3H51A

Crystal structure of putative calcium/calmodulin dependent protein kinase ii association domain (np_636218.1) from xanthomonas campestris at 1.70 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GVMHYTDKAALPADGEAREVAALFDTWNAALATGNPHKVADLYAPDGVLLPTVSNEVRASREQIENYFEMFLTKKPKGVINYRTVRLLDDDSAVDAGVYTFTLTDKNGKKSDVQARYTFVYEKRDGKWLIINHHSSAMPEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative calcium/calmodulin dependent protein kinase II asso
publication title Crystal structure of Putative calcium/calmodulin dependent protein kinase II association domain (NP_636218.1) from XANTHOMONAS CAMPESTRIS at 1.70 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Protein binding
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h51A00
1JB5A 2HMMB 3CPOA 5DRVA 3GZRA 3MSOA 1O7NB 5IENA 3LZAA 3NHXA 2RCDA 1JB2A 2YFIB 4HJLB 1SJWA 1GY7A 1O7HB 4X2HA 5IG3A 1JN5A 3FZWA 1OF5A 3ECFA 2XSHB 3EX9A 3B4OA 4CDLA 5HGRA 3GWRA 2STDA 3GRDA 4WYKB 5AEUB 4OVMA 2XSOB 2B1XB 2YFLB 3S5CA 3F9SA 2BNGA 1Q42A 3G0KA 4HM1B 3BB9A 2GEXA 3OX9A 1VZZA 3IPTA 4HM8B 1OCVA 2CHCA 5D81A 5G2GA 1UUVB 3OWUA 5AIFA 2HMKB 4HM7B 3JUPA 4L7KA 5CXOA 3H51A 3EBTA 1E3RA 2INXA 3NXJA 6STDA 4R1KA 3FF0A 1WQLB 5IF6A 1Q40B 1U5OA 4U13A 4LGQA 5BXQA 3SEDA 3NM2A 3HZPA 5D82A 3SOAA 3KE7A 3MHEA 7STDA 4J8TA 1DMNA 1A2KA 3OWYA 4HM6B 1O7MB 4HM0B 1K41A 5AIHA 3EN8A 2F99A 3EHCA 1OGXA 4XBTA 2QIYA 3T8UA 3FF2A 3HX8A 4WP5A 1ULIB 4K1UA 3H3HA 3FKAA 4J9AA 5CF1A 3VSYA 1Q40A 3A76A 5CF2A 5FW5A 2RGQA 3BLZA 1OHPA 1AR0A 3NV0A 4KVHA 4LEHA 3NBRA 5D83A 2F98A 3ER7A 1IDPA 3JUQA 3DUKA 3GZYB 3WMDA 5KP1A 3NUVA 1JKGB 2OWPA 3RGAA 1OHOA 5IEPA 1NWWA 3UJMA 1ZX2A 4HM4B 2JQ5A 1STDA 4Q53A 4HKVB 4RZMA 3F7SA 5KP4A 1OUNA 5IG5A 1O7GB 1O7WB 3MG3A 3MKIA 5TGNA 4GB5A 1W00A 3FSDA 3K7CA 4R9KA 4XDWA 1EA2A 4PEJA 1NU3A 3I0YA 4OUQA 1DMMA 3GZBA 2YFJB 2HMLB 1GY5A 2A15A 4WYKA 1ULJB 1QJGA 3CNXA 1GY6A 3MYTA 2R4IA 3OXAA 2CKFB 2IMJA 2RFRA 4FCMA 3MG1A 1ASKA 1GYBA 3G8ZA 3KKGA 5DREA 3EF8A 3E99A 3B7CA 5BVBA 3JUNA 1C7HA 3OV4A 4XM4A 1GS3A 4ORLA 3DMCA 2PZVA 2GEYA 2GBXB 2HMJB 1JN5B 1W01A 4XB5A 2HMNB 2W2CA 4XBYA 4IIAA 3EN1B 3F40A 4N3VA 1O7PB 2BMRB 3KSPA 3GZXB 3M8CA 8CHOA 2B24B 2Z76A 4HZBB 1QMAA 2GBWB 3RGRA 3CU3A 2QGUA 4STDA 3CNMA 3B4PA 4I4KA 4K1VA 4HVNA 3EC9A 3Q90A 4H3UA 3F7XA 3VGNA 3ROBA 3EQQB 3F14A 4XBXA 3FGYA 3LYGA 2BMQB 2I9WA 1TUHA 3MG2A 4HM5B 1W6YA 2K54A 1E97A 1OGZA 1HKXA 5JPPA 3JUMA 3B8LA 2Z77A 3JUOA 5EVHA 3STDA 2XR8B 4L8OA 1NDOB 3F8XA 4R9LA 3DXOA 5AIGA 1EG9B 5JPUA 3F8HA 2GXFA 4X2OA 1JKGA 1TP6A 4HZ9B 3G16A 3T8NA 5IEOA 4XDVA 1ISKA 1DMQA 3EJVA 5IG4A 3K0ZA 5KP3A 5STDA 5CK6A 5AIIA 2Z7AA 3UNLA 1ZO2A 4FCJA 4WWUC 3SOYA 3DZLA 3NV0B 1E3VA 3D9RA 3DM8A 4MJDA 2XRXB 1JB4A 1OF5B 4L8PA 3KZTA 1OHSA 1W02A 3OWSA 2HMOB 5IERA 3EBYA 4HM3B 1Z1SA 1OPYA 1OH0A 3FLJA 5AEWB 1UUWB 4HM2B 5CLKA 5IG0A 2BMOB 5AI1A 3HK4A 2UX0A 3FH1A 1CQSA 1BUQA 2F86B 4LMIA 1S5AA
chains in the Genus database with same CATH superfamily
1JB5A 3X41A 1IVWA 1RRLA 1V74A 2HMMB 3DGOA 3UB1A 1QALA 3CPOA 5DRVA 3AMOB 4FR9A 3GZRA 3MSOA 3NBJA 1O7NB 2OOVA 1UCLA 4EW5A 5IENA 3LZAA 3NHXA 2R41A 3U97A 1BRGA 2RCDA 4MMZB 3HIGA 4JF8A 1ZS7A 1JB2A 1MWTA 2YFIB 4HJLB 1SJWA 1GY7A 1O7HB 4N6NB 1RGCA 4X2HA 5IG3A 1JN5A 2W0QA 1GMRA 3FZWA 4EV5A 1OF5A 3ECFA 2XSHB 3EX9A 1YHQ3 1I2GA 1WNHA 2P0XA 3B4OA 5HGRA 3GWRA 4CDLA 3NQYA 1IK3A 1SQWA 2STDA 3GRDA 5M1AA 3D79A 4WYKB 5AEUB 1RTUA 4OVMA 2XSOB 1KWIA 4ILFA 1MWSA 1BIRA 3X3ZA 1W7CA 2B1XB 2P0MA 2OTL3 4GSPA 2KRTA 3X3YA 3PXMA 3EB8A 3D3LA 2YFLB 3S5CA 3F9SA 2BNGA 2CH9A 2CWUA 3QRDA 3SLUA 4BU4A 1Q42A 3G0KA 3AHWA 4HM1B 1BOXA 1RGFA 3BB9A 1RJOA 2GEXA 5LC7A 1B27A 2XH9A 3OX9A 3CCU3 1BSAA 1PYLA 1VZZA 1UCKA 2O3OA 2XEPA 9RNTA 4BTXA 1JBSA 3VF1A 3IPTA 4GHOA 4HOHA 2ZDJA 4LZIA 2KAAA 4HM8B 1OCVA 2CHCA 2CFLA 5D81A 1IT8A 1G02A 7GSPA 1B2ZA 5G2GA 1LOWA 2IUKA 1MOLA 1UUVB 5G1LA 3OWUA 3AMOA 3KFQC 5AIFA 1SPUA 2HMKB 4HM7B 4QWTA 3PYJA 2CFWA 2SBLA 3JUPA 2XFSA 4L7KA 5CXOA 3H51A 1PU4A 1N8R4 2HOHA 1TTOA 1UCJA 1RCKA 1SIHA 3EBTA 3FG3A 3BIRA 3S29A 4BL3A 1YVBI 3MWZA 1K8A4 1BSCA 1YVSA 1KSIA 4K90B 1E3RA 1FUSA 2INXA 4O02B 4CCVA 1RNBA 1W4NA 3NXJA 6STDA 1BNIA 4R1KA 1AV4A 1VQQA 1YNVX 3L0RA 3FF0A 1WQLB 5IF6A 2E2UA 2MC8A 4N6V0 1BRNL 1Q40B 1U5OA 1FGTA 2IUJA 2XGNA 1KD14 1M9GA 2H0HA 4U13A 1N9JA 2FNQA 4LGQA 5BXQA 2RBIA 2D42A 1AVLA 3SEDA 3GSPA 3NM2A 2XFTA 1B21A 1BSBA 1PFPA 3HZPA 5D82A 5EEOA 1FGMA 2XGLA 3LTDA 3SOAA 3KE7A 1FA3A 3MHEA 2F5MA 2IYJA 7STDA 4J8TA 1DMNA 1A2KA 1VQL3 2CWVA 3OWYA 3URPA 3LT9A 1O7MB 4HM0B 4HM6B 3PCRA 1NB5I 1BANA 1K41A 4KFDA 6GSPA 5AIHA 2K0MA 2LQVA 3RDEA 3EN8A 3CCR3 2F99A 1BUJA 1CYUA 1UGHI 3EHCA 3CCM3 2Z6BA 1TFOA 3G4S3 2XF3A 3WDGB 4AKYA 1OGXA 1IT7A 4HBRA 4FCZA 1IV9A 1QAFA 2KCDA 3J7Yd 1B2XA 3JVCA 4LSOA 1R4CA 2QIYA 4XBTA 3T8UA 1M1XB 2ZA4A 3FF2A 3HX8A 4EBGA 1RNTA 4WP5A 2LYXA 2OQEA 1AQZA 1LQMB 4OK0A 2BT3A 3CCJ3 1A2PA 1ULIB 3H3HA 4K1UA 3FKAA 1LRAA 4J9AA 3D5GA 3PZWA 4DKIA 5CF1A 1BRSA 3PCSA 4R4KA 3VSYA 1T5YA 3ZG0A 4TX4A 1Q40A 4CJNA 3CCQ3 1FYSA 1JZOA 4EYCA 1TRQA 3A76A 3GAXA 5CF2A 5FW5A 1LNHA 2RGQA 1WMOA 2W56A 3BLZA 5JBSA 4G1MB 1B2SA 1AR0A 1LOYA 1OHPA 1UDII 1BGSA 1X1UA 3LTAA 3NV0A 4KVHA 4N6TA 1FW7A 4LEHA 3NBRA 3NQZA 3CC23 1SIIA 3LTBA 1RCLA 2Y73A 3HOHA 2F98A 5D83A 1N5HA 3IMAB 1BRJA 3WA3A 1K734 1B3SA 1IVXA 2WGOA 3MPHA 4MMYB 1VQK3 1CEWI 2CWTA 3N54B 5HOHA 1I3IA 3ER7A 1IDPA 1MWRA 1YGEA 3JUQA 2QEX3 2F5WA 3DUKA 1YJW3 2KF5A 2CG1A 1A90A 3GZYB 3EE1A 1BNEA 3LXUX 3WMDA 5KP1A 3CMA3 2UUGC 3NUVA 2WOHA 5ELUA 4MMXB 1JKGB 1BRKA 4BTWA 1RLSA 2OWPA 3BNEA 4O2HA 1RGEA 2F4YA 3RGAA 1OHOA 5IEPA 1KC84 1YI23 1QVF2 3S28A 2Q07A 1NWWA 1AY7A 3UJMA 1ZX2A 2C10A 1NNVA 4HM4B 5AYRB 1YJN3 3DGMA 2JQ5A 1JNQA 1TFKA 1MGWA 2GSPA 2KXGA 1STDA 4Q53A 3V92A 4HKVB 1LQGC 1RGLA 1IVUA 2OOVC 3F7SA 4RZMA 1MGRA 5KP4A 3FG4A 2WGQA 2Y74A 5FGOA 1BNRA 1N8QA 1OUNA 1TRPA 1YGWA 4KFEA 4RNYA 5IG5A 1O7GB 4N6UA 3OW22 3FG1A 3CCV3 1O7WB 3MG3A 3MKIA 3N9HA 5TGNA 1JRQA 4GB5A 1HU9A 2ML6A 2BHMA 1W00A 4GL6A 1K28A 3I553 1VQN3 1S723 3DH2A 1FGQA 3FSDA 1YIJ3 1IV7A 2WOFA 3AHSA 2E2TA 2SARA 1Q9EA 4LYLB 1NB3I 3K7CA 2UGIA 1BVIA 4RNTA 1FZUA 1RGGA 1UW1A 3D5IA 4R9KA 4XDWA 1C54A 1EA2A 3WA2X 2W03A 2D1WA 4PEJA 1NU3A 4I5QA 1BNJA 3I0YA 2E2VA 3FCSB 1IU7A 4OUQA 1DMMA 1IYYA 1UI8A 1EKMA 2RNTA 2L1SA 2F56A 2CK3H 2ML5A 3GZBA 1W2ZA 2YFJB 3LTCA 3WR2A 5IW9A 4EV2A 1BNSA 1WMNA 1GY5A 2HMLB 1VQ63 1J2BA 2A15A 3O8YA 3CCS3 4IPBA 3UL6A 1WTHA 4WYKA 1ULJB 1QJGA 3CNXA 1VQ43 2CW9A 1GY6A 3MYTA 3DGLA 2R4IA 3OXAA 2GU1A 1A67A 1W6CA 4NHFA 2CKFB 2W9PA 3WHOA 2IMJA 3G6E3 3S67A 3LH4A 1D6ZA 2RFRA 4H61A 4FCMA 3MG1A 3AGNA 3D4AA 3PGBA 1DE3A 3V98A 1X1WA 1LVNA 1ASKA 1GYBA 2WO0A 3G8ZA 1I3FA 2P38A 3KKGA 1Q824 5DREA 5M18A 3EF8A 3E99A 3B7CA 1FGRA 1I8VA 1RGHA 1ZGXA 6RNTA 4FMDA 5BVBA 4NPBA 3S27A 3JUNA 1C7HA 1RDSA 4K61A 3G713 3OV4A 1PY3A 4XM4A 1GS3A 1QAKA 3Q3FA 4KFFA 4ORLA 2AAEA 5ELJA 3QK9A 2CIUA 1TU5A 2KF3A 1I70A 1U8CB 1BNFA 3DMCA 3X40A 2PZVA 2ZL8A 1STFI 2CFDA 4JRFA 2QA43 2GEYA 2GU3A 1JBTA 2GBXB 2HMJB 1JN5B 1W01A 1FUTA 1F8NA 2CX0A 3DGYA 4XB5A 2HMNB 1RHLA 2IA7A 2W2CA 1GOVA 4XBYA 4IIAA 3EN1B 1DVDA 3F40A 1G96A 1HYFA 5I97A 4N3VA 1O7PB 2BMRB 1BU4A 1GSPA 1BSEA 3KSPA 1A2VA 3GZXB 3M8CA 1LOVA 3X42A 4N6OB 8CHOA 1FUWA 4EC6A 5BU4A 1GD3A 1IQYA 1V57A 1Q814 2B24B 2Z76A 2OTJ3 1W5ZA 1GMQA 5GSPA 3DY5A 4HZBB 3Q1CA 1QMAA 2GBWB 3DGNA 4AKZA 1JBRA 3RGRA 1EEJA 3CU3A 2QGUA 3CD63 3V99A 5BIRA 3SYUA 3ZFZA 2BO9B 4O8SA 2M7OA 4STDA 3KIIA 3CNMA 3B4PA 4I4KA 1RRHA 1N9EA 2P09A 1B20A 1HZ1A 1US1A 2BU4A 3LMLA 4K1VA 4RBNA 5EQLA 1Q864 1FGOA 3EC9A 3Q90A 4H3UA 2J8XB 3KCHA 4HVNA 2IY2A 3F7XA 2YX9A 4IT7A 4J5KA 3EQQB 3F14A 1CYVA 4J5GA 4XBXA 3ROBA 1UI7A 2OQEC 3FGYA 3K63A 3T0UA 3I563 4KT3B 5RNTA 1R4YA 3CXC2 2FGTA 3ZG5A 2CFGA 3LYGA 2BMQB 1DETA 2V1LA 2I9WA 1B2MA 1JV2B 1TUHA 3MG2A 2KF4A 1IQXA 4HM5B 3KN4A 1W6YA 3BNBA 2K54A 4FMAA 2C11A 1E97A 1OGZA 2RSXA 3BU4A 3HI7A 4RNZA 4BIRA 1HKXA 1UUGB 4AEQA 4CPKA 5JPPA 1N5PA 1VQ93 3JUMA 3B8LA 1VQ53 1ROAA 1K9M4 1D6YA 2W9QA 2Z77A 3JUOA 5EVHA 1DVCA 3SXXA 1VQP3 3STDA 2K3DA 2XR8B 2H0GA 3K9MC 1GOYA 1BNGA 1V58A 1M1K4 1T3BA 1CH0A 2CC3A 3A5EA 5LC6A 3UL5A 4L8OA 3ALAA 1BRIA 1Y4KA 4N6LA 1AVKA 1NDOB 1RKYA 2FXTA 2C4BA 1RN1A 1W6GA 3KSED 3SVAA 3F8XA 3RNTA 2KF6A 1VQ83 1JJ22 5G1KA 3SX1A 4FMCA 4R9LA 1I2FA 1G0TA 3DXOA 1I0XA 2OCTA 5AIGA 1IVVA 4NREA 4WHAA 1JZDA 2BIRA 3CCE3 1EG9B 5JPUA 3F8HA 1EQKA 2PNCA 1BRHA 1DYUA 2GXFA 1I2EA 4X2OA 1UGIA 3U1WA 1JKGA 1TP6A 3WOEB 4HZ9B 3G16A 4O3VA 3T8NA 1NJI4 1QVG2 5IEOA 4XDVA 1Q7Y4 1VQM3 1ISKA 1LNIA 1DMQA 3EJVA 1T2HA 2P05A 2W04A 4HYZA 4KZ1A 3CC43 4N6MA 1YIT3 4R80A 1GMPA 3IJEB 3K0ZA 3NM7A 4MEIA 5IG4A 3NBBA 5KP3A 1RGAA 3X3XA 4HAAA 5A0OB 2ZHXB 5STDA 2L4VA 4BTYA 1X1YA 2CX1A 5CK6A 1RGKA 2Z7AA 5AIIA 3CC73 3WOFB 1GOUA 2H0IA 3NX0A 4ZM8A 3TDGA 2AADA 3UNLA 1UCIA 1ZO2A 4FCJA 4WWUC 2W56B 3SOYA 3DZLA 3NV0B 1LOXA 1I0VA 5AYSC 1GD4A 1BSDA 1E3VA 1RMSA 3HIIA 7RNTA 1OACA 1IQ8A 2JDIH 3CME3 3D9RA 3DM8A 1EUIC 4MJDA 3VGNA 1T2IA 4EXRA 3LOYA 3BNDA 2XRXB 1ROVA 1JB4A 4FMBA 1TIJA 1OF5B 4L8PA 3KZTA 1D6UA 1LXEA 1Q7HA 1W2B2 1KQS2 1MWUA 1OHSA 2O9UX 2MF7A 1W02A 1L5GB 8RNTA 1B2UA 3OWSA 1YJ93 1BAOA 1SARA 2HMOB 1VQ73 5IERA 3EBYA 3Q2PA 3K5TA 4HM3B 4WFOA 1Z1SA 1OPYA 3WODG 3PS8A 1WMPA 2W6JH 1X1XA 1NO3A 1OH0A 3FLJA 5AEWB 1RN4A 1RN7A 1UUWB 4HM2B 5CLKA 2CG0A 2CFKA 5IG0A 3CPW2 2BMOB 1RSNA 1M904 5AI1A 3BNCA 1MNLA 3AGOA 4BL2A 3N8BA 3HK4A 1TJDA 2UX0A 3FH1A 1CQSA 1VQO3 3LT8A 1BUQA 3CCL3 5M19A 2F86B 4LMIA 1S5AA
chains in the Genus database with same CATH topology
1JB5A 3X41A 1IVWA 1RRLA 1V74A 2HMMB 3DGOA 3UB1A 1QALA 3CPOA 5DRVA 3AMOB 4FR9A 3GZRA 3MSOA 3NBJA 1O7NB 2OOVA 5IENA 3LZAA 3NHXA 3U97A 2RCDA 4MMZB 3HIGA 4JF8A 1JB2A 2YFIB 4HJLB 1SJWA 1GY7A 1O7HB 4N6NB 4X2HA 5IG3A 1JN5A 2W0QA 3FZWA 4EV5A 1OF5A 3ECFA 2XSHB 3EX9A 1YHQ3 1WNHA 2P0XA 3B4OA 4CDLA 5HGRA 3GWRA 1IK3A 3NQYA 1SQWA 2STDA 3GRDA 4WYKB 5AEUB 4OVMA 2XSOB 1KWIA 3X3ZA 1W7CA 2B1XB 2P0MA 2OTL3 2KRTA 3X3YA 3PXMA 3EB8A 3D3LA 2YFLB 3S5CA 3F9SA 2BNGA 2CH9A 2CWUA 3QRDA 3SLUA 1Q42A 3G0KA 4HM1B 5LC7A 3BB9A 1RJOA 2GEXA 2XH9A 3OX9A 3CCU3 1VZZA 2O3OA 2XEPA 4BTXA 3VF1A 3IPTA 2ZDJA 4LZIA 4HM8B 1OCVA 2CHCA 2CFLA 5D81A 1IT8A 5G2GA 2IUKA 1MOLA 1UUVB 3OWUA 3AMOA 3KFQC 5AIFA 1SPUA 2HMKB 4HM7B 4QWTA 3PYJA 2CFWA 2SBLA 3JUPA 2XFSA 4L7KA 5CXOA 3H51A 1PU4A 1N8R4 1SIHA 3EBTA 3FG3A 3S29A 1YVBI 3MWZA 1K8A4 1KSIA 4K90B 1E3RA 2INXA 4O02B 4CCVA 1W4NA 3NXJA 6STDA 4R1KA 1AV4A 3L0RA 3FF0A 1WQLB 5IF6A 2E2UA 2MC8A 4N6V0 1Q40B 1U5OA 1FGTA 2IUJA 2XGNA 1KD14 1M9GA 4U13A 1N9JA 2FNQA 4LGQA 5BXQA 2D42A 1AVLA 3SEDA 3NM2A 2XFTA 3HZPA 1PFPA 5D82A 5EEOA 1FGMA 2XGLA 3LTDA 3SOAA 3KE7A 1FA3A 3MHEA 7STDA 4J8TA 1DMNA 1A2KA 1VQL3 2CWVA 3OWYA 3LT9A 1O7MB 4HM0B 4HM6B 3PCRA 1NB5I 1K41A 4KFDA 5AIHA 2K0MA 2LQVA 3RDEA 3EN8A 3CCR3 2F99A 1CYUA 3EHCA 3CCM3 2Z6BA 1TFOA 3G4S3 2XF3A 3WDGB 4AKYA 1OGXA 1IT7A 4HBRA 4FCZA 1IV9A 1QAFA 2KCDA 3J7Yd 3JVCA 4LSOA 1R4CA 2QIYA 4XBTA 3T8UA 1M1XB 3FF2A 3HX8A 4EBGA 4WP5A 2LYXA 2OQEA 4OK0A 2BT3A 3CCJ3 1ULIB 4K1UA 3H3HA 3FKAA 4J9AA 3PZWA 5CF1A 3PCSA 4R4KA 3VSYA 1T5YA 4TX4A 1Q40A 3CCQ3 4EYCA 3A76A 3GAXA 5CF2A 5FW5A 1LNHA 2RGQA 1WMOA 2W56A 3BLZA 5JBSA 4G1MB 1OHPA 1AR0A 3LTAA 3NV0A 4KVHA 4N6TA 4LEHA 3NBRA 3NQZA 3CC23 1SIIA 3LTBA 2Y73A 5D83A 1VQM3 2F98A 1N5HA 3IMAB 3WA3A 1K734 1IVXA 2WGOA 3MPHA 4MMYB 1VQK3 1CEWI 2CWTA 3N54B 3ER7A 1IDPA 1YGEA 3JUQA 2QEX3 3DUKA 1YJW3 1A90A 2CG1A 3GZYB 3EE1A 3LXUX 3WMDA 5KP1A 3CMA3 3NUVA 2WOHA 5ELUA 4MMXB 1JKGB 4BTWA 2OWPA 3BNEA 4O2HA 3RGAA 1OHOA 5IEPA 1KC84 1YI23 1QVF2 3S28A 2Q07A 1NWWA 3UJMA 1ZX2A 2C10A 4HM4B 5AYRB 1YJN3 3DGMA 2JQ5A 1JNQA 1TFKA 2KXGA 1STDA 4Q53A 3V92A 4HKVB 1IVUA 2OOVC 3F7SA 4RZMA 5KP4A 3FG4A 2WGQA 2Y74A 5FGOA 1N8QA 1OUNA 4KFEA 4RNYA 5IG5A 1O7GB 4N6UA 3OW22 3FG1A 3CCV3 1O7WB 3MG3A 3MKIA 3N9HA 5TGNA 1JRQA 4GB5A 1HU9A 2ML6A 2BHMA 1W00A 4GL6A 1K28A 3I553 1VQN3 1S723 1FGQA 3FSDA 1YIJ3 1IV7A 2WOFA 2E2TA 1NB3I 3K7CA 1UW1A 4R9KA 4XDWA 1EA2A 3WA2X 2W03A 2D1WA 4PEJA 1NU3A 3I0YA 2E2VA 3FCSB 1IU7A 4OUQA 1DMMA 1UI8A 1EKMA 2CK3H 2ML5A 3GZBA 1W2ZA 2YFJB 3LTCA 5IW9A 4EV2A 1WMNA 1GY5A 2HMLB 1VQ63 1J2BA 2A15A 3O8YA 3CCS3 4IPBA 3UL6A 1WTHA 4WYKA 1ULJB 1QJGA 3CNXA 1VQ43 2CW9A 1GY6A 3MYTA 3DGLA 2R4IA 3OXAA 2GU1A 1A67A 1W6CA 4NHFA 2CKFB 2W9PA 2IMJA 3G6E3 3S67A 3LH4A 1D6ZA 2RFRA 4H61A 4FCMA 3MG1A 3PGBA 3V98A 1LVNA 1ASKA 1GYBA 2WO0A 3G8ZA 2P38A 3KKGA 1Q824 5DREA 3EF8A 3E99A 3B7CA 1FGRA 4FMDA 5BVBA 3S27A 3JUNA 1C7HA 4K61A 3G713 3OV4A 4XM4A 1GS3A 1QAKA 4KFFA 4ORLA 5ELJA 3QK9A 2CIUA 1TU5A 1U8CB 3DMCA 3X40A 2PZVA 2ZL8A 1STFI 2CFDA 4JRFA 2QA43 2GEYA 2GU3A 2GBXB 2HMJB 1JN5B 1W01A 1F8NA 4XB5A 2HMNB 2IA7A 2W2CA 4XBYA 4IIAA 3EN1B 1DVDA 3F40A 1G96A 5I97A 4N3VA 1O7PB 2BMRB 3KSPA 1A2VA 3GZXB 3M8CA 3X42A 4N6OB 8CHOA 1FUWA 4EC6A 1GD3A 1IQYA 1Q814 2B24B 2Z76A 2OTJ3 1W5ZA 3DY5A 4HZBB 3Q1CA 1QMAA 2GBWB 3DGNA 4AKZA 3RGRA 3CU3A 2QGUA 3CD63 3V99A 2BO9B 4O8SA 2M7OA 4STDA 3KIIA 3CNMA 3B4PA 4I4KA 1RRHA 1N9EA 2P09A 3LMLA 1US1A 1Q864 4K1VA 4RBNA 5EQLA 1FGOA 3EC9A 3Q90A 4H3UA 4HVNA 4IT7A 3F7XA 2YX9A 3ROBA 3VGNA 3EQQB 3F14A 1CYVA 4XBXA 3T0UA 1UI7A 2OQEC 3FGYA 3K63A 3I563 3CXC2 2FGTA 2CFGA 3LYGA 2BMQB 2V1LA 2I9WA 1JV2B 1TUHA 3MG2A 1IQXA 4HM5B 3KN4A 1W6YA 3BNBA 2K54A 4FMAA 2C11A 1E97A 1OGZA 2RSXA 3HI7A 4RNZA 1HKXA 4AEQA 5JPPA 1N5PA 1VQ93 3JUMA 3B8LA 1VQ53 1ROAA 1K9M4 1D6YA 2W9QA 2Z77A 3JUOA 5EVHA 1DVCA 3SXXA 1VQP3 3STDA 2XR8B 3K9MC 1M1K4 2CC3A 5LC6A 3UL5A 4L8OA 3ALAA 4N6LA 1Y4KA 1AVKA 1NDOB 1RKYA 2FXTA 1W6GA 3KSED 3SVAA 3F8XA 1VQ83 1JJ22 3SX1A 4FMCA 4R9LA 3DXOA 2OCTA 5AIGA 1IVVA 4NREA 4WHAA 3CCE3 1EG9B 5JPUA 3F8HA 1EQKA 2PNCA 1DYUA 2GXFA 4X2OA 3U1WA 1JKGA 1TP6A 3WOEB 4HZ9B 3G16A 4O3VA 3T8NA 1NJI4 1QVG2 5IEOA 4XDVA 1Q7Y4 1ISKA 1DMQA 3EJVA 2P05A 2W04A 4HYZA 4KZ1A 3CC43 4N6MA 1YIT3 4R80A 5IG4A 3IJEB 3K0ZA 3NM7A 4MEIA 3NBBA 5KP3A 3X3XA 5A0OB 5STDA 2L4VA 4BTYA 5CK6A 5AIIA 3CC73 2Z7AA 3WOFB 3NX0A 4ZM8A 3TDGA 3UNLA 1ZO2A 4FCJA 4WWUC 2W56B 3SOYA 3DZLA 3NV0B 1LOXA 5AYSC 1GD4A 1E3VA 3HIIA 1OACA 1IQ8A 2JDIH 3CME3 3D9RA 3DM8A 4MJDA 4EXRA 3LOYA 3BNDA 2XRXB 1ROVA 1JB4A 4FMBA 1TIJA 1OF5B 4L8PA 3KZTA 1D6UA 1LXEA 1W2B2 1KQS2 1OHSA 2O9UX 2MF7A 1W02A 1L5GB 1YJ93 3OWSA 1VQ73 2HMOB 5IERA 3EBYA 3Q2PA 3K5TA 4HM3B 4WFOA 1Z1SA 1OPYA 3WODG 3PS8A 1WMPA 2W6JH 1NO3A 1OH0A 3FLJA 5AEWB 1RN7A 1UUWB 4HM2B 5CLKA 2CG0A 2CFKA 5IG0A 3CPW2 2BMOB 1M904 5AI1A 3BNCA 1MNLA 3N8BA 3HK4A 2UX0A 3FH1A 1CQSA 1VQO3 3LT8A 1BUQA 3CCL3 2F86B 4LMIA 1S5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB5 A;  2HMM B;  3CPO A;  5DRV A;  3GZR A;  3MSO A;  1O7N B;  5IEN A;  3LZA A;  3NHX A;  2RCD A;  1JB2 A;  2YFI B;  4HJL B;  1SJW A;  1GY7 A;  1O7H B;  4X2H A;  5IG3 A;  1JN5 A;  3FZW A;  1OF5 A;  3ECF A;  2XSH B;  3EX9 A;  3B4O A;  4CDL A;  5HGR A;  3GWR A;  2STD A;  3GRD A;  4WYK B;  5AEU B;  4OVM A;  2XSO B;  2B1X B;  2YFL B;  3S5C A;  3F9S A;  2BNG A;  1Q42 A;  3G0K A;  4HM1 B;  3BB9 A;  2GEX A;  3OX9 A;  1VZZ A;  3IPT A;  4HM8 B;  1OCV A;  2CHC A;  5D81 A;  5G2G A;  1UUV B;  3OWU A;  5AIF A;  2HMK B;  4HM7 B;  3JUP A;  4L7K A;  5CXO A;  3H51 A;  3EBT A;  1E3R A;  2INX A;  3NXJ A;  6STD A;  4R1K A;  3FF0 A;  1WQL B;  5IF6 A;  1Q40 B;  1U5O A;  4U13 A;  4LGQ A;  5BXQ A;  3SED A;  3NM2 A;  3HZP A;  5D82 A;  3SOA A;  3KE7 A;  3MHE A;  7STD A;  4J8T A;  1DMN A;  1A2K A;  3OWY A;  4HM6 B;  1O7M B;  4HM0 B;  1K41 A;  5AIH A;  3EN8 A;  2F99 A;  3EHC A;  1OGX A;  4XBT A;  2QIY A;  3T8U A;  3FF2 A;  3HX8 A;  4WP5 A;  1ULI B;  4K1U A;  3H3H A;  3FKA A;  4J9A A;  5CF1 A;  3VSY A;  1Q40 A;  3A76 A;  5CF2 A;  5FW5 A;  2RGQ A;  3BLZ A;  1OHP A;  1AR0 A;  3NV0 A;  4KVH A;  4LEH A;  3NBR A;  5D83 A;  2F98 A;  3ER7 A;  1IDP A;  3JUQ A;  3DUK A;  3GZY B;  3WMD A;  5KP1 A;  3NUV A;  1JKG B;  2OWP A;  3RGA A;  1OHO A;  5IEP A;  1NWW A;  3UJM A;  1ZX2 A;  4HM4 B;  2JQ5 A;  1STD A;  4Q53 A;  4HKV B;  4RZM A;  3F7S A;  5KP4 A;  1OUN A;  5IG5 A;  1O7G B;  1O7W B;  3MG3 A;  3MKI A;  5TGN A;  4GB5 A;  1W00 A;  3FSD A;  3K7C A;  4R9K A;  4XDW A;  1EA2 A;  4PEJ A;  1NU3 A;  3I0Y A;  4OUQ A;  1DMM A;  3GZB A;  2YFJ B;  2HML B;  1GY5 A;  2A15 A;  4WYK A;  1ULJ B;  1QJG A;  3CNX A;  1GY6 A;  3MYT A;  2R4I A;  3OXA A;  2CKF B;  2IMJ A;  2RFR A;  4FCM A;  3MG1 A;  1ASK A;  1GYB A;  3G8Z A;  3KKG A;  5DRE A;  3EF8 A;  3E99 A;  3B7C A;  5BVB A;  3JUN A;  1C7H A;  3OV4 A;  4XM4 A;  1GS3 A;  4ORL A;  3DMC A;  2PZV A;  2GEY A;  2GBX B;  2HMJ B;  1JN5 B;  1W01 A;  4XB5 A;  2HMN B;  2W2C A;  4XBY A;  4IIA A;  3EN1 B;  3F40 A;  4N3V A;  1O7P B;  2BMR B;  3KSP A;  3GZX B;  3M8C A;  8CHO A;  2B24 B;  2Z76 A;  4HZB B;  1QMA A;  2GBW B;  3RGR A;  3CU3 A;  2QGU A;  4STD A;  3CNM A;  3B4P A;  4I4K A;  4K1V A;  4HVN A;  3EC9 A;  3Q90 A;  4H3U A;  3F7X A;  3VGN A;  3ROB A;  3EQQ B;  3F14 A;  4XBX A;  3FGY A;  3LYG A;  2BMQ B;  2I9W A;  1TUH A;  3MG2 A;  4HM5 B;  1W6Y A;  2K54 A;  1E97 A;  1OGZ A;  1HKX A;  5JPP A;  3JUM A;  3B8L A;  2Z77 A;  3JUO A;  5EVH A;  3STD A;  2XR8 B;  4L8O A;  1NDO B;  3F8X A;  4R9L A;  3DXO A;  5AIG A;  1EG9 B;  5JPU A;  3F8H A;  2GXF A;  4X2O A;  1JKG A;  1TP6 A;  4HZ9 B;  3G16 A;  3T8N A;  5IEO A;  4XDV A;  1ISK A;  1DMQ A;  3EJV A;  5IG4 A;  3K0Z A;  5KP3 A;  5STD A;  5CK6 A;  5AII A;  2Z7A A;  3UNL A;  1ZO2 A;  4FCJ A;  4WWU C;  3SOY A;  3DZL A;  3NV0 B;  1E3V A;  3D9R A;  3DM8 A;  4MJD A;  2XRX B;  1JB4 A;  1OF5 B;  4L8P A;  3KZT A;  1OHS A;  1W02 A;  3OWS A;  2HMO B;  5IER A;  3EBY A;  4HM3 B;  1Z1S A;  1OPY A;  1OH0 A;  3FLJ A;  5AEW B;  1UUW B;  4HM2 B;  5CLK A;  5IG0 A;  2BMO B;  5AI1 A;  3HK4 A;  2UX0 A;  3FH1 A;  1CQS A;  1BUQ A;  2F86 B;  4LMI A;  1S5A A; 
#chains in the Genus database with same CATH topology
 1JB5 A;  3X41 A;  1IVW A;  1RRL A;  1V74 A;  2HMM B;  3DGO A;  3UB1 A;  1QAL A;  3CPO A;  5DRV A;  3AMO B;  4FR9 A;  3GZR A;  3MSO A;  3NBJ A;  1O7N B;  2OOV A;  1UCL A;  4EW5 A;  5IEN A;  3LZA A;  3NHX A;  2R41 A;  3U97 A;  1BRG A;  2RCD A;  4MMZ B;  3HIG A;  4JF8 A;  1ZS7 A;  1JB2 A;  1MWT A;  2YFI B;  4HJL B;  1SJW A;  1GY7 A;  1O7H B;  4N6N B;  1RGC A;  4X2H A;  5IG3 A;  1JN5 A;  2W0Q A;  1GMR A;  3FZW A;  4EV5 A;  1OF5 A;  3ECF A;  2XSH B;  3EX9 A;  1YHQ 3;  1I2G A;  1WNH A;  2P0X A;  3B4O A;  5HGR A;  3GWR A;  4CDL A;  3NQY A;  1IK3 A;  1SQW A;  2STD A;  3GRD A;  5M1A A;  3D79 A;  4WYK B;  5AEU B;  1RTU A;  4OVM A;  2XSO B;  1KWI A;  4ILF A;  1MWS A;  1BIR A;  3X3Z A;  1W7C A;  2B1X B;  2P0M A;  2OTL 3;  4GSP A;  2KRT A;  3X3Y A;  3PXM A;  3EB8 A;  3D3L A;  2YFL B;  3S5C A;  3F9S A;  2BNG A;  2CH9 A;  2CWU A;  3QRD A;  3SLU A;  4BU4 A;  1Q42 A;  3G0K A;  3AHW A;  4HM1 B;  1BOX A;  1RGF A;  3BB9 A;  1RJO A;  2GEX A;  5LC7 A;  1B27 A;  2XH9 A;  3OX9 A;  3CCU 3;  1BSA A;  1PYL A;  1VZZ A;  1UCK A;  2O3O A;  2XEP A;  9RNT A;  4BTX A;  1JBS A;  3VF1 A;  3IPT A;  4GHO A;  4HOH A;  2ZDJ A;  4LZI A;  2KAA A;  4HM8 B;  1OCV A;  2CHC A;  2CFL A;  5D81 A;  1IT8 A;  1G02 A;  7GSP A;  1B2Z A;  5G2G A;  1LOW A;  2IUK A;  1MOL A;  1UUV B;  5G1L A;  3OWU A;  3AMO A;  3KFQ C;  5AIF A;  1SPU A;  2HMK B;  4HM7 B;  4QWT A;  3PYJ A;  2CFW A;  2SBL A;  3JUP A;  2XFS A;  4L7K A;  5CXO A;  3H51 A;  1PU4 A;  1N8R 4;  2HOH A;  1TTO A;  1UCJ A;  1RCK A;  1SIH A;  3EBT A;  3FG3 A;  3BIR A;  3S29 A;  4BL3 A;  1YVB I;  3MWZ A;  1K8A 4;  1BSC A;  1YVS A;  1KSI A;  4K90 B;  1E3R A;  1FUS A;  2INX A;  4O02 B;  4CCV A;  1RNB A;  1W4N A;  3NXJ A;  6STD A;  1BNI A;  4R1K A;  1AV4 A;  1VQQ A;  1YNV X;  3L0R A;  3FF0 A;  1WQL B;  5IF6 A;  2E2U A;  2MC8 A;  4N6V 0;  1BRN L;  1Q40 B;  1U5O A;  1FGT A;  2IUJ A;  2XGN A;  1KD1 4;  1M9G A;  2H0H A;  4U13 A;  1N9J A;  2FNQ A;  4LGQ A;  5BXQ A;  2RBI A;  2D42 A;  1AVL A;  3SED A;  3GSP A;  3NM2 A;  2XFT A;  1B21 A;  1BSB A;  1PFP A;  3HZP A;  5D82 A;  5EEO A;  1FGM A;  2XGL A;  3LTD A;  3SOA A;  3KE7 A;  1FA3 A;  3MHE A;  2F5M A;  2IYJ A;  7STD A;  4J8T A;  1DMN A;  1A2K A;  1VQL 3;  2CWV A;  3OWY A;  3URP A;  3LT9 A;  1O7M B;  4HM0 B;  4HM6 B;  3PCR A;  1NB5 I;  1BAN A;  1K41 A;  4KFD A;  6GSP A;  5AIH A;  2K0M A;  2LQV A;  3RDE A;  3EN8 A;  3CCR 3;  2F99 A;  1BUJ A;  1CYU A;  1UGH I;  3EHC A;  3CCM 3;  2Z6B A;  1TFO A;  3G4S 3;  2XF3 A;  3WDG B;  4AKY A;  1OGX A;  1IT7 A;  4HBR A;  4FCZ A;  1IV9 A;  1QAF A;  2KCD A;  3J7Y d;  1B2X A;  3JVC A;  4LSO A;  1R4C A;  2QIY A;  4XBT A;  3T8U A;  1M1X B;  2ZA4 A;  3FF2 A;  3HX8 A;  4EBG A;  1RNT A;  4WP5 A;  2LYX A;  2OQE A;  1AQZ A;  1LQM B;  4OK0 A;  2BT3 A;  3CCJ 3;  1A2P A;  1ULI B;  3H3H A;  4K1U A;  3FKA A;  1LRA A;  4J9A A;  3D5G A;  3PZW A;  4DKI A;  5CF1 A;  1BRS A;  3PCS A;  4R4K A;  3VSY A;  1T5Y A;  3ZG0 A;  4TX4 A;  1Q40 A;  4CJN A;  3CCQ 3;  1FYS A;  1JZO A;  4EYC A;  1TRQ A;  3A76 A;  3GAX A;  5CF2 A;  5FW5 A;  1LNH A;  2RGQ A;  1WMO A;  2W56 A;  3BLZ A;  5JBS A;  4G1M B;  1B2S A;  1AR0 A;  1LOY A;  1OHP A;  1UDI I;  1BGS A;  1X1U A;  3LTA A;  3NV0 A;  4KVH A;  4N6T A;  1FW7 A;  4LEH A;  3NBR A;  3NQZ A;  3CC2 3;  1SII A;  3LTB A;  1RCL A;  2Y73 A;  3HOH A;  2F98 A;  5D83 A;  1N5H A;  3IMA B;  1BRJ A;  3WA3 A;  1K73 4;  1B3S A;  1IVX A;  2WGO A;  3MPH A;  4MMY B;  1VQK 3;  1CEW I;  2CWT A;  3N54 B;  5HOH A;  1I3I A;  3ER7 A;  1IDP A;  1MWR A;  1YGE A;  3JUQ A;  2QEX 3;  2F5W A;  3DUK A;  1YJW 3;  2KF5 A;  2CG1 A;  1A90 A;  3GZY B;  3EE1 A;  1BNE A;  3LXU X;  3WMD A;  5KP1 A;  3CMA 3;  2UUG C;  3NUV A;  2WOH A;  5ELU A;  4MMX B;  1JKG B;  1BRK A;  4BTW A;  1RLS A;  2OWP A;  3BNE A;  4O2H A;  1RGE A;  2F4Y A;  3RGA A;  1OHO A;  5IEP A;  1KC8 4;  1YI2 3;  1QVF 2;  3S28 A;  2Q07 A;  1NWW A;  1AY7 A;  3UJM A;  1ZX2 A;  2C10 A;  1NNV A;  4HM4 B;  5AYR B;  1YJN 3;  3DGM A;  2JQ5 A;  1JNQ A;  1TFK A;  1MGW A;  2GSP A;  2KXG A;  1STD A;  4Q53 A;  3V92 A;  4HKV B;  1LQG C;  1RGL A;  1IVU A;  2OOV C;  3F7S A;  4RZM A;  1MGR A;  5KP4 A;  3FG4 A;  2WGQ A;  2Y74 A;  5FGO A;  1BNR A;  1N8Q A;  1OUN A;  1TRP A;  1YGW A;  4KFE A;  4RNY A;  5IG5 A;  1O7G B;  4N6U A;  3OW2 2;  3FG1 A;  3CCV 3;  1O7W B;  3MG3 A;  3MKI A;  3N9H A;  5TGN A;  1JRQ A;  4GB5 A;  1HU9 A;  2ML6 A;  2BHM A;  1W00 A;  4GL6 A;  1K28 A;  3I55 3;  1VQN 3;  1S72 3;  3DH2 A;  1FGQ A;  3FSD A;  1YIJ 3;  1IV7 A;  2WOF A;  3AHS A;  2E2T A;  2SAR A;  1Q9E A;  4LYL B;  1NB3 I;  3K7C A;  2UGI A;  1BVI A;  4RNT A;  1FZU A;  1RGG A;  1UW1 A;  3D5I A;  4R9K A;  4XDW A;  1C54 A;  1EA2 A;  3WA2 X;  2W03 A;  2D1W A;  4PEJ A;  1NU3 A;  4I5Q A;  1BNJ A;  3I0Y A;  2E2V A;  3FCS B;  1IU7 A;  4OUQ A;  1DMM A;  1IYY A;  1UI8 A;  1EKM A;  2RNT A;  2L1S A;  2F56 A;  2CK3 H;  2ML5 A;  3GZB A;  1W2Z A;  2YFJ B;  3LTC A;  3WR2 A;  5IW9 A;  4EV2 A;  1BNS A;  1WMN A;  1GY5 A;  2HML B;  1VQ6 3;  1J2B A;  2A15 A;  3O8Y A;  3CCS 3;  4IPB A;  3UL6 A;  1WTH A;  4WYK A;  1ULJ B;  1QJG A;  3CNX A;  1VQ4 3;  2CW9 A;  1GY6 A;  3MYT A;  3DGL A;  2R4I A;  3OXA A;  2GU1 A;  1A67 A;  1W6C A;  4NHF A;  2CKF B;  2W9P A;  3WHO A;  2IMJ A;  3G6E 3;  3S67 A;  3LH4 A;  1D6Z A;  2RFR A;  4H61 A;  4FCM A;  3MG1 A;  3AGN A;  3D4A A;  3PGB A;  1DE3 A;  3V98 A;  1X1W A;  1LVN A;  1ASK A;  1GYB A;  2WO0 A;  3G8Z A;  1I3F A;  2P38 A;  3KKG A;  1Q82 4;  5DRE A;  5M18 A;  3EF8 A;  3E99 A;  3B7C A;  1FGR A;  1I8V A;  1RGH A;  1ZGX A;  6RNT A;  4FMD A;  5BVB A;  4NPB A;  3S27 A;  3JUN A;  1C7H A;  1RDS A;  4K61 A;  3G71 3;  3OV4 A;  1PY3 A;  4XM4 A;  1GS3 A;  1QAK A;  3Q3F A;  4KFF A;  4ORL A;  2AAE A;  5ELJ A;  3QK9 A;  2CIU A;  1TU5 A;  2KF3 A;  1I70 A;  1U8C B;  1BNF A;  3DMC A;  3X40 A;  2PZV A;  2ZL8 A;  1STF I;  2CFD A;  4JRF A;  2QA4 3;  2GEY A;  2GU3 A;  1JBT A;  2GBX B;  2HMJ B;  1JN5 B;  1W01 A;  1FUT A;  1F8N A;  2CX0 A;  3DGY A;  4XB5 A;  2HMN B;  1RHL A;  2IA7 A;  2W2C A;  1GOV A;  4XBY A;  4IIA A;  3EN1 B;  1DVD A;  3F40 A;  1G96 A;  1HYF A;  5I97 A;  4N3V A;  1O7P B;  2BMR B;  1BU4 A;  1GSP A;  1BSE A;  3KSP A;  1A2V A;  3GZX B;  3M8C A;  1LOV A;  3X42 A;  4N6O B;  8CHO A;  1FUW A;  4EC6 A;  5BU4 A;  1GD3 A;  1IQY A;  1V57 A;  1Q81 4;  2B24 B;  2Z76 A;  2OTJ 3;  1W5Z A;  1GMQ A;  5GSP A;  3DY5 A;  4HZB B;  3Q1C A;  1QMA A;  2GBW B;  3DGN A;  4AKZ A;  1JBR A;  3RGR A;  1EEJ A;  3CU3 A;  2QGU A;  3CD6 3;  3V99 A;  5BIR A;  3SYU A;  3ZFZ A;  2BO9 B;  4O8S A;  2M7O A;  4STD A;  3KII A;  3CNM A;  3B4P A;  4I4K A;  1RRH A;  1N9E A;  2P09 A;  1B20 A;  1HZ1 A;  1US1 A;  2BU4 A;  3LML A;  4K1V A;  4RBN A;  5EQL A;  1Q86 4;  1FGO A;  3EC9 A;  3Q90 A;  4H3U A;  2J8X B;  3KCH A;  4HVN A;  2IY2 A;  3F7X A;  2YX9 A;  4IT7 A;  4J5K A;  3EQQ B;  3F14 A;  1CYV A;  4J5G A;  4XBX A;  3ROB A;  1UI7 A;  2OQE C;  3FGY A;  3K63 A;  3T0U A;  3I56 3;  4KT3 B;  5RNT A;  1R4Y A;  3CXC 2;  2FGT A;  3ZG5 A;  2CFG A;  3LYG A;  2BMQ B;  1DET A;  2V1L A;  2I9W A;  1B2M A;  1JV2 B;  1TUH A;  3MG2 A;  2KF4 A;  1IQX A;  4HM5 B;  3KN4 A;  1W6Y A;  3BNB A;  2K54 A;  4FMA A;  2C11 A;  1E97 A;  1OGZ A;  2RSX A;  3BU4 A;  3HI7 A;  4RNZ A;  4BIR A;  1HKX A;  1UUG B;  4AEQ A;  4CPK A;  5JPP A;  1N5P A;  1VQ9 3;  3JUM A;  3B8L A;  1VQ5 3;  1ROA A;  1K9M 4;  1D6Y A;  2W9Q A;  2Z77 A;  3JUO A;  5EVH A;  1DVC A;  3SXX A;  1VQP 3;  3STD A;  2K3D A;  2XR8 B;  2H0G A;  3K9M C;  1GOY A;  1BNG A;  1V58 A;  1M1K 4;  1T3B A;  1CH0 A;  2CC3 A;  3A5E A;  5LC6 A;  3UL5 A;  4L8O A;  3ALA A;  1BRI A;  1Y4K A;  4N6L A;  1AVK A;  1NDO B;  1RKY A;  2FXT A;  2C4B A;  1RN1 A;  1W6G A;  3KSE D;  3SVA A;  3F8X A;  3RNT A;  2KF6 A;  1VQ8 3;  1JJ2 2;  5G1K A;  3SX1 A;  4FMC A;  4R9L A;  1I2F A;  1G0T A;  3DXO A;  1I0X A;  2OCT A;  5AIG A;  1IVV A;  4NRE A;  4WHA A;  1JZD A;  2BIR A;  3CCE 3;  1EG9 B;  5JPU A;  3F8H A;  1EQK A;  2PNC A;  1BRH A;  1DYU A;  2GXF A;  1I2E A;  4X2O A;  1UGI A;  3U1W A;  1JKG A;  1TP6 A;  3WOE B;  4HZ9 B;  3G16 A;  4O3V A;  3T8N A;  1NJI 4;  1QVG 2;  5IEO A;  4XDV A;  1Q7Y 4;  1VQM 3;  1ISK A;  1LNI A;  1DMQ A;  3EJV A;  1T2H A;  2P05 A;  2W04 A;  4HYZ A;  4KZ1 A;  3CC4 3;  4N6M A;  1YIT 3;  4R80 A;  1GMP A;  3IJE B;  3K0Z A;  3NM7 A;  4MEI A;  5IG4 A;  3NBB A;  5KP3 A;  1RGA A;  3X3X A;  4HAA A;  5A0O B;  2ZHX B;  5STD A;  2L4V A;  4BTY A;  1X1Y A;  2CX1 A;  5CK6 A;  1RGK A;  2Z7A A;  5AII A;  3CC7 3;  3WOF B;  1GOU A;  2H0I A;  3NX0 A;  4ZM8 A;  3TDG A;  2AAD A;  3UNL A;  1UCI A;  1ZO2 A;  4FCJ A;  4WWU C;  2W56 B;  3SOY A;  3DZL A;  3NV0 B;  1LOX A;  1I0V A;  5AYS C;  1GD4 A;  1BSD A;  1E3V A;  1RMS A;  3HII A;  7RNT A;  1OAC A;  1IQ8 A;  2JDI H;  3CME 3;  3D9R A;  3DM8 A;  1EUI C;  4MJD A;  3VGN A;  1T2I A;  4EXR A;  3LOY A;  3BND A;  2XRX B;  1ROV A;  1JB4 A;  4FMB A;  1TIJ A;  1OF5 B;  4L8P A;  3KZT A;  1D6U A;  1LXE A;  1Q7H A;  1W2B 2;  1KQS 2;  1MWU A;  1OHS A;  2O9U X;  2MF7 A;  1W02 A;  1L5G B;  8RNT A;  1B2U A;  3OWS A;  1YJ9 3;  1BAO A;  1SAR A;  2HMO B;  1VQ7 3;  5IER A;  3EBY A;  3Q2P A;  3K5T A;  4HM3 B;  4WFO A;  1Z1S A;  1OPY A;  3WOD G;  3PS8 A;  1WMP A;  2W6J H;  1X1X A;  1NO3 A;  1OH0 A;  3FLJ A;  5AEW B;  1RN4 A;  1RN7 A;  1UUW B;  4HM2 B;  5CLK A;  2CG0 A;  2CFK A;  5IG0 A;  3CPW 2;  2BMO B;  1RSN A;  1M90 4;  5AI1 A;  3BNC A;  1MNL A;  3AGO A;  4BL2 A;  3N8B A;  3HK4 A;  1TJD A;  2UX0 A;  3FH1 A;  1CQS A;  1VQO 3;  3LT8 A;  1BUQ A;  3CCL 3;  5M19 A;  2F86 B;  4LMI A;  1S5A A; 
#chains in the Genus database with same CATH homology
 1JB5 A;  3X41 A;  1IVW A;  1RRL A;  1V74 A;  2HMM B;  3DGO A;  3UB1 A;  1QAL A;  3CPO A;  5DRV A;  3AMO B;  4FR9 A;  3GZR A;  3MSO A;  3NBJ A;  1O7N B;  2OOV A;  5IEN A;  3LZA A;  3NHX A;  3U97 A;  2RCD A;  4MMZ B;  3HIG A;  4JF8 A;  1JB2 A;  2YFI B;  4HJL B;  1SJW A;  1GY7 A;  1O7H B;  4N6N B;  4X2H A;  5IG3 A;  1JN5 A;  2W0Q A;  3FZW A;  4EV5 A;  1OF5 A;  3ECF A;  2XSH B;  3EX9 A;  1YHQ 3;  1WNH A;  2P0X A;  3B4O A;  4CDL A;  5HGR A;  3GWR A;  1IK3 A;  3NQY A;  1SQW A;  2STD A;  3GRD A;  4WYK B;  5AEU B;  4OVM A;  2XSO B;  1KWI A;  3X3Z A;  1W7C A;  2B1X B;  2P0M A;  2OTL 3;  2KRT A;  3X3Y A;  3PXM A;  3EB8 A;  3D3L A;  2YFL B;  3S5C A;  3F9S A;  2BNG A;  2CH9 A;  2CWU A;  3QRD A;  3SLU A;  1Q42 A;  3G0K A;  4HM1 B;  5LC7 A;  3BB9 A;  1RJO A;  2GEX A;  2XH9 A;  3OX9 A;  3CCU 3;  1VZZ A;  2O3O A;  2XEP A;  4BTX A;  3VF1 A;  3IPT A;  2ZDJ A;  4LZI A;  4HM8 B;  1OCV A;  2CHC A;  2CFL A;  5D81 A;  1IT8 A;  5G2G A;  2IUK A;  1MOL A;  1UUV B;  3OWU A;  3AMO A;  3KFQ C;  5AIF A;  1SPU A;  2HMK B;  4HM7 B;  4QWT A;  3PYJ A;  2CFW A;  2SBL A;  3JUP A;  2XFS A;  4L7K A;  5CXO A;  3H51 A;  1PU4 A;  1N8R 4;  1SIH A;  3EBT A;  3FG3 A;  3S29 A;  1YVB I;  3MWZ A;  1K8A 4;  1KSI A;  4K90 B;  1E3R A;  2INX A;  4O02 B;  4CCV A;  1W4N A;  3NXJ A;  6STD A;  4R1K A;  1AV4 A;  3L0R A;  3FF0 A;  1WQL B;  5IF6 A;  2E2U A;  2MC8 A;  4N6V 0;  1Q40 B;  1U5O A;  1FGT A;  2IUJ A;  2XGN A;  1KD1 4;  1M9G A;  4U13 A;  1N9J A;  2FNQ A;  4LGQ A;  5BXQ A;  2D42 A;  1AVL A;  3SED A;  3NM2 A;  2XFT A;  3HZP A;  1PFP A;  5D82 A;  5EEO A;  1FGM A;  2XGL A;  3LTD A;  3SOA A;  3KE7 A;  1FA3 A;  3MHE A;  7STD A;  4J8T A;  1DMN A;  1A2K A;  1VQL 3;  2CWV A;  3OWY A;  3LT9 A;  1O7M B;  4HM0 B;  4HM6 B;  3PCR A;  1NB5 I;  1K41 A;  4KFD A;  5AIH A;  2K0M A;  2LQV A;  3RDE A;  3EN8 A;  3CCR 3;  2F99 A;  1CYU A;  3EHC A;  3CCM 3;  2Z6B A;  1TFO A;  3G4S 3;  2XF3 A;  3WDG B;  4AKY A;  1OGX A;  1IT7 A;  4HBR A;  4FCZ A;  1IV9 A;  1QAF A;  2KCD A;  3J7Y d;  3JVC A;  4LSO A;  1R4C A;  2QIY A;  4XBT A;  3T8U A;  1M1X B;  3FF2 A;  3HX8 A;  4EBG A;  4WP5 A;  2LYX A;  2OQE A;  4OK0 A;  2BT3 A;  3CCJ 3;  1ULI B;  4K1U A;  3H3H A;  3FKA A;  4J9A A;  3PZW A;  5CF1 A;  3PCS A;  4R4K A;  3VSY A;  1T5Y A;  4TX4 A;  1Q40 A;  3CCQ 3;  4EYC A;  3A76 A;  3GAX A;  5CF2 A;  5FW5 A;  1LNH A;  2RGQ A;  1WMO A;  2W56 A;  3BLZ A;  5JBS A;  4G1M B;  1OHP A;  1AR0 A;  3LTA A;  3NV0 A;  4KVH A;  4N6T A;  4LEH A;  3NBR A;  3NQZ A;  3CC2 3;  1SII A;  3LTB A;  2Y73 A;  5D83 A;  1VQM 3;  2F98 A;  1N5H A;  3IMA B;  3WA3 A;  1K73 4;  1IVX A;  2WGO A;  3MPH A;  4MMY B;  1VQK 3;  1CEW I;  2CWT A;  3N54 B;  3ER7 A;  1IDP A;  1YGE A;  3JUQ A;  2QEX 3;  3DUK A;  1YJW 3;  1A90 A;  2CG1 A;  3GZY B;  3EE1 A;  3LXU X;  3WMD A;  5KP1 A;  3CMA 3;  3NUV A;  2WOH A;  5ELU A;  4MMX B;  1JKG B;  4BTW A;  2OWP A;  3BNE A;  4O2H A;  3RGA A;  1OHO A;  5IEP A;  1KC8 4;  1YI2 3;  1QVF 2;  3S28 A;  2Q07 A;  1NWW A;  3UJM A;  1ZX2 A;  2C10 A;  4HM4 B;  5AYR B;  1YJN 3;  3DGM A;  2JQ5 A;  1JNQ A;  1TFK A;  2KXG A;  1STD A;  4Q53 A;  3V92 A;  4HKV B;  1IVU A;  2OOV C;  3F7S A;  4RZM A;  5KP4 A;  3FG4 A;  2WGQ A;  2Y74 A;  5FGO A;  1N8Q A;  1OUN A;  4KFE A;  4RNY A;  5IG5 A;  1O7G B;  4N6U A;  3OW2 2;  3FG1 A;  3CCV 3;  1O7W B;  3MG3 A;  3MKI A;  3N9H A;  5TGN A;  1JRQ A;  4GB5 A;  1HU9 A;  2ML6 A;  2BHM A;  1W00 A;  4GL6 A;  1K28 A;  3I55 3;  1VQN 3;  1S72 3;  1FGQ A;  3FSD A;  1YIJ 3;  1IV7 A;  2WOF A;  2E2T A;  1NB3 I;  3K7C A;  1UW1 A;  4R9K A;  4XDW A;  1EA2 A;  3WA2 X;  2W03 A;  2D1W A;  4PEJ A;  1NU3 A;  3I0Y A;  2E2V A;  3FCS B;  1IU7 A;  4OUQ A;  1DMM A;  1UI8 A;  1EKM A;  2CK3 H;  2ML5 A;  3GZB A;  1W2Z A;  2YFJ B;  3LTC A;  5IW9 A;  4EV2 A;  1WMN A;  1GY5 A;  2HML B;  1VQ6 3;  1J2B A;  2A15 A;  3O8Y A;  3CCS 3;  4IPB A;  3UL6 A;  1WTH A;  4WYK A;  1ULJ B;  1QJG A;  3CNX A;  1VQ4 3;  2CW9 A;  1GY6 A;  3MYT A;  3DGL A;  2R4I A;  3OXA A;  2GU1 A;  1A67 A;  1W6C A;  4NHF A;  2CKF B;  2W9P A;  2IMJ A;  3G6E 3;  3S67 A;  3LH4 A;  1D6Z A;  2RFR A;  4H61 A;  4FCM A;  3MG1 A;  3PGB A;  3V98 A;  1LVN A;  1ASK A;  1GYB A;  2WO0 A;  3G8Z A;  2P38 A;  3KKG A;  1Q82 4;  5DRE A;  3EF8 A;  3E99 A;  3B7C A;  1FGR A;  4FMD A;  5BVB A;  3S27 A;  3JUN A;  1C7H A;  4K61 A;  3G71 3;  3OV4 A;  4XM4 A;  1GS3 A;  1QAK A;  4KFF A;  4ORL A;  5ELJ A;  3QK9 A;  2CIU A;  1TU5 A;  1U8C B;  3DMC A;  3X40 A;  2PZV A;  2ZL8 A;  1STF I;  2CFD A;  4JRF A;  2QA4 3;  2GEY A;  2GU3 A;  2GBX B;  2HMJ B;  1JN5 B;  1W01 A;  1F8N A;  4XB5 A;  2HMN B;  2IA7 A;  2W2C A;  4XBY A;  4IIA A;  3EN1 B;  1DVD A;  3F40 A;  1G96 A;  5I97 A;  4N3V A;  1O7P B;  2BMR B;  3KSP A;  1A2V A;  3GZX B;  3M8C A;  3X42 A;  4N6O B;  8CHO A;  1FUW A;  4EC6 A;  1GD3 A;  1IQY A;  1Q81 4;  2B24 B;  2Z76 A;  2OTJ 3;  1W5Z A;  3DY5 A;  4HZB B;  3Q1C A;  1QMA A;  2GBW B;  3DGN A;  4AKZ A;  3RGR A;  3CU3 A;  2QGU A;  3CD6 3;  3V99 A;  2BO9 B;  4O8S A;  2M7O A;  4STD A;  3KII A;  3CNM A;  3B4P A;  4I4K A;  1RRH A;  1N9E A;  2P09 A;  3LML A;  1US1 A;  1Q86 4;  4K1V A;  4RBN A;  5EQL A;  1FGO A;  3EC9 A;  3Q90 A;  4H3U A;  4HVN A;  4IT7 A;  3F7X A;  2YX9 A;  3ROB A;  3VGN A;  3EQQ B;  3F14 A;  1CYV A;  4XBX A;  3T0U A;  1UI7 A;  2OQE C;  3FGY A;  3K63 A;  3I56 3;  3CXC 2;  2FGT A;  2CFG A;  3LYG A;  2BMQ B;  2V1L A;  2I9W A;  1JV2 B;  1TUH A;  3MG2 A;  1IQX A;  4HM5 B;  3KN4 A;  1W6Y A;  3BNB A;  2K54 A;  4FMA A;  2C11 A;  1E97 A;  1OGZ A;  2RSX A;  3HI7 A;  4RNZ A;  1HKX A;  4AEQ A;  5JPP A;  1N5P A;  1VQ9 3;  3JUM A;  3B8L A;  1VQ5 3;  1ROA A;  1K9M 4;  1D6Y A;  2W9Q A;  2Z77 A;  3JUO A;  5EVH A;  1DVC A;  3SXX A;  1VQP 3;  3STD A;  2XR8 B;  3K9M C;  1M1K 4;  2CC3 A;  5LC6 A;  3UL5 A;  4L8O A;  3ALA A;  4N6L A;  1Y4K A;  1AVK A;  1NDO B;  1RKY A;  2FXT A;  1W6G A;  3KSE D;  3SVA A;  3F8X A;  1VQ8 3;  1JJ2 2;  3SX1 A;  4FMC A;  4R9L A;  3DXO A;  2OCT A;  5AIG A;  1IVV A;  4NRE A;  4WHA A;  3CCE 3;  1EG9 B;  5JPU A;  3F8H A;  1EQK A;  2PNC A;  1DYU A;  2GXF A;  4X2O A;  3U1W A;  1JKG A;  1TP6 A;  3WOE B;  4HZ9 B;  3G16 A;  4O3V A;  3T8N A;  1NJI 4;  1QVG 2;  5IEO A;  4XDV A;  1Q7Y 4;  1ISK A;  1DMQ A;  3EJV A;  2P05 A;  2W04 A;  4HYZ A;  4KZ1 A;  3CC4 3;  4N6M A;  1YIT 3;  4R80 A;  5IG4 A;  3IJE B;  3K0Z A;  3NM7 A;  4MEI A;  3NBB A;  5KP3 A;  3X3X A;  5A0O B;  5STD A;  2L4V A;  4BTY A;  5CK6 A;  5AII A;  3CC7 3;  2Z7A A;  3WOF B;  3NX0 A;  4ZM8 A;  3TDG A;  3UNL A;  1ZO2 A;  4FCJ A;  4WWU C;  2W56 B;  3SOY A;  3DZL A;  3NV0 B;  1LOX A;  5AYS C;  1GD4 A;  1E3V A;  3HII A;  1OAC A;  1IQ8 A;  2JDI H;  3CME 3;  3D9R A;  3DM8 A;  4MJD A;  4EXR A;  3LOY A;  3BND A;  2XRX B;  1ROV A;  1JB4 A;  4FMB A;  1TIJ A;  1OF5 B;  4L8P A;  3KZT A;  1D6U A;  1LXE A;  1W2B 2;  1KQS 2;  1OHS A;  2O9U X;  2MF7 A;  1W02 A;  1L5G B;  1YJ9 3;  3OWS A;  1VQ7 3;  2HMO B;  5IER A;  3EBY A;  3Q2P A;  3K5T A;  4HM3 B;  4WFO A;  1Z1S A;  1OPY A;  3WOD G;  3PS8 A;  1WMP A;  2W6J H;  1NO3 A;  1OH0 A;  3FLJ A;  5AEW B;  1RN7 A;  1UUW B;  4HM2 B;  5CLK A;  2CG0 A;  2CFK A;  5IG0 A;  3CPW 2;  2BMO B;  1M90 4;  5AI1 A;  3BNC A;  1MNL A;  3N8B A;  3HK4 A;  2UX0 A;  3FH1 A;  1CQS A;  1VQO 3;  3LT8 A;  1BUQ A;  3CCL 3;  2F86 B;  4LMI A;  1S5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...