3H51A

Crystal structure of putative calcium/calmodulin dependent protein kinase ii association domain (np_636218.1) from xanthomonas campestris at 1.70 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GVMHYTDKAALPADGEAREVAALFDTWNAALATGNPHKVADLYAPDGVLLPTVSNEVRASREQIENYFEMFLTKKPKGVINYRTVRLLDDDSAVDAGVYTFTLTDKNGKKSDVQARYTFVYEKRDGKWLIINHHSSAMPEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative calcium/calmodulin dependent protein kinase II association domain (NP_636218.1) from XANTHOMONAS CAMPESTRIS at 1.70 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Protein binding
molecule keywords Putative calcium/calmodulin dependent protein kinase II asso
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h51A00
2GEYA 1K41A 2GBWB 4K1UA 2XSHB 2XRXB 4HM5B 1CQSA 1EA2A 2Z77A 3KKGA 1O7GB 5STDA 3VGNA 3GWRA 1OGZA 1NU3A 1O7WB 4IIAA 4R9KA 2K54A 4XM4A 2I9WA 3Q90A 4R9LA 5AI1A 4WYKB 3NM2A 5IEOA 3T8NA 4X2OA 4RZMA 4HM6B 4U13A 1JB2A 4LMIA 2Z7AA 3B8LA 1U5OA 3D9RA 3KZTA 3NXJA 1OH0A 3KSPA 4R1KA 4WWUC 3WMDA 1C7HA 3F40A 5BVBA 5D82A 1OF5B 3DUKA 3H3HA 4I4KA 6STDA 3MG3A 3B4PA 1DMQA 1NDOB 3DZLA 4HKVB 3EC9A 4XDVA 3DM8A 3HX8A 3OX9A 5AIHA 2HMKB 3EN8A 5FW5A 1DMNA 1Z1SA 2CKFB 1A2KA 2W2CA 4ORLA 3T8UA 2F86B 1JKGA 2RCDA 3GZRA 5JPPA 3NV0A 5TGNA 4FCMA 3FKAA 4K1VA 3F7XA 3FF2A 4HM8B 5AIGA 3ROBA 2QGUA 4HM7B 3FH1A 1BUQA 2YFIB 3NUVA 5CF1A 1ZX2A 3MKIA 5CK6A 3EHCA 3NHXA 3EBYA 5AEUB 3OXAA 3NBRA 3JUNA 1Q40A 3CNMA 3EQQB 2HMOB 1E3RA 2BMOB 2XR8B 1JB5A 1E97A 3RGAA 2GXFA 3E99A 5AIFA 5KP4A 3RGRA 1AR0A 3EF8A 1GY6A 1Q42A 1S5AA 2YFLB 3FF0A 4HJLB 4HVNA 4J9AA 4Q53A 5CLKA 3B7CA 5IG0A 5IG3A 3F14A 3HK4A 4XDWA 5IERA 2PZVA 1O7HB 5KP3A 2YFJB 5G2GA 3CNXA 2GEXA 2BNGA 4X2HA 4PEJA 1ISKA 2GBXB 5HGRA 3VSYA 2Z76A 1VZZA 3F8HA 4WP5A 1IDPA 1O7NB 3JUMA 1O7MB 4HM1B 3EN1B 4MJDA 3JUQA 3BB9A 5IG4A 3GZXB 4HM0B 1JN5B 3M8CA 1JN5A 1Q40B 1ULJB 3FSDA 4LGQA 3G16A 5JPUA 3SOAA 3DMCA 4OUQA 3MSOA 2A15A 1OHOA 2HMNB 3SEDA 1STDA 1ULIB 1GS3A 2OWPA 3OWYA 4HM4B 2UX0A 2F98A 3G8ZA 3IPTA 1JB4A 1DMMA 1OPYA 1NWWA 2JQ5A 1ZO2A 1GY5A 3CU3A 3LYGA 4XBXA 5EVHA 3FZWA 5KP1A 5DRVA 5D83A 1GY7A 1OHSA 4L7KA 4HZBB 3STDA 4CDLA 3KE7A 1OGXA 2HMJB 1EG9B 1SJWA 1ASKA 2QIYA 3MYTA 3EX9A 3UNLA 5D81A 3MG1A 4J8TA 4OVMA 3NV0B 3GZYB 3F9SA 3G0KA 4L8PA 2HMMB 3MG2A 3FLJA 4HM3B 4XBYA 2BMRB 3F7SA 3K7CA 5AEWB 3HZPA 1O7PB 4HM2B 8CHOA 1W01A 3JUOA 5CF2A 5BXQA 2BMQB 1UUVB 2RGQA 1OCVA 3F8XA 2B1XB 3BLZA 5CXOA 1TP6A 2HMLB 3H51A 5IENA 4LEHA 2INXA 1WQLB 3JUPA 1W00A 1HKXA 1OUNA 1JKGB 1QJGA 2XSOB 1E3VA 2R4IA 7STDA 5IG5A 3S5CA 3MHEA 4FCJA 1UUWB 5AIIA 4WYKA 3UJMA 2F99A 3A76A 3OWUA 1OHPA 3CPOA 4GB5A 3SOYA 3K0ZA 2CHCA 3FGYA 5IEPA 3ECFA 4HZ9B 1QMAA 3B4OA 1OF5A 4KVHA 1W6YA 4XB5A 3OV4A 1GYBA 4N3VA 3DXOA 3OWSA 5IF6A 3EBTA 1TUHA 2B24B 3GZBA 2RFRA 3LZAA 4H3UA 4L8OA 4STDA 3EJVA 3ER7A 5DREA 1W02A 3I0YA 4XBTA 2IMJA 3GRDA 2STDA
chains in the Genus database with same CATH superfamily
1IQXA 2GEYA 1VQP3 2XSHB 3LTDA 1VQL3 4IT7A 3KKGA 1M9GA 4IIAA 4R9KA 2CFDA 5AI1A 3VGNA 3X42A 2I9WA 3WA2X 4OK0A 4WYKB 5IEOA 2OTJ3 1BVIA 2QEX3 1RHLA 3B8LA 1U5OA 1HU9A 5BVBA 1RMSA 1N5HA 1RCKA 5D82A 4LYLB 1QAKA 3H3HA 2K3DA 4XDVA 1NDOB 1IVUA 5AYSC 3DM8A 3OX9A 5FW5A 1LQGC 2CKFB 1T2IA 2W2CA 1RNTA 1PU4A 3T8UA 2RCDA 1CEWI 3NV0A 1WNHA 5JPUA 1AY7A 2L1SA 3F7XA 1YJW3 1NNVA 3MWZA 3NUVA 2O9UX 1TRPA 3CCR3 1NO3A 3OXAA 2KAAA 3NQZA 2F4YA 5ELUA 1WMPA 4N6MA 4CJNA 1B2ZA 3LH4A 2GXFA 4J5GA 3EF8A 1IQ8A 1A2PA 1TTOA 1S5AA 4Q53A 3BIRA 3FF0A 1J2BA 1IV7A 3B7CA 5IG0A 3HK4A 3Q1CA 2XFTA 3BU4A 3CNXA 1T5YA 1B2UA 2GEXA 2HOHA 3K9MC 1VQ53 3UL6A 2ML5A 3RDEA 2Z76A 1O7NB 1IT7A 4EC6A 1EUIC 1O7MB 1SARA 2P0MA 1W7CA 1UGIA 2KXGA 4HM1B 3UB1A 7RNTA 2P0XA 1G96A 1S723 9RNTA 1JN5A 1Q40B 4LZIA 3FCSB 1QALA 3G16A 3DMCA 2UUGC 1ROVA 1A2VA 1GMRA 1BAOA 1FYSA 2W9QA 3SEDA 1W2ZA 2Q07A 2OWPA 1X1YA 4ORLA 4CDLA 1KWIA 2F98A 4KFFA 3LYGA 1I2FA 3PZWA 1JZDA 1SQWA 1SIIA 3FZWA 1RN4A 2C4BA 5DRVA 5D83A 1TIJA 1JZOA 3S29A 3V99A 4N6V0 4HZBB 3NX0A 1Q7Y4 2FNQA 1ASKA 3BNBA 1BANA 1FGMA 3MYTA 3LT9A 3HIGA 2E2VA 1B27A 3GZYB 2CG0A 3LOYA 3G0KA 3NV0B 2HMMB 1RGKA 3FLJA 4JF8A 4L8PA 1JRQA 3F7SA 4XBYA 5FGOA 8CHOA 1TU5A 3QRDA 4BTYA 1YGEA 2BU4A 1I0VA 1HYFA 1FGTA 1RRLA 2HMLB 5IENA 2J8XB 2P38A 1KC84 2INXA 1SPUA 3Q2PA 5JBSA 1G0TA 1IVWA 3K5TA 1GSPA 3MHEA 4IPBA 5IW9A 1FUSA 4WYKA 1RJOA 2XF3A 3DGOA 3DGYA 3LT8A 3OWUA 2W56B 3GSPA 4HZ9B 5HOHA 1LRAA 3B4OA 4XB5A 1A67A 1RNBA 3OWSA 5IF6A 1K28A 1YNVX 1W02A 3CXC2 1LOVA 3CCS3 3IPTA 3GRDA 4O3VA 1K41A 2GBWB 3EB8A 2CWVA 4TX4A 4WFOA 1LNIA 2RNTA 4EYCA 1B2XA 1EA2A 5M1AA 5BU4A 3S27A 2YX9A 1BRIA 1BRGA 3A5EA 3GAXA 4R4KA 1MWTA 1IQYA 4HOHA 1JB2A 4MEIA 4CPKA 1M1K4 1V57A 3D9RA 3DGMA 1BNSA 4GSPA 1OH0A 4WWUC 1QVF2 3F40A 1OF5B 3DUKA 3MG3A 3B4PA 1GMPA 3N54B 4FMCA 4HKVB 3EC9A 5AIHA 3HX8A 3X40A 4BTXA 3I553 1Q824 1IK3A 1Z1SA 4N6OB 1TJDA 3VF1A 2CC3A 3CCE3 2CK3H 3FKAA 3ZG5A 1MWUA 3ROBA 2QGUA 3FH1A 1IVVA 3AGOA 2YFIB 5CF1A 1L5GB 5CK6A 3NHXA 5AEUB 4K61A 1RN7A 2JDIH 1MWSA 1Q40A 3CNMA 1BGSA 2MF7A 3EQQB 2HMOB 3AHSA 2BMOB 2BO9B 3RGAA 1E97A 3UL5A 1RSNA 1YVBI 3G6E3 1AV4A 3D79A 3PCRA 4RNZA 4HJLB 5CLKA 4HYZA 1B2MA 5EQLA 3G713 1UDII 1O7HB 4BL3A 3PXMA 1QVG2 2WOFA 1JBTA 1FUWA 1T2HA 2GBXB 4N6UA 1B2SA 4KT3B 3CC73 4BU4A 3EN1B 4MJDA 5M18A 5EVHA 1BNIA 4RNTA 3WR2A 3KIIA 8RNTA 3G4S3 3NBBA 1DE3A 1GOVA 3AGNA 4BL2A 2H0IA 2Z6BA 3FSDA 3M8CA 2LYXA 1M1XB 1BSBA 1STDA 1ULIB 2CW9A 2KF5A 3D3LA 2M7OA 5IERA 1VQQA 3AMOA 1MGRA 3L0RA 2IUJA 2ZL8A 4MMXB 1YI23 4KFEA 1I2EA 3SX1A 2R41A 1VQM3 2OQEC 1OGXA 1EG9B 2QIYA 3FG1A 3ZG0A 3EX9A 3UNLA 2CH9A 5D81A 4J8TA 4OVMA 1YJ93 1YIJ3 1G02A 1KD14 2BMRB 3K7CA 4N6NB 1O7PB 4G1MB 1Q9EA 3Q3FA 4O02B 2L4VA 4WHAA 1TFKA 3WODG 1LVNA 3CCJ3 1I8VA 1T3BA 3F8XA 1R4CA 1D6YA 1TP6A 3D5GA 3H51A 1GOYA 2F5WA 3DGNA 5CXOA 1UCJA 3JUPA 2CX1A 1JKGB 4O2HA 1RLSA 7STDA 1CYUA 1Q7HA 3S5CA 1UUGB 3PCSA 5AIIA 3D5IA 6GSPA 4GB5A 1AVKA 1LXEA 3V92A 3ECFA 4BTWA 4EV5A 1BUJA 1OF5A 1OACA 1BNFA 1Q814 1VQO3 1CYVA 1BSAA 4NREA 1WMNA 4FCZA 1IV9A 2CWUA 3GZBA 3CCM3 3LZAA 2WO0A 4L8OA 2GU1A 4STDA 1RGFA 2RBIA 3I0YA 1AQZA 2E2UA 4XBTA 1BIRA 1MWRA 1NB3I 1DETA 4K90B 4FMBA 3SYUA 2GSPA 3X41A 2ZA4A 1IU7A 2Z77A 3LTAA 5STDA 1OGZA 1NU3A 1RCLA 2C10A 2K54A 4MMYB 4QWTA 3AMOB 3CD63 4X2OA 4RZMA 4U13A 4LMIA 1BNGA 1W5ZA 2IUKA 1RGCA 2ZHXB 3KZTA 3JVCA 3DH2A 3KSPA 4R1KA 3U1WA 1EKMA 2MC8A 3LXUX 2KF3A 1JV2B 3BNDA 6STDA 3DZLA 2OTL3 3KCHA 2HMKB 4FMDA 4J5KA 1C54A 4RBNA 1BRSA 2F86B 1KQS2 3GZRA 1JJ22 5TGNA 1U8CB 2KF6A 1TRQA 4HM8B 3LTBA 4HM7B 4EV2A 2CX0A 1PFPA 1ZX2A 3MKIA 2D42A 1D6UA 1RDSA 1HZ1A 1GD3A 1TFOA 1E3RA 2XR8B 1JB5A 1Y4KA 3ALAA 5AIFA 3RGRA 2W9PA 1GY6A 2YFLB 3RNTA 1GD4A 1JBSA 3F14A 3CCL3 1VQ63 4HAAA 2YFJB 3DY5A 3X3XA 4H61A 1RGAA 5I97A 2AAEA 5A0OB 1BOXA 4PEJA 2IY2A 2W0QA 1Q864 2P05A 2C11A 5HGRA 1UI8A 3VSYA 1IDPA 2W6JH 2KF4A 1QAFA 2WGQA 1BNJA 3BB9A 1K734 1M904 2XGNA 2E2TA 5AYRB 3GZXB 4HM0B 2CIUA 1VQN3 1BSCA 1JN5B 2W04A 4MMZB 1PY3A 1X1UA 2D1WA 1ULJB 1K8A4 4N6LA 4LGQA 2H0GA 4RNYA 1YVSA 2CWTA 4OUQA 3SOAA 1W4NA 2A15A 3MSOA 3SLUA 4AKYA 2UX0A 2V1LA 3G8ZA 1W6GA 1OPYA 1JB4A 1NWWA 2JQ5A 1ZO2A 1B21A 1GY5A 1D6ZA 1LNHA 2BHMA 2O3OA 2W56A 3CU3A 4EBGA 4GHOA 5M19A 1N9EA 1OHSA 1I70A 3OW22 2BT3A 2WGOA 3KN4A 2XEPA 3U97A 1AVLA 2XFSA 1UCLA 2Y73A 3MG1A 1STFI 3PGBA 2BIRA 4R80A 5LC7A 4HM3B 3MG2A 1VQ83 1GMQA 3HZPA 4I5QA 1VQ93 3JUOA 4EW5A 1B3SA 5BXQA 3KSED 1GOUA 5BIRA 3X3YA 2BMQB 1UUVB 1ZS7A 1LOYA 4FMAA 4EXRA 2B1XB 1N9JA 2KCDA 4LEHA 2SARA 1W00A 1HKXA 1OUNA 2K0MA 1QJGA 3CC43 5IG5A 1E3VA 1X1XA 2CFKA 4FCJA 3CCU3 2RSXA 2F99A 3A76A 1NJI4 2FGTA 3K0ZA 2CHCA 4FR9A 3WHOA 3X3ZA 4AKZA 5IEPA 2ZDJA 1QMAA 3BNEA 1V58A 5GSPA 1IYYA 1UCKA 3OV4A 4LSOA 3DXOA 3AHWA 3EBTA 1TUHA 2B24B 1RGGA 3ER7A 5RNTA 2IMJA 4KFDA 2STDA 2IYJA 5G2GA 1BNEA 4K1UA 4HM5B 2XRXB 1BRJA 1CQSA 3HOHA 3NQYA 3NBJA 3PYJA 1FA3A 1O7GB 3GWRA 1YIT3 1X1WA 1O7WB 4XM4A 2LQVA 4R9LA 3Q90A 1RKYA 3NM2A 3T8NA 1RGEA 2FXTA 2ML6A 1FW7A 2F56A 4HM6B 1UGHI 5G1LA 3CCQ3 1W2B2 2Z7AA 3NXJA 1MOLA 2H0HA 6RNTA 2SBLA 3WMDA 1PYLA 1C7HA 2GU3A 3CCV3 2OCTA 4I4KA 1DVCA 2KRTA 3DGLA 1YJN3 1DMQA 1US1A 3EN8A 1DMNA 4NPBA 1A2KA 1EEJA 1K9M4 7GSPA 1JNQA 5JPPA 1FUTA 1JKGA 3TDGA 3CPW2 4FCMA 4K1VA 1LOXA 3N9HA 3FF2A 5AIGA 1UI7A 1BUQA 3J7Yd 3T0UA 2Y74A 1VQ73 1JBRA 2CG1A 2CFWA 2IA7A 3EBYA 3EHCA 5ELJA 3WDGB 2W03A 3NBRA 5EEOA 3JUNA 1I3IA 2UGIA 1F8NA 4O8SA 1RN1A 3IMAB 3E99A 2PNCA 3CMA3 1AR0A 1ZGXA 4CCVA 4HBRA 1RGLA 1Q42A 2WOHA 3FG4A 3K63A 1MNLA 4HVNA 1FGRA 4J9AA 5IG3A 1YGWA 1FZUA 1WTHA 1LQMB 4XDWA 2PZVA 3PS8A 5KP3A 3I563 4N6TA 1N8QA 3HIIA 2BNGA 4X2HA 1BSDA 2OQEA 1ISKA 3V98A 1NB5I 1VZZA 3F8HA 4WP5A 3JUMA 1I3FA 4ZM8A 3JUQA 2P09A 1R4YA 4GL6A 3ZFZA 1YHQ3 1VQ43 1W6CA 5IG4A 3MPHA 1I2GA 3FG3A 3CC23 3EE1A 1A90A 3WOEB 2CFGA 4ILFA 2CFLA 1OHOA 1WMOA 2HMNB 5G1KA 1MGWA 4HM4B 1GS3A 3OWYA 2XGLA 3QK9A 3S67A 4DKIA 1DMMA 4BIRA 4JRFA 3KFQC 1B20A 3LMLA 1BRHA 1GY7A 4L7KA 4AEQA 2OOVA 1SIHA 3STDA 5LC6A 3KE7A 2HMJB 3N8BA 1N5PA 1UCIA 1SJWA 3LTCA 1BRNL 1IVXA 1BNRA 1CH0A 3URPA 3F9SA 5KP4A 5KP1A 3S28A 5AEWB 3D4AA 1IT8A 1RGHA 1N8R4 1BU4A 4HM2B 1W01A 1BRKA 5CF2A 3WA3A 2RGQA 1OCVA 1VQK3 1EQKA 3BLZA 3O8YA 1DVDA 1WQLB 1FGOA 2XSOB 1V74A 3NM7A 2R4IA 1I0XA 1DYUA 1UUWB 3UJMA 1KSIA 3WOFB 3CME3 1OHPA 3CPOA 3SOYA 4KZ1A 1LOWA 1UW1A 1BSEA 3FGYA 3HI7A 1RTUA 2F5MA 3IJEB 2AADA 4KVHA 3SVAA 1W6YA 2QA43 4N3VA 1GYBA 2RFRA 4H3UA 1FGQA 1RRHA 3BNCA 2XH9A 3EJVA 1ROAA 4NHFA 5DREA 2OOVC 4XBXA 3SXXA
chains in the Genus database with same CATH topology
1IQXA 2GEYA 1VQP3 2XSHB 3LTDA 1VQL3 4IT7A 3KKGA 1M9GA 4IIAA 4R9KA 2CFDA 5AI1A 3VGNA 3X42A 2I9WA 3WA2X 4OK0A 4WYKB 5IEOA 2QEX3 3B8LA 1U5OA 1HU9A 5BVBA 5D82A 1N5HA 1QAKA 3H3HA 4XDVA 1NDOB 1IVUA 5AYSC 3DM8A 3OX9A 5FW5A 2CKFB 1PU4A 2W2CA 3T8UA 2RCDA 1CEWI 3NV0A 1WNHA 3F7XA 1YJW3 3MWZA 3NUVA 2O9UX 3CCR3 1NO3A 3OXAA 3NQZA 1WMPA 4N6MA 3LH4A 2GXFA 3EF8A 1IQ8A 1S5AA 4Q53A 3FF0A 1J2BA 1IV7A 3B7CA 5IG0A 3HK4A 3Q1CA 2XFTA 3CNXA 1T5YA 2GEXA 1VQ53 3K9MC 3UL6A 2ML5A 3RDEA 2Z76A 1O7NB 1IT7A 4EC6A 1O7MB 4HM1B 2P0MA 1W7CA 2KXGA 3UB1A 2P0XA 1G96A 1S723 1JN5A 1Q40B 4LZIA 3FCSB 1QALA 3G16A 3DMCA 1ROVA 1A2VA 2W9QA 3SEDA 1W2ZA 2Q07A 2OWPA 4ORLA 4CDLA 1KWIA 2F98A 4KFFA 3LYGA 3PZWA 1SQWA 1SIIA 3FZWA 3S29A 3V99A 5DRVA 5D83A 1TIJA 3G6E3 4N6V0 4HZBB 3NX0A 1Q7Y4 2FNQA 1ASKA 3BNBA 1FGMA 3MYTA 3LT9A 3HIGA 2E2VA 3GZYB 3LOYA 2CG0A 3NV0B 3G0KA 4JF8A 2HMMB 4L8PA 3FLJA 4XBYA 1VQN3 1JRQA 3F7SA 5FGOA 8CHOA 1TU5A 3QRDA 4BTYA 1YGEA 1FGTA 1RRLA 2HMLB 5IENA 2P38A 1KC84 2INXA 1SPUA 3Q2PA 5JBSA 1IVWA 3K5TA 3MHEA 4IPBA 5IW9A 4WYKA 1RJOA 2XF3A 3DGOA 3OWUA 3LT8A 2W56B 4HZ9B 3B4OA 4XB5A 1A67A 3OWSA 5IF6A 1K28A 1W02A 3CXC2 3CCS3 3IPTA 3GRDA 4O3VA 1K41A 2GBWB 3EB8A 2CWVA 4TX4A 4WFOA 4EYCA 1EA2A 3S27A 2YX9A 3GAXA 4R4KA 1IQYA 1JB2A 4MEIA 1M1K4 3D9RA 3DGMA 1QVF2 1OH0A 4WWUC 3F40A 1OF5B 3DUKA 3MG3A 3B4PA 3N54B 4FMCA 4HKVB 3I553 3EC9A 5AIHA 3HX8A 3X40A 4BTXA 1Q824 1IK3A 1Z1SA 4N6OB 3VF1A 2CC3A 3CCE3 2CK3H 3FKAA 3ROBA 2QGUA 3FH1A 1IVVA 2YFIB 5CF1A 1L5GB 5CK6A 3NHXA 5AEUB 4K61A 1RN7A 2JDIH 1Q40A 3CNMA 2MF7A 3EQQB 2HMOB 2BMOB 2BO9B 3RGAA 1E97A 3UL5A 1YVBI 1AV4A 3PCRA 4RNZA 5CLKA 4HJLB 4HYZA 5EQLA 3G713 1O7HB 3PXMA 1QVG2 2WOFA 1FUWA 2GBXB 4N6UA 3CC73 3EN1B 4MJDA 5EVHA 3KIIA 3G4S3 3NBBA 3M8CA 2Z6BA 3FSDA 2LYXA 1M1XB 3D3LA 1STDA 1ULIB 2CW9A 2M7OA 5IERA 3AMOA 3L0RA 2IUJA 2ZL8A 4MMXB 1YI23 4KFEA 3SX1A 1VQM3 2OQEC 1OGXA 1EG9B 2QIYA 3FG1A 3EX9A 3UNLA 2CH9A 5D81A 4J8TA 4OVMA 1YJ93 1YIJ3 1KD14 2BMRB 3K7CA 4N6NB 1O7PB 4G1MB 4O02B 2L4VA 4WHAA 1TFKA 3WODG 1LVNA 3CCJ3 3F8XA 1R4CA 1D6YA 1TP6A 5CXOA 3H51A 3DGNA 3JUPA 1JKGB 4O2HA 7STDA 1CYUA 3S5CA 3PCSA 5AIIA 4GB5A 1AVKA 1LXEA 3V92A 3ECFA 4BTWA 4EV5A 1OF5A 1OACA 1Q814 1VQO3 1CYVA 4NREA 1WMNA 4FCZA 1IV9A 2CWUA 3GZBA 3CCM3 3LZAA 2WO0A 4L8OA 2GU1A 4STDA 3I0YA 4XBTA 2E2UA 1NB3I 4K90B 4FMBA 3X41A 1IU7A 2Z77A 3LTAA 5STDA 1OGZA 1NU3A 2C10A 2K54A 4MMYB 4QWTA 3AMOB 3CD63 4X2OA 4RZMA 4U13A 4LMIA 1W5ZA 2IUKA 3KZTA 3JVCA 3KSPA 4R1KA 3U1WA 1EKMA 2MC8A 3LXUX 1JV2B 3BNDA 6STDA 3DZLA 2OTL3 2HMKB 4FMDA 4RBNA 2F86B 1KQS2 3GZRA 1JJ22 5TGNA 1U8CB 4HM8B 3LTBA 4HM7B 4EV2A 1PFPA 1ZX2A 3MKIA 2D42A 1D6UA 1GD3A 1TFOA 1E3RA 2XR8B 1JB5A 1Y4KA 3ALAA 5AIFA 3RGRA 2W9PA 1GY6A 2YFLB 1GD4A 3F14A 3CCL3 1VQ63 2YFJB 3DY5A 3X3XA 4H61A 5I97A 5A0OB 4PEJA 2W0QA 1Q864 2P05A 2C11A 5HGRA 1UI8A 3VSYA 1IDPA 2W6JH 2WGQA 1QAFA 3BB9A 1K734 1M904 2XGNA 2E2TA 5AYRB 3GZXB 4HM0B 2CIUA 1JN5B 2W04A 4MMZB 2D1WA 1ULJB 1K8A4 4N6LA 4LGQA 4RNYA 5JPUA 2CWTA 3SOAA 4OUQA 3SLUA 1W4NA 2A15A 3MSOA 4AKYA 2UX0A 2V1LA 3G8ZA 1JB4A 1OPYA 2JQ5A 2W56A 1NWWA 1W6GA 1ZO2A 1GY5A 1LNHA 1D6ZA 2BHMA 2O3OA 3CU3A 4EBGA 1N9EA 1OHSA 3OW22 2BT3A 2WGOA 3KN4A 2XEPA 3U97A 1AVLA 2XFSA 2Y73A 3MG1A 3PGBA 1STFI 4R80A 2OTJ3 5LC7A 4HM3B 3MG2A 1VQ83 3HZPA 1VQ93 3JUOA 5BXQA 3KSED 3X3YA 2BMQB 1UUVB 4FMAA 4EXRA 2B1XB 1N9JA 2KCDA 4LEHA 1W00A 1HKXA 1OUNA 2K0MA 1QJGA 3CC43 5IG5A 1E3VA 2CFKA 4FCJA 3CCU3 2RSXA 2F99A 3A76A 1NJI4 2FGTA 3K0ZA 2CHCA 4FR9A 3X3ZA 4AKZA 5IEPA 2ZDJA 1QMAA 3BNEA 3OV4A 4LSOA 3DXOA 3EBTA 1TUHA 2B24B 3ER7A 2IMJA 4KFDA 2STDA 5G2GA 4K1UA 4HM5B 2XRXB 1CQSA 3NQYA 3NBJA 3PYJA 1FA3A 1O7GB 3GWRA 1YIT3 1O7WB 4XM4A 2LQVA 4R9LA 3Q90A 1RKYA 3NM2A 3T8NA 2FXTA 2ML6A 4HM6B 1W2B2 2Z7AA 3NXJA 1MOLA 2SBLA 3WMDA 2GU3A 1C7HA 3CCV3 2OCTA 4I4KA 1DVCA 2KRTA 3DGLA 1YJN3 1DMQA 1US1A 3EN8A 1DMNA 1A2KA 1K9M4 1JNQA 5JPPA 1JKGA 3TDGA 3CPW2 4FCMA 4K1VA 1LOXA 3N9HA 3FF2A 5AIGA 1UI7A 1BUQA 3J7Yd 3T0UA 2Y74A 1VQ73 2CG1A 2CFWA 2IA7A 3EBYA 3EHCA 5ELJA 3WDGB 2W03A 3NBRA 5EEOA 3JUNA 1F8NA 4O8SA 3IMAB 3E99A 2PNCA 3CMA3 1AR0A 4CCVA 4HBRA 5ELUA 1Q42A 2WOHA 3FG4A 3K63A 1MNLA 4HVNA 1FGRA 4J9AA 5IG3A 1WTHA 4XDWA 2PZVA 3PS8A 5KP3A 3I563 4N6TA 1N8QA 3HIIA 2BNGA 4X2HA 2OQEA 1ISKA 3V98A 1NB5I 1VZZA 3F8HA 4WP5A 3JUMA 4ZM8A 3JUQA 2P09A 4GL6A 1YHQ3 1VQ43 1W6CA 5IG4A 3MPHA 3FG3A 3CC23 3EE1A 1A90A 3WOEB 2CFGA 2CFLA 1OHOA 1WMOA 2HMNB 3CCQ3 4HM4B 1GS3A 3OWYA 2XGLA 3QK9A 3S67A 1DMMA 4JRFA 3KFQC 3LMLA 1GY7A 4L7KA 4AEQA 2OOVA 1SIHA 3STDA 5LC6A 3KE7A 2HMJB 3N8BA 1N5PA 1SJWA 3LTCA 1IVXA 3F9SA 5KP4A 5KP1A 3S28A 5AEWB 1IT8A 1N8R4 4HM2B 1W01A 5CF2A 3WA3A 2RGQA 1OCVA 1VQK3 1EQKA 3BLZA 3O8YA 1DVDA 1WQLB 1FGOA 2XSOB 1V74A 3NM7A 2R4IA 1DYUA 1UUWB 3UJMA 1KSIA 3WOFB 3CME3 1OHPA 3CPOA 3SOYA 4KZ1A 1UW1A 3FGYA 3HI7A 3IJEB 4KVHA 3SVAA 1W6YA 2QA43 4N3VA 1GYBA 2RFRA 4H3UA 1FGQA 1RRHA 3BNCA 2XH9A 3EJVA 1ROAA 4NHFA 5DREA 2OOVC 4XBXA 3SXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GEY A;  1K41 A;  2GBW B;  4K1U A;  2XSH B;  2XRX B;  4HM5 B;  1CQS A;  1EA2 A;  2Z77 A;  3KKG A;  1O7G B;  5STD A;  3VGN A;  3GWR A;  1OGZ A;  1NU3 A;  1O7W B;  4IIA A;  4R9K A;  2K54 A;  4XM4 A;  2I9W A;  3Q90 A;  4R9L A;  5AI1 A;  4WYK B;  3NM2 A;  5IEO A;  3T8N A;  4X2O A;  4RZM A;  4HM6 B;  4U13 A;  1JB2 A;  4LMI A;  2Z7A A;  3B8L A;  1U5O A;  3D9R A;  3KZT A;  3NXJ A;  1OH0 A;  3KSP A;  4R1K A;  4WWU C;  3WMD A;  1C7H A;  3F40 A;  5BVB A;  5D82 A;  1OF5 B;  3DUK A;  3H3H A;  4I4K A;  6STD A;  3MG3 A;  3B4P A;  1DMQ A;  1NDO B;  3DZL A;  4HKV B;  3EC9 A;  4XDV A;  3DM8 A;  3HX8 A;  3OX9 A;  5AIH A;  2HMK B;  3EN8 A;  5FW5 A;  1DMN A;  1Z1S A;  2CKF B;  1A2K A;  2W2C A;  4ORL A;  3T8U A;  2F86 B;  1JKG A;  2RCD A;  3GZR A;  5JPP A;  3NV0 A;  5TGN A;  4FCM A;  3FKA A;  4K1V A;  3F7X A;  3FF2 A;  4HM8 B;  5AIG A;  3ROB A;  2QGU A;  4HM7 B;  3FH1 A;  1BUQ A;  2YFI B;  3NUV A;  5CF1 A;  1ZX2 A;  3MKI A;  5CK6 A;  3EHC A;  3NHX A;  3EBY A;  5AEU B;  3OXA A;  3NBR A;  3JUN A;  1Q40 A;  3CNM A;  3EQQ B;  2HMO B;  1E3R A;  2BMO B;  2XR8 B;  1JB5 A;  1E97 A;  3RGA A;  2GXF A;  3E99 A;  5AIF A;  5KP4 A;  3RGR A;  1AR0 A;  3EF8 A;  1GY6 A;  1Q42 A;  1S5A A;  2YFL B;  3FF0 A;  4HJL B;  4HVN A;  4J9A A;  4Q53 A;  5CLK A;  3B7C A;  5IG0 A;  5IG3 A;  3F14 A;  3HK4 A;  4XDW A;  5IER A;  2PZV A;  1O7H B;  5KP3 A;  2YFJ B;  5G2G A;  3CNX A;  2GEX A;  2BNG A;  4X2H A;  4PEJ A;  1ISK A;  2GBX B;  5HGR A;  3VSY A;  2Z76 A;  1VZZ A;  3F8H A;  4WP5 A;  1IDP A;  1O7N B;  3JUM A;  1O7M B;  4HM1 B;  3EN1 B;  4MJD A;  3JUQ A;  3BB9 A;  5IG4 A;  3GZX B;  4HM0 B;  1JN5 B;  3M8C A;  1JN5 A;  1Q40 B;  1ULJ B;  3FSD A;  4LGQ A;  3G16 A;  5JPU A;  3SOA A;  3DMC A;  4OUQ A;  3MSO A;  2A15 A;  1OHO A;  2HMN B;  3SED A;  1STD A;  1ULI B;  1GS3 A;  2OWP A;  3OWY A;  4HM4 B;  2UX0 A;  2F98 A;  3G8Z A;  3IPT A;  1JB4 A;  1DMM A;  1OPY A;  1NWW A;  2JQ5 A;  1ZO2 A;  1GY5 A;  3CU3 A;  3LYG A;  4XBX A;  5EVH A;  3FZW A;  5KP1 A;  5DRV A;  5D83 A;  1GY7 A;  1OHS A;  4L7K A;  4HZB B;  3STD A;  4CDL A;  3KE7 A;  1OGX A;  2HMJ B;  1EG9 B;  1SJW A;  1ASK A;  2QIY A;  3MYT A;  3EX9 A;  3UNL A;  5D81 A;  3MG1 A;  4J8T A;  4OVM A;  3NV0 B;  3GZY B;  3F9S A;  3G0K A;  4L8P A;  2HMM B;  3MG2 A;  3FLJ A;  4HM3 B;  4XBY A;  2BMR B;  3F7S A;  3K7C A;  5AEW B;  3HZP A;  1O7P B;  4HM2 B;  8CHO A;  1W01 A;  3JUO A;  5CF2 A;  5BXQ A;  2BMQ B;  1UUV B;  2RGQ A;  1OCV A;  3F8X A;  2B1X B;  3BLZ A;  5CXO A;  1TP6 A;  2HML B;  3H51 A;  5IEN A;  4LEH A;  2INX A;  1WQL B;  3JUP A;  1W00 A;  1HKX A;  1OUN A;  1JKG B;  1QJG A;  2XSO B;  1E3V A;  2R4I A;  7STD A;  5IG5 A;  3S5C A;  3MHE A;  4FCJ A;  1UUW B;  5AII A;  4WYK A;  3UJM A;  2F99 A;  3A76 A;  3OWU A;  1OHP A;  3CPO A;  4GB5 A;  3SOY A;  3K0Z A;  2CHC A;  3FGY A;  5IEP A;  3ECF A;  4HZ9 B;  1QMA A;  3B4O A;  1OF5 A;  4KVH A;  1W6Y A;  4XB5 A;  3OV4 A;  1GYB A;  4N3V A;  3DXO A;  3OWS A;  5IF6 A;  3EBT A;  1TUH A;  2B24 B;  3GZB A;  2RFR A;  3LZA A;  4H3U A;  4L8O A;  4STD A;  3EJV A;  3ER7 A;  5DRE A;  1W02 A;  3I0Y A;  4XBT A;  2IMJ A;  3GRD A;  2STD A; 
#chains in the Genus database with same CATH topology
 1IQX A;  2GEY A;  1VQP 3;  2XSH B;  3LTD A;  1VQL 3;  4IT7 A;  3KKG A;  1M9G A;  4IIA A;  4R9K A;  2CFD A;  5AI1 A;  3VGN A;  3X42 A;  2I9W A;  3WA2 X;  4OK0 A;  4WYK B;  5IEO A;  2OTJ 3;  1BVI A;  2QEX 3;  1RHL A;  3B8L A;  1U5O A;  1HU9 A;  5BVB A;  1RMS A;  1N5H A;  1RCK A;  5D82 A;  4LYL B;  1QAK A;  3H3H A;  2K3D A;  4XDV A;  1NDO B;  1IVU A;  5AYS C;  3DM8 A;  3OX9 A;  5FW5 A;  1LQG C;  2CKF B;  1T2I A;  2W2C A;  1RNT A;  1PU4 A;  3T8U A;  2RCD A;  1CEW I;  3NV0 A;  1WNH A;  5JPU A;  1AY7 A;  2L1S A;  3F7X A;  1YJW 3;  1NNV A;  3MWZ A;  3NUV A;  2O9U X;  1TRP A;  3CCR 3;  1NO3 A;  3OXA A;  2KAA A;  3NQZ A;  2F4Y A;  5ELU A;  1WMP A;  4N6M A;  4CJN A;  1B2Z A;  3LH4 A;  2GXF A;  4J5G A;  3EF8 A;  1IQ8 A;  1A2P A;  1TTO A;  1S5A A;  4Q53 A;  3BIR A;  3FF0 A;  1J2B A;  1IV7 A;  3B7C A;  5IG0 A;  3HK4 A;  3Q1C A;  2XFT A;  3BU4 A;  3CNX A;  1T5Y A;  1B2U A;  2GEX A;  2HOH A;  3K9M C;  1VQ5 3;  3UL6 A;  2ML5 A;  3RDE A;  2Z76 A;  1O7N B;  1IT7 A;  4EC6 A;  1EUI C;  1O7M B;  1SAR A;  2P0M A;  1W7C A;  1UGI A;  2KXG A;  4HM1 B;  3UB1 A;  7RNT A;  2P0X A;  1G96 A;  1S72 3;  9RNT A;  1JN5 A;  1Q40 B;  4LZI A;  3FCS B;  1QAL A;  3G16 A;  3DMC A;  2UUG C;  1ROV A;  1A2V A;  1GMR A;  1BAO A;  1FYS A;  2W9Q A;  3SED A;  1W2Z A;  2Q07 A;  2OWP A;  1X1Y A;  4ORL A;  4CDL A;  1KWI A;  2F98 A;  4KFF A;  3LYG A;  1I2F A;  3PZW A;  1JZD A;  1SQW A;  1SII A;  3FZW A;  1RN4 A;  2C4B A;  5DRV A;  5D83 A;  1TIJ A;  1JZO A;  3S29 A;  3V99 A;  4N6V 0;  4HZB B;  3NX0 A;  1Q7Y 4;  2FNQ A;  1ASK A;  3BNB A;  1BAN A;  1FGM A;  3MYT A;  3LT9 A;  3HIG A;  2E2V A;  1B27 A;  3GZY B;  2CG0 A;  3LOY A;  3G0K A;  3NV0 B;  2HMM B;  1RGK A;  3FLJ A;  4JF8 A;  4L8P A;  1JRQ A;  3F7S A;  4XBY A;  5FGO A;  8CHO A;  1TU5 A;  3QRD A;  4BTY A;  1YGE A;  2BU4 A;  1I0V A;  1HYF A;  1FGT A;  1RRL A;  2HML B;  5IEN A;  2J8X B;  2P38 A;  1KC8 4;  2INX A;  1SPU A;  3Q2P A;  5JBS A;  1G0T A;  1IVW A;  3K5T A;  1GSP A;  3MHE A;  4IPB A;  5IW9 A;  1FUS A;  4WYK A;  1RJO A;  2XF3 A;  3DGO A;  3DGY A;  3LT8 A;  3OWU A;  2W56 B;  3GSP A;  4HZ9 B;  5HOH A;  1LRA A;  3B4O A;  4XB5 A;  1A67 A;  1RNB A;  3OWS A;  5IF6 A;  1K28 A;  1YNV X;  1W02 A;  3CXC 2;  1LOV A;  3CCS 3;  3IPT A;  3GRD A;  4O3V A;  1K41 A;  2GBW B;  3EB8 A;  2CWV A;  4TX4 A;  4WFO A;  1LNI A;  2RNT A;  4EYC A;  1B2X A;  1EA2 A;  5M1A A;  5BU4 A;  3S27 A;  2YX9 A;  1BRI A;  1BRG A;  3A5E A;  3GAX A;  4R4K A;  1MWT A;  1IQY A;  4HOH A;  1JB2 A;  4MEI A;  4CPK A;  1M1K 4;  1V57 A;  3D9R A;  3DGM A;  1BNS A;  4GSP A;  1OH0 A;  4WWU C;  1QVF 2;  3F40 A;  1OF5 B;  3DUK A;  3MG3 A;  3B4P A;  1GMP A;  3N54 B;  4FMC A;  4HKV B;  3EC9 A;  5AIH A;  3HX8 A;  3X40 A;  4BTX A;  3I55 3;  1Q82 4;  1IK3 A;  1Z1S A;  4N6O B;  1TJD A;  3VF1 A;  2CC3 A;  3CCE 3;  2CK3 H;  3FKA A;  3ZG5 A;  1MWU A;  3ROB A;  2QGU A;  3FH1 A;  1IVV A;  3AGO A;  2YFI B;  5CF1 A;  1L5G B;  5CK6 A;  3NHX A;  5AEU B;  4K61 A;  1RN7 A;  2JDI H;  1MWS A;  1Q40 A;  3CNM A;  1BGS A;  2MF7 A;  3EQQ B;  2HMO B;  3AHS A;  2BMO B;  2BO9 B;  3RGA A;  1E97 A;  3UL5 A;  1RSN A;  1YVB I;  3G6E 3;  1AV4 A;  3D79 A;  3PCR A;  4RNZ A;  4HJL B;  5CLK A;  4HYZ A;  1B2M A;  5EQL A;  3G71 3;  1UDI I;  1O7H B;  4BL3 A;  3PXM A;  1QVG 2;  2WOF A;  1JBT A;  1FUW A;  1T2H A;  2GBX B;  4N6U A;  1B2S A;  4KT3 B;  3CC7 3;  4BU4 A;  3EN1 B;  4MJD A;  5M18 A;  5EVH A;  1BNI A;  4RNT A;  3WR2 A;  3KII A;  8RNT A;  3G4S 3;  3NBB A;  1DE3 A;  1GOV A;  3AGN A;  4BL2 A;  2H0I A;  2Z6B A;  3FSD A;  3M8C A;  2LYX A;  1M1X B;  1BSB A;  1STD A;  1ULI B;  2CW9 A;  2KF5 A;  3D3L A;  2M7O A;  5IER A;  1VQQ A;  3AMO A;  1MGR A;  3L0R A;  2IUJ A;  2ZL8 A;  4MMX B;  1YI2 3;  4KFE A;  1I2E A;  3SX1 A;  2R41 A;  1VQM 3;  2OQE C;  1OGX A;  1EG9 B;  2QIY A;  3FG1 A;  3ZG0 A;  3EX9 A;  3UNL A;  2CH9 A;  5D81 A;  4J8T A;  4OVM A;  1YJ9 3;  1YIJ 3;  1G02 A;  1KD1 4;  2BMR B;  3K7C A;  4N6N B;  1O7P B;  4G1M B;  1Q9E A;  3Q3F A;  4O02 B;  2L4V A;  4WHA A;  1TFK A;  3WOD G;  1LVN A;  3CCJ 3;  1I8V A;  1T3B A;  3F8X A;  1R4C A;  1D6Y A;  1TP6 A;  3D5G A;  3H51 A;  1GOY A;  2F5W A;  3DGN A;  5CXO A;  1UCJ A;  3JUP A;  2CX1 A;  1JKG B;  4O2H A;  1RLS A;  7STD A;  1CYU A;  1Q7H A;  3S5C A;  1UUG B;  3PCS A;  5AII A;  3D5I A;  6GSP A;  4GB5 A;  1AVK A;  1LXE A;  3V92 A;  3ECF A;  4BTW A;  4EV5 A;  1BUJ A;  1OF5 A;  1OAC A;  1BNF A;  1Q81 4;  1VQO 3;  1CYV A;  1BSA A;  4NRE A;  1WMN A;  4FCZ A;  1IV9 A;  2CWU A;  3GZB A;  3CCM 3;  3LZA A;  2WO0 A;  4L8O A;  2GU1 A;  4STD A;  1RGF A;  2RBI A;  3I0Y A;  1AQZ A;  2E2U A;  4XBT A;  1BIR A;  1MWR A;  1NB3 I;  1DET A;  4K90 B;  4FMB A;  3SYU A;  2GSP A;  3X41 A;  2ZA4 A;  1IU7 A;  2Z77 A;  3LTA A;  5STD A;  1OGZ A;  1NU3 A;  1RCL A;  2C10 A;  2K54 A;  4MMY B;  4QWT A;  3AMO B;  3CD6 3;  4X2O A;  4RZM A;  4U13 A;  4LMI A;  1BNG A;  1W5Z A;  2IUK A;  1RGC A;  2ZHX B;  3KZT A;  3JVC A;  3DH2 A;  3KSP A;  4R1K A;  3U1W A;  1EKM A;  2MC8 A;  3LXU X;  2KF3 A;  1JV2 B;  3BND A;  6STD A;  3DZL A;  2OTL 3;  3KCH A;  2HMK B;  4FMD A;  4J5K A;  1C54 A;  4RBN A;  1BRS A;  2F86 B;  1KQS 2;  3GZR A;  1JJ2 2;  5TGN A;  1U8C B;  2KF6 A;  1TRQ A;  4HM8 B;  3LTB A;  4HM7 B;  4EV2 A;  2CX0 A;  1PFP A;  1ZX2 A;  3MKI A;  2D42 A;  1D6U A;  1RDS A;  1HZ1 A;  1GD3 A;  1TFO A;  1E3R A;  2XR8 B;  1JB5 A;  1Y4K A;  3ALA A;  5AIF A;  3RGR A;  2W9P A;  1GY6 A;  2YFL B;  3RNT A;  1GD4 A;  1JBS A;  3F14 A;  3CCL 3;  1VQ6 3;  4HAA A;  2YFJ B;  3DY5 A;  3X3X A;  4H61 A;  1RGA A;  5I97 A;  2AAE A;  5A0O B;  1BOX A;  4PEJ A;  2IY2 A;  2W0Q A;  1Q86 4;  2P05 A;  2C11 A;  5HGR A;  1UI8 A;  3VSY A;  1IDP A;  2W6J H;  2KF4 A;  1QAF A;  2WGQ A;  1BNJ A;  3BB9 A;  1K73 4;  1M90 4;  2XGN A;  2E2T A;  5AYR B;  3GZX B;  4HM0 B;  2CIU A;  1VQN 3;  1BSC A;  1JN5 B;  2W04 A;  4MMZ B;  1PY3 A;  1X1U A;  2D1W A;  1ULJ B;  1K8A 4;  4N6L A;  4LGQ A;  2H0G A;  4RNY A;  1YVS A;  2CWT A;  4OUQ A;  3SOA A;  1W4N A;  2A15 A;  3MSO A;  3SLU A;  4AKY A;  2UX0 A;  2V1L A;  3G8Z A;  1W6G A;  1OPY A;  1JB4 A;  1NWW A;  2JQ5 A;  1ZO2 A;  1B21 A;  1GY5 A;  1D6Z A;  1LNH A;  2BHM A;  2O3O A;  2W56 A;  3CU3 A;  4EBG A;  4GHO A;  5M19 A;  1N9E A;  1OHS A;  1I70 A;  3OW2 2;  2BT3 A;  2WGO A;  3KN4 A;  2XEP A;  3U97 A;  1AVL A;  2XFS A;  1UCL A;  2Y73 A;  3MG1 A;  1STF I;  3PGB A;  2BIR A;  4R80 A;  5LC7 A;  4HM3 B;  3MG2 A;  1VQ8 3;  1GMQ A;  3HZP A;  4I5Q A;  1VQ9 3;  3JUO A;  4EW5 A;  1B3S A;  5BXQ A;  3KSE D;  1GOU A;  5BIR A;  3X3Y A;  2BMQ B;  1UUV B;  1ZS7 A;  1LOY A;  4FMA A;  4EXR A;  2B1X B;  1N9J A;  2KCD A;  4LEH A;  2SAR A;  1W00 A;  1HKX A;  1OUN A;  2K0M A;  1QJG A;  3CC4 3;  5IG5 A;  1E3V A;  1X1X A;  2CFK A;  4FCJ A;  3CCU 3;  2RSX A;  2F99 A;  3A76 A;  1NJI 4;  2FGT A;  3K0Z A;  2CHC A;  4FR9 A;  3WHO A;  3X3Z A;  4AKZ A;  5IEP A;  2ZDJ A;  1QMA A;  3BNE A;  1V58 A;  5GSP A;  1IYY A;  1UCK A;  3OV4 A;  4LSO A;  3DXO A;  3AHW A;  3EBT A;  1TUH A;  2B24 B;  1RGG A;  3ER7 A;  5RNT A;  2IMJ A;  4KFD A;  2STD A;  2IYJ A;  5G2G A;  1BNE A;  4K1U A;  4HM5 B;  2XRX B;  1BRJ A;  1CQS A;  3HOH A;  3NQY A;  3NBJ A;  3PYJ A;  1FA3 A;  1O7G B;  3GWR A;  1YIT 3;  1X1W A;  1O7W B;  4XM4 A;  2LQV A;  4R9L A;  3Q90 A;  1RKY A;  3NM2 A;  3T8N A;  1RGE A;  2FXT A;  2ML6 A;  1FW7 A;  2F56 A;  4HM6 B;  1UGH I;  5G1L A;  3CCQ 3;  1W2B 2;  2Z7A A;  3NXJ A;  1MOL A;  2H0H A;  6RNT A;  2SBL A;  3WMD A;  1PYL A;  1C7H A;  2GU3 A;  3CCV 3;  2OCT A;  4I4K A;  1DVC A;  2KRT A;  3DGL A;  1YJN 3;  1DMQ A;  1US1 A;  3EN8 A;  1DMN A;  4NPB A;  1A2K A;  1EEJ A;  1K9M 4;  7GSP A;  1JNQ A;  5JPP A;  1FUT A;  1JKG A;  3TDG A;  3CPW 2;  4FCM A;  4K1V A;  1LOX A;  3N9H A;  3FF2 A;  5AIG A;  1UI7 A;  1BUQ A;  3J7Y d;  3T0U A;  2Y74 A;  1VQ7 3;  1JBR A;  2CG1 A;  2CFW A;  2IA7 A;  3EBY A;  3EHC A;  5ELJ A;  3WDG B;  2W03 A;  3NBR A;  5EEO A;  3JUN A;  1I3I A;  2UGI A;  1F8N A;  4O8S A;  1RN1 A;  3IMA B;  3E99 A;  2PNC A;  3CMA 3;  1AR0 A;  1ZGX A;  4CCV A;  4HBR A;  1RGL A;  1Q42 A;  2WOH A;  3FG4 A;  3K63 A;  1MNL A;  4HVN A;  1FGR A;  4J9A A;  5IG3 A;  1YGW A;  1FZU A;  1WTH A;  1LQM B;  4XDW A;  2PZV A;  3PS8 A;  5KP3 A;  3I56 3;  4N6T A;  1N8Q A;  3HII A;  2BNG A;  4X2H A;  1BSD A;  2OQE A;  1ISK A;  3V98 A;  1NB5 I;  1VZZ A;  3F8H A;  4WP5 A;  3JUM A;  1I3F A;  4ZM8 A;  3JUQ A;  2P09 A;  1R4Y A;  4GL6 A;  3ZFZ A;  1YHQ 3;  1VQ4 3;  1W6C A;  5IG4 A;  3MPH A;  1I2G A;  3FG3 A;  3CC2 3;  3EE1 A;  1A90 A;  3WOE B;  2CFG A;  4ILF A;  2CFL A;  1OHO A;  1WMO A;  2HMN B;  5G1K A;  1MGW A;  4HM4 B;  1GS3 A;  3OWY A;  2XGL A;  3QK9 A;  3S67 A;  4DKI A;  1DMM A;  4BIR A;  4JRF A;  3KFQ C;  1B20 A;  3LML A;  1BRH A;  1GY7 A;  4L7K A;  4AEQ A;  2OOV A;  1SIH A;  3STD A;  5LC6 A;  3KE7 A;  2HMJ B;  3N8B A;  1N5P A;  1UCI A;  1SJW A;  3LTC A;  1BRN L;  1IVX A;  1BNR A;  1CH0 A;  3URP A;  3F9S A;  5KP4 A;  5KP1 A;  3S28 A;  5AEW B;  3D4A A;  1IT8 A;  1RGH A;  1N8R 4;  1BU4 A;  4HM2 B;  1W01 A;  1BRK A;  5CF2 A;  3WA3 A;  2RGQ A;  1OCV A;  1VQK 3;  1EQK A;  3BLZ A;  3O8Y A;  1DVD A;  1WQL B;  1FGO A;  2XSO B;  1V74 A;  3NM7 A;  2R4I A;  1I0X A;  1DYU A;  1UUW B;  3UJM A;  1KSI A;  3WOF B;  3CME 3;  1OHP A;  3CPO A;  3SOY A;  4KZ1 A;  1LOW A;  1UW1 A;  1BSE A;  3FGY A;  3HI7 A;  1RTU A;  2F5M A;  3IJE B;  2AAD A;  4KVH A;  3SVA A;  1W6Y A;  2QA4 3;  4N3V A;  1GYB A;  2RFR A;  4H3U A;  1FGQ A;  1RRH A;  3BNC A;  2XH9 A;  3EJV A;  1ROA A;  4NHF A;  5DRE A;  2OOV C;  4XBX A;  3SXX A; 
#chains in the Genus database with same CATH homology
 1IQX A;  2GEY A;  1VQP 3;  2XSH B;  3LTD A;  1VQL 3;  4IT7 A;  3KKG A;  1M9G A;  4IIA A;  4R9K A;  2CFD A;  5AI1 A;  3VGN A;  3X42 A;  2I9W A;  3WA2 X;  4OK0 A;  4WYK B;  5IEO A;  2QEX 3;  3B8L A;  1U5O A;  1HU9 A;  5BVB A;  5D82 A;  1N5H A;  1QAK A;  3H3H A;  4XDV A;  1NDO B;  1IVU A;  5AYS C;  3DM8 A;  3OX9 A;  5FW5 A;  2CKF B;  1PU4 A;  2W2C A;  3T8U A;  2RCD A;  1CEW I;  3NV0 A;  1WNH A;  3F7X A;  1YJW 3;  3MWZ A;  3NUV A;  2O9U X;  3CCR 3;  1NO3 A;  3OXA A;  3NQZ A;  1WMP A;  4N6M A;  3LH4 A;  2GXF A;  3EF8 A;  1IQ8 A;  1S5A A;  4Q53 A;  3FF0 A;  1J2B A;  1IV7 A;  3B7C A;  5IG0 A;  3HK4 A;  3Q1C A;  2XFT A;  3CNX A;  1T5Y A;  2GEX A;  1VQ5 3;  3K9M C;  3UL6 A;  2ML5 A;  3RDE A;  2Z76 A;  1O7N B;  1IT7 A;  4EC6 A;  1O7M B;  4HM1 B;  2P0M A;  1W7C A;  2KXG A;  3UB1 A;  2P0X A;  1G96 A;  1S72 3;  1JN5 A;  1Q40 B;  4LZI A;  3FCS B;  1QAL A;  3G16 A;  3DMC A;  1ROV A;  1A2V A;  2W9Q A;  3SED A;  1W2Z A;  2Q07 A;  2OWP A;  4ORL A;  4CDL A;  1KWI A;  2F98 A;  4KFF A;  3LYG A;  3PZW A;  1SQW A;  1SII A;  3FZW A;  3S29 A;  3V99 A;  5DRV A;  5D83 A;  1TIJ A;  3G6E 3;  4N6V 0;  4HZB B;  3NX0 A;  1Q7Y 4;  2FNQ A;  1ASK A;  3BNB A;  1FGM A;  3MYT A;  3LT9 A;  3HIG A;  2E2V A;  3GZY B;  3LOY A;  2CG0 A;  3NV0 B;  3G0K A;  4JF8 A;  2HMM B;  4L8P A;  3FLJ A;  4XBY A;  1VQN 3;  1JRQ A;  3F7S A;  5FGO A;  8CHO A;  1TU5 A;  3QRD A;  4BTY A;  1YGE A;  1FGT A;  1RRL A;  2HML B;  5IEN A;  2P38 A;  1KC8 4;  2INX A;  1SPU A;  3Q2P A;  5JBS A;  1IVW A;  3K5T A;  3MHE A;  4IPB A;  5IW9 A;  4WYK A;  1RJO A;  2XF3 A;  3DGO A;  3OWU A;  3LT8 A;  2W56 B;  4HZ9 B;  3B4O A;  4XB5 A;  1A67 A;  3OWS A;  5IF6 A;  1K28 A;  1W02 A;  3CXC 2;  3CCS 3;  3IPT A;  3GRD A;  4O3V A;  1K41 A;  2GBW B;  3EB8 A;  2CWV A;  4TX4 A;  4WFO A;  4EYC A;  1EA2 A;  3S27 A;  2YX9 A;  3GAX A;  4R4K A;  1IQY A;  1JB2 A;  4MEI A;  1M1K 4;  3D9R A;  3DGM A;  1QVF 2;  1OH0 A;  4WWU C;  3F40 A;  1OF5 B;  3DUK A;  3MG3 A;  3B4P A;  3N54 B;  4FMC A;  4HKV B;  3I55 3;  3EC9 A;  5AIH A;  3HX8 A;  3X40 A;  4BTX A;  1Q82 4;  1IK3 A;  1Z1S A;  4N6O B;  3VF1 A;  2CC3 A;  3CCE 3;  2CK3 H;  3FKA A;  3ROB A;  2QGU A;  3FH1 A;  1IVV A;  2YFI B;  5CF1 A;  1L5G B;  5CK6 A;  3NHX A;  5AEU B;  4K61 A;  1RN7 A;  2JDI H;  1Q40 A;  3CNM A;  2MF7 A;  3EQQ B;  2HMO B;  2BMO B;  2BO9 B;  3RGA A;  1E97 A;  3UL5 A;  1YVB I;  1AV4 A;  3PCR A;  4RNZ A;  5CLK A;  4HJL B;  4HYZ A;  5EQL A;  3G71 3;  1O7H B;  3PXM A;  1QVG 2;  2WOF A;  1FUW A;  2GBX B;  4N6U A;  3CC7 3;  3EN1 B;  4MJD A;  5EVH A;  3KII A;  3G4S 3;  3NBB A;  3M8C A;  2Z6B A;  3FSD A;  2LYX A;  1M1X B;  3D3L A;  1STD A;  1ULI B;  2CW9 A;  2M7O A;  5IER A;  3AMO A;  3L0R A;  2IUJ A;  2ZL8 A;  4MMX B;  1YI2 3;  4KFE A;  3SX1 A;  1VQM 3;  2OQE C;  1OGX A;  1EG9 B;  2QIY A;  3FG1 A;  3EX9 A;  3UNL A;  2CH9 A;  5D81 A;  4J8T A;  4OVM A;  1YJ9 3;  1YIJ 3;  1KD1 4;  2BMR B;  3K7C A;  4N6N B;  1O7P B;  4G1M B;  4O02 B;  2L4V A;  4WHA A;  1TFK A;  3WOD G;  1LVN A;  3CCJ 3;  3F8X A;  1R4C A;  1D6Y A;  1TP6 A;  5CXO A;  3H51 A;  3DGN A;  3JUP A;  1JKG B;  4O2H A;  7STD A;  1CYU A;  3S5C A;  3PCS A;  5AII A;  4GB5 A;  1AVK A;  1LXE A;  3V92 A;  3ECF A;  4BTW A;  4EV5 A;  1OF5 A;  1OAC A;  1Q81 4;  1VQO 3;  1CYV A;  4NRE A;  1WMN A;  4FCZ A;  1IV9 A;  2CWU A;  3GZB A;  3CCM 3;  3LZA A;  2WO0 A;  4L8O A;  2GU1 A;  4STD A;  3I0Y A;  4XBT A;  2E2U A;  1NB3 I;  4K90 B;  4FMB A;  3X41 A;  1IU7 A;  2Z77 A;  3LTA A;  5STD A;  1OGZ A;  1NU3 A;  2C10 A;  2K54 A;  4MMY B;  4QWT A;  3AMO B;  3CD6 3;  4X2O A;  4RZM A;  4U13 A;  4LMI A;  1W5Z A;  2IUK A;  3KZT A;  3JVC A;  3KSP A;  4R1K A;  3U1W A;  1EKM A;  2MC8 A;  3LXU X;  1JV2 B;  3BND A;  6STD A;  3DZL A;  2OTL 3;  2HMK B;  4FMD A;  4RBN A;  2F86 B;  1KQS 2;  3GZR A;  1JJ2 2;  5TGN A;  1U8C B;  4HM8 B;  3LTB A;  4HM7 B;  4EV2 A;  1PFP A;  1ZX2 A;  3MKI A;  2D42 A;  1D6U A;  1GD3 A;  1TFO A;  1E3R A;  2XR8 B;  1JB5 A;  1Y4K A;  3ALA A;  5AIF A;  3RGR A;  2W9P A;  1GY6 A;  2YFL B;  1GD4 A;  3F14 A;  3CCL 3;  1VQ6 3;  2YFJ B;  3DY5 A;  3X3X A;  4H61 A;  5I97 A;  5A0O B;  4PEJ A;  2W0Q A;  1Q86 4;  2P05 A;  2C11 A;  5HGR A;  1UI8 A;  3VSY A;  1IDP A;  2W6J H;  2WGQ A;  1QAF A;  3BB9 A;  1K73 4;  1M90 4;  2XGN A;  2E2T A;  5AYR B;  3GZX B;  4HM0 B;  2CIU A;  1JN5 B;  2W04 A;  4MMZ B;  2D1W A;  1ULJ B;  1K8A 4;  4N6L A;  4LGQ A;  4RNY A;  5JPU A;  2CWT A;  3SOA A;  4OUQ A;  3SLU A;  1W4N A;  2A15 A;  3MSO A;  4AKY A;  2UX0 A;  2V1L A;  3G8Z A;  1JB4 A;  1OPY A;  2JQ5 A;  2W56 A;  1NWW A;  1W6G A;  1ZO2 A;  1GY5 A;  1LNH A;  1D6Z A;  2BHM A;  2O3O A;  3CU3 A;  4EBG A;  1N9E A;  1OHS A;  3OW2 2;  2BT3 A;  2WGO A;  3KN4 A;  2XEP A;  3U97 A;  1AVL A;  2XFS A;  2Y73 A;  3MG1 A;  3PGB A;  1STF I;  4R80 A;  2OTJ 3;  5LC7 A;  4HM3 B;  3MG2 A;  1VQ8 3;  3HZP A;  1VQ9 3;  3JUO A;  5BXQ A;  3KSE D;  3X3Y A;  2BMQ B;  1UUV B;  4FMA A;  4EXR A;  2B1X B;  1N9J A;  2KCD A;  4LEH A;  1W00 A;  1HKX A;  1OUN A;  2K0M A;  1QJG A;  3CC4 3;  5IG5 A;  1E3V A;  2CFK A;  4FCJ A;  3CCU 3;  2RSX A;  2F99 A;  3A76 A;  1NJI 4;  2FGT A;  3K0Z A;  2CHC A;  4FR9 A;  3X3Z A;  4AKZ A;  5IEP A;  2ZDJ A;  1QMA A;  3BNE A;  3OV4 A;  4LSO A;  3DXO A;  3EBT A;  1TUH A;  2B24 B;  3ER7 A;  2IMJ A;  4KFD A;  2STD A;  5G2G A;  4K1U A;  4HM5 B;  2XRX B;  1CQS A;  3NQY A;  3NBJ A;  3PYJ A;  1FA3 A;  1O7G B;  3GWR A;  1YIT 3;  1O7W B;  4XM4 A;  2LQV A;  4R9L A;  3Q90 A;  1RKY A;  3NM2 A;  3T8N A;  2FXT A;  2ML6 A;  4HM6 B;  1W2B 2;  2Z7A A;  3NXJ A;  1MOL A;  2SBL A;  3WMD A;  2GU3 A;  1C7H A;  3CCV 3;  2OCT A;  4I4K A;  1DVC A;  2KRT A;  3DGL A;  1YJN 3;  1DMQ A;  1US1 A;  3EN8 A;  1DMN A;  1A2K A;  1K9M 4;  1JNQ A;  5JPP A;  1JKG A;  3TDG A;  3CPW 2;  4FCM A;  4K1V A;  1LOX A;  3N9H A;  3FF2 A;  5AIG A;  1UI7 A;  1BUQ A;  3J7Y d;  3T0U A;  2Y74 A;  1VQ7 3;  2CG1 A;  2CFW A;  2IA7 A;  3EBY A;  3EHC A;  5ELJ A;  3WDG B;  2W03 A;  3NBR A;  5EEO A;  3JUN A;  1F8N A;  4O8S A;  3IMA B;  3E99 A;  2PNC A;  3CMA 3;  1AR0 A;  4CCV A;  4HBR A;  5ELU A;  1Q42 A;  2WOH A;  3FG4 A;  3K63 A;  1MNL A;  4HVN A;  1FGR A;  4J9A A;  5IG3 A;  1WTH A;  4XDW A;  2PZV A;  3PS8 A;  5KP3 A;  3I56 3;  4N6T A;  1N8Q A;  3HII A;  2BNG A;  4X2H A;  2OQE A;  1ISK A;  3V98 A;  1NB5 I;  1VZZ A;  3F8H A;  4WP5 A;  3JUM A;  4ZM8 A;  3JUQ A;  2P09 A;  4GL6 A;  1YHQ 3;  1VQ4 3;  1W6C A;  5IG4 A;  3MPH A;  3FG3 A;  3CC2 3;  3EE1 A;  1A90 A;  3WOE B;  2CFG A;  2CFL A;  1OHO A;  1WMO A;  2HMN B;  3CCQ 3;  4HM4 B;  1GS3 A;  3OWY A;  2XGL A;  3QK9 A;  3S67 A;  1DMM A;  4JRF A;  3KFQ C;  3LML A;  1GY7 A;  4L7K A;  4AEQ A;  2OOV A;  1SIH A;  3STD A;  5LC6 A;  3KE7 A;  2HMJ B;  3N8B A;  1N5P A;  1SJW A;  3LTC A;  1IVX A;  3F9S A;  5KP4 A;  5KP1 A;  3S28 A;  5AEW B;  1IT8 A;  1N8R 4;  4HM2 B;  1W01 A;  5CF2 A;  3WA3 A;  2RGQ A;  1OCV A;  1VQK 3;  1EQK A;  3BLZ A;  3O8Y A;  1DVD A;  1WQL B;  1FGO A;  2XSO B;  1V74 A;  3NM7 A;  2R4I A;  1DYU A;  1UUW B;  3UJM A;  1KSI A;  3WOF B;  3CME 3;  1OHP A;  3CPO A;  3SOY A;  4KZ1 A;  1UW1 A;  3FGY A;  3HI7 A;  3IJE B;  4KVH A;  3SVA A;  1W6Y A;  2QA4 3;  4N3V A;  1GYB A;  2RFR A;  4H3U A;  1FGQ A;  1RRH A;  3BNC A;  2XH9 A;  3EJV A;  1ROA A;  4NHF A;  5DRE A;  2OOV C;  4XBX A;  3SXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...