1O7HB

Naphthalene 1,2-dioxygenase with oxidized rieske iron sulphur center site.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
total genus 54
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7hB00
2YFIB 2Z76A 1EG9B 1STDA 3DZLA 5G2GA 2F86B 3STDA 3JUOA 3LYGA 4XBYA 3GRDA 2RFRA 1WQLB 5HGRA 3EN8A 5DREA 2XRXB 3H3HA 2XSHB 3NM2A 5KP3A 3FKAA 4N3VA 3OXAA 4HJLB 3F14A 3I0YA 3IPTA 3HX8A 5IENA 3H51A 3NHXA 2GXFA 1JB4A 1ZX2A 2IMJA 3SEDA 5D83A 4HM4B 4H3UA 5IG3A 7STDA 3ECFA 1O7GB 4RZMA 1EA2A 3MG3A 4K1VA 4OUQA 3VSYA 4IIAA 3G8ZA 1DMQA 1GY6A 3DUKA 4KVHA 1JKGA 1NWWA 2GEYA 1TUHA 1O7MB 3KZTA 3RGRA 2STDA 3NV0B 4HM6B 4XBXA 4XB5A 1OHOA 3K0ZA 3Q90A 3KSPA 3JUQA 5CLKA 2R4IA 3B4OA 3S5CA 5KP1A 3F7SA 4PEJA 1GS3A 3CU3A 4FCJA 1TP6A 2CHCA 2GBWB 3G0KA 5AIFA 4LEHA 2HMMB 1ASKA 2QGUA 3MG2A 2BMRB 1IDPA 3F8XA 1UUWB 3F9SA 2HMJB 4WYKB 1ZO2A 4CDLA 2INXA 2K54A 5D81A 2BMOB 2HMKB 5BXQA 4HM1B 3MSOA 1W6YA 3LZAA 3M8CA 1JN5A 3GWRA 3JUPA 5AIHA 3SOAA 1OPYA 3BLZA 5BVBA 4HM0B 4OVMA 1HKXA 3EC9A 3FZWA 1OF5B 5CF1A 2JQ5A 3KE7A 1OUNA 4ORLA 1OCVA 1ULIB 4K1UA 1QJGA 3FF0A 1A2KA 3E99A 5DRVA 4XM4A 3F7XA 3OV4A 5AIIA 1JB2A 1ISKA 3EHCA 1QMAA 2UX0A 3OWSA 5IF6A 2BMQB 1Q40B 3HK4A 3DMCA 3HZPA 3SOYA 3T8NA 3KKGA 3B7CA 2YFLB 4R1KA 4LMIA 2XR8B 5CF2A 3NXJA 1GY5A 1W01A 3CNMA 4HVNA 1O7WB 3OWYA 2RCDA 2CKFB 1JB5A 1ULJB 3EBTA 2QIYA 2HMOB 3F40A 3T8UA 1O7HB 3MYTA 5IERA 1Q42A 3JUMA 1OGXA 4HM8B 5AIGA 3A76A 6STDA 5IEOA 4X2HA 3EBYA 1OHSA 3EF8A 2BNGA 4HZ9B 3DM8A 3EN1B 3FF2A 3UNLA 3DXOA 3OX9A 5D82A 2HMLB 4GB5A 2OWPA 3EQQB 4J9AA 1JKGB 3B8LA 2YFJB 4R9LA 5AI1A 1OHPA 8CHOA 1SJWA 4HM3B 3OWUA 4U13A 3CPOA 4MJDA 1UUVB 3CNXA 4XBTA 3NV0A 2A15A 3FSDA 4HM7B 1E3VA 5IG4A 4I4KA 3EJVA 3ROBA 3WMDA 3FLJA 2B24B 2F98A 1AR0A 3GZBA 2Z7AA 3GZYB 5FW5A 5EVHA 4L8PA 3MG1A 1O7NB 1W00A 5IG0A 4WWUC 1NU3A 1S5AA 5CK6A 1VZZA 1GYBA 3BB9A 3GZRA 2RGQA 4FCMA 1JN5B 4WYKA 3FGYA 2I9WA 1BUQA 5STDA 3NUVA 4L7KA 4L8OA 3B4PA 3VGNA 5KP4A 4WP5A 3D9RA 1GY7A 2Z77A 2HMNB 1DMMA 1CQSA 1U5OA 4HKVB 1E3RA 3FH1A 2W2CA 1OF5A 4XDWA 4STDA 1C7HA 1K41A 1OH0A 3EX9A 2GBXB 2B1XB 3NBRA 3GZXB 4R9KA 3ER7A 5CXOA 3UJMA 2GEXA 4HM5B 3JUNA 1DMNA 5AEUB 4XDVA 5JPPA 5IEPA 5IG5A 2F99A 1W02A 1Q40A 3RGAA 3MKIA 4J8TA 5TGNA 4X2OA 2XSOB 3G16A 3F8HA 4HM2B 1NDOB 1Z1SA 4LGQA 3K7CA 1OGZA 1E97A 5AEWB 2PZVA 4HZBB 5JPUA 4Q53A 3MHEA 1O7PB
chains in the Genus database with same CATH superfamily
2CIUA 2YFIB 5IW9A 2Z76A 1EG9B 2XEPA 6GSPA 3D5GA 3NBBA 3UL6A 1STDA 2KRTA 4LSOA 3DZLA 5G2GA 3G713 2F86B 3STDA 3JUOA 2L1SA 1GD4A 2W0QA 3LYGA 3G6E3 4XBYA 1IT7A 4N6OB 3GRDA 2RFRA 1WQLB 1WTHA 1FGRA 1QAKA 1U8CB 4BIRA 5HGRA 5HOHA 3EN8A 3LH4A 1YVSA 1NB3I 1N8R4 1RGHA 4BL2A 5DREA 3CD63 1OACA 3ALAA 2XRXB 1B2UA 1CYVA 1DETA 1YJ93 3CC23 2P0XA 1FUSA 3H3HA 1R4YA 1SIIA 2XSHB 3CCV3 2C4BA 3NM2A 1KQS2 1WMPA 3V92A 5KP3A 3FKAA 4N3VA 2IA7A 2IUKA 3OXAA 2F5WA 5EEOA 4HJLB 3F14A 4AKZA 3I0YA 1FGTA 2BO9B 1B3SA 1G0TA 1JJ22 2OTJ3 3IPTA 2BHMA 3HX8A 1BRNL 3EE1A 5IENA 3H51A 4HBRA 3NHXA 2L4VA 3CXC2 2FGTA 1JB4A 2GXFA 1JZOA 1RGCA 3D4AA 1VQK3 1KC84 1ZX2A 2IMJA 3SEDA 5D83A 4KFFA 4N6V0 4HM4B 5AYSC 4EBGA 1SQWA 1YJW3 4H3UA 1NJI4 5IG3A 1BNGA 2CFDA 7STDA 3ECFA 1CH0A 1O7GB 4RZMA 1VQ43 2O3OA 1EA2A 1TJDA 5M18A 2BIRA 3MG3A 3UB1A 4K1VA 2V1LA 4FCZA 1Q7HA 1W6GA 4OUQA 2BU4A 1DE3A 1RN4A 3Q2PA 4CJNA 2E2TA 3S67A 1YVBI 1I3FA 3VSYA 1IQYA 4IIAA 3AHWA 3G8ZA 1DMQA 3Q1CA 3GAXA 1BVIA 1GY6A 2RSXA 1Y4KA 3KSED 3SLUA 1X1UA 3DUKA 3GSPA 3CCE3 1BSAA 1UGHI 2GU1A 4KVHA 1HYFA 1KD14 1JKGA 1MGWA 4HOHA 3NQZA 4NREA 2P09A 2CH9A 2JDIH 1NWWA 3PXMA 2K3DA 2GEYA 2CFKA 2ZDJA 1TUHA 1FGQA 1O7MB 2W04A 2XGNA 3KZTA 5AYRB 1L5GB 4BL3A 1JBRA 1RGEA 3X3ZA 1BAOA 1BSDA 1UUGB 2UGIA 3QK9A 3RGRA 2STDA 2YX9A 2XH9A 3NV0B 4HM6B 3LMLA 3DGMA 3PGBA 1RDSA 1YGEA 3PS8A 4OK0A 1C54A 4XBXA 1LOXA 1YIJ3 4XB5A 1OHOA 1LVNA 4N6LA 1Q9EA 2H0IA 3K0ZA 3Q90A 3KFQC 3KSPA 1BSCA 3JUQA 3Q3FA 5CLKA 1RGFA 3CCJ3 2R4IA 1MOLA 3DGYA 3DGNA 1JV2B 1BSEA 1IVUA 5FGOA 2SARA 3J7Yd 1VQ63 1IT8A 2ML6A 1FGOA 2LYXA 2F5MA 3B4OA 4FMAA 1HZ1A 1T2HA 3S5CA 5KP1A 2CG1A 1BRGA 1IYYA 1TFKA 3F7SA 1CYUA 1RHLA 4PEJA 1GS3A 4N6MA 1Q824 2ZA4A 4K61A 1A67A 4LZIA 1UCJA 1ZGXA 1VQ53 4BU4A 3ZG5A 3CU3A 3DGOA 4FCJA 1TP6A 2CHCA 2GBWB 3FG4A 3V99A 4MMYB 2H0HA 1TU5A 1VQQA 1BNEA 1TTOA 3G0KA 1G02A 2P0MA 1N9JA 5AIFA 1J2BA 4LEHA 3X41A 2J8XB 2HMMB 1ASKA 2QGUA 3MG2A 1BGSA 2BMRB 1IDPA 3F8XA 1UUWB 2IUJA 1M1XB 1D6YA 3F9SA 2HMJB 4WYKB 3KIIA 2ZL8A 3JVCA 1ZO2A 3CCQ3 1UGIA 4QWTA 1A2VA 5G1KA 2INXA 4WFOA 4CDLA 2K54A 1BRJA 5D81A 2BMOB 2HMKB 5BXQA 4HM1B 3MSOA 1W6YA 1RNBA 3LZAA 3AGOA 4I5QA 1HU9A 3M8CA 1JN5A 1BSBA 4EW5A 1WMOA 2W56B 3GWRA 1B27A 1EQKA 1K28A 1SIHA 3JUPA 2D1WA 5AIHA 3SOAA 1OPYA 1Q864 3AMOA 3BLZA 5BVBA 3HIGA 1FGMA 1I0XA 1ROVA 1TRPA 4HM0B 3ZFZA 4OVMA 1FA3A 1RGAA 2CX0A 1GD3A 1HKXA 1STFI 2BT3A 3EC9A 3FZWA 3T0UA 1N5HA 1OF5B 5CF1A 1FW7A 1BRHA 2JQ5A 1X1WA 2OCTA 3KE7A 4EXRA 1OUNA 4N6UA 1RGKA 4ORLA 1LQMB 1PFPA 1I2FA 1OCVA 1QVG2 1EEJA 1M904 2KCDA 1CEWI 1I2GA 3NX0A 1ULIB 3WOFB 3UL5A 3SYUA 4K1UA 7GSPA 7RNTA 3CCU3 1RN1A 4O02B 1QJGA 3WODG 4BTWA 3IMAB 3FF0A 3WA2X 1A2KA 3E99A 1BU4A 2PNCA 1R4CA 3CC43 5DRVA 3K9MC 1KWIA 4IPBA 4XM4A 9RNTA 1I0VA 1B21A 3N8BA 2P05A 3AHSA 2XFSA 1QALA 3F7XA 3OV4A 1JB2A 5AIIA 2ML5A 3N9HA 1ISKA 3EHCA 5RNTA 1WMNA 5ELJA 1QMAA 2HOHA 2UX0A 3OWSA 2RNTA 5IF6A 2CFWA 2BMQB 1FYSA 1V74A 1GMPA 1Q40B 3HK4A 4MMZB 3DMCA 4KFEA 2WOHA 6RNTA 3HZPA 1FUTA 3SOYA 2R41A 3SXXA 1BNFA 2C10A 1BNJA 4RNTA 5GSPA 1T5YA 3T8NA 1X1YA 3KKGA 4O8SA 3B7CA 1MWRA 3KCHA 4J5GA 4JF8A 4G1MB 1MNLA 4KZ1A 2YFLB 3OW22 1S723 1RLSA 4R1KA 1MGRA 1YNVX 4LMIA 2XR8B 2KF6A 1KSIA 1FZUA 3FCSB 5CF2A 1D6UA 3NXJA 1GY5A 2M7OA 2Y73A 3SVAA 1SARA 1M1K4 1W01A 2AAEA 5LC7A 1W2B2 5LC6A 2OTL3 3X42A 1DYUA 3CCS3 2CWVA 4N6TA 3CNMA 4O2HA 1YI23 2CG0A 2OOVC 1AY7A 1K8A4 4HVNA 1BANA 1US1A 1RSNA 1O7WB 1W5ZA 1JBSA 1LQGC 1NNVA 4MEIA 3OWYA 3PCSA 1G96A 2RCDA 2C11A 1Q7Y4 1T2IA 2CKFB 3S27A 5BIRA 1JB5A 1ULJB 3NM7A 3EBTA 1VQ83 4HYZA 3CCR3 4EV2A 2QIYA 1IVVA 1UI7A 2HMOB 3D5IA 3F40A 3T8UA 1VQO3 1YIT3 1Q814 1O7HB 1PYLA 4JRFA 3MYTA 5IERA 1Q42A 5ELUA 3JUMA 1YJN3 1OGXA 2RBIA 4HM8B 3WHOA 5AIGA 1GOYA 3A76A 2E2VA 6STDA 3LOYA 5IEOA 4X2HA 1RKYA 4TX4A 1A90A 2SBLA 3EBYA 1OHSA 3X40A 2XF3A 3EF8A 3BNCA 1EUIC 2BNGA 4HZ9B 3DM8A 4KFDA 4NHFA 1YHQ3 2CWUA 1W7CA 1B2XA 2XFTA 3RNTA 4IT7A 3EN1B 3CCM3 3FF2A 2F4YA 3PYJA 1IU7A 1GOUA 3DXOA 4FMDA 3UNLA 3BIRA 3OX9A 5D82A 3WOEB 4EC6A 1WNHA 2HMLB 2KXGA 1RTUA 1LXEA 4GB5A 1VQL3 1LOYA 3S28A 2Y74A 2OWPA 3I553 1RRHA 4ZM8A 1X1XA 1GOVA 3WDGB 2UUGC 3EQQB 4J9AA 2LQVA 3D79A 5EQLA 3CCL3 3KN4A 1JKGB 4O3VA 2CK3H 3URPA 3B8LA 1MWTA 2YFJB 1MWUA 1IQXA 3HI7A 4R9LA 4FR9A 1JRQA 3PCRA 2F56A 3CMA3 5AI1A 3NBJA 1VQ93 3D3LA 1OHPA 2CFLA 4GSPA 8CHOA 3LXUX 4FMCA 1QVF2 1RJOA 1SJWA 2CX1A 3EB8A 3LT8A 2P38A 3DY5A 3U1WA 3ZG0A 1JNQA 4HM3B 3LTDA 3TDGA 4LYLB 3FG3A 2WOFA 3OWUA 2AADA 1GSPA 4U13A 2K0MA 1YGWA 4KT3B 1I70A 1K9M4 1B2ZA 1N5PA 3IJEB 1LRAA 3G4S3 3CPOA 4MJDA 1UUVB 3CNXA 4XBTA 1TFOA 2D42A 3HIIA 2A15A 3NV0A 2GU3A 2WGOA 5M19A 1BRSA 1LNHA 1RMSA 1VQN3 1W4NA 1PY3A 2E2UA 1W2ZA 2IYJA 3X3YA 4HAAA 1IVXA 2CC3A 3FSDA 1UI8A 1VQM3 1V58A 1F8NA 4HM7B 1AQZA 1E3VA 1B2SA 3A5EA 1UW1A 3EJVA 4I4KA 4MMXB 5IG4A 3ROBA 3WMDA 2IY2A 3HOHA 3LTAA 3FLJA 2B24B 2F98A 4GHOA 4ILFA 1TIJA 1AR0A 3GZBA 3DH2A 2Z7AA 3GZYB 3K5TA 3RDEA 5FW5A 2OOVA 2QA43 5EVHA 1BUJA 4FMBA 2CWTA 2WGQA 3I563 5I97A 4L8PA 2CFGA 4K90B 2FNQA 2XGLA 3MG1A 3NQYA 1O7NB 1W00A 5IG0A 2OQEA 1MWSA 4WWUC 2Z6BA 1NU3A 1BNIA 3BU4A 3X3XA 1S5AA 2H0GA 1VQ73 2KAAA 2KF4A 4H61A 5CK6A 4DKIA 1VZZA 2MC8A 1V57A 1GYBA 3BB9A 4RNZA 1RCLA 1I8VA 3LT9A 3GZRA 4RNYA 2FXTA 2RGQA 4FCMA 4EV5A 1JN5B 3AGNA 4WYKA 3WR2A 1BNSA 3FGYA 2I9WA 2ZHXB 3SX1A 4AEQA 4J5KA 2GSPA 1BUQA 3AMOB 5JBSA 4R4KA 1SPUA 4R80A 1EKMA 3NUVA 5STDA 4L7KA 4L8OA 3B4PA 5M1AA 3VGNA 2W9PA 5KP4A 4WP5A 3D9RA 1GY7A 3QRDA 1ROAA 2Z77A 8RNTA 2HMNB 2W56A 3WA3A 1PU4A 1JZDA 5A0OB 3MPHA 1RRLA 4CCVA 2OQEC 3L0RA 1IQ8A 1DMMA 3CME3 1CQSA 2W9QA 1U5OA 1I3IA 3FG1A 1RCKA 4HKVB 1JBTA 1E3RA 3PZWA 2KF5A 1LNIA 3FH1A 3S29A 2QEX3 2W2CA 1M9GA 1BOXA 2W6JH 1D6ZA 2W03A 1OF5A 3O8YA 4XDWA 4STDA 1C7HA 1K41A 1OH0A 3LTCA 5BU4A 1RNTA 3EX9A 1DVDA 2GBXB 2B1XB 4WHAA 3NBRA 1UDII 3VF1A 3GZXB 4EYCA 4R9KA 1RGLA 4N6NB 4RBNA 3CC73 4CPKA 1DVCA 3MWZA 3V98A 2O9UX 1T3BA 1BNRA 3ER7A 2KF3A 4BTXA 5CXOA 1FUWA 5G1LA 1LOVA 1BIRA 1AVLA 1RGGA 2GEXA 3UJMA 4HM5B 3JUNA 1DMNA 4NPBA 5AEUB 1IK3A 4XDVA 5JPPA 5IEPA 3K63A 5IG5A 1TRQA 2F99A 3U97A 1NO3A 1Q40A 1W02A 1W6CA 3MKIA 4J8TA 4X2OA 5TGNA 3RGAA 1IV7A 2XSOB 2CW9A 3F8HA 1GMQA 1AVKA 3G16A 3DGLA 1B2MA 4HM2B 1GMRA 1I2EA 1ZS7A 4GL6A 1NDOB 1Z1SA 1UCKA 3K7CA 4LGQA 1RN7A 1K734 1QAFA 1BRKA 1LOWA 1UCIA 2WO0A 3N54B 1N9EA 4AKYA 3BNDA 4BTYA 3CPW2 1NB5I 1OGZA 1UCLA 2Q07A 3BNEA 1E97A 5AEWB 2PZVA 4HZBB 1B20A 3BNBA 1BRIA 5JPUA 1A2PA 1IV9A 3MHEA 4Q53A 1VQP3 1IVWA 1AV4A 2MF7A 1O7PB 1N8QA 3LTBA
chains in the Genus database with same CATH topology
2CIUA 2YFIB 5IW9A 2Z76A 1EG9B 2XEPA 3NBBA 3UL6A 1STDA 2KRTA 4LSOA 3DZLA 5G2GA 3G713 2F86B 3STDA 3JUOA 3LYGA 1GD4A 2W0QA 3G6E3 4XBYA 1IT7A 4N6OB 3GRDA 2RFRA 1WQLB 1WTHA 1FGRA 1QAKA 1U8CB 5HGRA 3EN8A 3LH4A 1NB3I 1N8R4 3CD63 5DREA 1OACA 3ALAA 2XRXB 1CYVA 1YJ93 3CC23 2P0XA 3H3HA 1SIIA 2XSHB 3CCV3 3NM2A 1KQS2 1WMPA 3V92A 5KP3A 3FKAA 4N3VA 2IA7A 2IUKA 3OXAA 5EEOA 4HJLB 3F14A 4AKZA 3I0YA 1FGTA 2BO9B 2OTJ3 1JJ22 3IPTA 2BHMA 3HX8A 3EE1A 5IENA 3H51A 4HBRA 3NHXA 2L4VA 3CXC2 2FGTA 1JB4A 2GXFA 1VQK3 1KC84 1ZX2A 2IMJA 3SEDA 5D83A 4KFFA 4N6V0 4HM4B 5AYSC 4EBGA 1SQWA 1YJW3 4H3UA 1NJI4 5IG3A 2CFDA 7STDA 3ECFA 1O7GB 4RZMA 1VQ43 2O3OA 1EA2A 3MG3A 3UB1A 4K1VA 2V1LA 4FCZA 4OUQA 1W6GA 3Q2PA 2E2TA 3S67A 1YVBI 3VSYA 1IQYA 4IIAA 3G8ZA 1DMQA 3Q1CA 3GAXA 1GY6A 2RSXA 1Y4KA 3KSED 3SLUA 3DUKA 3CCE3 1KD14 2GU1A 4KVHA 1JKGA 3NQZA 4NREA 2P09A 2CH9A 2JDIH 1NWWA 3PXMA 2GEYA 2CFKA 2ZDJA 1TUHA 1FGQA 1O7MB 2W04A 2XGNA 3KZTA 5AYRB 1L5GB 3X3ZA 3QK9A 3RGRA 2STDA 2YX9A 2XH9A 3NV0B 4HM6B 3LMLA 3DGMA 3PGBA 1YGEA 3PS8A 4OK0A 4XBXA 1LOXA 1YIJ3 4XB5A 1OHOA 1LVNA 4N6LA 3K0ZA 3Q90A 3KFQC 3KSPA 3JUQA 5CLKA 3CCJ3 2R4IA 1MOLA 5FGOA 3DGNA 1JV2B 1IVUA 1VQ63 3B4OA 1IT8A 1FGOA 2LYXA 2ML6A 4FMAA 3S5CA 5KP1A 3J7Yd 2CG1A 1CYUA 1TFKA 3F7SA 4PEJA 1GS3A 4N6MA 1Q824 4K61A 1A67A 4LZIA 1VQ53 3CU3A 3DGOA 4FCJA 1TP6A 2CHCA 2GBWB 3FG4A 3V99A 4MMYB 1TU5A 3G0KA 2P0MA 1N9JA 5AIFA 1J2BA 4LEHA 3X41A 2HMMB 1ASKA 2QGUA 3MG2A 2BMRB 1IDPA 3F8XA 1UUWB 2IUJA 1M1XB 1D6YA 3F9SA 2HMJB 4WYKB 3KIIA 2ZL8A 3JVCA 1ZO2A 3CCQ3 4QWTA 1A2VA 4CDLA 2INXA 4WFOA 2K54A 5D81A 2BMOB 2HMKB 5BXQA 4HM1B 3MSOA 1W6YA 3LZAA 1HU9A 3M8CA 1JN5A 1WMOA 2W56B 3GWRA 1EQKA 1K28A 1SIHA 3JUPA 2D1WA 5AIHA 3SOAA 1OPYA 1Q864 3AMOA 3BLZA 5BVBA 3HIGA 1FGMA 4HM0B 1ROVA 4OVMA 1FA3A 1GD3A 1HKXA 1STFI 2BT3A 3EC9A 3FZWA 3T0UA 1N5HA 1OF5B 5CF1A 2JQ5A 2OCTA 3KE7A 4EXRA 1OUNA 4N6UA 4ORLA 1PFPA 1OCVA 1QVG2 1M904 2KCDA 1CEWI 3NX0A 1ULIB 3WOFB 3UL5A 4K1UA 3CCU3 4O02B 1QJGA 3WODG 4BTWA 3IMAB 3FF0A 3WA2X 1A2KA 3E99A 2PNCA 1R4CA 3CC43 5DRVA 3K9MC 1KWIA 4IPBA 4XM4A 3N8BA 2P05A 2XFSA 1QALA 3F7XA 3OV4A 1JB2A 5AIIA 2ML5A 3N9HA 1ISKA 3EHCA 1WMNA 5ELJA 1QMAA 2UX0A 3OWSA 5IF6A 2CFWA 2BMQB 1V74A 1Q40B 3HK4A 4MMZB 3DMCA 4KFEA 2WOHA 3HZPA 3SOYA 3SXXA 2C10A 1T5YA 3T8NA 3KKGA 4O8SA 3B7CA 4JF8A 4G1MB 1MNLA 4KZ1A 2YFLB 3OW22 1S723 4R1KA 4LMIA 2XR8B 1KSIA 5CF2A 3FCSB 1D6UA 3NXJA 1GY5A 2M7OA 2Y73A 3SVAA 1M1K4 1W01A 5LC7A 1W2B2 5LC6A 2OTL3 3X42A 1DYUA 3CCS3 2CWVA 4N6TA 3CNMA 4O2HA 1YI23 2CG0A 2OOVC 1K8A4 4HVNA 1US1A 1O7WB 1W5ZA 4MEIA 3OWYA 3PCSA 1G96A 2RCDA 2C11A 1Q7Y4 2CKFB 3S27A 1JB5A 1ULJB 3NM7A 3EBTA 1VQ83 4HYZA 3CCR3 4EV2A 2QIYA 1IVVA 1UI7A 2HMOB 3F40A 3T8UA 1VQO3 1YIT3 1Q814 1O7HB 4JRFA 3MYTA 5IERA 1Q42A 5ELUA 3JUMA 1YJN3 1OGXA 4HM8B 5AIGA 3A76A 2E2VA 6STDA 3LOYA 5IEOA 4X2HA 1RKYA 4TX4A 1A90A 2SBLA 3EBYA 1OHSA 3X40A 2XF3A 3EF8A 3BNCA 2BNGA 4HZ9B 3DM8A 4KFDA 4NHFA 1YHQ3 2CWUA 1W7CA 2XFTA 4IT7A 3EN1B 3CCM3 3FF2A 3UNLA 3PYJA 1IU7A 3DXOA 4FMDA 3OX9A 5D82A 3WOEB 4EC6A 1WNHA 2HMLB 2KXGA 1LXEA 4GB5A 1VQL3 3S28A 2Y74A 2OWPA 3I553 1RRHA 4ZM8A 3WDGB 3EQQB 4J9AA 2LQVA 5EQLA 3CCL3 3KN4A 1JKGB 4O3VA 2CK3H 3B8LA 2YFJB 3HI7A 1IQXA 4R9LA 4FR9A 1JRQA 3PCRA 3CMA3 5AI1A 3NBJA 1VQ93 3D3LA 1OHPA 2CFLA 8CHOA 1QVF2 3LXUX 4FMCA 1RJOA 1SJWA 3EB8A 3LT8A 2P38A 3DY5A 3U1WA 1JNQA 4HM3B 3LTDA 3TDGA 3FG3A 2WOFA 3OWUA 4U13A 2K0MA 1K9M4 1N5PA 3IJEB 3G4S3 3CPOA 4MJDA 1UUVB 3CNXA 4XBTA 1TFOA 2D42A 3HIIA 2A15A 3NV0A 2GU3A 2WGOA 1VQN3 1LNHA 1W4NA 2E2UA 3X3YA 1W2ZA 1IVXA 2CC3A 3FSDA 1UI8A 1VQM3 1F8NA 4HM7B 1E3VA 5IG4A 4I4KA 1UW1A 3EJVA 4MMXB 3ROBA 3WMDA 3LTAA 3FLJA 2B24B 2F98A 1TIJA 1AR0A 3GZBA 3RDEA 2Z7AA 3GZYB 3K5TA 5FW5A 2OOVA 2QA43 5EVHA 4FMBA 2CWTA 2WGQA 3I563 5I97A 4L8PA 2CFGA 4K90B 2FNQA 2XGLA 3MG1A 3NQYA 1O7NB 1W00A 5IG0A 2OQEA 4WWUC 2Z6BA 1NU3A 3X3XA 1S5AA 1VQ73 4H61A 5CK6A 1VZZA 2MC8A 4RNZA 1GYBA 3BB9A 3LT9A 3GZRA 4RNYA 2FXTA 2RGQA 4FCMA 4EV5A 1JN5B 4WYKA 3SX1A 3FGYA 2I9WA 4AEQA 1BUQA 3AMOB 5JBSA 4R4KA 1SPUA 4R80A 1EKMA 3NUVA 5STDA 4L7KA 4L8OA 3B4PA 3VGNA 2W9PA 5KP4A 4WP5A 3D9RA 1GY7A 3QRDA 1ROAA 2Z77A 2HMNB 2W56A 3WA3A 1PU4A 5A0OB 3MPHA 1RRLA 4CCVA 2OQEC 3L0RA 1IQ8A 1DMMA 3CME3 1CQSA 2W9QA 1U5OA 3FG1A 4HKVB 1E3RA 3PZWA 3FH1A 3S29A 2QEX3 2W2CA 1M9GA 2W6JH 1D6ZA 2W03A 1OF5A 3O8YA 4XDWA 4STDA 1C7HA 1K41A 1OH0A 3LTCA 1DVDA 3EX9A 2GBXB 2B1XB 4WHAA 3NBRA 3VF1A 3GZXB 4EYCA 4R9KA 4N6NB 4RBNA 3CC73 1DVCA 3MWZA 3V98A 2O9UX 3ER7A 4BTXA 1FUWA 5CXOA 1AVLA 3UJMA 2GEXA 4HM5B 3JUNA 1DMNA 5AEUB 1IK3A 4XDVA 5JPPA 5IEPA 3K63A 5IG5A 2F99A 3U97A 1NO3A 1Q40A 1W02A 1W6CA 3MKIA 4J8TA 4X2OA 5TGNA 3RGAA 1IV7A 2XSOB 2CW9A 3F8HA 3G16A 1AVKA 3DGLA 4HM2B 4GL6A 1NDOB 1Z1SA 4LGQA 3K7CA 1RN7A 1K734 1QAFA 2WO0A 3N54B 1N9EA 4AKYA 3BNDA 4BTYA 3CPW2 1NB5I 1OGZA 2Q07A 3BNEA 1E97A 5AEWB 2PZVA 4HZBB 3BNBA 5JPUA 1IV9A 3MHEA 4Q53A 1VQP3 1IVWA 1AV4A 2MF7A 1O7PB 1N8QA 3LTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFI B;  2Z76 A;  1EG9 B;  1STD A;  3DZL A;  5G2G A;  2F86 B;  3STD A;  3JUO A;  3LYG A;  4XBY A;  3GRD A;  2RFR A;  1WQL B;  5HGR A;  3EN8 A;  5DRE A;  2XRX B;  3H3H A;  2XSH B;  3NM2 A;  5KP3 A;  3FKA A;  4N3V A;  3OXA A;  4HJL B;  3F14 A;  3I0Y A;  3IPT A;  3HX8 A;  5IEN A;  3H51 A;  3NHX A;  2GXF A;  1JB4 A;  1ZX2 A;  2IMJ A;  3SED A;  5D83 A;  4HM4 B;  4H3U A;  5IG3 A;  7STD A;  3ECF A;  1O7G B;  4RZM A;  1EA2 A;  3MG3 A;  4K1V A;  4OUQ A;  3VSY A;  4IIA A;  3G8Z A;  1DMQ A;  1GY6 A;  3DUK A;  4KVH A;  1JKG A;  1NWW A;  2GEY A;  1TUH A;  1O7M B;  3KZT A;  3RGR A;  2STD A;  3NV0 B;  4HM6 B;  4XBX A;  4XB5 A;  1OHO A;  3K0Z A;  3Q90 A;  3KSP A;  3JUQ A;  5CLK A;  2R4I A;  3B4O A;  3S5C A;  5KP1 A;  3F7S A;  4PEJ A;  1GS3 A;  3CU3 A;  4FCJ A;  1TP6 A;  2CHC A;  2GBW B;  3G0K A;  5AIF A;  4LEH A;  2HMM B;  1ASK A;  2QGU A;  3MG2 A;  2BMR B;  1IDP A;  3F8X A;  1UUW B;  3F9S A;  2HMJ B;  4WYK B;  1ZO2 A;  4CDL A;  2INX A;  2K54 A;  5D81 A;  2BMO B;  2HMK B;  5BXQ A;  4HM1 B;  3MSO A;  1W6Y A;  3LZA A;  3M8C A;  1JN5 A;  3GWR A;  3JUP A;  5AIH A;  3SOA A;  1OPY A;  3BLZ A;  5BVB A;  4HM0 B;  4OVM A;  1HKX A;  3EC9 A;  3FZW A;  1OF5 B;  5CF1 A;  2JQ5 A;  3KE7 A;  1OUN A;  4ORL A;  1OCV A;  1ULI B;  4K1U A;  1QJG A;  3FF0 A;  1A2K A;  3E99 A;  5DRV A;  4XM4 A;  3F7X A;  3OV4 A;  5AII A;  1JB2 A;  1ISK A;  3EHC A;  1QMA A;  2UX0 A;  3OWS A;  5IF6 A;  2BMQ B;  1Q40 B;  3HK4 A;  3DMC A;  3HZP A;  3SOY A;  3T8N A;  3KKG A;  3B7C A;  2YFL B;  4R1K A;  4LMI A;  2XR8 B;  5CF2 A;  3NXJ A;  1GY5 A;  1W01 A;  3CNM A;  4HVN A;  1O7W B;  3OWY A;  2RCD A;  2CKF B;  1JB5 A;  1ULJ B;  3EBT A;  2QIY A;  2HMO B;  3F40 A;  3T8U A;  1O7H B;  3MYT A;  5IER A;  1Q42 A;  3JUM A;  1OGX A;  4HM8 B;  5AIG A;  3A76 A;  6STD A;  5IEO A;  4X2H A;  3EBY A;  1OHS A;  3EF8 A;  2BNG A;  4HZ9 B;  3DM8 A;  3EN1 B;  3FF2 A;  3UNL A;  3DXO A;  3OX9 A;  5D82 A;  2HML B;  4GB5 A;  2OWP A;  3EQQ B;  4J9A A;  1JKG B;  3B8L A;  2YFJ B;  4R9L A;  5AI1 A;  1OHP A;  8CHO A;  1SJW A;  4HM3 B;  3OWU A;  4U13 A;  3CPO A;  4MJD A;  1UUV B;  3CNX A;  4XBT A;  3NV0 A;  2A15 A;  3FSD A;  4HM7 B;  1E3V A;  5IG4 A;  4I4K A;  3EJV A;  3ROB A;  3WMD A;  3FLJ A;  2B24 B;  2F98 A;  1AR0 A;  3GZB A;  2Z7A A;  3GZY B;  5FW5 A;  5EVH A;  4L8P A;  3MG1 A;  1O7N B;  1W00 A;  5IG0 A;  4WWU C;  1NU3 A;  1S5A A;  5CK6 A;  1VZZ A;  1GYB A;  3BB9 A;  3GZR A;  2RGQ A;  4FCM A;  1JN5 B;  4WYK A;  3FGY A;  2I9W A;  1BUQ A;  5STD A;  3NUV A;  4L7K A;  4L8O A;  3B4P A;  3VGN A;  5KP4 A;  4WP5 A;  3D9R A;  1GY7 A;  2Z77 A;  2HMN B;  1DMM A;  1CQS A;  1U5O A;  4HKV B;  1E3R A;  3FH1 A;  2W2C A;  1OF5 A;  4XDW A;  4STD A;  1C7H A;  1K41 A;  1OH0 A;  3EX9 A;  2GBX B;  2B1X B;  3NBR A;  3GZX B;  4R9K A;  3ER7 A;  5CXO A;  3UJM A;  2GEX A;  4HM5 B;  3JUN A;  1DMN A;  5AEU B;  4XDV A;  5JPP A;  5IEP A;  5IG5 A;  2F99 A;  1W02 A;  1Q40 A;  3RGA A;  3MKI A;  4J8T A;  5TGN A;  4X2O A;  2XSO B;  3G16 A;  3F8H A;  4HM2 B;  1NDO B;  1Z1S A;  4LGQ A;  3K7C A;  1OGZ A;  1E97 A;  5AEW B;  2PZV A;  4HZB B;  5JPU A;  4Q53 A;  3MHE A;  1O7P B; 
#chains in the Genus database with same CATH topology
 2CIU A;  2YFI B;  5IW9 A;  2Z76 A;  1EG9 B;  2XEP A;  6GSP A;  3D5G A;  3NBB A;  3UL6 A;  1STD A;  2KRT A;  4LSO A;  3DZL A;  5G2G A;  3G71 3;  2F86 B;  3STD A;  3JUO A;  2L1S A;  1GD4 A;  2W0Q A;  3LYG A;  3G6E 3;  4XBY A;  1IT7 A;  4N6O B;  3GRD A;  2RFR A;  1WQL B;  1WTH A;  1FGR A;  1QAK A;  1U8C B;  4BIR A;  5HGR A;  5HOH A;  3EN8 A;  3LH4 A;  1YVS A;  1NB3 I;  1N8R 4;  1RGH A;  4BL2 A;  5DRE A;  3CD6 3;  1OAC A;  3ALA A;  2XRX B;  1B2U A;  1CYV A;  1DET A;  1YJ9 3;  3CC2 3;  2P0X A;  1FUS A;  3H3H A;  1R4Y A;  1SII A;  2XSH B;  3CCV 3;  2C4B A;  3NM2 A;  1KQS 2;  1WMP A;  3V92 A;  5KP3 A;  3FKA A;  4N3V A;  2IA7 A;  2IUK A;  3OXA A;  2F5W A;  5EEO A;  4HJL B;  3F14 A;  4AKZ A;  3I0Y A;  1FGT A;  2BO9 B;  1B3S A;  1G0T A;  1JJ2 2;  2OTJ 3;  3IPT A;  2BHM A;  3HX8 A;  1BRN L;  3EE1 A;  5IEN A;  3H51 A;  4HBR A;  3NHX A;  2L4V A;  3CXC 2;  2FGT A;  1JB4 A;  2GXF A;  1JZO A;  1RGC A;  3D4A A;  1VQK 3;  1KC8 4;  1ZX2 A;  2IMJ A;  3SED A;  5D83 A;  4KFF A;  4N6V 0;  4HM4 B;  5AYS C;  4EBG A;  1SQW A;  1YJW 3;  4H3U A;  1NJI 4;  5IG3 A;  1BNG A;  2CFD A;  7STD A;  3ECF A;  1CH0 A;  1O7G B;  4RZM A;  1VQ4 3;  2O3O A;  1EA2 A;  1TJD A;  5M18 A;  2BIR A;  3MG3 A;  3UB1 A;  4K1V A;  2V1L A;  4FCZ A;  1Q7H A;  1W6G A;  4OUQ A;  2BU4 A;  1DE3 A;  1RN4 A;  3Q2P A;  4CJN A;  2E2T A;  3S67 A;  1YVB I;  1I3F A;  3VSY A;  1IQY A;  4IIA A;  3AHW A;  3G8Z A;  1DMQ A;  3Q1C A;  3GAX A;  1BVI A;  1GY6 A;  2RSX A;  1Y4K A;  3KSE D;  3SLU A;  1X1U A;  3DUK A;  3GSP A;  3CCE 3;  1BSA A;  1UGH I;  2GU1 A;  4KVH A;  1HYF A;  1KD1 4;  1JKG A;  1MGW A;  4HOH A;  3NQZ A;  4NRE A;  2P09 A;  2CH9 A;  2JDI H;  1NWW A;  3PXM A;  2K3D A;  2GEY A;  2CFK A;  2ZDJ A;  1TUH A;  1FGQ A;  1O7M B;  2W04 A;  2XGN A;  3KZT A;  5AYR B;  1L5G B;  4BL3 A;  1JBR A;  1RGE A;  3X3Z A;  1BAO A;  1BSD A;  1UUG B;  2UGI A;  3QK9 A;  3RGR A;  2STD A;  2YX9 A;  2XH9 A;  3NV0 B;  4HM6 B;  3LML A;  3DGM A;  3PGB A;  1RDS A;  1YGE A;  3PS8 A;  4OK0 A;  1C54 A;  4XBX A;  1LOX A;  1YIJ 3;  4XB5 A;  1OHO A;  1LVN A;  4N6L A;  1Q9E A;  2H0I A;  3K0Z A;  3Q90 A;  3KFQ C;  3KSP A;  1BSC A;  3JUQ A;  3Q3F A;  5CLK A;  1RGF A;  3CCJ 3;  2R4I A;  1MOL A;  3DGY A;  3DGN A;  1JV2 B;  1BSE A;  1IVU A;  5FGO A;  2SAR A;  3J7Y d;  1VQ6 3;  1IT8 A;  2ML6 A;  1FGO A;  2LYX A;  2F5M A;  3B4O A;  4FMA A;  1HZ1 A;  1T2H A;  3S5C A;  5KP1 A;  2CG1 A;  1BRG A;  1IYY A;  1TFK A;  3F7S A;  1CYU A;  1RHL A;  4PEJ A;  1GS3 A;  4N6M A;  1Q82 4;  2ZA4 A;  4K61 A;  1A67 A;  4LZI A;  1UCJ A;  1ZGX A;  1VQ5 3;  4BU4 A;  3ZG5 A;  3CU3 A;  3DGO A;  4FCJ A;  1TP6 A;  2CHC A;  2GBW B;  3FG4 A;  3V99 A;  4MMY B;  2H0H A;  1TU5 A;  1VQQ A;  1BNE A;  1TTO A;  3G0K A;  1G02 A;  2P0M A;  1N9J A;  5AIF A;  1J2B A;  4LEH A;  3X41 A;  2J8X B;  2HMM B;  1ASK A;  2QGU A;  3MG2 A;  1BGS A;  2BMR B;  1IDP A;  3F8X A;  1UUW B;  2IUJ A;  1M1X B;  1D6Y A;  3F9S A;  2HMJ B;  4WYK B;  3KII A;  2ZL8 A;  3JVC A;  1ZO2 A;  3CCQ 3;  1UGI A;  4QWT A;  1A2V A;  5G1K A;  2INX A;  4WFO A;  4CDL A;  2K54 A;  1BRJ A;  5D81 A;  2BMO B;  2HMK B;  5BXQ A;  4HM1 B;  3MSO A;  1W6Y A;  1RNB A;  3LZA A;  3AGO A;  4I5Q A;  1HU9 A;  3M8C A;  1JN5 A;  1BSB A;  4EW5 A;  1WMO A;  2W56 B;  3GWR A;  1B27 A;  1EQK A;  1K28 A;  1SIH A;  3JUP A;  2D1W A;  5AIH A;  3SOA A;  1OPY A;  1Q86 4;  3AMO A;  3BLZ A;  5BVB A;  3HIG A;  1FGM A;  1I0X A;  1ROV A;  1TRP A;  4HM0 B;  3ZFZ A;  4OVM A;  1FA3 A;  1RGA A;  2CX0 A;  1GD3 A;  1HKX A;  1STF I;  2BT3 A;  3EC9 A;  3FZW A;  3T0U A;  1N5H A;  1OF5 B;  5CF1 A;  1FW7 A;  1BRH A;  2JQ5 A;  1X1W A;  2OCT A;  3KE7 A;  4EXR A;  1OUN A;  4N6U A;  1RGK A;  4ORL A;  1LQM B;  1PFP A;  1I2F A;  1OCV A;  1QVG 2;  1EEJ A;  1M90 4;  2KCD A;  1CEW I;  1I2G A;  3NX0 A;  1ULI B;  3WOF B;  3UL5 A;  3SYU A;  4K1U A;  7GSP A;  7RNT A;  3CCU 3;  1RN1 A;  4O02 B;  1QJG A;  3WOD G;  4BTW A;  3IMA B;  3FF0 A;  3WA2 X;  1A2K A;  3E99 A;  1BU4 A;  2PNC A;  1R4C A;  3CC4 3;  5DRV A;  3K9M C;  1KWI A;  4IPB A;  4XM4 A;  9RNT A;  1I0V A;  1B21 A;  3N8B A;  2P05 A;  3AHS A;  2XFS A;  1QAL A;  3F7X A;  3OV4 A;  1JB2 A;  5AII A;  2ML5 A;  3N9H A;  1ISK A;  3EHC A;  5RNT A;  1WMN A;  5ELJ A;  1QMA A;  2HOH A;  2UX0 A;  3OWS A;  2RNT A;  5IF6 A;  2CFW A;  2BMQ B;  1FYS A;  1V74 A;  1GMP A;  1Q40 B;  3HK4 A;  4MMZ B;  3DMC A;  4KFE A;  2WOH A;  6RNT A;  3HZP A;  1FUT A;  3SOY A;  2R41 A;  3SXX A;  1BNF A;  2C10 A;  1BNJ A;  4RNT A;  5GSP A;  1T5Y A;  3T8N A;  1X1Y A;  3KKG A;  4O8S A;  3B7C A;  1MWR A;  3KCH A;  4J5G A;  4JF8 A;  4G1M B;  1MNL A;  4KZ1 A;  2YFL B;  3OW2 2;  1S72 3;  1RLS A;  4R1K A;  1MGR A;  1YNV X;  4LMI A;  2XR8 B;  2KF6 A;  1KSI A;  1FZU A;  3FCS B;  5CF2 A;  1D6U A;  3NXJ A;  1GY5 A;  2M7O A;  2Y73 A;  3SVA A;  1SAR A;  1M1K 4;  1W01 A;  2AAE A;  5LC7 A;  1W2B 2;  5LC6 A;  2OTL 3;  3X42 A;  1DYU A;  3CCS 3;  2CWV A;  4N6T A;  3CNM A;  4O2H A;  1YI2 3;  2CG0 A;  2OOV C;  1AY7 A;  1K8A 4;  4HVN A;  1BAN A;  1US1 A;  1RSN A;  1O7W B;  1W5Z A;  1JBS A;  1LQG C;  1NNV A;  4MEI A;  3OWY A;  3PCS A;  1G96 A;  2RCD A;  2C11 A;  1Q7Y 4;  1T2I A;  2CKF B;  3S27 A;  5BIR A;  1JB5 A;  1ULJ B;  3NM7 A;  3EBT A;  1VQ8 3;  4HYZ A;  3CCR 3;  4EV2 A;  2QIY A;  1IVV A;  1UI7 A;  2HMO B;  3D5I A;  3F40 A;  3T8U A;  1VQO 3;  1YIT 3;  1Q81 4;  1O7H B;  1PYL A;  4JRF A;  3MYT A;  5IER A;  1Q42 A;  5ELU A;  3JUM A;  1YJN 3;  1OGX A;  2RBI A;  4HM8 B;  3WHO A;  5AIG A;  1GOY A;  3A76 A;  2E2V A;  6STD A;  3LOY A;  5IEO A;  4X2H A;  1RKY A;  4TX4 A;  1A90 A;  2SBL A;  3EBY A;  1OHS A;  3X40 A;  2XF3 A;  3EF8 A;  3BNC A;  1EUI C;  2BNG A;  4HZ9 B;  3DM8 A;  4KFD A;  4NHF A;  1YHQ 3;  2CWU A;  1W7C A;  1B2X A;  2XFT A;  3RNT A;  4IT7 A;  3EN1 B;  3CCM 3;  3FF2 A;  2F4Y A;  3PYJ A;  1IU7 A;  1GOU A;  3DXO A;  4FMD A;  3UNL A;  3BIR A;  3OX9 A;  5D82 A;  3WOE B;  4EC6 A;  1WNH A;  2HML B;  2KXG A;  1RTU A;  1LXE A;  4GB5 A;  1VQL 3;  1LOY A;  3S28 A;  2Y74 A;  2OWP A;  3I55 3;  1RRH A;  4ZM8 A;  1X1X A;  1GOV A;  3WDG B;  2UUG C;  3EQQ B;  4J9A A;  2LQV A;  3D79 A;  5EQL A;  3CCL 3;  3KN4 A;  1JKG B;  4O3V A;  2CK3 H;  3URP A;  3B8L A;  1MWT A;  2YFJ B;  1MWU A;  1IQX A;  3HI7 A;  4R9L A;  4FR9 A;  1JRQ A;  3PCR A;  2F56 A;  3CMA 3;  5AI1 A;  3NBJ A;  1VQ9 3;  3D3L A;  1OHP A;  2CFL A;  4GSP A;  8CHO A;  3LXU X;  4FMC A;  1QVF 2;  1RJO A;  1SJW A;  2CX1 A;  3EB8 A;  3LT8 A;  2P38 A;  3DY5 A;  3U1W A;  3ZG0 A;  1JNQ A;  4HM3 B;  3LTD A;  3TDG A;  4LYL B;  3FG3 A;  2WOF A;  3OWU A;  2AAD A;  1GSP A;  4U13 A;  2K0M A;  1YGW A;  4KT3 B;  1I70 A;  1K9M 4;  1B2Z A;  1N5P A;  3IJE B;  1LRA A;  3G4S 3;  3CPO A;  4MJD A;  1UUV B;  3CNX A;  4XBT A;  1TFO A;  2D42 A;  3HII A;  2A15 A;  3NV0 A;  2GU3 A;  2WGO A;  5M19 A;  1BRS A;  1LNH A;  1RMS A;  1VQN 3;  1W4N A;  1PY3 A;  2E2U A;  1W2Z A;  2IYJ A;  3X3Y A;  4HAA A;  1IVX A;  2CC3 A;  3FSD A;  1UI8 A;  1VQM 3;  1V58 A;  1F8N A;  4HM7 B;  1AQZ A;  1E3V A;  1B2S A;  3A5E A;  1UW1 A;  3EJV A;  4I4K A;  4MMX B;  5IG4 A;  3ROB A;  3WMD A;  2IY2 A;  3HOH A;  3LTA A;  3FLJ A;  2B24 B;  2F98 A;  4GHO A;  4ILF A;  1TIJ A;  1AR0 A;  3GZB A;  3DH2 A;  2Z7A A;  3GZY B;  3K5T A;  3RDE A;  5FW5 A;  2OOV A;  2QA4 3;  5EVH A;  1BUJ A;  4FMB A;  2CWT A;  2WGQ A;  3I56 3;  5I97 A;  4L8P A;  2CFG A;  4K90 B;  2FNQ A;  2XGL A;  3MG1 A;  3NQY A;  1O7N B;  1W00 A;  5IG0 A;  2OQE A;  1MWS A;  4WWU C;  2Z6B A;  1NU3 A;  1BNI A;  3BU4 A;  3X3X A;  1S5A A;  2H0G A;  1VQ7 3;  2KAA A;  2KF4 A;  4H61 A;  5CK6 A;  4DKI A;  1VZZ A;  2MC8 A;  1V57 A;  1GYB A;  3BB9 A;  4RNZ A;  1RCL A;  1I8V A;  3LT9 A;  3GZR A;  4RNY A;  2FXT A;  2RGQ A;  4FCM A;  4EV5 A;  1JN5 B;  3AGN A;  4WYK A;  3WR2 A;  1BNS A;  3FGY A;  2I9W A;  2ZHX B;  3SX1 A;  4AEQ A;  4J5K A;  2GSP A;  1BUQ A;  3AMO B;  5JBS A;  4R4K A;  1SPU A;  4R80 A;  1EKM A;  3NUV A;  5STD A;  4L7K A;  4L8O A;  3B4P A;  5M1A A;  3VGN A;  2W9P A;  5KP4 A;  4WP5 A;  3D9R A;  1GY7 A;  3QRD A;  1ROA A;  2Z77 A;  8RNT A;  2HMN B;  2W56 A;  3WA3 A;  1PU4 A;  1JZD A;  5A0O B;  3MPH A;  1RRL A;  4CCV A;  2OQE C;  3L0R A;  1IQ8 A;  1DMM A;  3CME 3;  1CQS A;  2W9Q A;  1U5O A;  1I3I A;  3FG1 A;  1RCK A;  4HKV B;  1JBT A;  1E3R A;  3PZW A;  2KF5 A;  1LNI A;  3FH1 A;  3S29 A;  2QEX 3;  2W2C A;  1M9G A;  1BOX A;  2W6J H;  1D6Z A;  2W03 A;  1OF5 A;  3O8Y A;  4XDW A;  4STD A;  1C7H A;  1K41 A;  1OH0 A;  3LTC A;  5BU4 A;  1RNT A;  3EX9 A;  1DVD A;  2GBX B;  2B1X B;  4WHA A;  3NBR A;  1UDI I;  3VF1 A;  3GZX B;  4EYC A;  4R9K A;  1RGL A;  4N6N B;  4RBN A;  3CC7 3;  4CPK A;  1DVC A;  3MWZ A;  3V98 A;  2O9U X;  1T3B A;  1BNR A;  3ER7 A;  2KF3 A;  4BTX A;  5CXO A;  1FUW A;  5G1L A;  1LOV A;  1BIR A;  1AVL A;  1RGG A;  2GEX A;  3UJM A;  4HM5 B;  3JUN A;  1DMN A;  4NPB A;  5AEU B;  1IK3 A;  4XDV A;  5JPP A;  5IEP A;  3K63 A;  5IG5 A;  1TRQ A;  2F99 A;  3U97 A;  1NO3 A;  1Q40 A;  1W02 A;  1W6C A;  3MKI A;  4J8T A;  4X2O A;  5TGN A;  3RGA A;  1IV7 A;  2XSO B;  2CW9 A;  3F8H A;  1GMQ A;  1AVK A;  3G16 A;  3DGL A;  1B2M A;  4HM2 B;  1GMR A;  1I2E A;  1ZS7 A;  4GL6 A;  1NDO B;  1Z1S A;  1UCK A;  3K7C A;  4LGQ A;  1RN7 A;  1K73 4;  1QAF A;  1BRK A;  1LOW A;  1UCI A;  2WO0 A;  3N54 B;  1N9E A;  4AKY A;  3BND A;  4BTY A;  3CPW 2;  1NB5 I;  1OGZ A;  1UCL A;  2Q07 A;  3BNE A;  1E97 A;  5AEW B;  2PZV A;  4HZB B;  1B20 A;  3BNB A;  1BRI A;  5JPU A;  1A2P A;  1IV9 A;  3MHE A;  4Q53 A;  1VQP 3;  1IVW A;  1AV4 A;  2MF7 A;  1O7P B;  1N8Q A;  3LTB A; 
#chains in the Genus database with same CATH homology
 2CIU A;  2YFI B;  5IW9 A;  2Z76 A;  1EG9 B;  2XEP A;  3NBB A;  3UL6 A;  1STD A;  2KRT A;  4LSO A;  3DZL A;  5G2G A;  3G71 3;  2F86 B;  3STD A;  3JUO A;  3LYG A;  1GD4 A;  2W0Q A;  3G6E 3;  4XBY A;  1IT7 A;  4N6O B;  3GRD A;  2RFR A;  1WQL B;  1WTH A;  1FGR A;  1QAK A;  1U8C B;  5HGR A;  3EN8 A;  3LH4 A;  1NB3 I;  1N8R 4;  3CD6 3;  5DRE A;  1OAC A;  3ALA A;  2XRX B;  1CYV A;  1YJ9 3;  3CC2 3;  2P0X A;  3H3H A;  1SII A;  2XSH B;  3CCV 3;  3NM2 A;  1KQS 2;  1WMP A;  3V92 A;  5KP3 A;  3FKA A;  4N3V A;  2IA7 A;  2IUK A;  3OXA A;  5EEO A;  4HJL B;  3F14 A;  4AKZ A;  3I0Y A;  1FGT A;  2BO9 B;  2OTJ 3;  1JJ2 2;  3IPT A;  2BHM A;  3HX8 A;  3EE1 A;  5IEN A;  3H51 A;  4HBR A;  3NHX A;  2L4V A;  3CXC 2;  2FGT A;  1JB4 A;  2GXF A;  1VQK 3;  1KC8 4;  1ZX2 A;  2IMJ A;  3SED A;  5D83 A;  4KFF A;  4N6V 0;  4HM4 B;  5AYS C;  4EBG A;  1SQW A;  1YJW 3;  4H3U A;  1NJI 4;  5IG3 A;  2CFD A;  7STD A;  3ECF A;  1O7G B;  4RZM A;  1VQ4 3;  2O3O A;  1EA2 A;  3MG3 A;  3UB1 A;  4K1V A;  2V1L A;  4FCZ A;  4OUQ A;  1W6G A;  3Q2P A;  2E2T A;  3S67 A;  1YVB I;  3VSY A;  1IQY A;  4IIA A;  3G8Z A;  1DMQ A;  3Q1C A;  3GAX A;  1GY6 A;  2RSX A;  1Y4K A;  3KSE D;  3SLU A;  3DUK A;  3CCE 3;  1KD1 4;  2GU1 A;  4KVH A;  1JKG A;  3NQZ A;  4NRE A;  2P09 A;  2CH9 A;  2JDI H;  1NWW A;  3PXM A;  2GEY A;  2CFK A;  2ZDJ A;  1TUH A;  1FGQ A;  1O7M B;  2W04 A;  2XGN A;  3KZT A;  5AYR B;  1L5G B;  3X3Z A;  3QK9 A;  3RGR A;  2STD A;  2YX9 A;  2XH9 A;  3NV0 B;  4HM6 B;  3LML A;  3DGM A;  3PGB A;  1YGE A;  3PS8 A;  4OK0 A;  4XBX A;  1LOX A;  1YIJ 3;  4XB5 A;  1OHO A;  1LVN A;  4N6L A;  3K0Z A;  3Q90 A;  3KFQ C;  3KSP A;  3JUQ A;  5CLK A;  3CCJ 3;  2R4I A;  1MOL A;  5FGO A;  3DGN A;  1JV2 B;  1IVU A;  1VQ6 3;  3B4O A;  1IT8 A;  1FGO A;  2LYX A;  2ML6 A;  4FMA A;  3S5C A;  5KP1 A;  3J7Y d;  2CG1 A;  1CYU A;  1TFK A;  3F7S A;  4PEJ A;  1GS3 A;  4N6M A;  1Q82 4;  4K61 A;  1A67 A;  4LZI A;  1VQ5 3;  3CU3 A;  3DGO A;  4FCJ A;  1TP6 A;  2CHC A;  2GBW B;  3FG4 A;  3V99 A;  4MMY B;  1TU5 A;  3G0K A;  2P0M A;  1N9J A;  5AIF A;  1J2B A;  4LEH A;  3X41 A;  2HMM B;  1ASK A;  2QGU A;  3MG2 A;  2BMR B;  1IDP A;  3F8X A;  1UUW B;  2IUJ A;  1M1X B;  1D6Y A;  3F9S A;  2HMJ B;  4WYK B;  3KII A;  2ZL8 A;  3JVC A;  1ZO2 A;  3CCQ 3;  4QWT A;  1A2V A;  4CDL A;  2INX A;  4WFO A;  2K54 A;  5D81 A;  2BMO B;  2HMK B;  5BXQ A;  4HM1 B;  3MSO A;  1W6Y A;  3LZA A;  1HU9 A;  3M8C A;  1JN5 A;  1WMO A;  2W56 B;  3GWR A;  1EQK A;  1K28 A;  1SIH A;  3JUP A;  2D1W A;  5AIH A;  3SOA A;  1OPY A;  1Q86 4;  3AMO A;  3BLZ A;  5BVB A;  3HIG A;  1FGM A;  4HM0 B;  1ROV A;  4OVM A;  1FA3 A;  1GD3 A;  1HKX A;  1STF I;  2BT3 A;  3EC9 A;  3FZW A;  3T0U A;  1N5H A;  1OF5 B;  5CF1 A;  2JQ5 A;  2OCT A;  3KE7 A;  4EXR A;  1OUN A;  4N6U A;  4ORL A;  1PFP A;  1OCV A;  1QVG 2;  1M90 4;  2KCD A;  1CEW I;  3NX0 A;  1ULI B;  3WOF B;  3UL5 A;  4K1U A;  3CCU 3;  4O02 B;  1QJG A;  3WOD G;  4BTW A;  3IMA B;  3FF0 A;  3WA2 X;  1A2K A;  3E99 A;  2PNC A;  1R4C A;  3CC4 3;  5DRV A;  3K9M C;  1KWI A;  4IPB A;  4XM4 A;  3N8B A;  2P05 A;  2XFS A;  1QAL A;  3F7X A;  3OV4 A;  1JB2 A;  5AII A;  2ML5 A;  3N9H A;  1ISK A;  3EHC A;  1WMN A;  5ELJ A;  1QMA A;  2UX0 A;  3OWS A;  5IF6 A;  2CFW A;  2BMQ B;  1V74 A;  1Q40 B;  3HK4 A;  4MMZ B;  3DMC A;  4KFE A;  2WOH A;  3HZP A;  3SOY A;  3SXX A;  2C10 A;  1T5Y A;  3T8N A;  3KKG A;  4O8S A;  3B7C A;  4JF8 A;  4G1M B;  1MNL A;  4KZ1 A;  2YFL B;  3OW2 2;  1S72 3;  4R1K A;  4LMI A;  2XR8 B;  1KSI A;  5CF2 A;  3FCS B;  1D6U A;  3NXJ A;  1GY5 A;  2M7O A;  2Y73 A;  3SVA A;  1M1K 4;  1W01 A;  5LC7 A;  1W2B 2;  5LC6 A;  2OTL 3;  3X42 A;  1DYU A;  3CCS 3;  2CWV A;  4N6T A;  3CNM A;  4O2H A;  1YI2 3;  2CG0 A;  2OOV C;  1K8A 4;  4HVN A;  1US1 A;  1O7W B;  1W5Z A;  4MEI A;  3OWY A;  3PCS A;  1G96 A;  2RCD A;  2C11 A;  1Q7Y 4;  2CKF B;  3S27 A;  1JB5 A;  1ULJ B;  3NM7 A;  3EBT A;  1VQ8 3;  4HYZ A;  3CCR 3;  4EV2 A;  2QIY A;  1IVV A;  1UI7 A;  2HMO B;  3F40 A;  3T8U A;  1VQO 3;  1YIT 3;  1Q81 4;  1O7H B;  4JRF A;  3MYT A;  5IER A;  1Q42 A;  5ELU A;  3JUM A;  1YJN 3;  1OGX A;  4HM8 B;  5AIG A;  3A76 A;  2E2V A;  6STD A;  3LOY A;  5IEO A;  4X2H A;  1RKY A;  4TX4 A;  1A90 A;  2SBL A;  3EBY A;  1OHS A;  3X40 A;  2XF3 A;  3EF8 A;  3BNC A;  2BNG A;  4HZ9 B;  3DM8 A;  4KFD A;  4NHF A;  1YHQ 3;  2CWU A;  1W7C A;  2XFT A;  4IT7 A;  3EN1 B;  3CCM 3;  3FF2 A;  3UNL A;  3PYJ A;  1IU7 A;  3DXO A;  4FMD A;  3OX9 A;  5D82 A;  3WOE B;  4EC6 A;  1WNH A;  2HML B;  2KXG A;  1LXE A;  4GB5 A;  1VQL 3;  3S28 A;  2Y74 A;  2OWP A;  3I55 3;  1RRH A;  4ZM8 A;  3WDG B;  3EQQ B;  4J9A A;  2LQV A;  5EQL A;  3CCL 3;  3KN4 A;  1JKG B;  4O3V A;  2CK3 H;  3B8L A;  2YFJ B;  3HI7 A;  1IQX A;  4R9L A;  4FR9 A;  1JRQ A;  3PCR A;  3CMA 3;  5AI1 A;  3NBJ A;  1VQ9 3;  3D3L A;  1OHP A;  2CFL A;  8CHO A;  1QVF 2;  3LXU X;  4FMC A;  1RJO A;  1SJW A;  3EB8 A;  3LT8 A;  2P38 A;  3DY5 A;  3U1W A;  1JNQ A;  4HM3 B;  3LTD A;  3TDG A;  3FG3 A;  2WOF A;  3OWU A;  4U13 A;  2K0M A;  1K9M 4;  1N5P A;  3IJE B;  3G4S 3;  3CPO A;  4MJD A;  1UUV B;  3CNX A;  4XBT A;  1TFO A;  2D42 A;  3HII A;  2A15 A;  3NV0 A;  2GU3 A;  2WGO A;  1VQN 3;  1LNH A;  1W4N A;  2E2U A;  3X3Y A;  1W2Z A;  1IVX A;  2CC3 A;  3FSD A;  1UI8 A;  1VQM 3;  1F8N A;  4HM7 B;  1E3V A;  5IG4 A;  4I4K A;  1UW1 A;  3EJV A;  4MMX B;  3ROB A;  3WMD A;  3LTA A;  3FLJ A;  2B24 B;  2F98 A;  1TIJ A;  1AR0 A;  3GZB A;  3RDE A;  2Z7A A;  3GZY B;  3K5T A;  5FW5 A;  2OOV A;  2QA4 3;  5EVH A;  4FMB A;  2CWT A;  2WGQ A;  3I56 3;  5I97 A;  4L8P A;  2CFG A;  4K90 B;  2FNQ A;  2XGL A;  3MG1 A;  3NQY A;  1O7N B;  1W00 A;  5IG0 A;  2OQE A;  4WWU C;  2Z6B A;  1NU3 A;  3X3X A;  1S5A A;  1VQ7 3;  4H61 A;  5CK6 A;  1VZZ A;  2MC8 A;  4RNZ A;  1GYB A;  3BB9 A;  3LT9 A;  3GZR A;  4RNY A;  2FXT A;  2RGQ A;  4FCM A;  4EV5 A;  1JN5 B;  4WYK A;  3SX1 A;  3FGY A;  2I9W A;  4AEQ A;  1BUQ A;  3AMO B;  5JBS A;  4R4K A;  1SPU A;  4R80 A;  1EKM A;  3NUV A;  5STD A;  4L7K A;  4L8O A;  3B4P A;  3VGN A;  2W9P A;  5KP4 A;  4WP5 A;  3D9R A;  1GY7 A;  3QRD A;  1ROA A;  2Z77 A;  2HMN B;  2W56 A;  3WA3 A;  1PU4 A;  5A0O B;  3MPH A;  1RRL A;  4CCV A;  2OQE C;  3L0R A;  1IQ8 A;  1DMM A;  3CME 3;  1CQS A;  2W9Q A;  1U5O A;  3FG1 A;  4HKV B;  1E3R A;  3PZW A;  3FH1 A;  3S29 A;  2QEX 3;  2W2C A;  1M9G A;  2W6J H;  1D6Z A;  2W03 A;  1OF5 A;  3O8Y A;  4XDW A;  4STD A;  1C7H A;  1K41 A;  1OH0 A;  3LTC A;  1DVD A;  3EX9 A;  2GBX B;  2B1X B;  4WHA A;  3NBR A;  3VF1 A;  3GZX B;  4EYC A;  4R9K A;  4N6N B;  4RBN A;  3CC7 3;  1DVC A;  3MWZ A;  3V98 A;  2O9U X;  3ER7 A;  4BTX A;  1FUW A;  5CXO A;  1AVL A;  3UJM A;  2GEX A;  4HM5 B;  3JUN A;  1DMN A;  5AEU B;  1IK3 A;  4XDV A;  5JPP A;  5IEP A;  3K63 A;  5IG5 A;  2F99 A;  3U97 A;  1NO3 A;  1Q40 A;  1W02 A;  1W6C A;  3MKI A;  4J8T A;  4X2O A;  5TGN A;  3RGA A;  1IV7 A;  2XSO B;  2CW9 A;  3F8H A;  3G16 A;  1AVK A;  3DGL A;  4HM2 B;  4GL6 A;  1NDO B;  1Z1S A;  4LGQ A;  3K7C A;  1RN7 A;  1K73 4;  1QAF A;  2WO0 A;  3N54 B;  1N9E A;  4AKY A;  3BND A;  4BTY A;  3CPW 2;  1NB5 I;  1OGZ A;  2Q07 A;  3BNE A;  1E97 A;  5AEW B;  2PZV A;  4HZB B;  3BNB A;  5JPU A;  1IV9 A;  3MHE A;  4Q53 A;  1VQP 3;  1IVW A;  1AV4 A;  2MF7 A;  1O7P B;  1N8Q A;  3LTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...