3H51A

Crystal structure of putative calcium/calmodulin dependent protein kinase ii association domain (np_636218.1) from xanthomonas campestris at 1.70 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
b'GVMHYTDKAALPADGEAREVAALFDTWNAALATGNPHKVADLYAPDGVLLPTVSNEVRASREQIENYFEMFLTKKPKGVINYRTVRLLDDDSAVDAGVYTFTLTDKNGKKSDVQARYTFVYEKRDGKWLIINHHSSAMPEVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative calcium/calmodulin dependent protein kinase II asso
publication title Crystal structure of Putative calcium/calmodulin dependent protein kinase II association domain (NP_636218.1) from XANTHOMONAS CAMPESTRIS at 1.70 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Protein binding
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h51A00
4J9AA 3EQQB 1O7WB 1GS3A 2XR8B 5JPUA 1E97A 5D83A 5AI1A 3ER7A 3ECFA 2RCDA 3OWYA 1ISKA 4R9LA 1Q40A 7STDA 4HJLB 2Z7AA 6STDA 1W6YA 5KP4A 3MHEA 3F7SA 4IIAA 1E3VA 1OH0A 5IERA 3UNLA 2GBWB 8CHOA 4U13A 3MG3A 3NHXA 3KKGA 4RZMA 3EN8A 3FLJA 2Z77A 4K1UA 5CXOA 4L8OA 3F8HA 3B4PA 3RGAA 4ORLA 3MG1A 3NBRA 4R9KA 3EBYA 1JB4A 1O7NB 2B1XB 4STDA 2BNGA 2RFRA 3CNMA 1Q42A 3JUQA 1NDOB 5EVHA 1DMMA 1TUHA 5BVBA 3LYGA 5IG0A 4Q53A 3H51A 3MYTA 4HZ9B 5TGNA 1OGZA 4KVHA 3KSPA 3F40A 2OWPA 4J8TA 1ASKA 1OHSA 1EA2A 3MG2A 1GY5A 3K7CA 1GY7A 1STDA 2GEXA 4XBXA 3SEDA 3NUVA 1OHOA 5HGRA 3STDA 3DXOA 3CPOA 2UX0A 4X2HA 2F98A 3EHCA 1JKGB 1QJGA 2A15A 3DM8A 3ROBA 3GZYB 4PEJA 1K41A 5IENA 4HVNA 1ULIB 1W01A 3CU3A 3I0YA 4XDVA 3BB9A 3DZLA 4XDWA 3UJMA 5IF6A 1JB2A 4XB5A 1HKXA 2HMJB 2HMOB 3GZXB 1GYBA 4HM7B 4HM1B 2R4IA 4HZBB 5AEUB 5DREA 5CK6A 3OWUA 1CQSA 2JQ5A 5IEOA 3NV0B 1A2KA 3E99A 3WMDA 1AR0A 1IDPA 5KP3A 3LZAA 5AIHA 3EF8A 3FH1A 4FCMA 2HMNB 1EG9B 1GY6A 2HMKB 4HKVB 4L7KA 1JKGA 3VGNA 1W00A 3FZWA 4WYKA 2XSHB 4HM6B 1TP6A 3EJVA 4CDLA 1E3RA 5D81A 3BLZA 1WQLB 1VZZA 5STDA 5JPPA 3FF0A 4HM3B 4FCJA 3G16A 2PZVA 4R1KA 2HMLB 3SOYA 3G8ZA 2XRXB 3EX9A 2IMJA 3GWRA 4HM8B 2BMRB 3B7CA 4LEHA 3MSOA 2INXA 4HM4B 5IG4A 2YFLB 1UUVB 5IG3A 3VSYA 3HZPA 3GZBA 1U5OA 5CF1A 5AIIA 5AEWB 3FF2A 3T8UA 3F7XA 4WYKB 4WP5A 3OWSA 4OVMA 1SJWA 1QMAA 1UUWB 3NV0A 5CLKA 2W2CA 1O7HB 1O7MB 3Q90A 2B24B 5G2GA 3DUKA 3F9SA 1OF5A 5DRVA 3GRDA 5IG5A 3SOAA 3H3HA 4WWUC 3RGRA 4XM4A 1ZO2A 2QIYA 3F8XA 3G0KA 4MJDA 2STDA 1O7PB 3JUPA 1NWWA 2BMQB 3MKIA 4H3UA 1BUQA 3NXJA 1OHPA 2F86B 2RGQA 1JN5B 4X2OA 2GXFA 3EBTA 5KP1A 3HX8A 4XBTA 5BXQA 1Z1SA 1OF5B 2YFJB 3B8LA 1S5AA 1JB5A 3B4OA 3M8CA 3OV4A 4K1VA 1OUNA 4HM2B 4N3VA 2CKFB 1Q40B 3EC9A 1OCVA 3IPTA 5IEPA 2GBXB 3KE7A 4L8PA 5D82A 2XSOB 4HM5B 3S5CA 1O7GB 3T8NA 3OX9A 5CF2A 3OXAA 1ULJB 4GB5A 1C7HA 4LGQA 1DMQA 1OPYA 2I9WA 4I4KA 3JUOA 4LMIA 3D9RA 5FW5A 3FSDA 2CHCA 3JUNA 4XBYA 2Z76A 3NM2A 3DMCA 3FGYA 3HK4A 2YFIB 1NU3A 5AIGA 3K0ZA 2HMMB 3KZTA 1JN5A 2GEYA 3A76A 5AIFA 2BMOB 3CNXA 1OGXA 2F99A 2QGUA 3FKAA 1DMNA 1W02A 4OUQA 4HM0B 2K54A 1ZX2A 3GZRA 3F14A 3EN1B 3JUMA
chains in the Genus database with same CATH superfamily
1RGLA 1CEWI 2WOFA 1DYUA 4J9AA 1RDSA 3U1WA 3EQQB 1O7WB 3V92A 3I563 3DGNA 1GS3A 1YIJ3 5HOHA 2W6JH 3J7Yd 2XR8B 3IJEB 1QVF2 1LQGC 2KAAA 1E97A 2WO0A 4FMAA 1L5GB 5JPUA 3PYJA 3S29A 5D83A 1YJW3 1B2UA 5AI1A 1IQXA 3ECFA 2RCDA 3ER7A 3OWYA 5M19A 1ISKA 4K61A 4R9LA 1Q40A 7STDA 1IVXA 4HJLB 2Z7AA 1EUIC 2F5MA 3X3YA 4OK0A 3O8YA 6STDA 1BU4A 1W6YA 4K90B 1BRKA 4CCVA 5KP4A 3MHEA 3F7SA 2CFLA 4IIAA 1RTUA 1KWIA 1E3VA 1A2VA 1X1XA 4EBGA 1NB5I 1BSCA 1GD3A 1OH0A 2D1WA 2W04A 3DY5A 4FR9A 5IERA 3CCM3 2CX1A 1GMQA 3NQZA 1S723 1HU9A 3WHOA 1BNEA 2YX9A 2GBWB 3UNLA 8CHOA 3LTCA 1OACA 4U13A 1VQ73 3MG3A 1FGRA 3NHXA 1W7CA 3BNCA 1SIIA 2AAEA 3K9MC 3KKGA 4WFOA 1IT7A 1LOWA 4RZMA 4AEQA 1VQQA 3KSED 2JDIH 1RN4A 1UCLA 3EN8A 4BL2A 3FLJA 2Z77A 1I8VA 4K1UA 5CXOA 3QK9A 3AHSA 7RNTA 1LXEA 4G1MB 4L8OA 1RN7A 4EV5A 3F8HA 3B4PA 4ILFA 3RGAA 3LXUX 4ORLA 1BRNL 3MG1A 2XEPA 1IQ8A 1Q7HA 3HI7A 3NBRA 4R9KA 1DVCA 3CCS3 3TDGA 3EBYA 2D42A 1CYUA 2CWTA 3BNEA 1JB4A 3X40A 1GSPA 1O7NB 1B2SA 3AMOB 2XGLA 4MMZB 3RNTA 2B1XB 4H61A 2W9PA 4STDA 2BNGA 2RFRA 3CCU3 1C54A 4KFDA 3CNMA 5I97A 1PY3A 1Q42A 1W6GA 3DGYA 3JUQA 3N9HA 1JV2B 1NDOB 5M18A 1B27A 1WMOA 5G1KA 3G4S3 5RNTA 1PFPA 1M9GA 1QAKA 1JZOA 1DMMA 3HIIA 1TUHA 5EVHA 5IW9A 5BVBA 1DVDA 3LYGA 4RNTA 2P0XA 1HYFA 2Q07A 4Q53A 5IG0A 3H51A 4N6TA 3MYTA 4HZ9B 3AGNA 3V99A 5TGNA 1W5ZA 1BNFA 1OGZA 4KVHA 3KSPA 3F40A 2OWPA 4J8TA 1ASKA 4WHAA 4QWTA 1OHSA 1EA2A 1SIHA 3MG2A 1GY5A 3Q2PA 1YGEA 4I5QA 3K7CA 1BRGA 3A5EA 3X41A 1VQO3 1UI8A 4ZM8A 1GY7A 5LC6A 3CCQ3 1JRQA 1RGGA 1AV4A 2E2UA 1Q9EA 1STDA 2GEXA 2KXGA 1YNVX 3FG1A 1MNLA 7GSPA 4XBXA 4EYCA 1RCLA 1V74A 1FGQA 3SEDA 2IUKA 3NUVA 3ZG5A 4EW5A 1OHOA 1Q864 1RGEA 5HGRA 2QA43 2J8XB 3STDA 1VQ53 3DXOA 1AQZA 3D5IA 4O02B 2SBLA 3SVAA 1N9EA 1ROVA 2E2VA 2F4YA 2R41A 4FMDA 3CPOA 1YJ93 3LT8A 4GSPA 1IVUA 2UGIA 2UX0A 1MGRA 3N54B 4X2HA 3KFQC 1RGCA 1BAOA 2F98A 2RNTA 2C10A 2BT3A 3SXXA 3EHCA 1K9M4 1TFKA 4FCZA 4LSOA 1X1UA 1TRQA 4BU4A 1JKGB 1BANA 1EEJA 1QJGA 2WGOA 4BTYA 1VQK3 2A15A 3X3XA 1X1YA 5FGOA 3DM8A 4FMCA 2BHMA 1B3SA 3KCHA 3ROBA 4KT3B 1JBTA 2MC8A 1RGAA 1W2ZA 3EE1A 3GZYB 1DE3A 2H0IA 1JBRA 4LZIA 1GOUA 1RNBA 4PEJA 1IYYA 2IUJA 1LNHA 1LQMB 4N6MA 4KZ1A 1WTHA 2GU1A 1K41A 3CCR3 1YHQ3 3NM7A 3NX0A 3Q1CA 1AVLA 5GSPA 1MWRA 1RMSA 1ULIB 3N8BA 4HVNA 5IENA 8RNTA 1I2EA 1RHLA 2KRTA 1W01A 2CX0A 3AHWA 3CU3A 3AMOA 3I0YA 2FXTA 4XDVA 3BB9A 3FCSB 2O9UX 2H0GA 3SLUA 2E2TA 1B2XA 3DZLA 3MPHA 2CFKA 4XDWA 3T0UA 3DGLA 2L4VA 3LT9A 3UJMA 5IF6A 1M904 1JB2A 2P0MA 2RSXA 1M1K4 1IV9A 4XB5A 3CC43 3LTDA 1I0VA 1HKXA 1FGMA 2HMJB 1GMRA 2IY2A 1G96A 1MWSA 3D4AA 2HMOB 3GZXB 4RNZA 1TTOA 1I0XA 1BNSA 1SARA 3U97A 1GYBA 4HM7B 1MOLA 1FUTA 4HM1B 2R4IA 2M7OA 4HZBB 5AEUB 3D5GA 1I2GA 3DGMA 4NHFA 1T3BA 5DREA 1GMPA 5CK6A 3OWUA 2CK3H 3PZWA 1CQSA 1SPUA 1RSNA 2MF7A 3LMLA 4GHOA 2CWVA 3CD63 2JQ5A 1FZUA 1PYLA 2CG0A 2FGTA 2WGQA 4R80A 2OOVC 4RBNA 2CWUA 1A2KA 3NV0B 5IEOA 1RNTA 3E99A 1KSIA 2Z6BA 3Q3FA 3SX1A 1D6UA 3WMDA 4CJNA 1AR0A 1IDPA 4IPBA 1BNJA 1FGTA 1FGOA 2C4BA 5KP3A 1B2MA 3DGOA 1BVIA 4EC6A 3CPW2 3LZAA 5AIHA 3EF8A 2ZDJA 3FH1A 1YVBI 1FUSA 4FCMA 2HMNB 2BU4A 3FG4A 1BSBA 1D6YA 3LTAA 1PU4A 1EG9B 1GY6A 2HMKB 4HKVB 4FMBA 2XF3A 2FNQA 1B21A 1JKGA 4L7KA 1N5HA 3VGNA 1K8A4 2KF3A 1BNIA 1A2PA 1W00A 3FZWA 2O3OA 1W4NA 4WYKA 5ELUA 2XSHB 1IVVA 1GD4A 1MWTA 4HM6B 4KFFA 1TP6A 3EJVA 1BNRA 4CDLA 1E3RA 4RNYA 1SQWA 1V58A 3BLZA 1WQLB 2L1SA 1I2FA 5D81A 5LC7A 1VZZA 2OCTA 3WODG 3ZG0A 1MGWA 6GSPA 5STDA 1VQ83 5JPPA 3FF0A 3PXMA 3KN4A 4R4KA 2HOHA 4HM3B 1FYSA 5BIRA 1UCKA 5JBSA 1NJI4 4FCJA 3G16A 1BRIA 1RJOA 1IQYA 1T5YA 4HAAA 1US1A 2PZVA 1RRLA 3CCL3 1BSDA 1B20A 2CC3A 4R1KA 2HMLB 3EB8A 4CPKA 4HYZA 3SOYA 3G8ZA 2XRXB 3EX9A 1IU7A 1UDII 1IVWA 2IMJA 2QEX3 3GWRA 4HM8B 4BL3A 2BMRB 3B7CA 4LEHA 3MSOA 2INXA 4GL6A 1DETA 4HM4B 3K5TA 1TRPA 1UGIA 1ZGXA 5IG4A 2YFLB 1QALA 1VQP3 2C11A 2CIUA 2OOVA 1UUVB 5IG3A 9RNTA 1F8NA 3VSYA 3BNDA 3FG3A 3HZPA 3S67A 3GZBA 2ZHXB 1U5OA 3D3LA 2CFDA 5AIIA 2CW9A 5AEWB 1RGFA 5CF1A 1A67A 1JZDA 3FF2A 2F56A 3T8UA 4J5KA 3F7XA 4WYKB 6RNTA 1WMNA 1I3IA 3OWSA 4OVMA 4WP5A 2W9QA 2W56B 3NBBA 1KD14 1KQS2 1SJWA 2V1LA 1QMAA 2GU3A 1JBSA 4MMXB 1UUWB 1UGHI 3NV0A 3NQYA 5CLKA 2F5WA 2W2CA 1O7HB 1AVKA 2XH9A 4EXRA 1O7MB 3UB1A 1FUWA 2OTL3 4HBRA 2PNCA 1NB3I 1K734 3WDGB 1W2B2 2IYJA 4J5GA 4O8SA 3UL5A 1UCJA 3PS8A 1RN1A 4JF8A 3Q90A 3RDEA 2B24B 1UI7A 3X42A 2P38A 1BOXA 5G2GA 3DUKA 3F9SA 4O3VA 1OF5A 1RGHA 1J2BA 2XFTA 5DRVA 3GRDA 5ELJA 2LYXA 2ML6A 4LYLB 4EV2A 1B2ZA 5IG5A 3OW22 3NBJA 3SOAA 2OTJ3 3V98A 1WMPA 3H3HA 4WWUC 3G6E3 2P09A 3RGRA 4XM4A 1N9JA 2H0HA 2ZL8A 3ZFZA 1EQKA 1ZO2A 3X3ZA 1LVNA 2QIYA 3F8XA 1Q824 3G0KA 1UCIA 4MJDA 2CG1A 3MWZA 1TFOA 5A0OB 3BIRA 3DH2A 1LOYA 2CFWA 2STDA 1BGSA 1K28A 2KF6A 1O7PB 3S27A 1T2HA 3PCRA 4N6LA 1EKMA 2WOHA 3JUPA 3JVCA 1NWWA 4O2HA 2BMQB 3MKIA 3WA2X 4H3UA 1BUQA 3NXJA 4KFEA 1OHPA 1AY7A 4MEIA 1VQL3 1VQ93 2F86B 2RGQA 1YJN3 3HIGA 1X1WA 1N5PA 1JN5B 4X2OA 2GXFA 5AYRB 2KF4A 3EBTA 5BU4A 1QAFA 1TIJA 5M1AA 3S28A 3URPA 1YI23 1IV7A 2BIRA 5KP1A 1UUGB 4DKIA 3HX8A 4XBTA 2ML5A 1BRSA 4AKZA 3CC23 1VQN3 5BXQA 2GSPA 1LRAA 2XGNA 1RGKA 5EEOA 4JRFA 1Z1SA 1N8R4 3D79A 4N6NB 1RKYA 3CXC2 1I70A 3PGBA 4IT7A 1IK3A 1OF5B 1Q814 1BRHA 3GAXA 2YFJB 3B8LA 1FW7A 2IA7A 1M1XB 1S5AA 1JB5A 3UL6A 3WR2A 1Q7Y4 1TU5A 3B4OA 2CH9A 1RCKA 4AKYA 1CYVA 2SARA 3WOFB 1HZ1A 3M8CA 3OV4A 4K1VA 2OQEC 2KF5A 1OUNA 2LQVA 2W56A 1G02A 4HM2B 4N3VA 3CCE3 3K63A 1YVSA 1BRJA 3WA3A 2Y74A 3LOYA 2CKFB 1LOXA 1Q40B 2P05A 2RBIA 1FA3A 3EC9A 3CC73 1JJ22 1OCVA 3IPTA 5IEPA 2GBXB 2XFSA 2AADA 1CH0A 3KE7A 3CME3 4L8PA 5D82A 2XSOB 1RLSA 1KC84 4HM5B 1JNQA 3S5CA 3WOEB 1G0TA 1N8QA 1D6ZA 1O7GB 4N6OB 3T8NA 2KCDA 3OX9A 3OXAA 1ULJB 5CF2A 3IMAB 4GB5A 4BTWA 1QVG2 3AGOA 1C7HA 2W03A 3I553 4LGQA 1DMQA 1OPYA 2K3DA 1Y4KA 1WNHA 4MMYB 2I9WA 4I4KA 4N6UA 3BNBA 3G713 3JUOA 1LNIA 1STFI 1R4CA 1UW1A 4LMIA 3VF1A 3D9RA 3KIIA 5FW5A 1VQM3 3FSDA 1TJDA 1YIT3 2CHCA 3JUNA 4NPBA 3LH4A 4XBYA 1R4YA 1VQ43 1U8CB 1ZS7A 1VQ63 2K0MA 2Z76A 3NM2A 4HOHA 2CFGA 1IT8A 3DMCA 3FGYA 3HK4A 3ALAA 4BIRA 2YFIB 5G1LA 1NU3A 2UUGC 3GSPA 3L0RA 3K0ZA 1T2IA 5AIGA 2HMMB 1BSAA 3PCSA 3CMA3 3KZTA 1JN5A 1BIRA 2BO9B 2GEYA 1V57A 3LTBA 4N6V0 3A76A 3HOHA 3BU4A 1GOVA 1NO3A 5AIFA 1RRHA 3CCV3 2BMOB 1W6CA 3CNXA 1OGXA 2F99A 1ROAA 4BTXA 3CCJ3 1LOVA 2QGUA 3FKAA 1DMNA 1W02A 4OUQA 1GOYA 4HM0B 2ZA4A 3QRDA 4NREA 1YGWA 2OQEA 2K54A 1ZX2A 3GZRA 5EQLA 3SYUA 1BUJA 1A90A 3F14A 5AYSC 2Y73A 1BSEA 1I3FA 3EN1B 4TX4A 1NNVA 1MWUA 3JUMA 2W0QA 1BNGA
chains in the Genus database with same CATH topology
2WOFA 1CEWI 1DYUA 4J9AA 3U1WA 3EQQB 1O7WB 3V92A 3I563 3DGNA 1GS3A 1YIJ3 2W6JH 3J7Yd 2XR8B 3IJEB 1QVF2 4FMAA 1E97A 2WO0A 1L5GB 5JPUA 3PYJA 3S29A 5D83A 1YJW3 5AI1A 1IQXA 3ECFA 2RCDA 3ER7A 3OWYA 1ISKA 4K61A 4R9LA 1Q40A 7STDA 1IVXA 4HJLB 2Z7AA 3X3YA 4OK0A 3O8YA 6STDA 1W6YA 4K90B 5KP4A 4CCVA 3MHEA 3F7SA 2CFLA 4IIAA 1KWIA 1E3VA 1A2VA 4EBGA 1NB5I 1GD3A 1OH0A 2D1WA 2W04A 3DY5A 4FR9A 5IERA 3CCM3 3NQZA 1S723 1HU9A 2YX9A 2GBWB 3UNLA 8CHOA 3LTCA 1OACA 4U13A 1VQ73 3MG3A 1FGRA 3NHXA 1W7CA 3BNCA 1SIIA 3KKGA 3K9MC 4WFOA 1IT7A 4RZMA 4AEQA 3KSED 2JDIH 3EN8A 3FLJA 2Z77A 4K1UA 5CXOA 3QK9A 1LXEA 4G1MB 4L8OA 1RN7A 4EV5A 3F8HA 3B4PA 3RGAA 3LXUX 4ORLA 3MG1A 2XEPA 1IQ8A 3HI7A 3NBRA 4R9KA 1DVCA 3CCS3 3TDGA 3EBYA 2D42A 1CYUA 2CWTA 3BNEA 1JB4A 3X40A 1O7NB 3AMOB 2XGLA 4MMZB 2B1XB 4H61A 2W9PA 4STDA 2BNGA 2RFRA 3CCU3 4KFDA 3CNMA 5I97A 1Q42A 1W6GA 3JUQA 3N9HA 1JV2B 1NDOB 1K9M4 1WMOA 3G4S3 1PFPA 1M9GA 1QAKA 3HIIA 1DMMA 5EVHA 1TUHA 5IW9A 1DVDA 5BVBA 3LYGA 5IG0A 2P0XA 2Q07A 4Q53A 3H51A 4N6TA 3MYTA 4HZ9B 3V99A 5TGNA 1W5ZA 1OGZA 4KVHA 3KSPA 3F40A 2OWPA 4J8TA 1ASKA 4WHAA 4QWTA 1OHSA 1EA2A 1SIHA 3MG2A 1GY5A 3Q2PA 1YGEA 3K7CA 3X41A 1VQO3 1UI8A 4ZM8A 1GY7A 5LC6A 3CCQ3 1JRQA 1AV4A 2E2UA 1STDA 2GEXA 2KXGA 3FG1A 1MNLA 4XBXA 4EYCA 1V74A 1FGQA 3SEDA 2IUKA 3NUVA 1OHOA 1Q864 5HGRA 2QA43 3STDA 1VQ53 3DXOA 4O02B 3SVAA 2SBLA 1N9EA 1ROVA 2E2VA 4FMDA 3CPOA 1YJ93 3LT8A 1IVUA 3N54B 2UX0A 4X2HA 3KFQC 2F98A 2C10A 2BT3A 3SXXA 3EHCA 1TFKA 4FCZA 4LSOA 4BTYA 1JKGB 2WGOA 1QJGA 1VQK3 2A15A 3X3XA 5FGOA 3DM8A 4FMCA 2BHMA 3ROBA 2MC8A 1W2ZA 3EE1A 3GZYB 4LZIA 4PEJA 2IUJA 1LNHA 4N6MA 4KZ1A 1WTHA 2GU1A 1K41A 3CCR3 1YHQ3 3NM7A 3NX0A 3Q1CA 1AVLA 5IENA 4HVNA 3N8BA 1ULIB 2KRTA 1W01A 3CU3A 3AMOA 3I0YA 2FXTA 4XDVA 3BB9A 3FCSB 2O9UX 3SLUA 2E2TA 3DZLA 3MPHA 2CFKA 4XDWA 3T0UA 3DGLA 2L4VA 3LT9A 3UJMA 5IF6A 1M904 1JB2A 2P0MA 2RSXA 1M1K4 1IV9A 4XB5A 3CC43 3LTDA 1HKXA 1FGMA 2HMJB 1G96A 4RNZA 2HMOB 3GZXB 3U97A 1GYBA 4HM7B 1MOLA 4HM1B 2R4IA 2M7OA 4HZBB 5AEUB 3DGMA 4NHFA 5DREA 5CK6A 3OWUA 2CK3H 3PZWA 2MF7A 1CQSA 1SPUA 3LMLA 2CWVA 3CD63 2JQ5A 2CG0A 2FGTA 4R80A 2WGQA 4RBNA 2OOVC 5IEOA 2CWUA 1A2KA 3NV0B 3E99A 1KSIA 2Z6BA 3SX1A 1D6UA 3WMDA 1AR0A 1IDPA 4IPBA 1FGTA 1FGOA 5KP3A 3DGOA 3CPW2 4EC6A 3LZAA 5AIHA 3EF8A 2ZDJA 3FH1A 1YVBI 4FCMA 2HMNB 3FG4A 1D6YA 3LTAA 1PU4A 1EG9B 1GY6A 2HMKB 4HKVB 4FMBA 2XF3A 2FNQA 4L7KA 1JKGA 1N5HA 3VGNA 1K8A4 1W00A 3FZWA 2O3OA 1W4NA 4WYKA 5ELUA 2XSHB 1IVVA 1GD4A 4HM6B 4KFFA 1TP6A 3EJVA 4CDLA 1E3RA 4RNYA 1SQWA 3BLZA 5D81A 1WQLB 5LC7A 1VZZA 2OCTA 3WODG 5STDA 1VQ83 5JPPA 3FF0A 3PXMA 3KN4A 4R4KA 4HM3B 1NJI4 5JBSA 4FCJA 3G16A 1RJOA 1IQYA 1T5YA 1US1A 2PZVA 1RRLA 3CCL3 2CC3A 4R1KA 2HMLB 3EB8A 4HYZA 3SOYA 3G8ZA 2XRXB 3EX9A 1IU7A 1IVWA 2IMJA 2QEX3 3GWRA 4HM8B 2BMRB 3B7CA 4LEHA 3MSOA 2INXA 4GL6A 4HM4B 3K5TA 5IG4A 2YFLB 1QALA 1VQP3 2C11A 2CIUA 2OOVA 1UUVB 5IG3A 1F8NA 3VSYA 3BNDA 3FG3A 3HZPA 3S67A 3GZBA 1U5OA 3D3LA 2CFDA 5AIIA 2CW9A 5AEWB 5CF1A 1A67A 3FF2A 3T8UA 3F7XA 4WYKB 1WMNA 3OWSA 4OVMA 4WP5A 2W9QA 2W56B 3NBBA 1KD14 1KQS2 1SJWA 2V1LA 1QMAA 2GU3A 4MMXB 1UUWB 3NV0A 3NQYA 5CLKA 2W2CA 1O7HB 1AVKA 2XH9A 4EXRA 1O7MB 3UB1A 1FUWA 2OTL3 4HBRA 2PNCA 1NB3I 1K734 3WDGB 1W2B2 4O8SA 3UL5A 3PS8A 3RDEA 4JF8A 3Q90A 2B24B 1UI7A 3X42A 2P38A 5G2GA 3DUKA 3F9SA 4O3VA 1OF5A 1J2BA 2XFTA 5DRVA 3GRDA 5ELJA 2LYXA 2ML6A 4EV2A 3OW22 5IG5A 3NBJA 3SOAA 2OTJ3 3V98A 1WMPA 3H3HA 4WWUC 3G6E3 2P09A 3RGRA 4XM4A 1N9JA 2ZL8A 1EQKA 1ZO2A 3X3ZA 1LVNA 2QIYA 3F8XA 1Q824 3G0KA 2CG1A 4MJDA 3MWZA 1TFOA 5A0OB 2CFWA 2STDA 1K28A 1O7PB 3S27A 3PCRA 4N6LA 1EKMA 2WOHA 3JUPA 3JVCA 1NWWA 4O2HA 2BMQB 3MKIA 3WA2X 4H3UA 1BUQA 3NXJA 4KFEA 1OHPA 1VQ93 4MEIA 1VQL3 2F86B 2RGQA 1YJN3 3HIGA 1N5PA 1JN5B 4X2OA 2GXFA 5AYRB 3EBTA 1QAFA 1TIJA 1YI23 3S28A 1IV7A 5KP1A 3HX8A 4XBTA 2ML5A 4AKZA 3CC23 1VQN3 5BXQA 2XGNA 5EEOA 4JRFA 1Z1SA 1N8R4 4N6NB 1RKYA 3CXC2 4IT7A 3PGBA 1IK3A 1OF5B 1Q814 3GAXA 2YFJB 3B8LA 2IA7A 1M1XB 1S5AA 1JB5A 3UL6A 1Q7Y4 1TU5A 3B4OA 2CH9A 4AKYA 1CYVA 3WOFB 3M8CA 3OV4A 4K1VA 2OQEC 1OUNA 2LQVA 2W56A 4HM2B 4N3VA 3CCE3 3K63A 3WA3A 2Y74A 3LOYA 2CKFB 1LOXA 1Q40B 2P05A 1FA3A 3EC9A 3CC73 1JJ22 1OCVA 3IPTA 5IEPA 2GBXB 2XFSA 3KE7A 3CME3 4L8PA 5D82A 2XSOB 1KC84 4HM5B 1JNQA 3S5CA 3WOEB 1N8QA 1D6ZA 1O7GB 4N6OB 3T8NA 2KCDA 3OX9A 3OXAA 1ULJB 5CF2A 3IMAB 4GB5A 4BTWA 1QVG2 1C7HA 2W03A 3I553 4LGQA 1DMQA 1OPYA 1Y4KA 1WNHA 4MMYB 2I9WA 4I4KA 4N6UA 3BNBA 3G713 3JUOA 1STFI 4LMIA 1R4CA 1UW1A 3VF1A 1VQM3 3D9RA 3KIIA 5FW5A 3FSDA 1YIT3 2CHCA 3JUNA 3LH4A 4XBYA 1VQ43 1U8CB 1VQ63 2K0MA 2Z76A 3NM2A 2CFGA 1IT8A 3DMCA 3FGYA 3HK4A 3ALAA 2YFIB 1NU3A 3L0RA 5AIGA 3K0ZA 2HMMB 3PCSA 3CMA3 3KZTA 1JN5A 2BO9B 2GEYA 3LTBA 4N6V0 3A76A 5AIFA 3CCV3 1NO3A 1RRHA 2BMOB 1W6CA 3CNXA 1OGXA 2F99A 1ROAA 4BTXA 3CCJ3 2QGUA 3FKAA 1DMNA 1W02A 4OUQA 4HM0B 3QRDA 4NREA 2OQEA 2K54A 1ZX2A 3GZRA 5EQLA 1A90A 3F14A 5AYSC 2Y73A 4TX4A 3EN1B 3JUMA 2W0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9A A;  3EQQ B;  1O7W B;  1GS3 A;  2XR8 B;  5JPU A;  1E97 A;  5D83 A;  5AI1 A;  3ER7 A;  3ECF A;  2RCD A;  3OWY A;  1ISK A;  4R9L A;  1Q40 A;  7STD A;  4HJL B;  2Z7A A;  6STD A;  1W6Y A;  5KP4 A;  3MHE A;  3F7S A;  4IIA A;  1E3V A;  1OH0 A;  5IER A;  3UNL A;  2GBW B;  8CHO A;  4U13 A;  3MG3 A;  3NHX A;  3KKG A;  4RZM A;  3EN8 A;  3FLJ A;  2Z77 A;  4K1U A;  5CXO A;  4L8O A;  3F8H A;  3B4P A;  3RGA A;  4ORL A;  3MG1 A;  3NBR A;  4R9K A;  3EBY A;  1JB4 A;  1O7N B;  2B1X B;  4STD A;  2BNG A;  2RFR A;  3CNM A;  1Q42 A;  3JUQ A;  1NDO B;  5EVH A;  1DMM A;  1TUH A;  5BVB A;  3LYG A;  5IG0 A;  4Q53 A;  3H51 A;  3MYT A;  4HZ9 B;  5TGN A;  1OGZ A;  4KVH A;  3KSP A;  3F40 A;  2OWP A;  4J8T A;  1ASK A;  1OHS A;  1EA2 A;  3MG2 A;  1GY5 A;  3K7C A;  1GY7 A;  1STD A;  2GEX A;  4XBX A;  3SED A;  3NUV A;  1OHO A;  5HGR A;  3STD A;  3DXO A;  3CPO A;  2UX0 A;  4X2H A;  2F98 A;  3EHC A;  1JKG B;  1QJG A;  2A15 A;  3DM8 A;  3ROB A;  3GZY B;  4PEJ A;  1K41 A;  5IEN A;  4HVN A;  1ULI B;  1W01 A;  3CU3 A;  3I0Y A;  4XDV A;  3BB9 A;  3DZL A;  4XDW A;  3UJM A;  5IF6 A;  1JB2 A;  4XB5 A;  1HKX A;  2HMJ B;  2HMO B;  3GZX B;  1GYB A;  4HM7 B;  4HM1 B;  2R4I A;  4HZB B;  5AEU B;  5DRE A;  5CK6 A;  3OWU A;  1CQS A;  2JQ5 A;  5IEO A;  3NV0 B;  1A2K A;  3E99 A;  3WMD A;  1AR0 A;  1IDP A;  5KP3 A;  3LZA A;  5AIH A;  3EF8 A;  3FH1 A;  4FCM A;  2HMN B;  1EG9 B;  1GY6 A;  2HMK B;  4HKV B;  4L7K A;  1JKG A;  3VGN A;  1W00 A;  3FZW A;  4WYK A;  2XSH B;  4HM6 B;  1TP6 A;  3EJV A;  4CDL A;  1E3R A;  5D81 A;  3BLZ A;  1WQL B;  1VZZ A;  5STD A;  5JPP A;  3FF0 A;  4HM3 B;  4FCJ A;  3G16 A;  2PZV A;  4R1K A;  2HML B;  3SOY A;  3G8Z A;  2XRX B;  3EX9 A;  2IMJ A;  3GWR A;  4HM8 B;  2BMR B;  3B7C A;  4LEH A;  3MSO A;  2INX A;  4HM4 B;  5IG4 A;  2YFL B;  1UUV B;  5IG3 A;  3VSY A;  3HZP A;  3GZB A;  1U5O A;  5CF1 A;  5AII A;  5AEW B;  3FF2 A;  3T8U A;  3F7X A;  4WYK B;  4WP5 A;  3OWS A;  4OVM A;  1SJW A;  1QMA A;  1UUW B;  3NV0 A;  5CLK A;  2W2C A;  1O7H B;  1O7M B;  3Q90 A;  2B24 B;  5G2G A;  3DUK A;  3F9S A;  1OF5 A;  5DRV A;  3GRD A;  5IG5 A;  3SOA A;  3H3H A;  4WWU C;  3RGR A;  4XM4 A;  1ZO2 A;  2QIY A;  3F8X A;  3G0K A;  4MJD A;  2STD A;  1O7P B;  3JUP A;  1NWW A;  2BMQ B;  3MKI A;  4H3U A;  1BUQ A;  3NXJ A;  1OHP A;  2F86 B;  2RGQ A;  1JN5 B;  4X2O A;  2GXF A;  3EBT A;  5KP1 A;  3HX8 A;  4XBT A;  5BXQ A;  1Z1S A;  1OF5 B;  2YFJ B;  3B8L A;  1S5A A;  1JB5 A;  3B4O A;  3M8C A;  3OV4 A;  4K1V A;  1OUN A;  4HM2 B;  4N3V A;  2CKF B;  1Q40 B;  3EC9 A;  1OCV A;  3IPT A;  5IEP A;  2GBX B;  3KE7 A;  4L8P A;  5D82 A;  2XSO B;  4HM5 B;  3S5C A;  1O7G B;  3T8N A;  3OX9 A;  5CF2 A;  3OXA A;  1ULJ B;  4GB5 A;  1C7H A;  4LGQ A;  1DMQ A;  1OPY A;  2I9W A;  4I4K A;  3JUO A;  4LMI A;  3D9R A;  5FW5 A;  3FSD A;  2CHC A;  3JUN A;  4XBY A;  2Z76 A;  3NM2 A;  3DMC A;  3FGY A;  3HK4 A;  2YFI B;  1NU3 A;  5AIG A;  3K0Z A;  2HMM B;  3KZT A;  1JN5 A;  2GEY A;  3A76 A;  5AIF A;  2BMO B;  3CNX A;  1OGX A;  2F99 A;  2QGU A;  3FKA A;  1DMN A;  1W02 A;  4OUQ A;  4HM0 B;  2K54 A;  1ZX2 A;  3GZR A;  3F14 A;  3EN1 B;  3JUM A; 
#chains in the Genus database with same CATH topology
 1RGL A;  1CEW I;  2WOF A;  1DYU A;  4J9A A;  1RDS A;  3U1W A;  3EQQ B;  1O7W B;  3V92 A;  3I56 3;  3DGN A;  1GS3 A;  1YIJ 3;  5HOH A;  2W6J H;  3J7Y d;  2XR8 B;  3IJE B;  1QVF 2;  1LQG C;  2KAA A;  1E97 A;  2WO0 A;  4FMA A;  1L5G B;  5JPU A;  3PYJ A;  3S29 A;  5D83 A;  1YJW 3;  1B2U A;  5AI1 A;  1IQX A;  3ECF A;  2RCD A;  3ER7 A;  3OWY A;  5M19 A;  1ISK A;  4K61 A;  4R9L A;  1Q40 A;  7STD A;  1IVX A;  4HJL B;  2Z7A A;  1EUI C;  2F5M A;  3X3Y A;  4OK0 A;  3O8Y A;  6STD A;  1BU4 A;  1W6Y A;  4K90 B;  1BRK A;  4CCV A;  5KP4 A;  3MHE A;  3F7S A;  2CFL A;  4IIA A;  1RTU A;  1KWI A;  1E3V A;  1A2V A;  1X1X A;  4EBG A;  1NB5 I;  1BSC A;  1GD3 A;  1OH0 A;  2D1W A;  2W04 A;  3DY5 A;  4FR9 A;  5IER A;  3CCM 3;  2CX1 A;  1GMQ A;  3NQZ A;  1S72 3;  1HU9 A;  3WHO A;  1BNE A;  2YX9 A;  2GBW B;  3UNL A;  8CHO A;  3LTC A;  1OAC A;  4U13 A;  1VQ7 3;  3MG3 A;  1FGR A;  3NHX A;  1W7C A;  3BNC A;  1SII A;  2AAE A;  3K9M C;  3KKG A;  4WFO A;  1IT7 A;  1LOW A;  4RZM A;  4AEQ A;  1VQQ A;  3KSE D;  2JDI H;  1RN4 A;  1UCL A;  3EN8 A;  4BL2 A;  3FLJ A;  2Z77 A;  1I8V A;  4K1U A;  5CXO A;  3QK9 A;  3AHS A;  7RNT A;  1LXE A;  4G1M B;  4L8O A;  1RN7 A;  4EV5 A;  3F8H A;  3B4P A;  4ILF A;  3RGA A;  3LXU X;  4ORL A;  1BRN L;  3MG1 A;  2XEP A;  1IQ8 A;  1Q7H A;  3HI7 A;  3NBR A;  4R9K A;  1DVC A;  3CCS 3;  3TDG A;  3EBY A;  2D42 A;  1CYU A;  2CWT A;  3BNE A;  1JB4 A;  3X40 A;  1GSP A;  1O7N B;  1B2S A;  3AMO B;  2XGL A;  4MMZ B;  3RNT A;  2B1X B;  4H61 A;  2W9P A;  4STD A;  2BNG A;  2RFR A;  3CCU 3;  1C54 A;  4KFD A;  3CNM A;  5I97 A;  1PY3 A;  1Q42 A;  1W6G A;  3DGY A;  3JUQ A;  3N9H A;  1JV2 B;  1NDO B;  5M18 A;  1B27 A;  1WMO A;  5G1K A;  3G4S 3;  5RNT A;  1PFP A;  1M9G A;  1QAK A;  1JZO A;  1DMM A;  3HII A;  1TUH A;  5EVH A;  5IW9 A;  5BVB A;  1DVD A;  3LYG A;  4RNT A;  2P0X A;  1HYF A;  2Q07 A;  4Q53 A;  5IG0 A;  3H51 A;  4N6T A;  3MYT A;  4HZ9 B;  3AGN A;  3V99 A;  5TGN A;  1W5Z A;  1BNF A;  1OGZ A;  4KVH A;  3KSP A;  3F40 A;  2OWP A;  4J8T A;  1ASK A;  4WHA A;  4QWT A;  1OHS A;  1EA2 A;  1SIH A;  3MG2 A;  1GY5 A;  3Q2P A;  1YGE A;  4I5Q A;  3K7C A;  1BRG A;  3A5E A;  3X41 A;  1VQO 3;  1UI8 A;  4ZM8 A;  1GY7 A;  5LC6 A;  3CCQ 3;  1JRQ A;  1RGG A;  1AV4 A;  2E2U A;  1Q9E A;  1STD A;  2GEX A;  2KXG A;  1YNV X;  3FG1 A;  1MNL A;  7GSP A;  4XBX A;  4EYC A;  1RCL A;  1V74 A;  1FGQ A;  3SED A;  2IUK A;  3NUV A;  3ZG5 A;  4EW5 A;  1OHO A;  1Q86 4;  1RGE A;  5HGR A;  2QA4 3;  2J8X B;  3STD A;  1VQ5 3;  3DXO A;  1AQZ A;  3D5I A;  4O02 B;  2SBL A;  3SVA A;  1N9E A;  1ROV A;  2E2V A;  2F4Y A;  2R41 A;  4FMD A;  3CPO A;  1YJ9 3;  3LT8 A;  4GSP A;  1IVU A;  2UGI A;  2UX0 A;  1MGR A;  3N54 B;  4X2H A;  3KFQ C;  1RGC A;  1BAO A;  2F98 A;  2RNT A;  2C10 A;  2BT3 A;  3SXX A;  3EHC A;  1K9M 4;  1TFK A;  4FCZ A;  4LSO A;  1X1U A;  1TRQ A;  4BU4 A;  1JKG B;  1BAN A;  1EEJ A;  1QJG A;  2WGO A;  4BTY A;  1VQK 3;  2A15 A;  3X3X A;  1X1Y A;  5FGO A;  3DM8 A;  4FMC A;  2BHM A;  1B3S A;  3KCH A;  3ROB A;  4KT3 B;  1JBT A;  2MC8 A;  1RGA A;  1W2Z A;  3EE1 A;  3GZY B;  1DE3 A;  2H0I A;  1JBR A;  4LZI A;  1GOU A;  1RNB A;  4PEJ A;  1IYY A;  2IUJ A;  1LNH A;  1LQM B;  4N6M A;  4KZ1 A;  1WTH A;  2GU1 A;  1K41 A;  3CCR 3;  1YHQ 3;  3NM7 A;  3NX0 A;  3Q1C A;  1AVL A;  5GSP A;  1MWR A;  1RMS A;  1ULI B;  3N8B A;  4HVN A;  5IEN A;  8RNT A;  1I2E A;  1RHL A;  2KRT A;  1W01 A;  2CX0 A;  3AHW A;  3CU3 A;  3AMO A;  3I0Y A;  2FXT A;  4XDV A;  3BB9 A;  3FCS B;  2O9U X;  2H0G A;  3SLU A;  2E2T A;  1B2X A;  3DZL A;  3MPH A;  2CFK A;  4XDW A;  3T0U A;  3DGL A;  2L4V A;  3LT9 A;  3UJM A;  5IF6 A;  1M90 4;  1JB2 A;  2P0M A;  2RSX A;  1M1K 4;  1IV9 A;  4XB5 A;  3CC4 3;  3LTD A;  1I0V A;  1HKX A;  1FGM A;  2HMJ B;  1GMR A;  2IY2 A;  1G96 A;  1MWS A;  3D4A A;  2HMO B;  3GZX B;  4RNZ A;  1TTO A;  1I0X A;  1BNS A;  1SAR A;  3U97 A;  1GYB A;  4HM7 B;  1MOL A;  1FUT A;  4HM1 B;  2R4I A;  2M7O A;  4HZB B;  5AEU B;  3D5G A;  1I2G A;  3DGM A;  4NHF A;  1T3B A;  5DRE A;  1GMP A;  5CK6 A;  3OWU A;  2CK3 H;  3PZW A;  1CQS A;  1SPU A;  1RSN A;  2MF7 A;  3LML A;  4GHO A;  2CWV A;  3CD6 3;  2JQ5 A;  1FZU A;  1PYL A;  2CG0 A;  2FGT A;  2WGQ A;  4R80 A;  2OOV C;  4RBN A;  2CWU A;  1A2K A;  3NV0 B;  5IEO A;  1RNT A;  3E99 A;  1KSI A;  2Z6B A;  3Q3F A;  3SX1 A;  1D6U A;  3WMD A;  4CJN A;  1AR0 A;  1IDP A;  4IPB A;  1BNJ A;  1FGT A;  1FGO A;  2C4B A;  5KP3 A;  1B2M A;  3DGO A;  1BVI A;  4EC6 A;  3CPW 2;  3LZA A;  5AIH A;  3EF8 A;  2ZDJ A;  3FH1 A;  1YVB I;  1FUS A;  4FCM A;  2HMN B;  2BU4 A;  3FG4 A;  1BSB A;  1D6Y A;  3LTA A;  1PU4 A;  1EG9 B;  1GY6 A;  2HMK B;  4HKV B;  4FMB A;  2XF3 A;  2FNQ A;  1B21 A;  1JKG A;  4L7K A;  1N5H A;  3VGN A;  1K8A 4;  2KF3 A;  1BNI A;  1A2P A;  1W00 A;  3FZW A;  2O3O A;  1W4N A;  4WYK A;  5ELU A;  2XSH B;  1IVV A;  1GD4 A;  1MWT A;  4HM6 B;  4KFF A;  1TP6 A;  3EJV A;  1BNR A;  4CDL A;  1E3R A;  4RNY A;  1SQW A;  1V58 A;  3BLZ A;  1WQL B;  2L1S A;  1I2F A;  5D81 A;  5LC7 A;  1VZZ A;  2OCT A;  3WOD G;  3ZG0 A;  1MGW A;  6GSP A;  5STD A;  1VQ8 3;  5JPP A;  3FF0 A;  3PXM A;  3KN4 A;  4R4K A;  2HOH A;  4HM3 B;  1FYS A;  5BIR A;  1UCK A;  5JBS A;  1NJI 4;  4FCJ A;  3G16 A;  1BRI A;  1RJO A;  1IQY A;  1T5Y A;  4HAA A;  1US1 A;  2PZV A;  1RRL A;  3CCL 3;  1BSD A;  1B20 A;  2CC3 A;  4R1K A;  2HML B;  3EB8 A;  4CPK A;  4HYZ A;  3SOY A;  3G8Z A;  2XRX B;  3EX9 A;  1IU7 A;  1UDI I;  1IVW A;  2IMJ A;  2QEX 3;  3GWR A;  4HM8 B;  4BL3 A;  2BMR B;  3B7C A;  4LEH A;  3MSO A;  2INX A;  4GL6 A;  1DET A;  4HM4 B;  3K5T A;  1TRP A;  1UGI A;  1ZGX A;  5IG4 A;  2YFL B;  1QAL A;  1VQP 3;  2C11 A;  2CIU A;  2OOV A;  1UUV B;  5IG3 A;  9RNT A;  1F8N A;  3VSY A;  3BND A;  3FG3 A;  3HZP A;  3S67 A;  3GZB A;  2ZHX B;  1U5O A;  3D3L A;  2CFD A;  5AII A;  2CW9 A;  5AEW B;  1RGF A;  5CF1 A;  1A67 A;  1JZD A;  3FF2 A;  2F56 A;  3T8U A;  4J5K A;  3F7X A;  4WYK B;  6RNT A;  1WMN A;  1I3I A;  3OWS A;  4OVM A;  4WP5 A;  2W9Q A;  2W56 B;  3NBB A;  1KD1 4;  1KQS 2;  1SJW A;  2V1L A;  1QMA A;  2GU3 A;  1JBS A;  4MMX B;  1UUW B;  1UGH I;  3NV0 A;  3NQY A;  5CLK A;  2F5W A;  2W2C A;  1O7H B;  1AVK A;  2XH9 A;  4EXR A;  1O7M B;  3UB1 A;  1FUW A;  2OTL 3;  4HBR A;  2PNC A;  1NB3 I;  1K73 4;  3WDG B;  1W2B 2;  2IYJ A;  4J5G A;  4O8S A;  3UL5 A;  1UCJ A;  3PS8 A;  1RN1 A;  4JF8 A;  3Q90 A;  3RDE A;  2B24 B;  1UI7 A;  3X42 A;  2P38 A;  1BOX A;  5G2G A;  3DUK A;  3F9S A;  4O3V A;  1OF5 A;  1RGH A;  1J2B A;  2XFT A;  5DRV A;  3GRD A;  5ELJ A;  2LYX A;  2ML6 A;  4LYL B;  4EV2 A;  1B2Z A;  5IG5 A;  3OW2 2;  3NBJ A;  3SOA A;  2OTJ 3;  3V98 A;  1WMP A;  3H3H A;  4WWU C;  3G6E 3;  2P09 A;  3RGR A;  4XM4 A;  1N9J A;  2H0H A;  2ZL8 A;  3ZFZ A;  1EQK A;  1ZO2 A;  3X3Z A;  1LVN A;  2QIY A;  3F8X A;  1Q82 4;  3G0K A;  1UCI A;  4MJD A;  2CG1 A;  3MWZ A;  1TFO A;  5A0O B;  3BIR A;  3DH2 A;  1LOY A;  2CFW A;  2STD A;  1BGS A;  1K28 A;  2KF6 A;  1O7P B;  3S27 A;  1T2H A;  3PCR A;  4N6L A;  1EKM A;  2WOH A;  3JUP A;  3JVC A;  1NWW A;  4O2H A;  2BMQ B;  3MKI A;  3WA2 X;  4H3U A;  1BUQ A;  3NXJ A;  4KFE A;  1OHP A;  1AY7 A;  4MEI A;  1VQL 3;  1VQ9 3;  2F86 B;  2RGQ A;  1YJN 3;  3HIG A;  1X1W A;  1N5P A;  1JN5 B;  4X2O A;  2GXF A;  5AYR B;  2KF4 A;  3EBT A;  5BU4 A;  1QAF A;  1TIJ A;  5M1A A;  3S28 A;  3URP A;  1YI2 3;  1IV7 A;  2BIR A;  5KP1 A;  1UUG B;  4DKI A;  3HX8 A;  4XBT A;  2ML5 A;  1BRS A;  4AKZ A;  3CC2 3;  1VQN 3;  5BXQ A;  2GSP A;  1LRA A;  2XGN A;  1RGK A;  5EEO A;  4JRF A;  1Z1S A;  1N8R 4;  3D79 A;  4N6N B;  1RKY A;  3CXC 2;  1I70 A;  3PGB A;  4IT7 A;  1IK3 A;  1OF5 B;  1Q81 4;  1BRH A;  3GAX A;  2YFJ B;  3B8L A;  1FW7 A;  2IA7 A;  1M1X B;  1S5A A;  1JB5 A;  3UL6 A;  3WR2 A;  1Q7Y 4;  1TU5 A;  3B4O A;  2CH9 A;  1RCK A;  4AKY A;  1CYV A;  2SAR A;  3WOF B;  1HZ1 A;  3M8C A;  3OV4 A;  4K1V A;  2OQE C;  2KF5 A;  1OUN A;  2LQV A;  2W56 A;  1G02 A;  4HM2 B;  4N3V A;  3CCE 3;  3K63 A;  1YVS A;  1BRJ A;  3WA3 A;  2Y74 A;  3LOY A;  2CKF B;  1LOX A;  1Q40 B;  2P05 A;  2RBI A;  1FA3 A;  3EC9 A;  3CC7 3;  1JJ2 2;  1OCV A;  3IPT A;  5IEP A;  2GBX B;  2XFS A;  2AAD A;  1CH0 A;  3KE7 A;  3CME 3;  4L8P A;  5D82 A;  2XSO B;  1RLS A;  1KC8 4;  4HM5 B;  1JNQ A;  3S5C A;  3WOE B;  1G0T A;  1N8Q A;  1D6Z A;  1O7G B;  4N6O B;  3T8N A;  2KCD A;  3OX9 A;  3OXA A;  1ULJ B;  5CF2 A;  3IMA B;  4GB5 A;  4BTW A;  1QVG 2;  3AGO A;  1C7H A;  2W03 A;  3I55 3;  4LGQ A;  1DMQ A;  1OPY A;  2K3D A;  1Y4K A;  1WNH A;  4MMY B;  2I9W A;  4I4K A;  4N6U A;  3BNB A;  3G71 3;  3JUO A;  1LNI A;  1STF I;  1R4C A;  1UW1 A;  4LMI A;  3VF1 A;  3D9R A;  3KII A;  5FW5 A;  1VQM 3;  3FSD A;  1TJD A;  1YIT 3;  2CHC A;  3JUN A;  4NPB A;  3LH4 A;  4XBY A;  1R4Y A;  1VQ4 3;  1U8C B;  1ZS7 A;  1VQ6 3;  2K0M A;  2Z76 A;  3NM2 A;  4HOH A;  2CFG A;  1IT8 A;  3DMC A;  3FGY A;  3HK4 A;  3ALA A;  4BIR A;  2YFI B;  5G1L A;  1NU3 A;  2UUG C;  3GSP A;  3L0R A;  3K0Z A;  1T2I A;  5AIG A;  2HMM B;  1BSA A;  3PCS A;  3CMA 3;  3KZT A;  1JN5 A;  1BIR A;  2BO9 B;  2GEY A;  1V57 A;  3LTB A;  4N6V 0;  3A76 A;  3HOH A;  3BU4 A;  1GOV A;  1NO3 A;  5AIF A;  1RRH A;  3CCV 3;  2BMO B;  1W6C A;  3CNX A;  1OGX A;  2F99 A;  1ROA A;  4BTX A;  3CCJ 3;  1LOV A;  2QGU A;  3FKA A;  1DMN A;  1W02 A;  4OUQ A;  1GOY A;  4HM0 B;  2ZA4 A;  3QRD A;  4NRE A;  1YGW A;  2OQE A;  2K54 A;  1ZX2 A;  3GZR A;  5EQL A;  3SYU A;  1BUJ A;  1A90 A;  3F14 A;  5AYS C;  2Y73 A;  1BSE A;  1I3F A;  3EN1 B;  4TX4 A;  1NNV A;  1MWU A;  3JUM A;  2W0Q A;  1BNG A; 
#chains in the Genus database with same CATH homology
 2WOF A;  1CEW I;  1DYU A;  4J9A A;  3U1W A;  3EQQ B;  1O7W B;  3V92 A;  3I56 3;  3DGN A;  1GS3 A;  1YIJ 3;  2W6J H;  3J7Y d;  2XR8 B;  3IJE B;  1QVF 2;  4FMA A;  1E97 A;  2WO0 A;  1L5G B;  5JPU A;  3PYJ A;  3S29 A;  5D83 A;  1YJW 3;  5AI1 A;  1IQX A;  3ECF A;  2RCD A;  3ER7 A;  3OWY A;  1ISK A;  4K61 A;  4R9L A;  1Q40 A;  7STD A;  1IVX A;  4HJL B;  2Z7A A;  3X3Y A;  4OK0 A;  3O8Y A;  6STD A;  1W6Y A;  4K90 B;  5KP4 A;  4CCV A;  3MHE A;  3F7S A;  2CFL A;  4IIA A;  1KWI A;  1E3V A;  1A2V A;  4EBG A;  1NB5 I;  1GD3 A;  1OH0 A;  2D1W A;  2W04 A;  3DY5 A;  4FR9 A;  5IER A;  3CCM 3;  3NQZ A;  1S72 3;  1HU9 A;  2YX9 A;  2GBW B;  3UNL A;  8CHO A;  3LTC A;  1OAC A;  4U13 A;  1VQ7 3;  3MG3 A;  1FGR A;  3NHX A;  1W7C A;  3BNC A;  1SII A;  3KKG A;  3K9M C;  4WFO A;  1IT7 A;  4RZM A;  4AEQ A;  3KSE D;  2JDI H;  3EN8 A;  3FLJ A;  2Z77 A;  4K1U A;  5CXO A;  3QK9 A;  1LXE A;  4G1M B;  4L8O A;  1RN7 A;  4EV5 A;  3F8H A;  3B4P A;  3RGA A;  3LXU X;  4ORL A;  3MG1 A;  2XEP A;  1IQ8 A;  3HI7 A;  3NBR A;  4R9K A;  1DVC A;  3CCS 3;  3TDG A;  3EBY A;  2D42 A;  1CYU A;  2CWT A;  3BNE A;  1JB4 A;  3X40 A;  1O7N B;  3AMO B;  2XGL A;  4MMZ B;  2B1X B;  4H61 A;  2W9P A;  4STD A;  2BNG A;  2RFR A;  3CCU 3;  4KFD A;  3CNM A;  5I97 A;  1Q42 A;  1W6G A;  3JUQ A;  3N9H A;  1JV2 B;  1NDO B;  1K9M 4;  1WMO A;  3G4S 3;  1PFP A;  1M9G A;  1QAK A;  3HII A;  1DMM A;  5EVH A;  1TUH A;  5IW9 A;  1DVD A;  5BVB A;  3LYG A;  5IG0 A;  2P0X A;  2Q07 A;  4Q53 A;  3H51 A;  4N6T A;  3MYT A;  4HZ9 B;  3V99 A;  5TGN A;  1W5Z A;  1OGZ A;  4KVH A;  3KSP A;  3F40 A;  2OWP A;  4J8T A;  1ASK A;  4WHA A;  4QWT A;  1OHS A;  1EA2 A;  1SIH A;  3MG2 A;  1GY5 A;  3Q2P A;  1YGE A;  3K7C A;  3X41 A;  1VQO 3;  1UI8 A;  4ZM8 A;  1GY7 A;  5LC6 A;  3CCQ 3;  1JRQ A;  1AV4 A;  2E2U A;  1STD A;  2GEX A;  2KXG A;  3FG1 A;  1MNL A;  4XBX A;  4EYC A;  1V74 A;  1FGQ A;  3SED A;  2IUK A;  3NUV A;  1OHO A;  1Q86 4;  5HGR A;  2QA4 3;  3STD A;  1VQ5 3;  3DXO A;  4O02 B;  3SVA A;  2SBL A;  1N9E A;  1ROV A;  2E2V A;  4FMD A;  3CPO A;  1YJ9 3;  3LT8 A;  1IVU A;  3N54 B;  2UX0 A;  4X2H A;  3KFQ C;  2F98 A;  2C10 A;  2BT3 A;  3SXX A;  3EHC A;  1TFK A;  4FCZ A;  4LSO A;  4BTY A;  1JKG B;  2WGO A;  1QJG A;  1VQK 3;  2A15 A;  3X3X A;  5FGO A;  3DM8 A;  4FMC A;  2BHM A;  3ROB A;  2MC8 A;  1W2Z A;  3EE1 A;  3GZY B;  4LZI A;  4PEJ A;  2IUJ A;  1LNH A;  4N6M A;  4KZ1 A;  1WTH A;  2GU1 A;  1K41 A;  3CCR 3;  1YHQ 3;  3NM7 A;  3NX0 A;  3Q1C A;  1AVL A;  5IEN A;  4HVN A;  3N8B A;  1ULI B;  2KRT A;  1W01 A;  3CU3 A;  3AMO A;  3I0Y A;  2FXT A;  4XDV A;  3BB9 A;  3FCS B;  2O9U X;  3SLU A;  2E2T A;  3DZL A;  3MPH A;  2CFK A;  4XDW A;  3T0U A;  3DGL A;  2L4V A;  3LT9 A;  3UJM A;  5IF6 A;  1M90 4;  1JB2 A;  2P0M A;  2RSX A;  1M1K 4;  1IV9 A;  4XB5 A;  3CC4 3;  3LTD A;  1HKX A;  1FGM A;  2HMJ B;  1G96 A;  4RNZ A;  2HMO B;  3GZX B;  3U97 A;  1GYB A;  4HM7 B;  1MOL A;  4HM1 B;  2R4I A;  2M7O A;  4HZB B;  5AEU B;  3DGM A;  4NHF A;  5DRE A;  5CK6 A;  3OWU A;  2CK3 H;  3PZW A;  2MF7 A;  1CQS A;  1SPU A;  3LML A;  2CWV A;  3CD6 3;  2JQ5 A;  2CG0 A;  2FGT A;  4R80 A;  2WGQ A;  4RBN A;  2OOV C;  5IEO A;  2CWU A;  1A2K A;  3NV0 B;  3E99 A;  1KSI A;  2Z6B A;  3SX1 A;  1D6U A;  3WMD A;  1AR0 A;  1IDP A;  4IPB A;  1FGT A;  1FGO A;  5KP3 A;  3DGO A;  3CPW 2;  4EC6 A;  3LZA A;  5AIH A;  3EF8 A;  2ZDJ A;  3FH1 A;  1YVB I;  4FCM A;  2HMN B;  3FG4 A;  1D6Y A;  3LTA A;  1PU4 A;  1EG9 B;  1GY6 A;  2HMK B;  4HKV B;  4FMB A;  2XF3 A;  2FNQ A;  4L7K A;  1JKG A;  1N5H A;  3VGN A;  1K8A 4;  1W00 A;  3FZW A;  2O3O A;  1W4N A;  4WYK A;  5ELU A;  2XSH B;  1IVV A;  1GD4 A;  4HM6 B;  4KFF A;  1TP6 A;  3EJV A;  4CDL A;  1E3R A;  4RNY A;  1SQW A;  3BLZ A;  5D81 A;  1WQL B;  5LC7 A;  1VZZ A;  2OCT A;  3WOD G;  5STD A;  1VQ8 3;  5JPP A;  3FF0 A;  3PXM A;  3KN4 A;  4R4K A;  4HM3 B;  1NJI 4;  5JBS A;  4FCJ A;  3G16 A;  1RJO A;  1IQY A;  1T5Y A;  1US1 A;  2PZV A;  1RRL A;  3CCL 3;  2CC3 A;  4R1K A;  2HML B;  3EB8 A;  4HYZ A;  3SOY A;  3G8Z A;  2XRX B;  3EX9 A;  1IU7 A;  1IVW A;  2IMJ A;  2QEX 3;  3GWR A;  4HM8 B;  2BMR B;  3B7C A;  4LEH A;  3MSO A;  2INX A;  4GL6 A;  4HM4 B;  3K5T A;  5IG4 A;  2YFL B;  1QAL A;  1VQP 3;  2C11 A;  2CIU A;  2OOV A;  1UUV B;  5IG3 A;  1F8N A;  3VSY A;  3BND A;  3FG3 A;  3HZP A;  3S67 A;  3GZB A;  1U5O A;  3D3L A;  2CFD A;  5AII A;  2CW9 A;  5AEW B;  5CF1 A;  1A67 A;  3FF2 A;  3T8U A;  3F7X A;  4WYK B;  1WMN A;  3OWS A;  4OVM A;  4WP5 A;  2W9Q A;  2W56 B;  3NBB A;  1KD1 4;  1KQS 2;  1SJW A;  2V1L A;  1QMA A;  2GU3 A;  4MMX B;  1UUW B;  3NV0 A;  3NQY A;  5CLK A;  2W2C A;  1O7H B;  1AVK A;  2XH9 A;  4EXR A;  1O7M B;  3UB1 A;  1FUW A;  2OTL 3;  4HBR A;  2PNC A;  1NB3 I;  1K73 4;  3WDG B;  1W2B 2;  4O8S A;  3UL5 A;  3PS8 A;  3RDE A;  4JF8 A;  3Q90 A;  2B24 B;  1UI7 A;  3X42 A;  2P38 A;  5G2G A;  3DUK A;  3F9S A;  4O3V A;  1OF5 A;  1J2B A;  2XFT A;  5DRV A;  3GRD A;  5ELJ A;  2LYX A;  2ML6 A;  4EV2 A;  3OW2 2;  5IG5 A;  3NBJ A;  3SOA A;  2OTJ 3;  3V98 A;  1WMP A;  3H3H A;  4WWU C;  3G6E 3;  2P09 A;  3RGR A;  4XM4 A;  1N9J A;  2ZL8 A;  1EQK A;  1ZO2 A;  3X3Z A;  1LVN A;  2QIY A;  3F8X A;  1Q82 4;  3G0K A;  2CG1 A;  4MJD A;  3MWZ A;  1TFO A;  5A0O B;  2CFW A;  2STD A;  1K28 A;  1O7P B;  3S27 A;  3PCR A;  4N6L A;  1EKM A;  2WOH A;  3JUP A;  3JVC A;  1NWW A;  4O2H A;  2BMQ B;  3MKI A;  3WA2 X;  4H3U A;  1BUQ A;  3NXJ A;  4KFE A;  1OHP A;  1VQ9 3;  4MEI A;  1VQL 3;  2F86 B;  2RGQ A;  1YJN 3;  3HIG A;  1N5P A;  1JN5 B;  4X2O A;  2GXF A;  5AYR B;  3EBT A;  1QAF A;  1TIJ A;  1YI2 3;  3S28 A;  1IV7 A;  5KP1 A;  3HX8 A;  4XBT A;  2ML5 A;  4AKZ A;  3CC2 3;  1VQN 3;  5BXQ A;  2XGN A;  5EEO A;  4JRF A;  1Z1S A;  1N8R 4;  4N6N B;  1RKY A;  3CXC 2;  4IT7 A;  3PGB A;  1IK3 A;  1OF5 B;  1Q81 4;  3GAX A;  2YFJ B;  3B8L A;  2IA7 A;  1M1X B;  1S5A A;  1JB5 A;  3UL6 A;  1Q7Y 4;  1TU5 A;  3B4O A;  2CH9 A;  4AKY A;  1CYV A;  3WOF B;  3M8C A;  3OV4 A;  4K1V A;  2OQE C;  1OUN A;  2LQV A;  2W56 A;  4HM2 B;  4N3V A;  3CCE 3;  3K63 A;  3WA3 A;  2Y74 A;  3LOY A;  2CKF B;  1LOX A;  1Q40 B;  2P05 A;  1FA3 A;  3EC9 A;  3CC7 3;  1JJ2 2;  1OCV A;  3IPT A;  5IEP A;  2GBX B;  2XFS A;  3KE7 A;  3CME 3;  4L8P A;  5D82 A;  2XSO B;  1KC8 4;  4HM5 B;  1JNQ A;  3S5C A;  3WOE B;  1N8Q A;  1D6Z A;  1O7G B;  4N6O B;  3T8N A;  2KCD A;  3OX9 A;  3OXA A;  1ULJ B;  5CF2 A;  3IMA B;  4GB5 A;  4BTW A;  1QVG 2;  1C7H A;  2W03 A;  3I55 3;  4LGQ A;  1DMQ A;  1OPY A;  1Y4K A;  1WNH A;  4MMY B;  2I9W A;  4I4K A;  4N6U A;  3BNB A;  3G71 3;  3JUO A;  1STF I;  4LMI A;  1R4C A;  1UW1 A;  3VF1 A;  1VQM 3;  3D9R A;  3KII A;  5FW5 A;  3FSD A;  1YIT 3;  2CHC A;  3JUN A;  3LH4 A;  4XBY A;  1VQ4 3;  1U8C B;  1VQ6 3;  2K0M A;  2Z76 A;  3NM2 A;  2CFG A;  1IT8 A;  3DMC A;  3FGY A;  3HK4 A;  3ALA A;  2YFI B;  1NU3 A;  3L0R A;  5AIG A;  3K0Z A;  2HMM B;  3PCS A;  3CMA 3;  3KZT A;  1JN5 A;  2BO9 B;  2GEY A;  3LTB A;  4N6V 0;  3A76 A;  5AIF A;  3CCV 3;  1NO3 A;  1RRH A;  2BMO B;  1W6C A;  3CNX A;  1OGX A;  2F99 A;  1ROA A;  4BTX A;  3CCJ 3;  2QGU A;  3FKA A;  1DMN A;  1W02 A;  4OUQ A;  4HM0 B;  3QRD A;  4NRE A;  2OQE A;  2K54 A;  1ZX2 A;  3GZR A;  5EQL A;  1A90 A;  3F14 A;  5AYS C;  2Y73 A;  4TX4 A;  3EN1 B;  3JUM A;  2W0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...