86 4;  1ROV A;  4R1K A;  3SYU A;  3URP A;  3GZB A;  1OHP A; 
#chains in the Genus database with same CATH homology
 4WYK A;  3F40 A;  2XGL A;  2PZV A;  3PZW A;  4Q53 A;  4R80 A;  3JUN A;  3CXC 2;  2ZL8 A;  5HGR A;  1IVW A;  3A76 A;  1SIH A;  4GB5 A;  2FGT A;  1IU7 A;  1TU5 A;  1QJG A;  2D42 A;  4NHF A;  3J7Y d;  3OWY A;  3OWU A;  3SXX A;  4OVM A;  3NQY A;  4EXR A;  3Q2P A;  1SJW A;  1UUW B;  2XEP A;  4HM1 B;  2HMO B;  3B8L A;  4ORL A;  3OW2 2;  1VQ9 3;  1E3R A;  5BXQ A;  4FR9 A;  5KP3 A;  4U13 A;  1R4C A;  2IUK A;  4XB5 A;  2Z77 A;  4FCJ A;  4ZM8 A;  3SLU A;  3G0K A;  4K1U A;  3CU3 A;  2CWT A;  3KSP A;  3PCR A;  3SVA A;  4PEJ A;  1JKG B;  5AEU B;  5AEW B;  3CCQ 3;  1IVX A;  4J8T A;  2O3O A;  2GBW B;  2XH9 A;  4BTW A;  4RNY A;  1YJN 3;  3CC4 3;  1NDO B;  1KSI A;  2XFS A;  5EVH A;  1OPY A;  1SQW A;  4FMB A;  1QVG 2;  2O9U X;  2GU1 A;  1RJO A;  3MWZ A;  3HK4 A;  1N8R 4;  2Y73 A;  1VQ7 3;  3NBJ A;  3VF1 A;  2ZDJ A;  2RGQ A;  2R4I A;  4EV5 A;  2JDI H;  2JQ5 A;  4BTY A;  2QEX 3;  1RKY A;  1D6Z A;  5CK6 A;  3WDG B;  2CFG A;  3G71 3;  1NB5 I;  3EQQ B;  2CFW A;  1S5A A;  1CEW I;  4HM7 B;  5DRV A;  1K9M 4;  3X41 A;  1VQ6 3;  3NHX A;  2P05 A;  2ML6 A;  1O7N B;  5D83 A;  3EB8 A;  1ZO2 A;  2F86 B;  2IMJ A;  4KFD A;  4KZ1 A;  4OK0 A;  2STD A;  3LML A;  2LYX A;  2XSH B;  2M7O A;  3JUO A;  1VQM 3;  4HM8 B;  1UUV B;  1KD1 4;  4XDW A;  1YHQ 3;  3FGY A;  2CKF B;  1VQK 3;  4WYK B;  5IF6 A;  3QRD A;  1TIJ A;  1DMN A;  1TFK A;  4I4K A;  5AIF A;  3D9R A;  1W00 A;  1STD A;  1QAF A;  4LSO A;  4RBN A;  2FXT A;  1CYV A;  3EJV A;  3CME 3;  3GZY B;  1GY7 A;  1VZZ A;  3SOA A;  5AI1 A;  1Y4K A;  1E97 A;  1K28 A;  1OHO A;  2WOF A;  3ECF A;  1NB3 I;  3HII A;  1IV7 A;  2OTL 3;  4IPB A;  1M9G A;  2ML5 A;  2K54 A;  3G4S 3;  4N3V A;  2KXG A;  4QWT A;  3CPO A;  4N6T A;  1OGZ A;  4O8S A;  5IG4 A;  3VSY A;  4O02 B;  1FGQ A;  1VQ4 3;  1Q40 B;  5CLK A;  3G8Z A;  3HI7 A;  2OQE C;  1YVB I;  3DZL A;  3E99 A;  8CHO A;  4HM4 B;  4WWU C;  1FGR A;  1UI8 A;  4G1M B;  3OWS A;  5ELJ A;  2CFK A;  3ROB A;  1OGX A;  2Q07 A;  2V1L A;  1N8Q A;  1W6Y A;  5ELU A;  5AYR B;  2CG1 A;  3MHE A;  1EA2 A;  4FMD A;  1W5Z A;  2SBL A;  1F8N A;  2MF7 A;  3EN8 A;  4AEQ A;  1N5H A;  3NM7 A;  3T8U A;  3JVC A;  2K0M A;  3CCR 3;  4GL6 A;  1LNH A;  4J9A A;  1QVF 2;  3MG1 A;  4HM0 B;  1NU3 A;  4R4K A;  2Y74 A;  3CCM 3;  1Q81 4;  2W03 A;  1VQL 3;  1YIT 3;  2B24 B;  5KP4 A;  4XBY A;  5AIH A;  3S29 A;  5LC6 A;  3DXO A;  4MJD A;  3UB1 A;  4X2H A;  1OUN A;  4MMX B;  3S5C A;  3M8C A;  1AVL A;  1BUQ A;  2WO0 A;  1RN7 A;  1JRQ A;  3I0Y A;  1ULJ B;  4TX4 A;  1CYU A;  5JPU A;  3CMA 3;  1OH0 A;  2P09 A;  3EBY A;  1UI7 A;  4FCM A;  3CC2 3;  2GEX A;  1W7C A;  1WTH A;  4HKV B;  1J2B A;  3DGM A;  1WNH A;  4JF8 A;  1JV2 B;  1OF5 A;  2UX0 A;  1QMA A;  1O7P B;  1STF I;  1O7G B;  3S67 A;  1FGO A;  2YFI B;  4FMC A;  3EHC A;  2PNC A;  1U8C B;  1A90 A;  1IQY A;  3CD6 3;  4BTX A;  1PU4 A;  3BNC A;  3UNL A;  5IG3 A;  3K7C A;  4O3V A;  1Q82 4;  1U5O A;  1N5P A;  2W56 A;  1S72 3;  2MC8 A;  1IT7 A;  1GD4 A;  1Z1S A;  3BNB A;  4N6N B;  3PXM A;  5G2G A;  2CFL A;  1JN5 A;  4EV2 A;  3OX9 A;  3NBB A;  2OTJ 3;  3MKI A;  3RGA A;  5IEP A;  5JBS A;  2XF3 A;  1W6C A;  3JUQ A;  3S28 A;  2RSX A;  3PS8 A;  2OOV A;  2OWP A;  1FA3 A;  5CF1 A;  3H51 A;  4HM2 B;  3SED A;  3U97 A;  3CNM A;  3STD A;  5JPP A;  3JUM A;  1RRH A;  3CCJ 3;  1AR0 A;  1UW1 A;  5IER A;  3EF8 A;  1GY5 A;  3PYJ A;  2IA7 A;  2BT3 A;  1D6Y A;  2HMJ B;  3DGL A;  3VGN A;  1EKM A;  7STD A;  3WOD G;  4N6U A;  1DVD A;  3KE7 A;  3LYG A;  2YX9 A;  2CH9 A;  5A0O B;  4EBG A;  4XDV A;  1O7W B;  2BHM A;  1GD3 A;  1GS3 A;  2W2C A;  2HMK B;  3V92 A;  3KFQ C;  3KKG A;  1D6U A;  3N8B A;  4K61 A;  5LC7 A;  4HZ9 B;  4N6O B;  3AMO A;  3U1W A;  3FLJ A;  3I56 3;  3F8H A;  3LTA A;  3LTB A;  1TFO A;  2KCD A;  4O2H A;  3CPW 2;  1ISK A;  5IEO A;  3MPH A;  1KC8 4;  2P0M A;  3KZT A;  2F99 A;  3V99 A;  2CG0 A;  3MYT A;  2KRT A;  4H3U A;  1RRL A;  1IDP A;  3RDE A;  1IQX A;  3DGO A;  1A67 A;  4RZM A;  2GU3 A;  1W6G A;  4R9K A;  1SPU A;  5TGN A;  1AVK A;  3NXJ A;  1IK3 A;  1KWI A;  4K1V A;  1IVU A;  3GZR A;  3GZX B;  4N6M A;  1VQ5 3;  5BVB A;  1FUW A;  1M90 4;  4HM6 B;  3CC7 3;  4AKY A;  3GAX A;  2HMN B;  2W56 B;  2GBX B;  4L7K A;  3Q90 A;  1W2B 2;  3F7S A;  4N6L A;  3DY5 A;  1MNL A;  1JN5 B;  3NUV A;  3SX1 A;  1O7H B;  2I9W A;  1TP6 A;  1FGT A;  1OHS A;  3G16 A;  5CXO A;  3WMD A;  3NV0 A;  2OCT A;  1IVV A;  2W6J H;  3KN4 A;  1LXE A;  1KQS 2;  3KSE D;  3CCE 3;  2XRX B;  2CWV A;  1MOL A;  1DMQ A;  3IJE B;  1EG9 B;  3EBT A;  5EEO A;  3K63 A;  1DYU A;  2RCD A;  1ASK A;  1W01 A;  4MMZ B;  1NWW A;  5AIG A;  2YFL B;  1CQS A;  6STD A;  4FMA A;  2F98 A;  1JJ2 2;  4LZI A;  2CFD A;  1QAL A;  3B4O A;  3HIG A;  1NJI 4;  3X40 A;  1YGE A;  1AV4 A;  2XFT A;  1OCV A;  3MSO A;  4STD A;  2BMO B;  3DUK A;  3CCL 3;  3WA2 X;  3OXA A;  2E2V A;  3X3X A;  1N9E A;  2W0Q A;  2Z6B A;  1WMP A;  3Q1C A;  5STD A;  5FW5 A;  1YI2 3;  1YIJ 3;  2WGQ A;  4EC6 A;  4HM3 B;  1JB5 A;  1JB2 A;  4WP5 A;  5EQL A;  3WOE B;  4LMI A;  1K73 4;  3HZP A;  3K9M C;  5FGO A;  3BLZ A;  4KFE A;  1US1 A;  2INX A;  3AMO B;  3FH1 A;  2XGN A;  1YJW 3;  1VQ8 3;  3FSD A;  4HYZ A;  4K90 B;  1LOX A;  2HML B;  4MEI A;  2CC3 A;  3GRD A;  2QIY A;  4HJL B;  1L5G B;  1Q42 A;  3PCS A;  3T8N A;  2W9Q A;  1K8A 4;  5I97 A;  4X2O A;  4CCV A;  3HX8 A;  4H61 A;  3LH4 A;  3FG1 A;  4XBT A;  2CWU A;  3WOF B;  3ALA A;  1NO3 A;  3SOY A;  4AKZ A;  3IPT A;  1G96 A;  3MG2 A;  4LGQ A;  4RNZ A;  2E2U A;  3FZW A;  1Q40 A;  1TUH A;  1W2Z A;  3K5T A;  2FNQ A;  1IT8 A;  2OOV C;  1VQN 3;  1DMM A;  2RFR A;  3FG3 A;  3H3H A;  3ER7 A;  4LEH A;  2CW9 A;  3F14 A;  1PFP A;  3G6E 3;  3EX9 A;  3GWR A;  2XSO B;  4EYC A;  2HMM B;  1E3V A;  3EE1 A;  1IQ8 A;  4FCZ A;  2L4V A;  2XR8 B;  1QAK A;  4IIA A;  4R9L A;  4L8P A;  3NV0 B;  4XM4 A;  3X3Y A;  1VQP 3;  5AII A;  3IMA B;  5IEN A;  2W9P A;  1YJ9 3;  3K0Z A;  1WMO A;  2E2T A;  1O7M B;  2IUJ A;  3LTD A;  3PGB A;  3LOY A;  5D82 A;  3B4P A;  3BB9 A;  1JB4 A;  3LTC A;  3OV4 A;  2BNG A;  2BMR B;  4HBR A;  3WA3 A;  1EQK A;  2GXF A;  1V74 A;  1SII A;  2Z76 A;  3F9S A;  5DRE A;  1DVC A;  3NBR A;  3DMC A;  3I55 3;  3FKA A;  2BMQ B;  2C11 A;  3FF2 A;  3BND A;  1Q7Y 4;  3FF0 A;  3UJM A;  1GY6 A;  3MG3 A;  4XBX A;  2A15 A;  3RGR A;  5KP1 A;  3O8Y A;  3CCV 3;  3NM2 A;  1OF5 B;  1A2K A;  2CHC A;  5IG0 A;  3X3Z A;  2C10 A;  2CK3 H;  2WOH A;  4KFF A;  4NRE A;  3LT9 A;  1OAC A;  4WFO A;  2B1X B;  2WGO A;  1JKG A;  3T0U A;  3TDG A;  3UL5 A;  1N9J A;  4MMY B;  2YFJ B;  3NX0 A;  4WHA A;  1W02 A;  3QK9 A;  4HVN A;  2LQV A;  1ROA A;  3KII A;  3LT8 A;  1JNQ A;  3EN1 B;  2GEY A;  1C7H A;  3CNX A;  1ZX2 A;  1M1X B;  2P0X A;  2W04 A;  4HM5 B;  3NQZ A;  2BO9 B;  1IV9 A;  4IT7 A;  3LXU X;  4JRF A;  2D1W A;  2QA4 3;  3UL6 A;  2P38 A;  2OQE A;  4CDL A;  3B7C A;  1M1K 4;  1A2V A;  4OUQ A;  3N54 B;  3S27 A;  1FGM A;  1T5Y A;  2QGU A;  5D81 A;  5IG5 A;  3CCS 3;  2CIU A;  1LVN A;  3X42 A;  3F7X A;  3FCS B;  5IW9 A;  4HZB B;  3D3L A;  1HKX A;  1ULI B;  3DM8 A;  3L0R A;  4KVH A;  3BNE A;  3FG4 A;  1VQO 3;  1GYB A;  4L8O A;  1WQL B;  5CF2 A;  5AYS C;  4N6V 0;  3LZA A;  3DGN A;  1WMN A;  2Z7A A;  3CCU 3;  3N9H A;  3JUP A;  3EC9 A;  1HU9 A;  3F8X A;  3V98 A;  1K41 A;  1W4N A;  1Q86 4;  1ROV A;  4R1K A;  3GZB A;  1OHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...