3H51A

Crystal structure of putative calcium/calmodulin dependent protein kinase ii association domain (np_636218.1) from xanthomonas campestris at 1.70 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GVMHYTDKAALPADGEAREVAALFDTWNAALATGNPHKVADLYAPDGVLLPTVSNEVRASREQIENYFEMFLTKKPKGVINYRTVRLLDDDSAVDAGVYTFTLTDKNGKKSDVQARYTFVYEKRDGKWLIINHHSSAMPEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Putative calcium/calmodulin dependent protein kinase II asso
publication title Crystal structure of Putative calcium/calmodulin dependent protein kinase II association domain (NP_636218.1) from XANTHOMONAS CAMPESTRIS at 1.70 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h51A00
3K7CA 4HM2B 2R4IA 1OHSA 2IMJA 3F9SA 4HJLB 4MJDA 3H51A 2RCDA 1GY7A 1QMAA 2YFJB 3MYTA 3MKIA 2CHCA 1C7HA 1ZX2A 2HMLB 3KZTA 1O7WB 3RGAA 4HM0B 5CLKA 1ULJB 7STDA 2GBWB 1W01A 1ISKA 4XDWA 3SOAA 1OUNA 4K1VA 3NV0B 2F86B 2RFRA 3FF2A 1O7PB 3EBTA 5IG4A 4IIAA 3HK4A 4FCMA 3ECFA 4PEJA 1OCVA 3G0KA 1E3VA 3B8LA 5IEOA 5AIFA 4XM4A 5IERA 3A76A 2OWPA 4HVNA 5IF6A 3FH1A 3F8HA 3HX8A 3DUKA 3HZPA 4R9LA 3SOYA 1JKGB 6STDA 1JB2A 1ULIB 3G16A 4K1UA 1OPYA 2A15A 3BB9A 1E3RA 5AIHA 2STDA 3GZRA 2W2CA 2K54A 2RGQA 4HM6B 1SJWA 3OX9A 5AIIA 4OUQA 3EX9A 3WMDA 3T8NA 1E97A 1OGZA 4L8PA 1VZZA 3FLJA 2B24B 1UUWB 2I9WA 4HM1B 4HZ9B 4XBYA 3NXJA 4WYKA 2BMRB 5FW5A 4XB5A 1GYBA 1OGXA 2GBXB 3FF0A 4X2OA 2B1XB 3OXAA 3FGYA 1JB4A 3BLZA 2GXFA 1NDOB 2XSHB 4ORLA 1GS3A 4HM4B 5CK6A 5IG5A 3GWRA 4XBTA 5DRVA 1JB5A 2F99A 1STDA 3JUPA 4HM3B 1JN5A 5D83A 5G2GA 4STDA 2INXA 1EA2A 3VSYA 5AEUB 4KVHA 3EN1B 1IDPA 3DZLA 3IPTA 4X2HA 3OWSA 3DXOA 5AIGA 3F8XA 5KP4A 5EVHA 3MHEA 4WYKB 3F7SA 3LZAA 3EJVA 2GEXA 3KE7A 3EF8A 3MG3A 1HKXA 1BUQA 5KP3A 2CKFB 5IEPA 1OHOA 5DREA 3FZWA 1QJGA 3NBRA 1NU3A 1O7MB 1W6YA 3VGNA 4GB5A 1JN5B 5CXOA 1DMMA 3JUOA 3I0YA 5AEWB 1Q40A 4LEHA 1GY5A 2JQ5A 2Z77A 5BVBA 5HGRA 1AR0A 5D81A 2BNGA 4WP5A 1UUVB 5IG0A 3F40A 3OWYA 3F7XA 5IG3A 2UX0A 3S5CA 4I4KA 2YFLB 1TUHA 3JUQA 8CHOA 1GY6A 3MSOA 4HZBB 1OF5A 3NHXA 1ZO2A 4J9AA 2QIYA 4FCJA 3EQQB 3GZXB 3CNMA 3KSPA 5BXQA 5TGNA 3CPOA 2QGUA 1DMNA 1U5OA 2Z76A 3F14A 3RGRA 1OH0A 3B4PA 4HM7B 2PZVA 4N3VA 2BMQB 1Q40B 3LYGA 2GEYA 3T8UA 3ER7A 3KKGA 5CF2A 4R1KA 3CNXA 3EBYA 5IENA 1JKGA 2XRXB 5CF1A 5KP1A 4L8OA 1S5AA 1TP6A 1O7HB 2HMJB 5AI1A 1OF5B 3GZBA 3B4OA 4RZMA 5JPPA 2XSOB 1Q42A 3JUNA 1W02A 2HMMB 1O7GB 1CQSA 3OWUA 2Z7AA 3MG1A 3GZYB 3DMCA 3EC9A 4HM5B 4Q53A 2BMOB 1A2KA 4U13A 4XDVA 3EHCA 4L7KA 5D82A 1EG9B 3GRDA 4HKVB 4LGQA 1DMQA 4XBXA 2YFIB 3E99A 3SEDA 1K41A 2HMNB 1NWWA 2HMKB 3G8ZA 4WWUC 5JPUA 4R9KA 3FKAA 2HMOB 2F98A 1Z1SA 3M8CA 1W00A 3H3HA 1O7NB 4OVMA 3DM8A 2XR8B 3CU3A 4LMIA 4HM8B 1ASKA 5STDA 3UJMA 4J8TA 3JUMA 3OV4A 1WQLB 4CDLA 3Q90A 3K0ZA 3NV0A 3D9RA 3FSDA 3ROBA 1OHPA 3EN8A 3STDA 3MG2A 3B7CA 4H3UA 3NUVA 3UNLA 3NM2A
chains in the Genus database with same CATH superfamily
3K7CA 1A2VA 2R4IA 4HM2B 3FCSB 2C11A 1OHSA 2IMJA 2CFWA 3F9SA 3CC23 5I97A 2J8XB 2XEPA 1M1XB 1S723 1BNIA 1RGEA 2XF3A 4HJLB 3ALAA 4RNYA 1TFKA 3H51A 4MJDA 2LQVA 1QAFA 4MMZB 2RCDA 1STFI 2CX0A 3PCSA 1GY7A 4N6TA 1QMAA 2YFJB 3BU4A 1GD3A 3MKIA 3MYTA 2CHCA 1C7HA 1TRPA 1ZX2A 2HMLB 9RNTA 3KZTA 1I2GA 1O7WB 2CFDA 3RGAA 3U97A 5HOHA 3PYJA 1UGIA 4HM0B 3O8YA 1I0VA 5CLKA 1ULJB 7STDA 7GSPA 1VQN3 2OOVA 3I553 2GBWB 2CC3A 2WOHA 1J2BA 1OACA 1W01A 3JVCA 1ISKA 3LTDA 4XDWA 3SOAA 1SPUA 1L5GB 4FR9A 1BRHA 3LXUX 3S29A 1IVXA 4KFEA 3D5GA 3D79A 3BNDA 3LTBA 5G1KA 1OUNA 4K1VA 2W0QA 3NV0B 1VQL3 2F86B 1YJW3 3FG4A 1TTOA 1I2FA 2RFRA 1LXEA 1FYSA 1B3SA 1W6GA 1X1YA 3FF2A 1JBSA 1O7PB 1D6UA 3EBTA 5IG4A 4IIAA 2BHMA 2CH9A 5AYSC 3URPA 1WNHA 1BRGA 3HI7A 2CFGA 1V74A 2RSXA 4EV5A 3HK4A 2O3OA 3GAXA 4FCMA 3EB8A 4O2HA 3ECFA 4PEJA 1OCVA 2OQEA 3G0KA 1JRQA 3ZG5A 3SVAA 1E3VA 5FGOA 4AKZA 1VQO3 3B8LA 1LOYA 5IEOA 1G96A 5AIFA 4BU4A 4XM4A 1Q814 5IERA 1U8CB 3A76A 1BSDA 1ROAA 2OWPA 4HVNA 5IF6A 1K734 1RGCA 3FH1A 3SX1A 1RGKA 3F8HA 1IK3A 3HOHA 3X3XA 1BRKA 1AVKA 1LNHA 3HX8A 3DUKA 1AVLA 1HZ1A 3HZPA 1B2MA 4R9LA 4GHOA 1T3BA 3SOYA 2SARA 3HIGA 1JKGB 6STDA 3CCS3 1JB2A 1ULIB 3G16A 4K1UA 3CCJ3 1VQK3 1OPYA 4FMBA 2A15A 1UCJA 3DGOA 2QEX3 1VQ53 3BB9A 1D6YA 3DGLA 1E3RA 1I3FA 2P05A 5AIHA 2CWUA 2STDA 2W2CA 1YGEA 2K54A 2RGQA 3GZRA 1RCKA 1BNRA 4HM6B 1WMOA 2KF3A 1SJWA 3OX9A 4FMDA 1JZOA 2WGOA 5AIIA 3U1WA 3WOFB 1IVVA 4OUQA 1VQ63 2W56A 1RJOA 1BNJA 1A67A 3KIIA 3PCRA 1RMSA 1EEJA 2SBLA 1B2XA 4J5KA 3CCR3 2ML6A 1UCIA 3EX9A 3PXMA 3Q1CA 3WMDA 5ELUA 2CG1A 3T8NA 1E97A 2BT3A 3FG1A 4BTWA 2PNCA 2IYJA 1RN7A 1OGZA 3MWZA 1MGRA 4L8PA 1NNVA 3AMOA 3KCHA 1RCLA 1VZZA 3WR2A 1Q864 3BNCA 2L1SA 2B24B 3FLJA 1UUWB 1X1WA 1DYUA 2D1WA 3EE1A 4CJNA 1RGLA 2HOHA 1WTHA 1JJ22 2I9WA 1GOVA 3N54B 4O3VA 4HM1B 1T2HA 4HZ9B 1MGWA 1IYYA 1UDII 4EC6A 4XBYA 4JF8A 3NXJA 4WYKA 1KC84 2BMRB 5FW5A 1YHQ3 4EV2A 4XB5A 1GSPA 1B27A 5M18A 1BIRA 1GYBA 3NX0A 1OGXA 1PFPA 2GBXB 1SIIA 1I70A 3FF0A 4X2OA 2B1XB 4H61A 3OXAA 1FGTA 3X42A 2QA43 4O02B 1I3IA 1KWIA 3CXC2 3FGYA 1JB4A 3BLZA 2F5WA 2GXFA 1NDOB 1W2B2 2XSHB 1LRAA 4ZM8A 3WODG 1FGQA 1M9GA 3S67A 1KSIA 1GOYA 3KN4A 4ORLA 1GS3A 4RNZA 3VF1A 4HM4B 3CCV3 1QVF2 1IV9A 1MWUA 1T5YA 5CK6A 5IG5A 1FUTA 5IW9A 1PY3A 3RDEA 3S28A 3GWRA 4N6V0 2IY2A 3LTCA 4XBTA 6RNTA 5DRVA 1N8R4 1BSAA 1JB5A 3UL5A 2F99A 3G6E3 1STDA 2E2UA 3DH2A 3JUPA 4HM3B 1JN5A 3AGOA 1ZS7A 2OTL3 1EQKA 2GU3A 2H0IA 5D83A 3NQYA 1BUJA 3DGMA 5G2GA 1VQQA 4STDA 2INXA 1EA2A 3VSYA 5AEUB 5G1LA 4KVHA 4LSOA 1FA3A 1RTUA 1W7CA 3EN1B 1IDPA 2C4BA 3DZLA 3IPTA 1RGHA 4X2HA 3AMOB 1RLSA 2ZDJA 3K9MC 3OWSA 3DXOA 1W4NA 1TRQA 2R41A 5AIGA 4EW5A 3F8XA 4AEQA 1MOLA 4AKYA 1GMRA 1AY7A 4IT7A 1GD4A 3X40A 1T2IA 2XGLA 1BNFA 4KFDA 1IQYA 5KP4A 7RNTA 1CYUA 1BRJA 5EVHA 2WO0A 3WOEB 3MHEA 4WYKB 1KD14 1A2PA 2OOVC 2KRTA 2KF6A 1IT8A 1PYLA 3K5TA 1RNBA 2Y73A 3DY5A 3S27A 2M7OA 1Y4KA 3F7SA 1UCKA 3LZAA 2BO9B 3EJVA 2GEXA 3KE7A 1BRSA 4KT3B 1Q7Y4 1SQWA 3EF8A 3MG3A 4N6UA 3NBJA 3CC43 1RHLA 1HKXA 2RNTA 4FMCA 1BSBA 2AAEA 1BUQA 3Q3FA 1N5HA 5KP3A 4KZ1A 1NB5I 2CKFB 5IEPA 1C54A 5LC6A 1OHOA 5DREA 5BIRA 3FZWA 4BL3A 3V99A 2XFTA 1NJI4 4FMAA 3I563 1QJGA 1N8QA 3FG3A 3HIIA 3NBRA 1FZUA 1NU3A 2OQEC 1LOVA 1O7MB 1RSNA 1W6YA 2F56A 4FCZA 3PS8A 1JN5B 4GB5A 2XFSA 2F5MA 3K63A 5CXOA 3VGNA 1PU4A 1DMMA 2BIRA 3JUOA 3I0YA 3IMAB 1YIJ3 1MWSA 1MNLA 4TX4A 5BU4A 1JNQA 1K9M4 1VQ93 5AEWB 1N9JA 3D4AA 1I8VA 1Q40A 4LEHA 1GY5A 1BGSA 1MWRA 2JQ5A 2Z77A 2O9UX 1BNSA 1CYVA 3WA2X 4CPKA 3NBBA 1ROVA 5BVBA 5LC7A 5HGRA 1AR0A 1B2ZA 5D81A 1RGGA 1JZDA 2BNGA 2XH9A 4WP5A 5M1AA 5M19A 3CPW2 1N9EA 2IA7A 2XGNA 4MMYB 4RBNA 3N9HA 1UUVB 5GSPA 5IG0A 3F40A 3OWYA 2GU1A 2K0MA 2OTJ3 3F7XA 4GL6A 1QAKA 3CC73 4N6OB 2KXGA 5IG3A 1BRIA 4HBRA 4KFFA 2UX0A 2WGQA 1QALA 4I4KA 2YFLB 4QWTA 3S5CA 3CCE3 1IV7A 5ELJA 4BTYA 1WMPA 1B20A 2H0GA 1TUHA 3JUQA 8CHOA 3CD63 1GY6A 3MSOA 4HZBB 1HYFA 2CW9A 1OF5A 1HU9A 1CEWI 3NHXA 2D42A 1F8NA 2L4VA 2ZL8A 1UW1A 2W6JH 1ZO2A 4CCVA 1Q9EA 3WDGB 4J9AA 2ML5A 2QIYA 2IUJA 3SXXA 1YJ93 4FCJA 3EQQB 4BL2A 1RKYA 3GZXB 4N6MA 1YNVX 2AADA 3T0UA 3AHWA 1VQ73 3CME3 1RRHA 1BU4A 1JV2B 3CNMA 3KSPA 4BIRA 4N6LA 3BIRA 1D6ZA 4GSPA 5BXQA 5TGNA 1LOWA 3CPOA 2QGUA 1DETA 1B21A 1DMNA 3PGBA 3G713 1TFOA 2C10A 3CMA3 1BANA 1M1K4 1U5OA 2Z76A 2V1LA 3F14A 3KFQC 3KSED 3RGRA 4N6NB 3ZFZA 1W5ZA 4DKIA 1OH0A 3B4PA 2KF5A 3MPHA 4HM7B 2PZVA 4NHFA 4N3VA 2BMQB 4NREA 4EYCA 2W56B 1SIHA 1IT7A 1Q40B 3LYGA 1RRLA 2GEYA 2P0MA 2IUKA 2KF4A 2CWTA 3T8UA 2CWVA 3ER7A 3KKGA 1LOXA 3GSPA 4K61A 5CF2A 3J7Yd 1YGWA 2MF7A 1RN4A 3BNEA 4R1KA 3CNXA 1R4CA 1DVDA 3EBYA 5IENA 1JKGA 2CX1A 2XRXB 2RBIA 5CF1A 3X3YA 1FUWA 2P0XA 5KP1A 4EBGA 1I0XA 4L8OA 1IU7A 1S5AA 1LNIA 1TP6A 4I5QA 4IPBA 1GOUA 1O7HB 1A90A 2HMJB 4HYZA 2CIUA 1SARA 3SLUA 4MEIA 1IQ8A 1TJDA 2W03A 5AI1A 3V98A 1OF5B 3CCL3 3GZBA 1VQM3 4EXRA 3LMLA 3B4OA 5AYRB 1Q7HA 4R4KA 1I2EA 4RZMA 5JPPA 1UI8A 2CG0A 1IVUA 4BTXA 3WA3A 2W9QA 1EKMA 2XSOB 3UB1A 1M904 1Q42A 2ZHXB 5JBSA 3JUNA 1YVBI 2WOFA 1IQXA 1W02A 2HMMB 1O7GB 1VQ43 1WMNA 3X41A 1CQSA 3OWUA 2YX9A 3LT8A 2OCTA 1V58A 1FGOA 3LOYA 1VQ83 2FXTA 2Z7AA 4MMXB 3N8BA 3MG1A 2Y74A 2LYXA 4J5GA 4R80A 3X3ZA 1RGFA 2P38A 1BOXA 1G0TA 3DMCA 3GZYB 3ZG0A 1VQP3 1BSEA 1Q824 1BSCA 1UCLA 3DGYA 3EC9A 5A0OB 3QRDA 1BAOA 1CH0A 2KAAA 1MWTA 3NQZA 3L0RA 4HM5B 1TIJA 1US1A 3BNBA 2ZA4A 4Q53A 3TDGA 2Z6BA 3QK9A 1K8A4 2BMOB 1RGAA 2MC8A 4HOHA 1AQZA 1A2KA 5EQLA 1W2ZA 1JBTA 2FGTA 3AGNA 4U13A 1YJN3 1W6CA 3EHCA 4G1MB 4XDVA 1V57A 4L7KA 4ILFA 2CFKA 2F4YA 4WHAA 5D82A 1EG9B 3GRDA 4HKVB 4LGQA 4O8SA 2UGIA 5EEOA 3CCQ3 3RNTA 1DMQA 4XBXA 2YFIB 3PZWA 3Q2PA 3E99A 3SEDA 1BNGA 2GSPA 1K41A 1G02A 1K28A 2HMNB 3UL6A 1LQMB 3WHOA 3A5EA 1B2UA 1LQGC 3CCU3 1NWWA 2HMKB 3LT9A 1X1XA 2K3DA 2P09A 3G8ZA 4WWUC 5JPUA 1KQS2 4R9KA 3FKAA 3CCM3 2HMOB 2F98A 1Z1SA 3M8CA 8RNTA 1LVNA 1W00A 1O7NB 3H3HA 4OVMA 3DM8A 4LZIA 4NPBA 3V92A 1GMQA 1B2SA 1ZGXA 1UI7A 2XR8B 3CU3A 4LMIA 1UUGB 1NO3A 4HM8B 4HAAA 2BU4A 2E2VA 1ASKA 5STDA 1RDSA 1X1UA 3UJMA 4J8TA 3D5IA 3JUMA 3OV4A 2KCDA 3NM7A 1YVSA 1AV4A 1FW7A 1IVWA 1WQLB 2E2TA 2H0HA 1BNEA 4CDLA 3Q90A 3D3LA 1BRNL 3K0ZA 3NV0A 2JDIH 3LTAA 1FGMA 3G4S3 3DGNA 3D9RA 1GMPA 3FSDA 2CFLA 3ROBA 1FUSA 1OHPA 6GSPA 1JBRA 2W04A 1RN1A 3EN8A 3AHSA 4K90B 1NB3I 1DVCA 4JRFA 3STDA 1YI23 1QVG2 1BVIA 5RNTA 3MG2A 4LYLB 3B7CA 3OW22 2CK3H 4H3UA 4WFOA 1TU5A 1UGHI 3IJEB 3NUVA 3UNLA 1FGRA 2FNQA 1R4YA 3NM2A 3SYUA 1DE3A 2Q07A 3LH4A 1YIT3 2UUGC 2W9PA 1RNTA 4RNTA 1EUIC 4OK0A 1N5PA
chains in the Genus database with same CATH topology
3K7CA 1A2VA 2R4IA 4HM2B 3FCSB 2C11A 1OHSA 2IMJA 2CFWA 3F9SA 3CC23 5I97A 2XEPA 1M1XB 1S723 2XF3A 4HJLB 3ALAA 4RNYA 1TFKA 3H51A 4MJDA 2LQVA 1QAFA 4MMZB 2RCDA 1STFI 3PCSA 1GY7A 4N6TA 1QMAA 2YFJB 1GD3A 3MKIA 3MYTA 2CHCA 1C7HA 1ZX2A 2HMLB 3KZTA 3U97A 1O7WB 2CFDA 3RGAA 3PYJA 4HM0B 3O8YA 5CLKA 1ULJB 7STDA 1VQN3 2OOVA 3I553 2GBWB 2CC3A 2WOHA 1J2BA 1OACA 1W01A 3JVCA 1ISKA 3LTDA 4XDWA 3SOAA 1SPUA 1L5GB 4FR9A 3LXUX 3S29A 1IVXA 4KFEA 3BNDA 3LTBA 1OUNA 4K1VA 2W0QA 3NV0B 1VQL3 2F86B 1YJW3 3FG4A 2RFRA 1LXEA 1W6GA 3FF2A 1O7PB 1D6UA 3EBTA 5IG4A 4IIAA 2BHMA 2CH9A 5AYSC 1WNHA 3HI7A 2CFGA 1V74A 2RSXA 4EV5A 3HK4A 2O3OA 3GAXA 4FCMA 3EB8A 4O2HA 3ECFA 4PEJA 1OCVA 2OQEA 3G0KA 1JRQA 3SVAA 1E3VA 5FGOA 4AKZA 1VQO3 3B8LA 5IEOA 1G96A 5AIFA 1Q814 4XM4A 5IERA 1U8CB 3A76A 1ROAA 2OWPA 4HVNA 5IF6A 1K734 3FH1A 3SX1A 1IK3A 3F8HA 3X3XA 1AVKA 1LNHA 3HX8A 3DUKA 1AVLA 3HZPA 4R9LA 3SOYA 3HIGA 1JKGB 6STDA 3CCS3 1JB2A 1ULIB 3G16A 4K1UA 3CCJ3 1VQK3 1OPYA 4FMBA 2A15A 3DGOA 2QEX3 1VQ53 3BB9A 1D6YA 3DGLA 1E3RA 2P05A 5AIHA 2CWUA 2STDA 2W2CA 1YGEA 2K54A 2RGQA 3GZRA 4HM6B 1WMOA 4FMDA 1SJWA 3OX9A 5AIIA 2WGOA 3WOFB 1VQ63 3U1WA 1IVVA 4OUQA 2W56A 1RJOA 1A67A 3KIIA 3PCRA 2SBLA 3CCR3 2ML6A 3EX9A 3PXMA 3Q1CA 3WMDA 5ELUA 2CG1A 3T8NA 1E97A 2BT3A 3FG1A 4BTWA 2PNCA 1RN7A 1OGZA 3MWZA 4L8PA 3AMOA 1VZZA 1Q864 3BNCA 3FLJA 2B24B 1UUWB 1DYUA 2D1WA 3EE1A 1WTHA 1JJ22 2I9WA 3N54B 4O3VA 4HM1B 4HZ9B 4EC6A 4XBYA 4JF8A 3NXJA 4WYKA 1KC84 2BMRB 5FW5A 4EV2A 4XB5A 1GYBA 3NX0A 1OGXA 1PFPA 2GBXB 1SIIA 3FF0A 4X2OA 2B1XB 4H61A 3OXAA 1FGTA 3X42A 2QA43 4O02B 1KWIA 3CXC2 3FGYA 1JB4A 3BLZA 2GXFA 1NDOB 1W2B2 2XSHB 4ZM8A 3WODG 1FGQA 1M9GA 3S67A 1KSIA 3KN4A 4ORLA 1GS3A 4RNZA 3VF1A 4HM4B 3CCV3 1QVF2 1IV9A 1T5YA 5CK6A 5IG5A 5IW9A 3RDEA 3S28A 3GWRA 4N6V0 4XBTA 3LTCA 1N8R4 5DRVA 1JB5A 3UL5A 2F99A 3G6E3 1STDA 2E2UA 3JUPA 4HM3B 1JN5A 1EQKA 2OTL3 2GU3A 5D83A 3NQYA 3DGMA 5G2GA 4STDA 2INXA 1EA2A 3VSYA 5AEUB 4KVHA 4LSOA 1FA3A 1W7CA 3EN1B 1IDPA 3DZLA 3IPTA 4X2HA 3AMOB 3K9MC 2ZDJA 3OWSA 3DXOA 1W4NA 5AIGA 3F8XA 4AEQA 1MOLA 4AKYA 4IT7A 1GD4A 3X40A 2XGLA 5KP4A 4KFDA 1IQYA 1CYUA 5EVHA 2WO0A 3WOEB 3MHEA 4WYKB 1KD14 2OOVC 2KRTA 1IT8A 3K5TA 2Y73A 3DY5A 3S27A 2M7OA 1Y4KA 3F7SA 3LZAA 2BO9B 3EJVA 2GEXA 3KE7A 1Q7Y4 1SQWA 3EF8A 3MG3A 4N6UA 3NBJA 3CC43 1HKXA 4FMCA 1BUQA 1N5HA 5KP3A 4KZ1A 1NB5I 2CKFB 5IEPA 5LC6A 1OHOA 5DREA 3FZWA 3V99A 2XFTA 1NJI4 4FMAA 3I563 1QJGA 1N8QA 3FG3A 3HIIA 3NBRA 2OQEC 1NU3A 1YHQ3 1O7MB 1W6YA 4FCZA 4GB5A 3VGNA 3PS8A 1JN5B 5CXOA 2XFSA 3K63A 1PU4A 1DMMA 3JUOA 3I0YA 3IMAB 1YIJ3 1MNLA 4TX4A 1VQ93 1JNQA 1K9M4 5AEWB 1N9JA 1Q40A 4LEHA 1GY5A 2JQ5A 2Z77A 2O9UX 1CYVA 3WA2X 3NBBA 1ROVA 5BVBA 5LC7A 5HGRA 1AR0A 5D81A 2BNGA 2XH9A 3CPW2 4WP5A 1N9EA 2IA7A 2XGNA 4MMYB 4RBNA 3N9HA 1UUVB 5IG0A 3F40A 3OWYA 2GU1A 2K0MA 2OTJ3 3F7XA 4GL6A 1QAKA 3CC73 4N6OB 2KXGA 5IG3A 4HBRA 4KFFA 2UX0A 2WGQA 1QALA 4I4KA 2YFLB 4QWTA 3S5CA 3CCE3 1IV7A 5ELJA 4BTYA 1WMPA 3CD63 1TUHA 3JUQA 8CHOA 1GY6A 3MSOA 4HZBB 2CW9A 1OF5A 1HU9A 1CEWI 3NHXA 2D42A 1F8NA 2L4VA 2ZL8A 1UW1A 2W6JH 1ZO2A 4CCVA 3WDGB 4J9AA 2ML5A 2QIYA 2IUJA 3SXXA 1YJ93 4FCJA 3EQQB 1RKYA 3GZXB 4N6MA 3T0UA 1VQ73 3CME3 1RRHA 3CNMA 1JV2B 3KSPA 4N6LA 1D6ZA 5BXQA 5TGNA 3CPOA 2QGUA 3PGBA 1DMNA 3G713 1TFOA 2C10A 3CMA3 1M1K4 1U5OA 2Z76A 2V1LA 3F14A 3KFQC 3KSED 3RGRA 4N6NB 1W5ZA 1OH0A 3B4PA 3MPHA 4HM7B 2PZVA 4NHFA 4N3VA 2BMQB 4NREA 4EYCA 2W56B 1SIHA 1IT7A 1Q40B 3LYGA 1RRLA 2GEYA 2P0MA 2IUKA 2CWTA 3T8UA 2CWVA 3ER7A 3KKGA 1LOXA 4K61A 5CF2A 3J7Yd 2MF7A 3BNEA 4R1KA 3CNXA 1R4CA 1DVDA 3EBYA 5IENA 1JKGA 2XRXB 5CF1A 3X3YA 1FUWA 2P0XA 5KP1A 4EBGA 4L8OA 1IU7A 1S5AA 1TP6A 1A90A 4IPBA 1O7HB 2HMJB 4HYZA 2CIUA 3SLUA 4MEIA 1IQ8A 3CCL3 2W03A 5AI1A 3V98A 1OF5B 3GZBA 1VQM3 4EXRA 3LMLA 3B4OA 5AYRB 4R4KA 4RZMA 5JPPA 1UI8A 2CG0A 1IVUA 4BTXA 3WA3A 2W9QA 1EKMA 2XSOB 3UB1A 1M904 1Q42A 5JBSA 3JUNA 1YVBI 2WOFA 1IQXA 1W02A 2HMMB 1O7GB 1VQ43 1WMNA 3X41A 1CQSA 3OWUA 2YX9A 3LT8A 2OCTA 1FGOA 3LOYA 1VQ83 2FXTA 2Z7AA 4MMXB 3N8BA 3MG1A 2Y74A 2LYXA 4R80A 3X3ZA 3GZYB 2P38A 3DMCA 1VQP3 1Q824 5A0OB 3EC9A 3QRDA 3NQZA 3L0RA 4HM5B 1TIJA 1US1A 3BNBA 4Q53A 3TDGA 2Z6BA 3QK9A 1K8A4 2BMOB 2MC8A 1A2KA 5EQLA 1W2ZA 2FGTA 4U13A 1YJN3 1W6CA 3EHCA 4G1MB 4XDVA 4L7KA 2CFKA 4WHAA 5D82A 1EG9B 3GRDA 4HKVB 4LGQA 4O8SA 5EEOA 3CCQ3 1DMQA 4XBXA 2YFIB 3PZWA 3Q2PA 3E99A 3SEDA 1K41A 1K28A 2HMNB 3UL6A 3CCU3 1NWWA 2HMKB 3LT9A 3G8ZA 2P09A 4WWUC 5JPUA 1KQS2 4R9KA 3FKAA 3CCM3 2HMOB 2F98A 1Z1SA 3M8CA 1LVNA 1W00A 1O7NB 3H3HA 4OVMA 3DM8A 4LZIA 3V92A 2XR8B 3CU3A 1UI7A 4LMIA 4HM8B 1NO3A 2E2VA 1ASKA 5STDA 3UJMA 4J8TA 3JUMA 3OV4A 2KCDA 3NM7A 1AV4A 1IVWA 1WQLB 2E2TA 4CDLA 3Q90A 3D3LA 3K0ZA 3NV0A 2JDIH 3LTAA 1FGMA 3G4S3 3DGNA 3D9RA 3FSDA 2CFLA 3ROBA 1OHPA 2W04A 3EN8A 4K90B 1NB3I 1DVCA 4JRFA 3STDA 1YI23 1QVG2 3MG2A 3B7CA 3OW22 2CK3H 4H3UA 4WFOA 1TU5A 3IJEB 3NUVA 3UNLA 1FGRA 2FNQA 3NM2A 2Q07A 3LH4A 1YIT3 2W9PA 4OK0A 1N5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7C A;  4HM2 B;  2R4I A;  1OHS A;  2IMJ A;  3F9S A;  4HJL B;  4MJD A;  3H51 A;  2RCD A;  1GY7 A;  1QMA A;  2YFJ B;  3MYT A;  3MKI A;  2CHC A;  1C7H A;  1ZX2 A;  2HML B;  3KZT A;  1O7W B;  3RGA A;  4HM0 B;  5CLK A;  1ULJ B;  7STD A;  2GBW B;  1W01 A;  1ISK A;  4XDW A;  3SOA A;  1OUN A;  4K1V A;  3NV0 B;  2F86 B;  2RFR A;  3FF2 A;  1O7P B;  3EBT A;  5IG4 A;  4IIA A;  3HK4 A;  4FCM A;  3ECF A;  4PEJ A;  1OCV A;  3G0K A;  1E3V A;  3B8L A;  5IEO A;  5AIF A;  4XM4 A;  5IER A;  3A76 A;  2OWP A;  4HVN A;  5IF6 A;  3FH1 A;  3F8H A;  3HX8 A;  3DUK A;  3HZP A;  4R9L A;  3SOY A;  1JKG B;  6STD A;  1JB2 A;  1ULI B;  3G16 A;  4K1U A;  1OPY A;  2A15 A;  3BB9 A;  1E3R A;  5AIH A;  2STD A;  3GZR A;  2W2C A;  2K54 A;  2RGQ A;  4HM6 B;  1SJW A;  3OX9 A;  5AII A;  4OUQ A;  3EX9 A;  3WMD A;  3T8N A;  1E97 A;  1OGZ A;  4L8P A;  1VZZ A;  3FLJ A;  2B24 B;  1UUW B;  2I9W A;  4HM1 B;  4HZ9 B;  4XBY A;  3NXJ A;  4WYK A;  2BMR B;  5FW5 A;  4XB5 A;  1GYB A;  1OGX A;  2GBX B;  3FF0 A;  4X2O A;  2B1X B;  3OXA A;  3FGY A;  1JB4 A;  3BLZ A;  2GXF A;  1NDO B;  2XSH B;  4ORL A;  1GS3 A;  4HM4 B;  5CK6 A;  5IG5 A;  3GWR A;  4XBT A;  5DRV A;  1JB5 A;  2F99 A;  1STD A;  3JUP A;  4HM3 B;  1JN5 A;  5D83 A;  5G2G A;  4STD A;  2INX A;  1EA2 A;  3VSY A;  5AEU B;  4KVH A;  3EN1 B;  1IDP A;  3DZL A;  3IPT A;  4X2H A;  3OWS A;  3DXO A;  5AIG A;  3F8X A;  5KP4 A;  5EVH A;  3MHE A;  4WYK B;  3F7S A;  3LZA A;  3EJV A;  2GEX A;  3KE7 A;  3EF8 A;  3MG3 A;  1HKX A;  1BUQ A;  5KP3 A;  2CKF B;  5IEP A;  1OHO A;  5DRE A;  3FZW A;  1QJG A;  3NBR A;  1NU3 A;  1O7M B;  1W6Y A;  3VGN A;  4GB5 A;  1JN5 B;  5CXO A;  1DMM A;  3JUO A;  3I0Y A;  5AEW B;  1Q40 A;  4LEH A;  1GY5 A;  2JQ5 A;  2Z77 A;  5BVB A;  5HGR A;  1AR0 A;  5D81 A;  2BNG A;  4WP5 A;  1UUV B;  5IG0 A;  3F40 A;  3OWY A;  3F7X A;  5IG3 A;  2UX0 A;  3S5C A;  4I4K A;  2YFL B;  1TUH A;  3JUQ A;  8CHO A;  1GY6 A;  3MSO A;  4HZB B;  1OF5 A;  3NHX A;  1ZO2 A;  4J9A A;  2QIY A;  4FCJ A;  3EQQ B;  3GZX B;  3CNM A;  3KSP A;  5BXQ A;  5TGN A;  3CPO A;  2QGU A;  1DMN A;  1U5O A;  2Z76 A;  3F14 A;  3RGR A;  1OH0 A;  3B4P A;  4HM7 B;  2PZV A;  4N3V A;  2BMQ B;  1Q40 B;  3LYG A;  2GEY A;  3T8U A;  3ER7 A;  3KKG A;  5CF2 A;  4R1K A;  3CNX A;  3EBY A;  5IEN A;  1JKG A;  2XRX B;  5CF1 A;  5KP1 A;  4L8O A;  1S5A A;  1TP6 A;  1O7H B;  2HMJ B;  5AI1 A;  1OF5 B;  3GZB A;  3B4O A;  4RZM A;  5JPP A;  2XSO B;  1Q42 A;  3JUN A;  1W02 A;  2HMM B;  1O7G B;  1CQS A;  3OWU A;  2Z7A A;  3MG1 A;  3GZY B;  3DMC A;  3EC9 A;  4HM5 B;  4Q53 A;  2BMO B;  1A2K A;  4U13 A;  4XDV A;  3EHC A;  4L7K A;  5D82 A;  1EG9 B;  3GRD A;  4HKV B;  4LGQ A;  1DMQ A;  4XBX A;  2YFI B;  3E99 A;  3SED A;  1K41 A;  2HMN B;  1NWW A;  2HMK B;  3G8Z A;  4WWU C;  5JPU A;  4R9K A;  3FKA A;  2HMO B;  2F98 A;  1Z1S A;  3M8C A;  1W00 A;  3H3H A;  1O7N B;  4OVM A;  3DM8 A;  2XR8 B;  3CU3 A;  4LMI A;  4HM8 B;  1ASK A;  5STD A;  3UJM A;  4J8T A;  3JUM A;  3OV4 A;  1WQL B;  4CDL A;  3Q90 A;  3K0Z A;  3NV0 A;  3D9R A;  3FSD A;  3ROB A;  1OHP A;  3EN8 A;  3STD A;  3MG2 A;  3B7C A;  4H3U A;  3NUV A;  3UNL A;  3NM2 A; 
#chains in the Genus database with same CATH topology
 3K7C A;  1A2V A;  2R4I A;  4HM2 B;  3FCS B;  2C11 A;  1OHS A;  2IMJ A;  2CFW A;  3F9S A;  3CC2 3;  5I97 A;  2J8X B;  2XEP A;  1M1X B;  1S72 3;  1BNI A;  1RGE A;  2XF3 A;  4HJL B;  3ALA A;  4RNY A;  1TFK A;  3H51 A;  4MJD A;  2LQV A;  1QAF A;  4MMZ B;  2RCD A;  1STF I;  2CX0 A;  3PCS A;  1GY7 A;  4N6T A;  1QMA A;  2YFJ B;  3BU4 A;  1GD3 A;  3MKI A;  3MYT A;  2CHC A;  1C7H A;  1TRP A;  1ZX2 A;  2HML B;  9RNT A;  3KZT A;  1I2G A;  1O7W B;  2CFD A;  3RGA A;  3U97 A;  5HOH A;  3PYJ A;  1UGI A;  4HM0 B;  3O8Y A;  1I0V A;  5CLK A;  1ULJ B;  7STD A;  7GSP A;  1VQN 3;  2OOV A;  3I55 3;  2GBW B;  2CC3 A;  2WOH A;  1J2B A;  1OAC A;  1W01 A;  3JVC A;  1ISK A;  3LTD A;  4XDW A;  3SOA A;  1SPU A;  1L5G B;  4FR9 A;  1BRH A;  3LXU X;  3S29 A;  1IVX A;  4KFE A;  3D5G A;  3D79 A;  3BND A;  3LTB A;  5G1K A;  1OUN A;  4K1V A;  2W0Q A;  3NV0 B;  1VQL 3;  2F86 B;  1YJW 3;  3FG4 A;  1TTO A;  1I2F A;  2RFR A;  1LXE A;  1FYS A;  1B3S A;  1W6G A;  1X1Y A;  3FF2 A;  1JBS A;  1O7P B;  1D6U A;  3EBT A;  5IG4 A;  4IIA A;  2BHM A;  2CH9 A;  5AYS C;  3URP A;  1WNH A;  1BRG A;  3HI7 A;  2CFG A;  1V74 A;  2RSX A;  4EV5 A;  3HK4 A;  2O3O A;  3GAX A;  4FCM A;  3EB8 A;  4O2H A;  3ECF A;  4PEJ A;  1OCV A;  2OQE A;  3G0K A;  1JRQ A;  3ZG5 A;  3SVA A;  1E3V A;  5FGO A;  4AKZ A;  1VQO 3;  3B8L A;  1LOY A;  5IEO A;  1G96 A;  5AIF A;  4BU4 A;  4XM4 A;  1Q81 4;  5IER A;  1U8C B;  3A76 A;  1BSD A;  1ROA A;  2OWP A;  4HVN A;  5IF6 A;  1K73 4;  1RGC A;  3FH1 A;  3SX1 A;  1RGK A;  3F8H A;  1IK3 A;  3HOH A;  3X3X A;  1BRK A;  1AVK A;  1LNH A;  3HX8 A;  3DUK A;  1AVL A;  1HZ1 A;  3HZP A;  1B2M A;  4R9L A;  4GHO A;  1T3B A;  3SOY A;  2SAR A;  3HIG A;  1JKG B;  6STD A;  3CCS 3;  1JB2 A;  1ULI B;  3G16 A;  4K1U A;  3CCJ 3;  1VQK 3;  1OPY A;  4FMB A;  2A15 A;  1UCJ A;  3DGO A;  2QEX 3;  1VQ5 3;  3BB9 A;  1D6Y A;  3DGL A;  1E3R A;  1I3F A;  2P05 A;  5AIH A;  2CWU A;  2STD A;  2W2C A;  1YGE A;  2K54 A;  2RGQ A;  3GZR A;  1RCK A;  1BNR A;  4HM6 B;  1WMO A;  2KF3 A;  1SJW A;  3OX9 A;  4FMD A;  1JZO A;  2WGO A;  5AII A;  3U1W A;  3WOF B;  1IVV A;  4OUQ A;  1VQ6 3;  2W56 A;  1RJO A;  1BNJ A;  1A67 A;  3KII A;  3PCR A;  1RMS A;  1EEJ A;  2SBL A;  1B2X A;  4J5K A;  3CCR 3;  2ML6 A;  1UCI A;  3EX9 A;  3PXM A;  3Q1C A;  3WMD A;  5ELU A;  2CG1 A;  3T8N A;  1E97 A;  2BT3 A;  3FG1 A;  4BTW A;  2PNC A;  2IYJ A;  1RN7 A;  1OGZ A;  3MWZ A;  1MGR A;  4L8P A;  1NNV A;  3AMO A;  3KCH A;  1RCL A;  1VZZ A;  3WR2 A;  1Q86 4;  3BNC A;  2L1S A;  2B24 B;  3FLJ A;  1UUW B;  1X1W A;  1DYU A;  2D1W A;  3EE1 A;  4CJN A;  1RGL A;  2HOH A;  1WTH A;  1JJ2 2;  2I9W A;  1GOV A;  3N54 B;  4O3V A;  4HM1 B;  1T2H A;  4HZ9 B;  1MGW A;  1IYY A;  1UDI I;  4EC6 A;  4XBY A;  4JF8 A;  3NXJ A;  4WYK A;  1KC8 4;  2BMR B;  5FW5 A;  1YHQ 3;  4EV2 A;  4XB5 A;  1GSP A;  1B27 A;  5M18 A;  1BIR A;  1GYB A;  3NX0 A;  1OGX A;  1PFP A;  2GBX B;  1SII A;  1I70 A;  3FF0 A;  4X2O A;  2B1X B;  4H61 A;  3OXA A;  1FGT A;  3X42 A;  2QA4 3;  4O02 B;  1I3I A;  1KWI A;  3CXC 2;  3FGY A;  1JB4 A;  3BLZ A;  2F5W A;  2GXF A;  1NDO B;  1W2B 2;  2XSH B;  1LRA A;  4ZM8 A;  3WOD G;  1FGQ A;  1M9G A;  3S67 A;  1KSI A;  1GOY A;  3KN4 A;  4ORL A;  1GS3 A;  4RNZ A;  3VF1 A;  4HM4 B;  3CCV 3;  1QVF 2;  1IV9 A;  1MWU A;  1T5Y A;  5CK6 A;  5IG5 A;  1FUT A;  5IW9 A;  1PY3 A;  3RDE A;  3S28 A;  3GWR A;  4N6V 0;  2IY2 A;  3LTC A;  4XBT A;  6RNT A;  5DRV A;  1N8R 4;  1BSA A;  1JB5 A;  3UL5 A;  2F99 A;  3G6E 3;  1STD A;  2E2U A;  3DH2 A;  3JUP A;  4HM3 B;  1JN5 A;  3AGO A;  1ZS7 A;  2OTL 3;  1EQK A;  2GU3 A;  2H0I A;  5D83 A;  3NQY A;  1BUJ A;  3DGM A;  5G2G A;  1VQQ A;  4STD A;  2INX A;  1EA2 A;  3VSY A;  5AEU B;  5G1L A;  4KVH A;  4LSO A;  1FA3 A;  1RTU A;  1W7C A;  3EN1 B;  1IDP A;  2C4B A;  3DZL A;  3IPT A;  1RGH A;  4X2H A;  3AMO B;  1RLS A;  2ZDJ A;  3K9M C;  3OWS A;  3DXO A;  1W4N A;  1TRQ A;  2R41 A;  5AIG A;  4EW5 A;  3F8X A;  4AEQ A;  1MOL A;  4AKY A;  1GMR A;  1AY7 A;  4IT7 A;  1GD4 A;  3X40 A;  1T2I A;  2XGL A;  1BNF A;  4KFD A;  1IQY A;  5KP4 A;  7RNT A;  1CYU A;  1BRJ A;  5EVH A;  2WO0 A;  3WOE B;  3MHE A;  4WYK B;  1KD1 4;  1A2P A;  2OOV C;  2KRT A;  2KF6 A;  1IT8 A;  1PYL A;  3K5T A;  1RNB A;  2Y73 A;  3DY5 A;  3S27 A;  2M7O A;  1Y4K A;  3F7S A;  1UCK A;  3LZA A;  2BO9 B;  3EJV A;  2GEX A;  3KE7 A;  1BRS A;  4KT3 B;  1Q7Y 4;  1SQW A;  3EF8 A;  3MG3 A;  4N6U A;  3NBJ A;  3CC4 3;  1RHL A;  1HKX A;  2RNT A;  4FMC A;  1BSB A;  2AAE A;  1BUQ A;  3Q3F A;  1N5H A;  5KP3 A;  4KZ1 A;  1NB5 I;  2CKF B;  5IEP A;  1C54 A;  5LC6 A;  1OHO A;  5DRE A;  5BIR A;  3FZW A;  4BL3 A;  3V99 A;  2XFT A;  1NJI 4;  4FMA A;  3I56 3;  1QJG A;  1N8Q A;  3FG3 A;  3HII A;  3NBR A;  1FZU A;  1NU3 A;  2OQE C;  1LOV A;  1O7M B;  1RSN A;  1W6Y A;  2F56 A;  4FCZ A;  3PS8 A;  1JN5 B;  4GB5 A;  2XFS A;  2F5M A;  3K63 A;  5CXO A;  3VGN A;  1PU4 A;  1DMM A;  2BIR A;  3JUO A;  3I0Y A;  3IMA B;  1YIJ 3;  1MWS A;  1MNL A;  4TX4 A;  5BU4 A;  1JNQ A;  1K9M 4;  1VQ9 3;  5AEW B;  1N9J A;  3D4A A;  1I8V A;  1Q40 A;  4LEH A;  1GY5 A;  1BGS A;  1MWR A;  2JQ5 A;  2Z77 A;  2O9U X;  1BNS A;  1CYV A;  3WA2 X;  4CPK A;  3NBB A;  1ROV A;  5BVB A;  5LC7 A;  5HGR A;  1AR0 A;  1B2Z A;  5D81 A;  1RGG A;  1JZD A;  2BNG A;  2XH9 A;  4WP5 A;  5M1A A;  5M19 A;  3CPW 2;  1N9E A;  2IA7 A;  2XGN A;  4MMY B;  4RBN A;  3N9H A;  1UUV B;  5GSP A;  5IG0 A;  3F40 A;  3OWY A;  2GU1 A;  2K0M A;  2OTJ 3;  3F7X A;  4GL6 A;  1QAK A;  3CC7 3;  4N6O B;  2KXG A;  5IG3 A;  1BRI A;  4HBR A;  4KFF A;  2UX0 A;  2WGQ A;  1QAL A;  4I4K A;  2YFL B;  4QWT A;  3S5C A;  3CCE 3;  1IV7 A;  5ELJ A;  4BTY A;  1WMP A;  1B20 A;  2H0G A;  1TUH A;  3JUQ A;  8CHO A;  3CD6 3;  1GY6 A;  3MSO A;  4HZB B;  1HYF A;  2CW9 A;  1OF5 A;  1HU9 A;  1CEW I;  3NHX A;  2D42 A;  1F8N A;  2L4V A;  2ZL8 A;  1UW1 A;  2W6J H;  1ZO2 A;  4CCV A;  1Q9E A;  3WDG B;  4J9A A;  2ML5 A;  2QIY A;  2IUJ A;  3SXX A;  1YJ9 3;  4FCJ A;  3EQQ B;  4BL2 A;  1RKY A;  3GZX B;  4N6M A;  1YNV X;  2AAD A;  3T0U A;  3AHW A;  1VQ7 3;  3CME 3;  1RRH A;  1BU4 A;  1JV2 B;  3CNM A;  3KSP A;  4BIR A;  4N6L A;  3BIR A;  1D6Z A;  4GSP A;  5BXQ A;  5TGN A;  1LOW A;  3CPO A;  2QGU A;  1DET A;  1B21 A;  1DMN A;  3PGB A;  3G71 3;  1TFO A;  2C10 A;  3CMA 3;  1BAN A;  1M1K 4;  1U5O A;  2Z76 A;  2V1L A;  3F14 A;  3KFQ C;  3KSE D;  3RGR A;  4N6N B;  3ZFZ A;  1W5Z A;  4DKI A;  1OH0 A;  3B4P A;  2KF5 A;  3MPH A;  4HM7 B;  2PZV A;  4NHF A;  4N3V A;  2BMQ B;  4NRE A;  4EYC A;  2W56 B;  1SIH A;  1IT7 A;  1Q40 B;  3LYG A;  1RRL A;  2GEY A;  2P0M A;  2IUK A;  2KF4 A;  2CWT A;  3T8U A;  2CWV A;  3ER7 A;  3KKG A;  1LOX A;  3GSP A;  4K61 A;  5CF2 A;  3J7Y d;  1YGW A;  2MF7 A;  1RN4 A;  3BNE A;  4R1K A;  3CNX A;  1R4C A;  1DVD A;  3EBY A;  5IEN A;  1JKG A;  2CX1 A;  2XRX B;  2RBI A;  5CF1 A;  3X3Y A;  1FUW A;  2P0X A;  5KP1 A;  4EBG A;  1I0X A;  4L8O A;  1IU7 A;  1S5A A;  1LNI A;  1TP6 A;  4I5Q A;  4IPB A;  1GOU A;  1O7H B;  1A90 A;  2HMJ B;  4HYZ A;  2CIU A;  1SAR A;  3SLU A;  4MEI A;  1IQ8 A;  1TJD A;  2W03 A;  5AI1 A;  3V98 A;  1OF5 B;  3CCL 3;  3GZB A;  1VQM 3;  4EXR A;  3LML A;  3B4O A;  5AYR B;  1Q7H A;  4R4K A;  1I2E A;  4RZM A;  5JPP A;  1UI8 A;  2CG0 A;  1IVU A;  4BTX A;  3WA3 A;  2W9Q A;  1EKM A;  2XSO B;  3UB1 A;  1M90 4;  1Q42 A;  2ZHX B;  5JBS A;  3JUN A;  1YVB I;  2WOF A;  1IQX A;  1W02 A;  2HMM B;  1O7G B;  1VQ4 3;  1WMN A;  3X41 A;  1CQS A;  3OWU A;  2YX9 A;  3LT8 A;  2OCT A;  1V58 A;  1FGO A;  3LOY A;  1VQ8 3;  2FXT A;  2Z7A A;  4MMX B;  3N8B A;  3MG1 A;  2Y74 A;  2LYX A;  4J5G A;  4R80 A;  3X3Z A;  1RGF A;  2P38 A;  1BOX A;  1G0T A;  3DMC A;  3GZY B;  3ZG0 A;  1VQP 3;  1BSE A;  1Q82 4;  1BSC A;  1UCL A;  3DGY A;  3EC9 A;  5A0O B;  3QRD A;  1BAO A;  1CH0 A;  2KAA A;  1MWT A;  3NQZ A;  3L0R A;  4HM5 B;  1TIJ A;  1US1 A;  3BNB A;  2ZA4 A;  4Q53 A;  3TDG A;  2Z6B A;  3QK9 A;  1K8A 4;  2BMO B;  1RGA A;  2MC8 A;  4HOH A;  1AQZ A;  1A2K A;  5EQL A;  1W2Z A;  1JBT A;  2FGT A;  3AGN A;  4U13 A;  1YJN 3;  1W6C A;  3EHC A;  4G1M B;  4XDV A;  1V57 A;  4L7K A;  4ILF A;  2CFK A;  2F4Y A;  4WHA A;  5D82 A;  1EG9 B;  3GRD A;  4HKV B;  4LGQ A;  4O8S A;  2UGI A;  5EEO A;  3CCQ 3;  3RNT A;  1DMQ A;  4XBX A;  2YFI B;  3PZW A;  3Q2P A;  3E99 A;  3SED A;  1BNG A;  2GSP A;  1K41 A;  1G02 A;  1K28 A;  2HMN B;  3UL6 A;  1LQM B;  3WHO A;  3A5E A;  1B2U A;  1LQG C;  3CCU 3;  1NWW A;  2HMK B;  3LT9 A;  1X1X A;  2K3D A;  2P09 A;  3G8Z A;  4WWU C;  5JPU A;  1KQS 2;  4R9K A;  3FKA A;  3CCM 3;  2HMO B;  2F98 A;  1Z1S A;  3M8C A;  8RNT A;  1LVN A;  1W00 A;  1O7N B;  3H3H A;  4OVM A;  3DM8 A;  4LZI A;  4NPB A;  3V92 A;  1GMQ A;  1B2S A;  1ZGX A;  1UI7 A;  2XR8 B;  3CU3 A;  4LMI A;  1UUG B;  1NO3 A;  4HM8 B;  4HAA A;  2BU4 A;  2E2V A;  1ASK A;  5STD A;  1RDS A;  1X1U A;  3UJM A;  4J8T A;  3D5I A;  3JUM A;  3OV4 A;  2KCD A;  3NM7 A;  1YVS A;  1AV4 A;  1FW7 A;  1IVW A;  1WQL B;  2E2T A;  2H0H A;  1BNE A;  4CDL A;  3Q90 A;  3D3L A;  1BRN L;  3K0Z A;  3NV0 A;  2JDI H;  3LTA A;  1FGM A;  3G4S 3;  3DGN A;  3D9R A;  1GMP A;  3FSD A;  2CFL A;  3ROB A;  1FUS A;  1OHP A;  6GSP A;  1JBR A;  2W04 A;  1RN1 A;  3EN8 A;  3AHS A;  4K90 B;  1NB3 I;  1DVC A;  4JRF A;  3STD A;  1YI2 3;  1QVG 2;  1BVI A;  5RNT A;  3MG2 A;  4LYL B;  3B7C A;  3OW2 2;  2CK3 H;  4H3U A;  4WFO A;  1TU5 A;  1UGH I;  3IJE B;  3NUV A;  3UNL A;  1FGR A;  2FNQ A;  1R4Y A;  3NM2 A;  3SYU A;  1DE3 A;  2Q07 A;  3LH4 A;  1YIT 3;  2UUG C;  2W9P A;  1RNT A;  4RNT A;  1EUI C;  4OK0 A;  1N5P A; 
#chains in the Genus database with same CATH homology
 3K7C A;  1A2V A;  2R4I A;  4HM2 B;  3FCS B;  2C11 A;  1OHS A;  2IMJ A;  2CFW A;  3F9S A;  3CC2 3;  5I97 A;  2XEP A;  1M1X B;  1S72 3;  2XF3 A;  4HJL B;  3ALA A;  4RNY A;  1TFK A;  3H51 A;  4MJD A;  2LQV A;  1QAF A;  4MMZ B;  2RCD A;  1STF I;  3PCS A;  1GY7 A;  4N6T A;  1QMA A;  2YFJ B;  1GD3 A;  3MKI A;  3MYT A;  2CHC A;  1C7H A;  1ZX2 A;  2HML B;  3KZT A;  3U97 A;  1O7W B;  2CFD A;  3RGA A;  3PYJ A;  4HM0 B;  3O8Y A;  5CLK A;  1ULJ B;  7STD A;  1VQN 3;  2OOV A;  3I55 3;  2GBW B;  2CC3 A;  2WOH A;  1J2B A;  1OAC A;  1W01 A;  3JVC A;  1ISK A;  3LTD A;  4XDW A;  3SOA A;  1SPU A;  1L5G B;  4FR9 A;  3LXU X;  3S29 A;  1IVX A;  4KFE A;  3BND A;  3LTB A;  1OUN A;  4K1V A;  2W0Q A;  3NV0 B;  1VQL 3;  2F86 B;  1YJW 3;  3FG4 A;  2RFR A;  1LXE A;  1W6G A;  3FF2 A;  1O7P B;  1D6U A;  3EBT A;  5IG4 A;  4IIA A;  2BHM A;  2CH9 A;  5AYS C;  1WNH A;  3HI7 A;  2CFG A;  1V74 A;  2RSX A;  4EV5 A;  3HK4 A;  2O3O A;  3GAX A;  4FCM A;  3EB8 A;  4O2H A;  3ECF A;  4PEJ A;  1OCV A;  2OQE A;  3G0K A;  1JRQ A;  3SVA A;  1E3V A;  5FGO A;  4AKZ A;  1VQO 3;  3B8L A;  5IEO A;  1G96 A;  5AIF A;  1Q81 4;  4XM4 A;  5IER A;  1U8C B;  3A76 A;  1ROA A;  2OWP A;  4HVN A;  5IF6 A;  1K73 4;  3FH1 A;  3SX1 A;  1IK3 A;  3F8H A;  3X3X A;  1AVK A;  1LNH A;  3HX8 A;  3DUK A;  1AVL A;  3HZP A;  4R9L A;  3SOY A;  3HIG A;  1JKG B;  6STD A;  3CCS 3;  1JB2 A;  1ULI B;  3G16 A;  4K1U A;  3CCJ 3;  1VQK 3;  1OPY A;  4FMB A;  2A15 A;  3DGO A;  2QEX 3;  1VQ5 3;  3BB9 A;  1D6Y A;  3DGL A;  1E3R A;  2P05 A;  5AIH A;  2CWU A;  2STD A;  2W2C A;  1YGE A;  2K54 A;  2RGQ A;  3GZR A;  4HM6 B;  1WMO A;  4FMD A;  1SJW A;  3OX9 A;  5AII A;  2WGO A;  3WOF B;  1VQ6 3;  3U1W A;  1IVV A;  4OUQ A;  2W56 A;  1RJO A;  1A67 A;  3KII A;  3PCR A;  2SBL A;  3CCR 3;  2ML6 A;  3EX9 A;  3PXM A;  3Q1C A;  3WMD A;  5ELU A;  2CG1 A;  3T8N A;  1E97 A;  2BT3 A;  3FG1 A;  4BTW A;  2PNC A;  1RN7 A;  1OGZ A;  3MWZ A;  4L8P A;  3AMO A;  1VZZ A;  1Q86 4;  3BNC A;  3FLJ A;  2B24 B;  1UUW B;  1DYU A;  2D1W A;  3EE1 A;  1WTH A;  1JJ2 2;  2I9W A;  3N54 B;  4O3V A;  4HM1 B;  4HZ9 B;  4EC6 A;  4XBY A;  4JF8 A;  3NXJ A;  4WYK A;  1KC8 4;  2BMR B;  5FW5 A;  4EV2 A;  4XB5 A;  1GYB A;  3NX0 A;  1OGX A;  1PFP A;  2GBX B;  1SII A;  3FF0 A;  4X2O A;  2B1X B;  4H61 A;  3OXA A;  1FGT A;  3X42 A;  2QA4 3;  4O02 B;  1KWI A;  3CXC 2;  3FGY A;  1JB4 A;  3BLZ A;  2GXF A;  1NDO B;  1W2B 2;  2XSH B;  4ZM8 A;  3WOD G;  1FGQ A;  1M9G A;  3S67 A;  1KSI A;  3KN4 A;  4ORL A;  1GS3 A;  4RNZ A;  3VF1 A;  4HM4 B;  3CCV 3;  1QVF 2;  1IV9 A;  1T5Y A;  5CK6 A;  5IG5 A;  5IW9 A;  3RDE A;  3S28 A;  3GWR A;  4N6V 0;  4XBT A;  3LTC A;  1N8R 4;  5DRV A;  1JB5 A;  3UL5 A;  2F99 A;  3G6E 3;  1STD A;  2E2U A;  3JUP A;  4HM3 B;  1JN5 A;  1EQK A;  2OTL 3;  2GU3 A;  5D83 A;  3NQY A;  3DGM A;  5G2G A;  4STD A;  2INX A;  1EA2 A;  3VSY A;  5AEU B;  4KVH A;  4LSO A;  1FA3 A;  1W7C A;  3EN1 B;  1IDP A;  3DZL A;  3IPT A;  4X2H A;  3AMO B;  3K9M C;  2ZDJ A;  3OWS A;  3DXO A;  1W4N A;  5AIG A;  3F8X A;  4AEQ A;  1MOL A;  4AKY A;  4IT7 A;  1GD4 A;  3X40 A;  2XGL A;  5KP4 A;  4KFD A;  1IQY A;  1CYU A;  5EVH A;  2WO0 A;  3WOE B;  3MHE A;  4WYK B;  1KD1 4;  2OOV C;  2KRT A;  1IT8 A;  3K5T A;  2Y73 A;  3DY5 A;  3S27 A;  2M7O A;  1Y4K A;  3F7S A;  3LZA A;  2BO9 B;  3EJV A;  2GEX A;  3KE7 A;  1Q7Y 4;  1SQW A;  3EF8 A;  3MG3 A;  4N6U A;  3NBJ A;  3CC4 3;  1HKX A;  4FMC A;  1BUQ A;  1N5H A;  5KP3 A;  4KZ1 A;  1NB5 I;  2CKF B;  5IEP A;  5LC6 A;  1OHO A;  5DRE A;  3FZW A;  3V99 A;  2XFT A;  1NJI 4;  4FMA A;  3I56 3;  1QJG A;  1N8Q A;  3FG3 A;  3HII A;  3NBR A;  2OQE C;  1NU3 A;  1YHQ 3;  1O7M B;  1W6Y A;  4FCZ A;  4GB5 A;  3VGN A;  3PS8 A;  1JN5 B;  5CXO A;  2XFS A;  3K63 A;  1PU4 A;  1DMM A;  3JUO A;  3I0Y A;  3IMA B;  1YIJ 3;  1MNL A;  4TX4 A;  1VQ9 3;  1JNQ A;  1K9M 4;  5AEW B;  1N9J A;  1Q40 A;  4LEH A;  1GY5 A;  2JQ5 A;  2Z77 A;  2O9U X;  1CYV A;  3WA2 X;  3NBB A;  1ROV A;  5BVB A;  5LC7 A;  5HGR A;  1AR0 A;  5D81 A;  2BNG A;  2XH9 A;  3CPW 2;  4WP5 A;  1N9E A;  2IA7 A;  2XGN A;  4MMY B;  4RBN A;  3N9H A;  1UUV B;  5IG0 A;  3F40 A;  3OWY A;  2GU1 A;  2K0M A;  2OTJ 3;  3F7X A;  4GL6 A;  1QAK A;  3CC7 3;  4N6O B;  2KXG A;  5IG3 A;  4HBR A;  4KFF A;  2UX0 A;  2WGQ A;  1QAL A;  4I4K A;  2YFL B;  4QWT A;  3S5C A;  3CCE 3;  1IV7 A;  5ELJ A;  4BTY A;  1WMP A;  3CD6 3;  1TUH A;  3JUQ A;  8CHO A;  1GY6 A;  3MSO A;  4HZB B;  2CW9 A;  1OF5 A;  1HU9 A;  1CEW I;  3NHX A;  2D42 A;  1F8N A;  2L4V A;  2ZL8 A;  1UW1 A;  2W6J H;  1ZO2 A;  4CCV A;  3WDG B;  4J9A A;  2ML5 A;  2QIY A;  2IUJ A;  3SXX A;  1YJ9 3;  4FCJ A;  3EQQ B;  1RKY A;  3GZX B;  4N6M A;  3T0U A;  1VQ7 3;  3CME 3;  1RRH A;  3CNM A;  1JV2 B;  3KSP A;  4N6L A;  1D6Z A;  5BXQ A;  5TGN A;  3CPO A;  2QGU A;  3PGB A;  1DMN A;  3G71 3;  1TFO A;  2C10 A;  3CMA 3;  1M1K 4;  1U5O A;  2Z76 A;  2V1L A;  3F14 A;  3KFQ C;  3KSE D;  3RGR A;  4N6N B;  1W5Z A;  1OH0 A;  3B4P A;  3MPH A;  4HM7 B;  2PZV A;  4NHF A;  4N3V A;  2BMQ B;  4NRE A;  4EYC A;  2W56 B;  1SIH A;  1IT7 A;  1Q40 B;  3LYG A;  1RRL A;  2GEY A;  2P0M A;  2IUK A;  2CWT A;  3T8U A;  2CWV A;  3ER7 A;  3KKG A;  1LOX A;  4K61 A;  5CF2 A;  3J7Y d;  2MF7 A;  3BNE A;  4R1K A;  3CNX A;  1R4C A;  1DVD A;  3EBY A;  5IEN A;  1JKG A;  2XRX B;  5CF1 A;  3X3Y A;  1FUW A;  2P0X A;  5KP1 A;  4EBG A;  4L8O A;  1IU7 A;  1S5A A;  1TP6 A;  1A90 A;  4IPB A;  1O7H B;  2HMJ B;  4HYZ A;  2CIU A;  3SLU A;  4MEI A;  1IQ8 A;  3CCL 3;  2W03 A;  5AI1 A;  3V98 A;  1OF5 B;  3GZB A;  1VQM 3;  4EXR A;  3LML A;  3B4O A;  5AYR B;  4R4K A;  4RZM A;  5JPP A;  1UI8 A;  2CG0 A;  1IVU A;  4BTX A;  3WA3 A;  2W9Q A;  1EKM A;  2XSO B;  3UB1 A;  1M90 4;  1Q42 A;  5JBS A;  3JUN A;  1YVB I;  2WOF A;  1IQX A;  1W02 A;  2HMM B;  1O7G B;  1VQ4 3;  1WMN A;  3X41 A;  1CQS A;  3OWU A;  2YX9 A;  3LT8 A;  2OCT A;  1FGO A;  3LOY A;  1VQ8 3;  2FXT A;  2Z7A A;  4MMX B;  3N8B A;  3MG1 A;  2Y74 A;  2LYX A;  4R80 A;  3X3Z A;  3GZY B;  2P38 A;  3DMC A;  1VQP 3;  1Q82 4;  5A0O B;  3EC9 A;  3QRD A;  3NQZ A;  3L0R A;  4HM5 B;  1TIJ A;  1US1 A;  3BNB A;  4Q53 A;  3TDG A;  2Z6B A;  3QK9 A;  1K8A 4;  2BMO B;  2MC8 A;  1A2K A;  5EQL A;  1W2Z A;  2FGT A;  4U13 A;  1YJN 3;  1W6C A;  3EHC A;  4G1M B;  4XDV A;  4L7K A;  2CFK A;  4WHA A;  5D82 A;  1EG9 B;  3GRD A;  4HKV B;  4LGQ A;  4O8S A;  5EEO A;  3CCQ 3;  1DMQ A;  4XBX A;  2YFI B;  3PZW A;  3Q2P A;  3E99 A;  3SED A;  1K41 A;  1K28 A;  2HMN B;  3UL6 A;  3CCU 3;  1NWW A;  2HMK B;  3LT9 A;  3G8Z A;  2P09 A;  4WWU C;  5JPU A;  1KQS 2;  4R9K A;  3FKA A;  3CCM 3;  2HMO B;  2F98 A;  1Z1S A;  3M8C A;  1LVN A;  1W00 A;  1O7N B;  3H3H A;  4OVM A;  3DM8 A;  4LZI A;  3V92 A;  2XR8 B;  3CU3 A;  1UI7 A;  4LMI A;  4HM8 B;  1NO3 A;  2E2V A;  1ASK A;  5STD A;  3UJM A;  4J8T A;  3JUM A;  3OV4 A;  2KCD A;  3NM7 A;  1AV4 A;  1IVW A;  1WQL B;  2E2T A;  4CDL A;  3Q90 A;  3D3L A;  3K0Z A;  3NV0 A;  2JDI H;  3LTA A;  1FGM A;  3G4S 3;  3DGN A;  3D9R A;  3FSD A;  2CFL A;  3ROB A;  1OHP A;  2W04 A;  3EN8 A;  4K90 B;  1NB3 I;  1DVC A;  4JRF A;  3STD A;  1YI2 3;  1QVG 2;  3MG2 A;  3B7C A;  3OW2 2;  2CK3 H;  4H3U A;  4WFO A;  1TU5 A;  3IJE B;  3NUV A;  3UNL A;  1FGR A;  2FNQ A;  3NM2 A;  2Q07 A;  3LH4 A;  1YIT 3;  2W9P A;  4OK0 A;  1N5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...