3H51A

Crystal structure of putative calcium/calmodulin dependent protein kinase ii association domain (np_636218.1) from xanthomonas campestris at 1.70 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GVMHYTDKAALPADGEAREVAALFDTWNAALATGNPHKVADLYAPDGVLLPTVSNEVRASREQIENYFEMFLTKKPKGVINYRTVRLLDDDSAVDAGVYTFTLTDKNGKKSDVQARYTFVYEKRDGKWLIINHHSSAMPEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative calcium/calmodulin dependent protein kinase II asso
publication title Crystal structure of Putative calcium/calmodulin dependent protein kinase II association domain (NP_636218.1) from XANTHOMONAS CAMPESTRIS at 1.70 A resolution
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Protein binding
total genus 38
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3h51A00
3DMCA 3GWRA 3KZTA 3G16A 3FH1A 1W00A 4FCJA 3HK4A 3NV0B 5JPPA 1OHSA 2GEYA 2Z76A 3A76A 4WWUC 1JN5A 3UNLA 1K41A 3GZRA 5G2GA 4L8OA 4LEHA 4OUQA 2GEXA 1E3RA 4R9LA 4FCMA 1O7HB 3F7SA 3VGNA 3KE7A 1E97A 2XSOB 3KSPA 3UJMA 4R9KA 4L7KA 4XDWA 3H3HA 3SOAA 1A2KA 3FZWA 5BXQA 2RCDA 2B24B 5AIIA 3FKAA 2YFLB 2BMRB 3FF2A 3H51A 1NWWA 5IG5A 1STDA 4KVHA 3MHEA 4ORLA 2BMQB 2STDA 1Q42A 5AIFA 4IIAA 3LYGA 1O7PB 3K0ZA 1O7WB 5AEWB 2XRXB 4HM1B 4X2HA 2R4IA 5AEUB 1GYBA 3OWYA 2IMJA 4HM0B 5KP4A 1W6YA 3ECFA 3GZXB 2RGQA 6STDA 3EJVA 1UUVB 5AI1A 1JB5A 5AIHA 2XR8B 3MG1A 2HMLB 8CHOA 3HZPA 3MKIA 1EA2A 3DUKA 2F99A 3DZLA 4U13A 3WMDA 3NM2A 4XBXA 1OGZA 3HX8A 3F14A 5KP1A 3ROBA 3EC9A 4HM8B 3EHCA 3LZAA 1TP6A 1E3VA 1GS3A 4J8TA 1U5OA 2K54A 4LMIA 5KP3A 4WYKA 2GBXB 4I4KA 3MSOA 4HM7B 3JUQA 2Z77A 3EF8A 4HM4B 4H3UA 3I0YA 3OV4A 3EBTA 3RGAA 3ER7A 5TGNA 1OCVA 1DMNA 1GY6A 2INXA 1ZO2A 2QIYA 2Z7AA 4K1UA 3E99A 5D83A 2OWPA 4OVMA 1QJGA 3EBYA 3JUPA 2I9WA 3IPTA 1JB4A 4WYKB 5IG0A 4XM4A 1JN5B 1QMAA 3MG2A 5STDA 5CLKA 1OHPA 1SJWA 2HMKB 1EG9B 5D81A 3FF0A 5JPUA 2PZVA 2JQ5A 2QGUA 4L8PA 4HM5B 3OWUA 2HMNB 4HJLB 1CQSA 4HM3B 1O7NB 5IENA 2XSHB 3STDA 3CNXA 3SOYA 3CPOA 4GB5A 5FW5A 5DREA 2BNGA 4HM6B 2F98A 1OH0A 4PEJA 5IG4A 1W01A 3S5CA 1BUQA 5IF6A 5BVBA 1NDOB 4R1KA 4WP5A 4HZBB 1WQLB 2YFJB 3NBRA 3KKGA 3B8LA 5CXOA 3FSDA 1S5AA 1W02A 4RZMA 1Q40A 2GBWB 3OXAA 3EX9A 1NU3A 5D82A 4HVNA 2HMMB 2UX0A 3EQQB 5IEOA 5CF1A 3D9RA 5IERA 3B7CA 3SEDA 3K7CA 3FLJA 1OF5A 1JKGA 1GY7A 2CHCA 4J9AA 5IEPA 3OWSA 2YFIB 3GRDA 1OHOA 1GY5A 4XBYA 3JUOA 3MYTA 4CDLA 1ASKA 2GXFA 3F7XA 3G0KA 3Q90A 1Q40B 1OGXA 3B4PA 4XB5A 1O7GB 4K1VA 3BLZA 3EN1B 1IDPA 3GZYB 1OPYA 3F8XA 5CF2A 4Q53A 4HKVB 4LGQA 5EVHA 3BB9A 1OF5B 1UUWB 1JKGB 2BMOB 2W2CA 2A15A 3F9SA 2HMOB 2CKFB 2F86B 3CU3A 5DRVA 3DM8A 3B4OA 4MJDA 3F40A 1OUNA 2HMJB 1DMQA 4XBTA 5HGRA 3DXOA 3EN8A 2RFRA 5AIGA 1ISKA 4STDA 5CK6A 3NXJA 1DMMA 1ZX2A 3FGYA 4HZ9B 7STDA 2B1XB 3NV0A 1ULIB 3M8CA 1HKXA 3OX9A 5IG3A 1TUHA 3NHXA 3MG3A 1ULJB 4XDVA 1Z1SA 3GZBA 3JUMA 3CNMA 4HM2B 3G8ZA 4N3VA 3T8UA 3F8HA 1C7HA 4X2OA 1JB2A 1AR0A 3T8NA 1VZZA 1O7MB 3VSYA 3NUVA 3JUNA 3RGRA
chains in the Genus database with same CATH superfamily
3DMCA 1BSEA 3GWRA 2E2UA 2XFTA 3G16A 3KZTA 1PYLA 3FH1A 3CC23 4KT3B 1YGWA 3D79A 1W00A 4BL2A 4FCJA 3HK4A 3NV0B 1X1XA 6GSPA 5JPPA 3NQYA 2CX1A 1OHSA 1B2UA 2WGOA 5BIRA 3PS8A 3LTDA 3Q2PA 1W2B2 1YIT3 2GEYA 2Z76A 3A76A 1JN5A 4WWUC 5EEOA 3UNLA 1K41A 3GZRA 5G2GA 1RDSA 4L8OA 1W6GA 2F4YA 3OW22 1LXEA 1RGAA 3NX0A 3LMLA 4IPBA 4LEHA 4OUQA 2OQEC 2GEXA 4KFEA 2GU1A 1QAKA 1LNIA 1SQWA 3WDGB 1VQO3 3S67A 1E3RA 1M1XB 3NQZA 4R9LA 1YHQ3 5GSPA 1CEWI 1RJOA 4FCMA 1YJN3 1O7HB 7GSPA 2CFLA 3F7SA 3VGNA 2Y73A 2CIUA 3KE7A 3CCL3 4MEIA 4BIRA 2IUKA 1Q7HA 1E97A 2XSOB 1BSBA 1X1UA 3KSPA 3UJMA 1V74A 5G1KA 1PFPA 1N8R4 4R9KA 2AAEA 3UB1A 4L7KA 4XDWA 1VQQA 2CX0A 2O9UX 3H3HA 3CCM3 3CCV3 3SOAA 4K90B 1SIHA 1BNRA 4HYZA 1A2KA 1T2IA 3FZWA 5BXQA 4RNYA 2RCDA 1JBSA 4N6V0 3WOFB 2B24B 5AIIA 1M1K4 3FKAA 2P09A 2YFLB 1S723 3BNCA 3KSED 4BL3A 2P38A 3FG3A 7RNTA 2BMRB 4GHOA 4NHFA 1OACA 1LVNA 1UGIA 3FF2A 3H51A 4IT7A 1KC84 1X1WA 3LTCA 1T3BA 2CW9A 1K28A 1T5YA 1UGHI 1NWWA 5IG5A 1STDA 1B2XA 5M18A 3ALAA 2CK3H 3D4AA 1IVXA 4KVHA 1RGGA 3MHEA 1RGLA 3NBJA 4ORLA 2BMQB 2CC3A 2STDA 4AEQA 2ZA4A 5I97A 1I0VA 3Q3FA 3X40A 2M7OA 1D6ZA 1Q42A 5AIFA 4IIAA 3LYGA 3CCQ3 1O7PB 3K0ZA 1O7WB 4CPKA 5AEWB 1EQKA 1I2GA 2XRXB 5LC7A 4HM1B 2XGNA 3A5EA 4X2HA 1BNIA 1RMSA 2R4IA 1SPUA 3WOEB 1IVWA 5AEUB 1VQ53 4H61A 1BIRA 3VF1A 5BU4A 4TX4A 1GYBA 2CH9A 3OWYA 2BU4A 2IMJA 4HM0B 5KP4A 1IU7A 1W6YA 1BGSA 3K9MC 3LTBA 3CPW2 1FUSA 2MF7A 1YJ93 3ECFA 1IV9A 1W4NA 2W6JH 3GZXB 3K63A 2RGQA 5M19A 1B27A 1T2HA 4MMYB 2RNTA 4KFDA 3BNEA 2W0QA 6STDA 1FZUA 1ROVA 3PCRA 3EJVA 4MMZB 1DVCA 1PY3A 1LQGC 1KWIA 1GOVA 2JDIH 2KF3A 4NREA 5ELUA 1HU9A 1UUVB 5AI1A 1MNLA 1JB5A 5AIHA 2CWUA 3X3ZA 2XR8B 1WMOA 4JRFA 4OK0A 3MG1A 4BTYA 1RNBA 1R4YA 2HMLB 1G96A 3HZPA 1D6UA 3MKIA 8CHOA 1EA2A 3DUKA 1US1A 3O8YA 2BIRA 2F99A 4LSOA 4RNTA 1W2ZA 3LH4A 2SARA 3DZLA 1CYVA 1FUTA 3GAXA 4FR9A 4U13A 3WMDA 3NM2A 1Y4KA 1RLSA 4XBXA 1OGZA 1UI7A 4J5KA 3X41A 2SBLA 3PCSA 3ZG5A 3HX8A 3F14A 1JNQA 1UUGB 2K0MA 5KP1A 2C10A 1BOXA 1G0TA 2XEPA 1FGOA 2OOVA 1V57A 1X1YA 3FG1A 1VQP3 1YNVX 3ROBA 3EC9A 4HM8B 1N5PA 3EHCA 3LZAA 2RBIA 1N8QA 1TP6A 2H0IA 2XGLA 1E3VA 3UL6A 1GS3A 3AMOA 4J8TA 1QVG2 1U5OA 2K54A 2IY2A 1BSAA 1BNJA 3NBBA 1SARA 4LMIA 1JZDA 5KP3A 4WYKA 1LRAA 1CH0A 1W6CA 2XFSA 1VQM3 1EUIC 2GBXB 3S28A 3WHOA 4RBNA 1BRKA 4ZM8A 1TFOA 4R80A 3DGMA 4I4KA 1D6YA 2KF4A 2CG0A 3MSOA 1UCLA 3LXUX 4HM7B 1PU4A 1VQ73 3CXC2 3JUQA 3U1WA 3Q1CA 2Z77A 1UCIA 3EF8A 2KF6A 4FMDA 1RRLA 4EW5A 4HM4B 1VQK3 4O02B 1BSCA 3I0YA 3OV4A 4H3UA 3EBTA 3WA3A 1VQN3 5JBSA 3DGNA 2H0HA 3RGAA 1N9EA 1UCJA 3PYJA 3ER7A 1IQXA 5TGNA 4I5QA 1LOVA 2FNQA 3IJEB 1NJI4 4N6TA 1OCVA 1DMNA 1TRQA 2K3DA 1GY6A 2INXA 1ZO2A 3KIIA 3LOYA 2QIYA 2Z7AA 1C54A 2KRTA 4K1UA 3E99A 1RGKA 4FCZA 3MPHA 3CD63 5D83A 2OWPA 4OVMA 2F56A 1BRHA 1GSPA 1QJGA 3CC43 1BRNL 1GOUA 1LOYA 3WR2A 3EBYA 3CC73 1LNHA 1LOWA 3AMOB 3JUPA 1BNFA 1A2PA 4RNZA 3PGBA 4EV2A 2I9WA 3IPTA 1WMPA 1JB4A 4QWTA 2WOHA 1BRGA 3DGLA 3G4S3 2GSPA 3HIIA 4WYKB 3T0UA 2W03A 5IG0A 4XM4A 1JN5B 4AKYA 1QMAA 1ZS7A 1BU4A 1BVIA 3MG2A 5STDA 2BHMA 2W9QA 1B3SA 5CLKA 3RNTA 3KN4A 2PNCA 3SVAA 2RSXA 2UGIA 4J5GA 1BUJA 1MGRA 3TDGA 1OHPA 1SJWA 2C4BA 2F5MA 2HMKB 3KCHA 5AYRB 1EG9B 5D81A 1IVUA 3KFQC 3UL5A 3FF0A 1I70A 1MGWA 5JPUA 2FXTA 5G1LA 1DETA 3JVCA 1RGFA 4KZ1A 1BRJA 2PZVA 4O3VA 3CCS3 3ZFZA 2JQ5A 2KCDA 1FGMA 2QGUA 4L8PA 1VQL3 4HM5B 1QALA 3OWUA 3URPA 4N6OB 2HMNB 1SIIA 4HJLB 1CQSA 4HM3B 1KSIA 8RNTA 1O7NB 1UCKA 1RGCA 1FGQA 1RN4A 5IENA 4MMXB 4O2HA 3HI7A 2CFWA 2R41A 2XSHB 2D1WA 4EV5A 3STDA 1W7CA 1RSNA 4K61A 3CNXA 2UUGC 2CWTA 1YVSA 2GU3A 3BU4A 3SOYA 1BAOA 4KFFA 1AY7A 4WFOA 1UI8A 1I8VA 2E2VA 3X3YA 6RNTA 2W04A 4EC6A 1B2SA 3CPOA 4HOHA 1NB5I 4GB5A 1F8NA 5FW5A 1RN7A 2CG1A 1VQ63 3D3LA 9RNTA 5DREA 2BNGA 1HZ1A 4HM6B 2F98A 1BRIA 1BNEA 1WTHA 4EYCA 1B2MA 1MWSA 1OH0A 3QK9A 5A0OB 3DH2A 4PEJA 5IG4A 1K9M4 4BU4A 3V99A 3K5TA 1W01A 3S5CA 1BUQA 1NNVA 2Y74A 1RKYA 2KXGA 1QAFA 1W5ZA 1STFI 2J8XB 2ZHXB 4LYLB 1ZGXA 2MC8A 5IF6A 1BRSA 2F5WA 1TTOA 5BVBA 1NDOB 1G02A 4R1KA 1RCLA 2OOVC 4NPBA 3SLUA 1DVDA 2FGTA 3CCJ3 4WP5A 2CFKA 4HZBB 1WQLB 2YFJB 3FG4A 2YX9A 3KKGA 3NBRA 1A90A 3J7Yd 3B8LA 2LQVA 5CXOA 1L5GB 3FSDA 3WA2X 1B21A 1Q7Y4 1S5AA 1W02A 4RZMA 1I3IA 3WODG 1Q40A 4LZIA 4JF8A 2GBWB 2Z6BA 3OXAA 1M904 3EX9A 4GSPA 1NU3A 5AYSC 3I563 3CMA3 1I2FA 1JV2B 4HVNA 2HMMB 2UX0A 4G1MB 1RCKA 5D82A 3EQQB 5IEOA 5CF1A 5EQLA 3D9RA 1GD4A 5IERA 2WO0A 1Q824 3B7CA 3SEDA 3K7CA 2LYXA 1MWUA 2KF5A 3FLJA 1I3FA 1OF5A 4AKZA 1JKGA 2HOHA 3GSPA 1GY7A 2CHCA 1BNGA 4J9AA 1YGEA 3CCU3 4HBRA 1TRPA 5IEPA 2P0MA 3AHWA 4FMCA 3SX1A 3SYUA 1RTUA 1N9JA 2BO9B 3OWSA 3LT8A 1MWRA 1Q814 1HYFA 2C11A 5FGOA 2XH9A 3RDEA 2YFIB 3S29A 4CCVA 2W56A 1WMNA 3GRDA 3HIGA 1FGTA 4GL6A 2OQEA 1KQS2 3G6E3 1A2VA 1OHOA 3LT9A 3PZWA 1GY5A 1VQ43 4WHAA 1VQ93 1ROAA 3NM7A 2P05A 3IMAB 1IT8A 3D5GA 2ML5A 3FCSB 3MWZA 4XBYA 2E2TA 1U8CB 1BSDA 2L1SA 3DGOA 3JUOA 2KAAA 3DY5A 3V98A 1IVVA 3AGNA 4EXRA 3MYTA 4ILFA 1ASKA 1RNTA 4CDLA 1JZOA 2GXFA 1FA3A 1FGRA 3F7XA 1FW7A 3G0KA 1QVF2 3Q90A 1K734 1Q40B 1OGXA 1M9GA 1B20A 1NO3A 3B4PA 4XB5A 1O7GB 4K1VA 3BLZA 3EN1B 5M1AA 2CFGA 1IDPA 1AV4A 1I2EA 2AADA 2CWVA 3GZYB 3S27A 3CCR3 1IQ8A 1GMRA 4O8SA 1OPYA 3F8XA 3N9HA 5CF2A 3X3XA 1UDII 1TFKA 1JBRA 3U97A 4Q53A 4HKVB 1IV7A 3EB8A 3BB9A 4LGQA 5EVHA 3V92A 5RNTA 1Q864 1OF5B 4FMBA 5IW9A 1UUWB 1JKGB 2BMOB 2W2CA 2A15A 3LTAA 4N6MA 1RGHA 1BNSA 3F9SA 1YI23 1KD14 1CYUA 2ZDJA 3AHSA 2HMOB 2QA43 2CFDA 2CKFB 2H0GA 2F86B 3CU3A 2IA7A 3SXXA 3DGYA 1AQZA 2OTJ3 1GMQA 1RN1A 2W56B 1MWTA 3DM8A 5DRVA 3B4OA 5ELJA 4MJDA 1TU5A 1UW1A 1FYSA 1EEJA 3F40A 3N8BA 2IUJA 1GOYA 1OUNA 2HMJB 3EE1A 2WGQA 1DMQA 1Q9EA 4XBTA 5HGRA 3G713 1I0XA 2P0XA 3DXOA 3EN8A 4BTWA 2Q07A 1K8A4 2RFRA 2L4VA 5AIGA 1ISKA 3BNBA 2IYJA 4STDA 1TIJA 3QRDA 1EKMA 5CK6A 2BT3A 3NXJA 1RRHA 4N6UA 1DMMA 1ZX2A 3FGYA 1V58A 3HOHA 4HAAA 4HZ9B 2B1XB 5LC6A 7STDA 3D5IA 2W9PA 3L0RA 1YIJ3 1J2BA 3NV0A 3X42A 3PXMA 1ULIB 3BIRA 3CME3 1GMPA 4R4KA 3M8CA 4N6LA 1HKXA 3OX9A 1GD3A 5IG3A 1TUHA 3BNDA 1AVKA 3CCE3 5HOHA 1IK3A 3NHXA 1B2ZA 1RHLA 3ZG0A 4EBGA 1FUWA 1BANA 1JRQA 3MG3A 1RGEA 2WOFA 1ULJB 1IQYA 1IT7A 1DYUA 1AVLA 2XF3A 4XDVA 2D42A 1Z1SA 4N6NB 1JJ22 3GZBA 3JUMA 3CNMA 1R4CA 2ML6A 1LQMB 3N54B 2OTL3 3AGOA 4HM2B 1YVBI 1JBTA 1A67A 1DE3A 1VQ83 3G8ZA 4N3VA 2ZL8A 3T8UA 4BTXA 2V1LA 1LOXA 1YJW3 3F8HA 1WNHA 2O3OA 1N5HA 1TJDA 1C7HA 2OCTA 4X2OA 1JB2A 1AR0A 1MOLA 3I553 1NB3I 3T8NA 1VZZA 1O7MB 4CJNA 4FMAA 3VSYA 2QEX3 1IYYA 3NUVA 3JUNA 4DKIA 3RGRA
chains in the Genus database with same CATH topology
3DMCA 3GWRA 2E2UA 2XFTA 3G16A 3KZTA 3FH1A 3CC23 1W00A 4FCJA 3HK4A 3NV0B 5JPPA 3NQYA 1OHSA 2WGOA 3PS8A 3LTDA 3Q2PA 1W2B2 1YIT3 2GEYA 2Z76A 3A76A 1JN5A 4WWUC 5EEOA 3UNLA 1K41A 3GZRA 5G2GA 4L8OA 1W6GA 3OW22 1LXEA 3NX0A 4IPBA 3LMLA 4LEHA 4OUQA 2OQEC 2GEXA 4KFEA 2GU1A 1QAKA 1SQWA 3WDGB 1VQO3 1YHQ3 3S67A 1E3RA 1M1XB 3NQZA 4R9LA 1CEWI 1RJOA 4FCMA 1YJN3 1O7HB 2CFLA 3F7SA 3VGNA 2Y73A 2CIUA 3KE7A 3CCL3 4MEIA 2IUKA 1E97A 2XSOB 3KSPA 3UJMA 1V74A 1PFPA 1N8R4 4R9KA 3UB1A 4L7KA 4XDWA 2O9UX 3H3HA 3CCM3 3CCV3 3SOAA 4K90B 1SIHA 4HYZA 1A2KA 3FZWA 5BXQA 4RNYA 2RCDA 4N6V0 3WOFB 2B24B 5AIIA 1M1K4 3FKAA 2P09A 2YFLB 1S723 3BNCA 3KSED 2P38A 3FG3A 2BMRB 4NHFA 1OACA 1LVNA 3FF2A 3H51A 4IT7A 1KC84 3LTCA 2CW9A 1K28A 1T5YA 1NWWA 5IG5A 1STDA 3ALAA 2CK3H 1IVXA 4KVHA 3MHEA 3NBJA 4ORLA 2BMQB 2CC3A 2STDA 4AEQA 5I97A 3X40A 2M7OA 1D6ZA 1Q42A 5AIFA 4IIAA 3LYGA 3CCQ3 1O7PB 3K0ZA 1O7WB 5AEWB 1EQKA 2XRXB 5LC7A 4HM1B 2XGNA 4X2HA 3WOEB 2R4IA 1SPUA 1VQ53 1IVWA 5AEUB 4H61A 3VF1A 4TX4A 1GYBA 2CH9A 3OWYA 2IMJA 4HM0B 5KP4A 1IU7A 1W6YA 3K9MC 3LTBA 3CPW2 2MF7A 1YJ93 3ECFA 1IV9A 1W4NA 2W6JH 3GZXB 3K63A 2RGQA 4MMYB 4KFDA 3BNEA 2W0QA 6STDA 1ROVA 3PCRA 3EJVA 4MMZB 1DVCA 2JDIH 1KWIA 4NREA 5ELUA 1HU9A 1UUVB 5AI1A 1MNLA 1JB5A 5AIHA 2CWUA 3X3ZA 2XR8B 1WMOA 4JRFA 4OK0A 3MG1A 4BTYA 2HMLB 1G96A 3HZPA 1D6UA 3MKIA 8CHOA 1EA2A 3DUKA 1US1A 3O8YA 2F99A 4LSOA 1W2ZA 3LH4A 3DZLA 1CYVA 3GAXA 4FR9A 4U13A 3WMDA 3NM2A 1Y4KA 4XBXA 1OGZA 1UI7A 3X41A 2SBLA 3PCSA 3HX8A 3F14A 1JNQA 2K0MA 5KP1A 2C10A 2XEPA 1FGOA 2OOVA 3FG1A 1VQP3 3ROBA 3EC9A 4HM8B 1N5PA 3EHCA 3LZAA 1N8QA 1TP6A 2XGLA 1E3VA 3UL6A 1GS3A 3AMOA 4J8TA 1QVG2 1U5OA 2K54A 3NBBA 4LMIA 5KP3A 4WYKA 1W6CA 2XFSA 1VQM3 2GBXB 3S28A 4RBNA 4ZM8A 1TFOA 4R80A 3DGMA 4I4KA 1D6YA 2CG0A 3MSOA 4HM7B 3LXUX 1PU4A 1VQ73 3CXC2 3JUQA 3U1WA 3Q1CA 2Z77A 3EF8A 4FMDA 1RRLA 4HM4B 1VQK3 4O02B 4H3UA 3I0YA 3OV4A 3WA3A 3EBTA 1VQN3 5JBSA 3DGNA 3RGAA 1N9EA 3PYJA 3ER7A 1IQXA 5TGNA 2FNQA 3IJEB 1NJI4 4N6TA 1OCVA 1DMNA 1GY6A 2INXA 1ZO2A 3KIIA 3LOYA 2QIYA 2Z7AA 2KRTA 4K1UA 3E99A 4FCZA 3MPHA 3CD63 5D83A 2OWPA 4OVMA 1QJGA 3CC43 3EBYA 3CC73 1LNHA 3AMOB 3JUPA 4RNZA 3PGBA 4EV2A 2I9WA 3IPTA 1WMPA 1JB4A 4QWTA 2WOHA 3DGLA 3G4S3 3HIIA 4WYKB 3T0UA 2W03A 5IG0A 4XM4A 1JN5B 4AKYA 1QMAA 3MG2A 5STDA 2BHMA 2W9QA 5CLKA 3SVAA 1VQ83 3KN4A 2PNCA 2RSXA 3TDGA 1OHPA 1SJWA 2HMKB 5AYRB 1EG9B 5D81A 1IVUA 3KFQC 3UL5A 3FF0A 5JPUA 2FXTA 3JVCA 4KZ1A 2PZVA 4O3VA 3CCS3 2JQ5A 2KCDA 1FGMA 2QGUA 4L8PA 1VQL3 4HM5B 1QALA 3OWUA 4N6OB 2HMNB 1SIIA 4HJLB 1CQSA 4HM3B 1KSIA 1O7NB 5IENA 1FGQA 4MMXB 4O2HA 3HI7A 2CFWA 2XSHB 2D1WA 4EV5A 3STDA 1W7CA 4K61A 3CNXA 2CWTA 2GU3A 3SOYA 4KFFA 4WFOA 1UI8A 2E2VA 3X3YA 2W04A 4EC6A 3CPOA 1NB5I 4GB5A 1F8NA 5FW5A 1RN7A 2CG1A 1VQ63 3D3LA 5DREA 2BNGA 4HM6B 2F98A 1WTHA 4EYCA 1OH0A 3QK9A 5A0OB 4PEJA 5IG4A 1K9M4 3V99A 3K5TA 1W01A 3S5CA 1BUQA 2Y74A 1RKYA 2KXGA 1QAFA 1W5ZA 1STFI 5IF6A 2MC8A 5BVBA 1NDOB 4R1KA 3SLUA 2OOVC 1DVDA 2FGTA 3CCJ3 4WP5A 2CFKA 4HZBB 1WQLB 2YFJB 3FG4A 2YX9A 3KKGA 3NBRA 1A90A 3J7Yd 3B8LA 2LQVA 5CXOA 1L5GB 3FSDA 3WA2X 1Q7Y4 1S5AA 1W02A 4RZMA 3WODG 1Q40A 4LZIA 4JF8A 2GBWB 2Z6BA 3OXAA 1M904 3EX9A 1NU3A 5AYSC 3I563 3CMA3 1JV2B 4HVNA 2HMMB 2UX0A 4G1MB 5D82A 3EQQB 5IEOA 5CF1A 5EQLA 3D9RA 1GD4A 5IERA 2WO0A 1Q824 3B7CA 3SEDA 3K7CA 2LYXA 4AKZA 3FLJA 1OF5A 1JKGA 1GY7A 2CHCA 4J9AA 1YGEA 3CCU3 4HBRA 5IEPA 2P0MA 4FMCA 3SX1A 1N9JA 2BO9B 3OWSA 3LT8A 1Q814 2C11A 5FGOA 2XH9A 3RDEA 2YFIB 3S29A 4CCVA 2W56A 1WMNA 3GRDA 3HIGA 1FGTA 4GL6A 2OQEA 1KQS2 3G6E3 1A2VA 1OHOA 3LT9A 3PZWA 1GY5A 1VQ43 4WHAA 1VQ93 1ROAA 3NM7A 2P05A 3IMAB 1IT8A 2ML5A 3FCSB 3MWZA 4XBYA 2E2TA 1U8CB 3DGOA 3JUOA 3V98A 3DY5A 1IVVA 4EXRA 3MYTA 4CDLA 1ASKA 1FA3A 2GXFA 1FGRA 3F7XA 3G0KA 1QVF2 3Q90A 1K734 1Q40B 1OGXA 1M9GA 1NO3A 3B4PA 4XB5A 1O7GB 4K1VA 3BLZA 3EN1B 2CFGA 1IDPA 1AV4A 2CWVA 3GZYB 3S27A 3CCR3 1IQ8A 4O8SA 1OPYA 3F8XA 3N9HA 5CF2A 3X3XA 1TFKA 3U97A 4Q53A 4HKVB 1IV7A 3EB8A 3BB9A 4LGQA 5EVHA 3V92A 1Q864 1OF5B 4FMBA 5IW9A 1UUWB 1JKGB 2BMOB 2W2CA 2A15A 3LTAA 4N6MA 1YI23 3F9SA 1KD14 1CYUA 2ZDJA 2HMOB 2QA43 2CFDA 2CKFB 2F86B 3CU3A 2IA7A 3SXXA 2OTJ3 2W56B 3DM8A 5DRVA 5ELJA 3B4OA 1TU5A 4MJDA 1UW1A 3F40A 3N8BA 2IUJA 1OUNA 2HMJB 3EE1A 2WGQA 1DMQA 4XBTA 5HGRA 3G713 2P0XA 3DXOA 3EN8A 4BTWA 2Q07A 1K8A4 2RFRA 2L4VA 5AIGA 1ISKA 3BNBA 4STDA 1TIJA 3QRDA 1EKMA 5CK6A 2BT3A 3NXJA 1RRHA 4N6UA 1DMMA 1ZX2A 3FGYA 4HZ9B 5LC6A 7STDA 2B1XB 2W9PA 3L0RA 1YIJ3 1J2BA 3NV0A 3X42A 3PXMA 1ULIB 3CME3 4R4KA 3M8CA 4N6LA 1HKXA 3OX9A 1GD3A 5IG3A 1TUHA 3BNDA 1AVKA 3CCE3 1IK3A 3NHXA 4EBGA 1FUWA 1JRQA 3MG3A 2WOFA 1ULJB 1IQYA 1IT7A 1DYUA 1AVLA 2XF3A 4XDVA 2D42A 1Z1SA 4N6NB 1JJ22 3GZBA 3JUMA 3CNMA 1R4CA 2ML6A 3N54B 2OTL3 4HM2B 1YVBI 1A67A 3G8ZA 4N3VA 2ZL8A 3T8UA 4BTXA 2V1LA 1LOXA 1YJW3 3F8HA 1WNHA 2O3OA 1N5HA 1C7HA 2OCTA 4X2OA 1JB2A 1AR0A 1MOLA 3I553 1NB3I 3T8NA 1VZZA 1O7MB 2QEX3 4FMAA 3VSYA 3NUVA 3JUNA 3RGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMC A;  3GWR A;  3KZT A;  3G16 A;  3FH1 A;  1W00 A;  4FCJ A;  3HK4 A;  3NV0 B;  5JPP A;  1OHS A;  2GEY A;  2Z76 A;  3A76 A;  4WWU C;  1JN5 A;  3UNL A;  1K41 A;  3GZR A;  5G2G A;  4L8O A;  4LEH A;  4OUQ A;  2GEX A;  1E3R A;  4R9L A;  4FCM A;  1O7H B;  3F7S A;  3VGN A;  3KE7 A;  1E97 A;  2XSO B;  3KSP A;  3UJM A;  4R9K A;  4L7K A;  4XDW A;  3H3H A;  3SOA A;  1A2K A;  3FZW A;  5BXQ A;  2RCD A;  2B24 B;  5AII A;  3FKA A;  2YFL B;  2BMR B;  3FF2 A;  3H51 A;  1NWW A;  5IG5 A;  1STD A;  4KVH A;  3MHE A;  4ORL A;  2BMQ B;  2STD A;  1Q42 A;  5AIF A;  4IIA A;  3LYG A;  1O7P B;  3K0Z A;  1O7W B;  5AEW B;  2XRX B;  4HM1 B;  4X2H A;  2R4I A;  5AEU B;  1GYB A;  3OWY A;  2IMJ A;  4HM0 B;  5KP4 A;  1W6Y A;  3ECF A;  3GZX B;  2RGQ A;  6STD A;  3EJV A;  1UUV B;  5AI1 A;  1JB5 A;  5AIH A;  2XR8 B;  3MG1 A;  2HML B;  8CHO A;  3HZP A;  3MKI A;  1EA2 A;  3DUK A;  2F99 A;  3DZL A;  4U13 A;  3WMD A;  3NM2 A;  4XBX A;  1OGZ A;  3HX8 A;  3F14 A;  5KP1 A;  3ROB A;  3EC9 A;  4HM8 B;  3EHC A;  3LZA A;  1TP6 A;  1E3V A;  1GS3 A;  4J8T A;  1U5O A;  2K54 A;  4LMI A;  5KP3 A;  4WYK A;  2GBX B;  4I4K A;  3MSO A;  4HM7 B;  3JUQ A;  2Z77 A;  3EF8 A;  4HM4 B;  4H3U A;  3I0Y A;  3OV4 A;  3EBT A;  3RGA A;  3ER7 A;  5TGN A;  1OCV A;  1DMN A;  1GY6 A;  2INX A;  1ZO2 A;  2QIY A;  2Z7A A;  4K1U A;  3E99 A;  5D83 A;  2OWP A;  4OVM A;  1QJG A;  3EBY A;  3JUP A;  2I9W A;  3IPT A;  1JB4 A;  4WYK B;  5IG0 A;  4XM4 A;  1JN5 B;  1QMA A;  3MG2 A;  5STD A;  5CLK A;  1OHP A;  1SJW A;  2HMK B;  1EG9 B;  5D81 A;  3FF0 A;  5JPU A;  2PZV A;  2JQ5 A;  2QGU A;  4L8P A;  4HM5 B;  3OWU A;  2HMN B;  4HJL B;  1CQS A;  4HM3 B;  1O7N B;  5IEN A;  2XSH B;  3STD A;  3CNX A;  3SOY A;  3CPO A;  4GB5 A;  5FW5 A;  5DRE A;  2BNG A;  4HM6 B;  2F98 A;  1OH0 A;  4PEJ A;  5IG4 A;  1W01 A;  3S5C A;  1BUQ A;  5IF6 A;  5BVB A;  1NDO B;  4R1K A;  4WP5 A;  4HZB B;  1WQL B;  2YFJ B;  3NBR A;  3KKG A;  3B8L A;  5CXO A;  3FSD A;  1S5A A;  1W02 A;  4RZM A;  1Q40 A;  2GBW B;  3OXA A;  3EX9 A;  1NU3 A;  5D82 A;  4HVN A;  2HMM B;  2UX0 A;  3EQQ B;  5IEO A;  5CF1 A;  3D9R A;  5IER A;  3B7C A;  3SED A;  3K7C A;  3FLJ A;  1OF5 A;  1JKG A;  1GY7 A;  2CHC A;  4J9A A;  5IEP A;  3OWS A;  2YFI B;  3GRD A;  1OHO A;  1GY5 A;  4XBY A;  3JUO A;  3MYT A;  4CDL A;  1ASK A;  2GXF A;  3F7X A;  3G0K A;  3Q90 A;  1Q40 B;  1OGX A;  3B4P A;  4XB5 A;  1O7G B;  4K1V A;  3BLZ A;  3EN1 B;  1IDP A;  3GZY B;  1OPY A;  3F8X A;  5CF2 A;  4Q53 A;  4HKV B;  4LGQ A;  5EVH A;  3BB9 A;  1OF5 B;  1UUW B;  1JKG B;  2BMO B;  2W2C A;  2A15 A;  3F9S A;  2HMO B;  2CKF B;  2F86 B;  3CU3 A;  5DRV A;  3DM8 A;  3B4O A;  4MJD A;  3F40 A;  1OUN A;  2HMJ B;  1DMQ A;  4XBT A;  5HGR A;  3DXO A;  3EN8 A;  2RFR A;  5AIG A;  1ISK A;  4STD A;  5CK6 A;  3NXJ A;  1DMM A;  1ZX2 A;  3FGY A;  4HZ9 B;  7STD A;  2B1X B;  3NV0 A;  1ULI B;  3M8C A;  1HKX A;  3OX9 A;  5IG3 A;  1TUH A;  3NHX A;  3MG3 A;  1ULJ B;  4XDV A;  1Z1S A;  3GZB A;  3JUM A;  3CNM A;  4HM2 B;  3G8Z A;  4N3V A;  3T8U A;  3F8H A;  1C7H A;  4X2O A;  1JB2 A;  1AR0 A;  3T8N A;  1VZZ A;  1O7M B;  3VSY A;  3NUV A;  3JUN A;  3RGR A; 
#chains in the Genus database with same CATH topology
 3DMC A;  1BSE A;  3GWR A;  2E2U A;  2XFT A;  3G16 A;  3KZT A;  1PYL A;  3FH1 A;  3CC2 3;  4KT3 B;  1YGW A;  3D79 A;  1W00 A;  4BL2 A;  4FCJ A;  3HK4 A;  3NV0 B;  1X1X A;  6GSP A;  5JPP A;  3NQY A;  2CX1 A;  1OHS A;  1B2U A;  2WGO A;  5BIR A;  3PS8 A;  3LTD A;  3Q2P A;  1W2B 2;  1YIT 3;  2GEY A;  2Z76 A;  3A76 A;  1JN5 A;  4WWU C;  5EEO A;  3UNL A;  1K41 A;  3GZR A;  5G2G A;  1RDS A;  4L8O A;  1W6G A;  2F4Y A;  3OW2 2;  1LXE A;  1RGA A;  3NX0 A;  3LML A;  4IPB A;  4LEH A;  4OUQ A;  2OQE C;  2GEX A;  4KFE A;  2GU1 A;  1QAK A;  1LNI A;  1SQW A;  3WDG B;  1VQO 3;  3S67 A;  1E3R A;  1M1X B;  3NQZ A;  4R9L A;  1YHQ 3;  5GSP A;  1CEW I;  1RJO A;  4FCM A;  1YJN 3;  1O7H B;  7GSP A;  2CFL A;  3F7S A;  3VGN A;  2Y73 A;  2CIU A;  3KE7 A;  3CCL 3;  4MEI A;  4BIR A;  2IUK A;  1Q7H A;  1E97 A;  2XSO B;  1BSB A;  1X1U A;  3KSP A;  3UJM A;  1V74 A;  5G1K A;  1PFP A;  1N8R 4;  4R9K A;  2AAE A;  3UB1 A;  4L7K A;  4XDW A;  1VQQ A;  2CX0 A;  2O9U X;  3H3H A;  3CCM 3;  3CCV 3;  3SOA A;  4K90 B;  1SIH A;  1BNR A;  4HYZ A;  1A2K A;  1T2I A;  3FZW A;  5BXQ A;  4RNY A;  2RCD A;  1JBS A;  4N6V 0;  3WOF B;  2B24 B;  5AII A;  1M1K 4;  3FKA A;  2P09 A;  2YFL B;  1S72 3;  3BNC A;  3KSE D;  4BL3 A;  2P38 A;  3FG3 A;  7RNT A;  2BMR B;  4GHO A;  4NHF A;  1OAC A;  1LVN A;  1UGI A;  3FF2 A;  3H51 A;  4IT7 A;  1KC8 4;  1X1W A;  3LTC A;  1T3B A;  2CW9 A;  1K28 A;  1T5Y A;  1UGH I;  1NWW A;  5IG5 A;  1STD A;  1B2X A;  5M18 A;  3ALA A;  2CK3 H;  3D4A A;  1IVX A;  4KVH A;  1RGG A;  3MHE A;  1RGL A;  3NBJ A;  4ORL A;  2BMQ B;  2CC3 A;  2STD A;  4AEQ A;  2ZA4 A;  5I97 A;  1I0V A;  3Q3F A;  3X40 A;  2M7O A;  1D6Z A;  1Q42 A;  5AIF A;  4IIA A;  3LYG A;  3CCQ 3;  1O7P B;  3K0Z A;  1O7W B;  4CPK A;  5AEW B;  1EQK A;  1I2G A;  2XRX B;  5LC7 A;  4HM1 B;  2XGN A;  3A5E A;  4X2H A;  1BNI A;  1RMS A;  2R4I A;  1SPU A;  3WOE B;  1IVW A;  5AEU B;  1VQ5 3;  4H61 A;  1BIR A;  3VF1 A;  5BU4 A;  4TX4 A;  1GYB A;  2CH9 A;  3OWY A;  2BU4 A;  2IMJ A;  4HM0 B;  5KP4 A;  1IU7 A;  1W6Y A;  1BGS A;  3K9M C;  3LTB A;  3CPW 2;  1FUS A;  2MF7 A;  1YJ9 3;  3ECF A;  1IV9 A;  1W4N A;  2W6J H;  3GZX B;  3K63 A;  2RGQ A;  5M19 A;  1B27 A;  1T2H A;  4MMY B;  2RNT A;  4KFD A;  3BNE A;  2W0Q A;  6STD A;  1FZU A;  1ROV A;  3PCR A;  3EJV A;  4MMZ B;  1DVC A;  1PY3 A;  1LQG C;  1KWI A;  1GOV A;  2JDI H;  2KF3 A;  4NRE A;  5ELU A;  1HU9 A;  1UUV B;  5AI1 A;  1MNL A;  1JB5 A;  5AIH A;  2CWU A;  3X3Z A;  2XR8 B;  1WMO A;  4JRF A;  4OK0 A;  3MG1 A;  4BTY A;  1RNB A;  1R4Y A;  2HML B;  1G96 A;  3HZP A;  1D6U A;  3MKI A;  8CHO A;  1EA2 A;  3DUK A;  1US1 A;  3O8Y A;  2BIR A;  2F99 A;  4LSO A;  4RNT A;  1W2Z A;  3LH4 A;  2SAR A;  3DZL A;  1CYV A;  1FUT A;  3GAX A;  4FR9 A;  4U13 A;  3WMD A;  3NM2 A;  1Y4K A;  1RLS A;  4XBX A;  1OGZ A;  1UI7 A;  4J5K A;  3X41 A;  2SBL A;  3PCS A;  3ZG5 A;  3HX8 A;  3F14 A;  1JNQ A;  1UUG B;  2K0M A;  5KP1 A;  2C10 A;  1BOX A;  1G0T A;  2XEP A;  1FGO A;  2OOV A;  1V57 A;  1X1Y A;  3FG1 A;  1VQP 3;  1YNV X;  3ROB A;  3EC9 A;  4HM8 B;  1N5P A;  3EHC A;  3LZA A;  2RBI A;  1N8Q A;  1TP6 A;  2H0I A;  2XGL A;  1E3V A;  3UL6 A;  1GS3 A;  3AMO A;  4J8T A;  1QVG 2;  1U5O A;  2K54 A;  2IY2 A;  1BSA A;  1BNJ A;  3NBB A;  1SAR A;  4LMI A;  1JZD A;  5KP3 A;  4WYK A;  1LRA A;  1CH0 A;  1W6C A;  2XFS A;  1VQM 3;  1EUI C;  2GBX B;  3S28 A;  3WHO A;  4RBN A;  1BRK A;  4ZM8 A;  1TFO A;  4R80 A;  3DGM A;  4I4K A;  1D6Y A;  2KF4 A;  2CG0 A;  3MSO A;  1UCL A;  3LXU X;  4HM7 B;  1PU4 A;  1VQ7 3;  3CXC 2;  3JUQ A;  3U1W A;  3Q1C A;  2Z77 A;  1UCI A;  3EF8 A;  2KF6 A;  4FMD A;  1RRL A;  4EW5 A;  4HM4 B;  1VQK 3;  4O02 B;  1BSC A;  3I0Y A;  3OV4 A;  4H3U A;  3EBT A;  3WA3 A;  1VQN 3;  5JBS A;  3DGN A;  2H0H A;  3RGA A;  1N9E A;  1UCJ A;  3PYJ A;  3ER7 A;  1IQX A;  5TGN A;  4I5Q A;  1LOV A;  2FNQ A;  3IJE B;  1NJI 4;  4N6T A;  1OCV A;  1DMN A;  1TRQ A;  2K3D A;  1GY6 A;  2INX A;  1ZO2 A;  3KII A;  3LOY A;  2QIY A;  2Z7A A;  1C54 A;  2KRT A;  4K1U A;  3E99 A;  1RGK A;  4FCZ A;  3MPH A;  3CD6 3;  5D83 A;  2OWP A;  4OVM A;  2F56 A;  1BRH A;  1GSP A;  1QJG A;  3CC4 3;  1BRN L;  1GOU A;  1LOY A;  3WR2 A;  3EBY A;  3CC7 3;  1LNH A;  1LOW A;  3AMO B;  3JUP A;  1BNF A;  1A2P A;  4RNZ A;  3PGB A;  4EV2 A;  2I9W A;  3IPT A;  1WMP A;  1JB4 A;  4QWT A;  2WOH A;  1BRG A;  3DGL A;  3G4S 3;  2GSP A;  3HII A;  4WYK B;  3T0U A;  2W03 A;  5IG0 A;  4XM4 A;  1JN5 B;  4AKY A;  1QMA A;  1ZS7 A;  1BU4 A;  1BVI A;  3MG2 A;  5STD A;  2BHM A;  2W9Q A;  1B3S A;  5CLK A;  3RNT A;  3KN4 A;  2PNC A;  3SVA A;  2RSX A;  2UGI A;  4J5G A;  1BUJ A;  1MGR A;  3TDG A;  1OHP A;  1SJW A;  2C4B A;  2F5M A;  2HMK B;  3KCH A;  5AYR B;  1EG9 B;  5D81 A;  1IVU A;  3KFQ C;  3UL5 A;  3FF0 A;  1I70 A;  1MGW A;  5JPU A;  2FXT A;  5G1L A;  1DET A;  3JVC A;  1RGF A;  4KZ1 A;  1BRJ A;  2PZV A;  4O3V A;  3CCS 3;  3ZFZ A;  2JQ5 A;  2KCD A;  1FGM A;  2QGU A;  4L8P A;  1VQL 3;  4HM5 B;  1QAL A;  3OWU A;  3URP A;  4N6O B;  2HMN B;  1SII A;  4HJL B;  1CQS A;  4HM3 B;  1KSI A;  8RNT A;  1O7N B;  1UCK A;  1RGC A;  1FGQ A;  1RN4 A;  5IEN A;  4MMX B;  4O2H A;  3HI7 A;  2CFW A;  2R41 A;  2XSH B;  2D1W A;  4EV5 A;  3STD A;  1W7C A;  1RSN A;  4K61 A;  3CNX A;  2UUG C;  2CWT A;  1YVS A;  2GU3 A;  3BU4 A;  3SOY A;  1BAO A;  4KFF A;  1AY7 A;  4WFO A;  1UI8 A;  1I8V A;  2E2V A;  3X3Y A;  6RNT A;  2W04 A;  4EC6 A;  1B2S A;  3CPO A;  4HOH A;  1NB5 I;  4GB5 A;  1F8N A;  5FW5 A;  1RN7 A;  2CG1 A;  1VQ6 3;  3D3L A;  9RNT A;  5DRE A;  2BNG A;  1HZ1 A;  4HM6 B;  2F98 A;  1BRI A;  1BNE A;  1WTH A;  4EYC A;  1B2M A;  1MWS A;  1OH0 A;  3QK9 A;  5A0O B;  3DH2 A;  4PEJ A;  5IG4 A;  1K9M 4;  4BU4 A;  3V99 A;  3K5T A;  1W01 A;  3S5C A;  1BUQ A;  1NNV A;  2Y74 A;  1RKY A;  2KXG A;  1QAF A;  1W5Z A;  1STF I;  2J8X B;  2ZHX B;  4LYL B;  1ZGX A;  2MC8 A;  5IF6 A;  1BRS A;  2F5W A;  1TTO A;  5BVB A;  1NDO B;  1G02 A;  4R1K A;  1RCL A;  2OOV C;  4NPB A;  3SLU A;  1DVD A;  2FGT A;  3CCJ 3;  4WP5 A;  2CFK A;  4HZB B;  1WQL B;  2YFJ B;  3FG4 A;  2YX9 A;  3KKG A;  3NBR A;  1A90 A;  3J7Y d;  3B8L A;  2LQV A;  5CXO A;  1L5G B;  3FSD A;  3WA2 X;  1B21 A;  1Q7Y 4;  1S5A A;  1W02 A;  4RZM A;  1I3I A;  3WOD G;  1Q40 A;  4LZI A;  4JF8 A;  2GBW B;  2Z6B A;  3OXA A;  1M90 4;  3EX9 A;  4GSP A;  1NU3 A;  5AYS C;  3I56 3;  3CMA 3;  1I2F A;  1JV2 B;  4HVN A;  2HMM B;  2UX0 A;  4G1M B;  1RCK A;  5D82 A;  3EQQ B;  5IEO A;  5CF1 A;  5EQL A;  3D9R A;  1GD4 A;  5IER A;  2WO0 A;  1Q82 4;  3B7C A;  3SED A;  3K7C A;  2LYX A;  1MWU A;  2KF5 A;  3FLJ A;  1I3F A;  1OF5 A;  4AKZ A;  1JKG A;  2HOH A;  3GSP A;  1GY7 A;  2CHC A;  1BNG A;  4J9A A;  1YGE A;  3CCU 3;  4HBR A;  1TRP A;  5IEP A;  2P0M A;  3AHW A;  4FMC A;  3SX1 A;  3SYU A;  1RTU A;  1N9J A;  2BO9 B;  3OWS A;  3LT8 A;  1MWR A;  1Q81 4;  1HYF A;  2C11 A;  5FGO A;  2XH9 A;  3RDE A;  2YFI B;  3S29 A;  4CCV A;  2W56 A;  1WMN A;  3GRD A;  3HIG A;  1FGT A;  4GL6 A;  2OQE A;  1KQS 2;  3G6E 3;  1A2V A;  1OHO A;  3LT9 A;  3PZW A;  1GY5 A;  1VQ4 3;  4WHA A;  1VQ9 3;  1ROA A;  3NM7 A;  2P05 A;  3IMA B;  1IT8 A;  3D5G A;  2ML5 A;  3FCS B;  3MWZ A;  4XBY A;  2E2T A;  1U8C B;  1BSD A;  2L1S A;  3DGO A;  3JUO A;  2KAA A;  3DY5 A;  3V98 A;  1IVV A;  3AGN A;  4EXR A;  3MYT A;  4ILF A;  1ASK A;  1RNT A;  4CDL A;  1JZO A;  2GXF A;  1FA3 A;  1FGR A;  3F7X A;  1FW7 A;  3G0K A;  1QVF 2;  3Q90 A;  1K73 4;  1Q40 B;  1OGX A;  1M9G A;  1B20 A;  1NO3 A;  3B4P A;  4XB5 A;  1O7G B;  4K1V A;  3BLZ A;  3EN1 B;  5M1A A;  2CFG A;  1IDP A;  1AV4 A;  1I2E A;  2AAD A;  2CWV A;  3GZY B;  3S27 A;  3CCR 3;  1IQ8 A;  1GMR A;  4O8S A;  1OPY A;  3F8X A;  3N9H A;  5CF2 A;  3X3X A;  1UDI I;  1TFK A;  1JBR A;  3U97 A;  4Q53 A;  4HKV B;  1IV7 A;  3EB8 A;  3BB9 A;  4LGQ A;  5EVH A;  3V92 A;  5RNT A;  1Q86 4;  1OF5 B;  4FMB A;  5IW9 A;  1UUW B;  1JKG B;  2BMO B;  2W2C A;  2A15 A;  3LTA A;  4N6M A;  1RGH A;  1BNS A;  3F9S A;  1YI2 3;  1KD1 4;  1CYU A;  2ZDJ A;  3AHS A;  2HMO B;  2QA4 3;  2CFD A;  2CKF B;  2H0G A;  2F86 B;  3CU3 A;  2IA7 A;  3SXX A;  3DGY A;  1AQZ A;  2OTJ 3;  1GMQ A;  1RN1 A;  2W56 B;  1MWT A;  3DM8 A;  5DRV A;  3B4O A;  5ELJ A;  4MJD A;  1TU5 A;  1UW1 A;  1FYS A;  1EEJ A;  3F40 A;  3N8B A;  2IUJ A;  1GOY A;  1OUN A;  2HMJ B;  3EE1 A;  2WGQ A;  1DMQ A;  1Q9E A;  4XBT A;  5HGR A;  3G71 3;  1I0X A;  2P0X A;  3DXO A;  3EN8 A;  4BTW A;  2Q07 A;  1K8A 4;  2RFR A;  2L4V A;  5AIG A;  1ISK A;  3BNB A;  2IYJ A;  4STD A;  1TIJ A;  3QRD A;  1EKM A;  5CK6 A;  2BT3 A;  3NXJ A;  1RRH A;  4N6U A;  1DMM A;  1ZX2 A;  3FGY A;  1V58 A;  3HOH A;  4HAA A;  4HZ9 B;  2B1X B;  5LC6 A;  7STD A;  3D5I A;  2W9P A;  3L0R A;  1YIJ 3;  1J2B A;  3NV0 A;  3X42 A;  3PXM A;  1ULI B;  3BIR A;  3CME 3;  1GMP A;  4R4K A;  3M8C A;  4N6L A;  1HKX A;  3OX9 A;  1GD3 A;  5IG3 A;  1TUH A;  3BND A;  1AVK A;  3CCE 3;  5HOH A;  1IK3 A;  3NHX A;  1B2Z A;  1RHL A;  3ZG0 A;  4EBG A;  1FUW A;  1BAN A;  1JRQ A;  3MG3 A;  1RGE A;  2WOF A;  1ULJ B;  1IQY A;  1IT7 A;  1DYU A;  1AVL A;  2XF3 A;  4XDV A;  2D42 A;  1Z1S A;  4N6N B;  1JJ2 2;  3GZB A;  3JUM A;  3CNM A;  1R4C A;  2ML6 A;  1LQM B;  3N54 B;  2OTL 3;  3AGO A;  4HM2 B;  1YVB I;  1JBT A;  1A67 A;  1DE3 A;  1VQ8 3;  3G8Z A;  4N3V A;  2ZL8 A;  3T8U A;  4BTX A;  2V1L A;  1LOX A;  1YJW 3;  3F8H A;  1WNH A;  2O3O A;  1N5H A;  1TJD A;  1C7H A;  2OCT A;  4X2O A;  1JB2 A;  1AR0 A;  1MOL A;  3I55 3;  1NB3 I;  3T8N A;  1VZZ A;  1O7M B;  4CJN A;  4FMA A;  3VSY A;  2QEX 3;  1IYY A;  3NUV A;  3JUN A;  4DKI A;  3RGR A; 
#chains in the Genus database with same CATH homology
 3DMC A;  3GWR A;  2E2U A;  2XFT A;  3G16 A;  3KZT A;  3FH1 A;  3CC2 3;  1W00 A;  4FCJ A;  3HK4 A;  3NV0 B;  5JPP A;  3NQY A;  1OHS A;  2WGO A;  3PS8 A;  3LTD A;  3Q2P A;  1W2B 2;  1YIT 3;  2GEY A;  2Z76 A;  3A76 A;  1JN5 A;  4WWU C;  5EEO A;  3UNL A;  1K41 A;  3GZR A;  5G2G A;  4L8O A;  1W6G A;  3OW2 2;  1LXE A;  3NX0 A;  4IPB A;  3LML A;  4LEH A;  4OUQ A;  2OQE C;  2GEX A;  4KFE A;  2GU1 A;  1QAK A;  1SQW A;  3WDG B;  1VQO 3;  1YHQ 3;  3S67 A;  1E3R A;  1M1X B;  3NQZ A;  4R9L A;  1CEW I;  1RJO A;  4FCM A;  1YJN 3;  1O7H B;  2CFL A;  3F7S A;  3VGN A;  2Y73 A;  2CIU A;  3KE7 A;  3CCL 3;  4MEI A;  2IUK A;  1E97 A;  2XSO B;  3KSP A;  3UJM A;  1V74 A;  1PFP A;  1N8R 4;  4R9K A;  3UB1 A;  4L7K A;  4XDW A;  2O9U X;  3H3H A;  3CCM 3;  3CCV 3;  3SOA A;  4K90 B;  1SIH A;  4HYZ A;  1A2K A;  3FZW A;  5BXQ A;  4RNY A;  2RCD A;  4N6V 0;  3WOF B;  2B24 B;  5AII A;  1M1K 4;  3FKA A;  2P09 A;  2YFL B;  1S72 3;  3BNC A;  3KSE D;  2P38 A;  3FG3 A;  2BMR B;  4NHF A;  1OAC A;  1LVN A;  3FF2 A;  3H51 A;  4IT7 A;  1KC8 4;  3LTC A;  2CW9 A;  1K28 A;  1T5Y A;  1NWW A;  5IG5 A;  1STD A;  3ALA A;  2CK3 H;  1IVX A;  4KVH A;  3MHE A;  3NBJ A;  4ORL A;  2BMQ B;  2CC3 A;  2STD A;  4AEQ A;  5I97 A;  3X40 A;  2M7O A;  1D6Z A;  1Q42 A;  5AIF A;  4IIA A;  3LYG A;  3CCQ 3;  1O7P B;  3K0Z A;  1O7W B;  5AEW B;  1EQK A;  2XRX B;  5LC7 A;  4HM1 B;  2XGN A;  4X2H A;  3WOE B;  2R4I A;  1SPU A;  1VQ5 3;  1IVW A;  5AEU B;  4H61 A;  3VF1 A;  4TX4 A;  1GYB A;  2CH9 A;  3OWY A;  2IMJ A;  4HM0 B;  5KP4 A;  1IU7 A;  1W6Y A;  3K9M C;  3LTB A;  3CPW 2;  2MF7 A;  1YJ9 3;  3ECF A;  1IV9 A;  1W4N A;  2W6J H;  3GZX B;  3K63 A;  2RGQ A;  4MMY B;  4KFD A;  3BNE A;  2W0Q A;  6STD A;  1ROV A;  3PCR A;  3EJV A;  4MMZ B;  1DVC A;  2JDI H;  1KWI A;  4NRE A;  5ELU A;  1HU9 A;  1UUV B;  5AI1 A;  1MNL A;  1JB5 A;  5AIH A;  2CWU A;  3X3Z A;  2XR8 B;  1WMO A;  4JRF A;  4OK0 A;  3MG1 A;  4BTY A;  2HML B;  1G96 A;  3HZP A;  1D6U A;  3MKI A;  8CHO A;  1EA2 A;  3DUK A;  1US1 A;  3O8Y A;  2F99 A;  4LSO A;  1W2Z A;  3LH4 A;  3DZL A;  1CYV A;  3GAX A;  4FR9 A;  4U13 A;  3WMD A;  3NM2 A;  1Y4K A;  4XBX A;  1OGZ A;  1UI7 A;  3X41 A;  2SBL A;  3PCS A;  3HX8 A;  3F14 A;  1JNQ A;  2K0M A;  5KP1 A;  2C10 A;  2XEP A;  1FGO A;  2OOV A;  3FG1 A;  1VQP 3;  3ROB A;  3EC9 A;  4HM8 B;  1N5P A;  3EHC A;  3LZA A;  1N8Q A;  1TP6 A;  2XGL A;  1E3V A;  3UL6 A;  1GS3 A;  3AMO A;  4J8T A;  1QVG 2;  1U5O A;  2K54 A;  3NBB A;  4LMI A;  5KP3 A;  4WYK A;  1W6C A;  2XFS A;  1VQM 3;  2GBX B;  3S28 A;  4RBN A;  4ZM8 A;  1TFO A;  4R80 A;  3DGM A;  4I4K A;  1D6Y A;  2CG0 A;  3MSO A;  4HM7 B;  3LXU X;  1PU4 A;  1VQ7 3;  3CXC 2;  3JUQ A;  3U1W A;  3Q1C A;  2Z77 A;  3EF8 A;  4FMD A;  1RRL A;  4HM4 B;  1VQK 3;  4O02 B;  4H3U A;  3I0Y A;  3OV4 A;  3WA3 A;  3EBT A;  1VQN 3;  5JBS A;  3DGN A;  3RGA A;  1N9E A;  3PYJ A;  3ER7 A;  1IQX A;  5TGN A;  2FNQ A;  3IJE B;  1NJI 4;  4N6T A;  1OCV A;  1DMN A;  1GY6 A;  2INX A;  1ZO2 A;  3KII A;  3LOY A;  2QIY A;  2Z7A A;  2KRT A;  4K1U A;  3E99 A;  4FCZ A;  3MPH A;  3CD6 3;  5D83 A;  2OWP A;  4OVM A;  1QJG A;  3CC4 3;  3EBY A;  3CC7 3;  1LNH A;  3AMO B;  3JUP A;  4RNZ A;  3PGB A;  4EV2 A;  2I9W A;  3IPT A;  1WMP A;  1JB4 A;  4QWT A;  2WOH A;  3DGL A;  3G4S 3;  3HII A;  4WYK B;  3T0U A;  2W03 A;  5IG0 A;  4XM4 A;  1JN5 B;  4AKY A;  1QMA A;  3MG2 A;  5STD A;  2BHM A;  2W9Q A;  5CLK A;  3SVA A;  1VQ8 3;  3KN4 A;  2PNC A;  2RSX A;  3TDG A;  1OHP A;  1SJW A;  2HMK B;  5AYR B;  1EG9 B;  5D81 A;  1IVU A;  3KFQ C;  3UL5 A;  3FF0 A;  5JPU A;  2FXT A;  3JVC A;  4KZ1 A;  2PZV A;  4O3V A;  3CCS 3;  2JQ5 A;  2KCD A;  1FGM A;  2QGU A;  4L8P A;  1VQL 3;  4HM5 B;  1QAL A;  3OWU A;  4N6O B;  2HMN B;  1SII A;  4HJL B;  1CQS A;  4HM3 B;  1KSI A;  1O7N B;  5IEN A;  1FGQ A;  4MMX B;  4O2H A;  3HI7 A;  2CFW A;  2XSH B;  2D1W A;  4EV5 A;  3STD A;  1W7C A;  4K61 A;  3CNX A;  2CWT A;  2GU3 A;  3SOY A;  4KFF A;  4WFO A;  1UI8 A;  2E2V A;  3X3Y A;  2W04 A;  4EC6 A;  3CPO A;  1NB5 I;  4GB5 A;  1F8N A;  5FW5 A;  1RN7 A;  2CG1 A;  1VQ6 3;  3D3L A;  5DRE A;  2BNG A;  4HM6 B;  2F98 A;  1WTH A;  4EYC A;  1OH0 A;  3QK9 A;  5A0O B;  4PEJ A;  5IG4 A;  1K9M 4;  3V99 A;  3K5T A;  1W01 A;  3S5C A;  1BUQ A;  2Y74 A;  1RKY A;  2KXG A;  1QAF A;  1W5Z A;  1STF I;  5IF6 A;  2MC8 A;  5BVB A;  1NDO B;  4R1K A;  3SLU A;  2OOV C;  1DVD A;  2FGT A;  3CCJ 3;  4WP5 A;  2CFK A;  4HZB B;  1WQL B;  2YFJ B;  3FG4 A;  2YX9 A;  3KKG A;  3NBR A;  1A90 A;  3J7Y d;  3B8L A;  2LQV A;  5CXO A;  1L5G B;  3FSD A;  3WA2 X;  1Q7Y 4;  1S5A A;  1W02 A;  4RZM A;  3WOD G;  1Q40 A;  4LZI A;  4JF8 A;  2GBW B;  2Z6B A;  3OXA A;  1M90 4;  3EX9 A;  1NU3 A;  5AYS C;  3I56 3;  3CMA 3;  1JV2 B;  4HVN A;  2HMM B;  2UX0 A;  4G1M B;  5D82 A;  3EQQ B;  5IEO A;  5CF1 A;  5EQL A;  3D9R A;  1GD4 A;  5IER A;  2WO0 A;  1Q82 4;  3B7C A;  3SED A;  3K7C A;  2LYX A;  4AKZ A;  3FLJ A;  1OF5 A;  1JKG A;  1GY7 A;  2CHC A;  4J9A A;  1YGE A;  3CCU 3;  4HBR A;  5IEP A;  2P0M A;  4FMC A;  3SX1 A;  1N9J A;  2BO9 B;  3OWS A;  3LT8 A;  1Q81 4;  2C11 A;  5FGO A;  2XH9 A;  3RDE A;  2YFI B;  3S29 A;  4CCV A;  2W56 A;  1WMN A;  3GRD A;  3HIG A;  1FGT A;  4GL6 A;  2OQE A;  1KQS 2;  3G6E 3;  1A2V A;  1OHO A;  3LT9 A;  3PZW A;  1GY5 A;  1VQ4 3;  4WHA A;  1VQ9 3;  1ROA A;  3NM7 A;  2P05 A;  3IMA B;  1IT8 A;  2ML5 A;  3FCS B;  3MWZ A;  4XBY A;  2E2T A;  1U8C B;  3DGO A;  3JUO A;  3V98 A;  3DY5 A;  1IVV A;  4EXR A;  3MYT A;  4CDL A;  1ASK A;  1FA3 A;  2GXF A;  1FGR A;  3F7X A;  3G0K A;  1QVF 2;  3Q90 A;  1K73 4;  1Q40 B;  1OGX A;  1M9G A;  1NO3 A;  3B4P A;  4XB5 A;  1O7G B;  4K1V A;  3BLZ A;  3EN1 B;  2CFG A;  1IDP A;  1AV4 A;  2CWV A;  3GZY B;  3S27 A;  3CCR 3;  1IQ8 A;  4O8S A;  1OPY A;  3F8X A;  3N9H A;  5CF2 A;  3X3X A;  1TFK A;  3U97 A;  4Q53 A;  4HKV B;  1IV7 A;  3EB8 A;  3BB9 A;  4LGQ A;  5EVH A;  3V92 A;  1Q86 4;  1OF5 B;  4FMB A;  5IW9 A;  1UUW B;  1JKG B;  2BMO B;  2W2C A;  2A15 A;  3LTA A;  4N6M A;  1YI2 3;  3F9S A;  1KD1 4;  1CYU A;  2ZDJ A;  2HMO B;  2QA4 3;  2CFD A;  2CKF B;  2F86 B;  3CU3 A;  2IA7 A;  3SXX A;  2OTJ 3;  2W56 B;  3DM8 A;  5DRV A;  5ELJ A;  3B4O A;  1TU5 A;  4MJD A;  1UW1 A;  3F40 A;  3N8B A;  2IUJ A;  1OUN A;  2HMJ B;  3EE1 A;  2WGQ A;  1DMQ A;  4XBT A;  5HGR A;  3G71 3;  2P0X A;  3DXO A;  3EN8 A;  4BTW A;  2Q07 A;  1K8A 4;  2RFR A;  2L4V A;  5AIG A;  1ISK A;  3BNB A;  4STD A;  1TIJ A;  3QRD A;  1EKM A;  5CK6 A;  2BT3 A;  3NXJ A;  1RRH A;  4N6U A;  1DMM A;  1ZX2 A;  3FGY A;  4HZ9 B;  5LC6 A;  7STD A;  2B1X B;  2W9P A;  3L0R A;  1YIJ 3;  1J2B A;  3NV0 A;  3X42 A;  3PXM A;  1ULI B;  3CME 3;  4R4K A;  3M8C A;  4N6L A;  1HKX A;  3OX9 A;  1GD3 A;  5IG3 A;  1TUH A;  3BND A;  1AVK A;  3CCE 3;  1IK3 A;  3NHX A;  4EBG A;  1FUW A;  1JRQ A;  3MG3 A;  2WOF A;  1ULJ B;  1IQY A;  1IT7 A;  1DYU A;  1AVL A;  2XF3 A;  4XDV A;  2D42 A;  1Z1S A;  4N6N B;  1JJ2 2;  3GZB A;  3JUM A;  3CNM A;  1R4C A;  2ML6 A;  3N54 B;  2OTL 3;  4HM2 B;  1YVB I;  1A67 A;  3G8Z A;  4N3V A;  2ZL8 A;  3T8U A;  4BTX A;  2V1L A;  1LOX A;  1YJW 3;  3F8H A;  1WNH A;  2O3O A;  1N5H A;  1C7H A;  2OCT A;  4X2O A;  1JB2 A;  1AR0 A;  1MOL A;  3I55 3;  1NB3 I;  3T8N A;  1VZZ A;  1O7M B;  2QEX 3;  4FMA A;  3VSY A;  3NUV A;  3JUN A;  3RGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...