1O7HB

Naphthalene 1,2-dioxygenase with oxidized rieske iron sulphur center site.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Naphthalene Dioxygenase: Side-on Binding of Dioxygen to Iron
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
total genus 54
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1o7hB00
2K54A 1Q40B 1C7HA 3BLZA 4HM3B 2RCDA 1OPYA 4LMIA 1SJWA 2XRXB 3F7XA 4HKVB 7STDA 3JUPA 1Z1SA 1GYBA 2B1XB 4WYKA 2JQ5A 3T8NA 1GY7A 3LZAA 1CQSA 4RZMA 3CU3A 3GWRA 3VSYA 3EHCA 3SOYA 3FKAA 1W01A 1JB5A 4XBYA 5CLKA 2GBWB 3B8LA 1OH0A 2IMJA 1TUHA 3KE7A 4HZBB 3MG1A 2HMNB 3OWYA 3EN1B 3FH1A 1JKGB 1QMAA 4HM0B 4OVMA 3F8HA 4PEJA 3K0ZA 3CNMA 3G16A 5BXQA 3KKGA 2GEYA 1NU3A 2Z7AA 5D83A 1STDA 5IEPA 1VZZA 1Q42A 3SOAA 3ROBA 3B7CA 3F8XA 3KSPA 5FW5A 3NV0A 5HGRA 3JUNA 3FGYA 1DMQA 4MJDA 2HMLB 4CDLA 4HM5B 5AEUB 1WQLB 3HX8A 5IENA 5EVHA 1ASKA 2INXA 4J8TA 4XB5A 2HMMB 2GEXA 2PZVA 3ECFA 3A76A 3STDA 4FCJA 1O7MB 1O7HB 3HK4A 2BMOB 4XDWA 5CXOA 2BMRB 3NBRA 3GZYB 3JUOA 3GZXB 3NV0B 2R4IA 4K1VA 4XDVA 5CF2A 4FCMA 3RGRA 1W02A 3FSDA 3HZPA 2BMQB 1ULIB 2GBXB 3EBTA 1NDOB 3EX9A 3IPTA 4XBXA 6STDA 3ER7A 1UUWB 4HM8B 5IEOA 3D9RA 3OWSA 5AIGA 2BNGA 1W00A 5IG3A 3FZWA 4WP5A 3EJVA 4L7KA 4XBTA 1O7WB 1DMMA 1GY5A 2HMOB 4HVNA 3MYTA 4U13A 4ORLA 5IF6A 3B4PA 1EA2A 3MSOA 2Z76A 3DMCA 2CKFB 5IG0A 2F99A 1GY6A 3F40A 4GB5A 3FLJA 1E3VA 4X2OA 3OWUA 4KVHA 5CK6A 2GXFA 3DUKA 3FF2A 4R9LA 3WMDA 3MG3A 8CHOA 1O7NB 5KP1A 2QIYA 3F9SA 3GZRA 2YFIB 3NUVA 1OHPA 2B24B 3EN8A 3UJMA 3F7SA 5IERA 1OHSA 5STDA 1U5OA 4HM6B 1TP6A 5AEWB 5KP4A 1AR0A 1ULJB 1IDPA 5AI1A 4WWUC 2F98A 1OCVA 3NM2A 2XSHB 2Z77A 2RFRA 4H3UA 4WYKB 5IG4A 2XSOB 3H51A 1S5AA 1HKXA 3FF0A 2XR8B 3MKIA 1ZX2A 3DM8A 4HJLB 3K7CA 3T8UA 1JB2A 1OGXA 2STDA 3OX9A 5AIFA 1OF5A 3NXJA 4HM4B 5TGNA 5AIHA 1BUQA 2CHCA 5KP3A 1JB4A 1QJGA 3DXOA 1GS3A 1OHOA 1UUVB 3GZBA 3M8CA 3Q90A 4K1UA 2OWPA 3E99A 4XM4A 1Q40A 2UX0A 3NHXA 4HZ9B 4L8PA 5D81A 3JUMA 2YFJB 3G0KA 3EF8A 3MG2A 2I9WA 1E97A 1JKGA 2YFLB 3OXAA 5AIIA 3SEDA 1NWWA 4LEHA 4Q53A 1JN5B 5IG5A 3EBYA 5DREA 2HMJB 2W2CA 3UNLA 1JN5A 4HM2B 3CNXA 3MHEA 3OV4A 4I4KA 2RGQA 4HM7B 5D82A 3RGAA 3KZTA 4J9AA 4IIAA 3VGNA 3EQQB 1O7PB 5JPPA 1W6YA 1K41A 3H3HA 3F14A 3I0YA 3LYGA 4X2HA 1O7GB 2HMKB 3S5CA 5CF1A 4L8OA 1EG9B 2F86B 2QGUA 5BVBA 1OGZA 3EC9A 4STDA 3B4OA 5JPUA 3BB9A 2A15A 5DRVA 4OUQA 3G8ZA 3DZLA 4N3VA 3GRDA 3JUQA 4LGQA 1E3RA 4R1KA 1A2KA 1OUNA 1DMNA 1ZO2A 4HM1B 5G2GA 4R9KA 1ISKA 3CPOA 1OF5B
chains in the Genus database with same CATH superfamily
3DGLA 3BLZA 4HM3B 5EEOA 2IUKA 3LH4A 4NREA 1OPYA 1BSCA 2W6JH 1QAKA 7STDA 1RJOA 2SBLA 1GYBA 1G96A 3EE1A 5AYSC 1CQSA 1BOXA 1B20A 3EHCA 3CCV3 1W01A 1FGQA 2GBWB 1PY3A 4FMDA 2OTL3 2IMJA 3Q3FA 1TUHA 5BU4A 1N8R4 2AAEA 4GL6A 3OWYA 3WDGB 4HM0B 1JKGB 2F5MA 5A0OB 3F8HA 3K0ZA 1DVCA 3D3LA 3CNMA 5BXQA 1BNFA 4EV2A 1VQO3 3KKGA 2GEYA 4CCVA 1NB5I 1NU3A 2Z7AA 1LVNA 1LOYA 4EBGA 1YNVX 1N9EA 1Q42A 3Q2PA 2CG1A 1I2GA 2P05A 3B7CA 4KFEA 3F8XA 3CCM3 2KF3A 5HGRA 1RNTA 3JUNA 1AVLA 1B3SA 1Q814 2W56A 3D5GA 5IENA 1ASKA 4XB5A 3CC43 2HMMB 1KSIA 1YVSA 4FCJA 3HK4A 4MMYB 2BMOB 5CXOA 1B2UA 1HZ1A 3DGYA 2BMRB 1AV4A 3RGRA 2M7OA 1CYVA 3EBTA 3JVCA 1VQQA 1NJI4 5GSPA 1GOUA 2MC8A 1B2ZA 3KIIA 2CX0A 5IEOA 4NHFA 1X1WA 1EUIC 4L7KA 1O7WB 1GY5A 1RMSA 2FGTA 4R4KA 3MYTA 3MSOA 4O8SA 3DMCA 2CKFB 2MF7A 5M19A 1GD3A 2IY2A 1RGFA 4FCZA 4GB5A 3CCL3 1MNLA 3RNTA 2GXFA 1RGKA 3BNEA 2WOFA 3WOFB 1YJN3 1RTUA 2Q07A 2P0XA 3F9SA 3G6E3 1LXEA 2B24B 4RBNA 3FCSB 4DKIA 3F7SA 3CCQ3 3TDGA 1TP6A 1OACA 3ALAA 3D5IA 3DH2A 4N6UA 4BIRA 2GU1A 4FMCA 2KF6A 2F98A 3NM2A 4WWUC 3ZFZA 1A90A 2KF5A 2ZHXB 3DY5A 2RFRA 4H3UA 4EYCA 1FGRA 1WMPA 2XSOB 1B2SA 3FF0A 1ROAA 2XEPA 1ZX2A 2RBIA 4HJLB 3U97A 1FUWA 3K7CA 1G0TA 1OGXA 5AIFA 1SPUA 1JZOA 5KP3A 2P38A 1JB4A 1QJGA 3GZBA 2V1LA 1OHOA 2ZDJA 4KZ1A 4XM4A 2L4VA 2W04A 3NX0A 1PFPA 3G0KA 3MG2A 2I9WA 3KN4A 3CC73 1YIT3 4Q53A 4CPKA 1LNHA 2BU4A 2CFLA 2HMJB 1Q7HA 4FMBA 1MWRA 2P0MA 4HM7B 3RGAA 1RNBA 3BNCA 4IIAA 3VGNA 3EQQB 1PU4A 3K9MC 3I563 1GMPA 2BO9B 3I0YA 3LYGA 3NM7A 2H0HA 4X2HA 1S723 1VQL3 4L8OA 4LSOA 1QAFA 1BNSA 1OGZA 1V58A 2CH9A 3BB9A 2A15A 2RNTA 1RDSA 2CG0A 4IT7A 1BNEA 3DGOA 3PGBA 2WGOA 2O9UX 4LGQA 1E3RA 4R1KA 3D79A 1J2BA 1OUNA 1DMNA 3MWZA 1ISKA 3CPOA 4N6OB 5FGOA 1Q40B 1C7HA 3LTBA 4BTWA 1JBRA 2R41A 3V98A 2XRXB 3F7XA 1RCLA 2LQVA 3MPHA 4O2HA 4WYKA 1GY7A 1W5ZA 3LT9A 3LOYA 3CCJ3 1BUJA 3S27A 4N6MA 2KRTA 3CU3A 3VSYA 1R4YA 4XBYA 8RNTA 1UCIA 1U8CB 3Q1CA 3B8LA 4FMAA 2IUJA 1IVWA 1OH0A 1UGHI 2XGNA 2CIUA 1L5GB 3AHWA 1QMAA 3FH1A 3K63A 3G16A 2XH9A 2E2TA 3UL6A 1LOXA 1US1A 2ZL8A 5D83A 3UL5A 3CXC2 3VF1A 1FA3A 4BTXA 1BVIA 1VQ63 1YIJ3 3SOAA 2Y73A 1VQK3 3KSPA 2OTJ3 2C10A 4O3VA 5FW5A 3FGYA 1DMQA 2HMLB 5AEUB 5EVHA 1IVVA 3STDA 1I0VA 1O7MB 1I2FA 1X1YA 3KFQC 3NBRA 1W2B2 2R4IA 4XDVA 2KAAA 3FSDA 3KCHA 1CEWI 1ULIB 2BMQB 2GBXB 2CWVA 1LQGC 1W7CA 3EX9A 1WNHA 3IPTA 1MWSA 4XBXA 1KC84 1AY7A 2CFDA 1X1XA 3D4AA 1N9JA 3D9RA 3PCRA 4K61A 2BNGA 5AIGA 3G713 2GU3A 3EJVA 4LYLB 4XBTA 4HVNA 3NQZA 3FG3A 2UUGC 4KFFA 4EW5A 1LOVA 5RNTA 3CMA3 1FGOA 4WHAA 1JNQA 2J8XB 1VQ43 1E3VA 5LC6A 1IVXA 1TJDA 4KVHA 3DUKA 3FF2A 4R9LA 2W03A 3ZG0A 1G02A 2YFIB 3NUVA 3RDEA 3AMOB 3FG4A 3U1WA 4HM6B 5AEWB 2W9PA 3ZG5A 1IQXA 1UI7A 3PZWA 1UCLA 1C54A 3SLUA 4NPBA 2QEX3 3H51A 1S5AA 1HKXA 1UCKA 3T8UA 3WOEB 1BSEA 1OF5A 3NXJA 5AIHA 1BUQA 2CHCA 1GS3A 3SYUA 4RNYA 3IJEB 3E99A 2UX0A 2YFJB 1GSPA 1KWIA 3EF8A 1NB3I 3OXAA 1E97A 3BNDA 2YFLB 4R9KA 4J5GA 3PCSA 2OCTA 1TRQA 1Q824 3EBYA 5DREA 3DGNA 2W2CA 3WA3A 1B2MA 5D82A 2ML6A 5M1AA 1UI8A 3KZTA 1JZDA 4AKZA 5JPPA 1W6YA 1A67A 1K41A 3UB1A 3H3HA 3F14A 5CF1A 2E2VA 1LOWA 5BVBA 1N8QA 2QGUA 1BNRA 3EC9A 1CYUA 3X3ZA 1Y4KA 3HI7A 3LXUX 1T2IA 6RNTA 3DZLA 4BTYA 4HYZA 5G2GA 1OF5B 3L0RA 1YHQ3 2K54A 1A2VA 2P09A 1JV2B 1FUTA 4LMIA 5G1LA 1I0XA 1SJWA 3I553 4HKVB 3JUPA 1M904 1Z1SA 2B1XB 2BT3A 4EC6A 3LTDA 1MWTA 1SARA 4RZMA 2ZA4A 3GWRA 1M1XB 3SOYA 2KF4A 2Y74A 1JB5A 5CLKA 5HOHA 2Z6BA 3KE7A 1QVG2 2L1SA 3MG1A 2HMNB 1M1K4 4I5QA 4J5KA 1QALA 4GHOA 1BRJA 4N6TA 1RGEA 2AADA 1V57A 3HIGA 1STDA 1BNJA 3PXMA 4HAAA 1VQ73 1K28A 1IV9A 3K5TA 3NV0A 1RRLA 5LC7A 3SX1A 1V74A 2CFKA 4CDLA 4HM5B 4EV5A 1WQLB 3HX8A 2INXA 4J8TA 3BIRA 1JBTA 4O02B 2PZVA 2GEXA 1KD14 1DE3A 3A76A 1O7HB 4XDWA 1JRQA 1UDII 1UW1A 1IQYA 3NV0B 3JUOA 3WODG 5IG3A 2CK3H 5CF2A 1I3FA 4FCMA 1D6UA 1W02A 3OW22 4LZIA 1FZUA 6STDA 4OK0A 1IU7A 3ER7A 1UUWB 3A5EA 3CCS3 3WA2X 1T2HA 1K734 1W00A 4WP5A 3URPA 5IF6A 1DMMA 4U13A 2HMOB 3S28A 4G1MB 5ELJA 4N6LA 3FLJA 4X2OA 1LQMB 3OWUA 8CHOA 4WFOA 3MG3A 1RRHA 1O7NB 3N54B 4MMZB 2SARA 1BSBA 2CC3A 2CX1A 4AEQA 3UJMA 3HIIA 2XF3A 4MEIA 1OHSA 1X1UA 2OOVA 5STDA 1U5OA 5IERA 1RHLA 5KP4A 1HYFA 2FXTA 1AR0A 2WO0A 1RN4A 1IDPA 1LNIA 1AQZA 1OCVA 2XSHB 5M18A 3FG1A 4ZM8A 4WYKB 2OQEC 1VQ53 1EEJA 1IVUA 2XR8B 2H0GA 2C4BA 1JB2A 4HOHA 3V92A 3PYJA 4HM4B 2W0QA 1MGRA 1GMQA 1TTOA 1YVBI 5TGNA 3QRDA 3X3YA 3X3XA 1IYYA 3DXOA 1RGHA 2OQEA 1TFKA 4K1UA 3Q90A 2ML5A 1Q7Y4 1RKYA 3AGNA 3NHXA 2YX9A 1FGTA 2PNCA 4HZ9B 3JUMA 1IT7A 1UGIA 3LMLA 1DYUA 1JKGA 1NO3A 4TX4A 5AIIA 2BIRA 1DVDA 2OOVC 2XFTA 3LTAA 1BANA 1JN5B 1I3IA 1YGWA 3T0UA 3G4S3 4BU4A 1JN5A 1WMOA 3MHEA 3OV4A 4I4KA 3X41A 2RGQA 4RNTA 1JBSA 4BL2A 1O7PB 2KCDA 4CJNA 2HMKB 2W9QA 1IV7A 2F86B 5JPUA 1T5YA 3O8YA 2H0IA 3B4OA 1TRPA 3J7Yd 1GD4A 4OUQA 3IMAB 4HBRA 1PYLA 4H61A 3GRDA 3JUQA 4RNZA 1A2KA 1ZO2A 4HM1B 2QA43 1Q864 1ZGXA 1QVF2 1FUSA 5G1KA 2RCDA 1IQ8A 3HOHA 1RLSA 3T8NA 1BAOA 2JQ5A 1RGCA 3LZAA 1UUGB 3SXXA 1BRHA 1IT8A 2WOHA 2KXGA 1VQM3 3FKAA 1WMNA 4QWTA 1EKMA 4GSPA 4EXRA 4HZBB 3AGOA 1TU5A 1K8A4 3EN1B 4JF8A 4OVMA 4PEJA 4N6V0 1BRSA 3N8BA 1D6YA 1GOYA 1BRIA 2IA7A 2XGLA 3AMOA 5IEPA 2E2UA 1VZZA 3GAXA 3X40A 2F5WA 1EQKA 3ROBA 3BNBA 4MMXB 3CCU3 1RN7A 1NNVA 2BHMA 1BGSA 4BL3A 4MJDA 5EQLA 3LTCA 1I8VA 2JDIH 1ROVA 4KT3B 2CW9A 3ECFA 2D42A 1FW7A 1TIJA 2CFWA 2IYJA 1RGGA 1TFOA 1FGMA 1IK3A 1JJ22 4K1VA 3GZYB 3GZXB 3QK9A 4K90B 1SIHA 2K3DA 3CPW2 1UCJA 3HZPA 3KSED 1NDOB 1K9M4 1W4NA 1N5PA 4HM8B 1BNGA 2W56B 3CCE3 1MWUA 3OWSA 1B21A 2C11A 4R80A 3FZWA 5ELUA 1YJ93 7RNTA 4AKYA 1MOLA 4ORLA 3B4PA 1EA2A 1ZS7A 3CCR3 2Z76A 5IG0A 1VQP3 2F99A 3WR2A 1GY6A 2F56A 3F40A 1BNIA 1CH0A 2D1WA 5CK6A 1WTHA 3WMDA 5KP1A 1RSNA 2QIYA 4N6NB 3GZRA 3CD63 1OHPA 3EN8A 1N5HA 4JRFA 1GOVA 2CFGA 3NQYA 9RNTA 1YI23 4KFDA 1A2PA 1T3BA 3LT8A 1FYSA 1ULJB 1BRGA 1BSAA 5AI1A 3S67A 3NBJA 3SVAA 2Z77A 5IG4A 1F8NA 1BRNL 1I70A 1RCKA 1VQ93 1YJW3 1B27A 2LYXA 3WHOA 3MKIA 1KQS2 3DGMA 3DM8A 3OX9A 2STDA 1MGWA 3BU4A 1VQ83 1HU9A 5BIRA 2CWTA 1D6ZA 1UUVB 1W2ZA 3AHSA 3M8CA 4IPBA 4ILFA 1M9GA 2OWPA 1W6GA 2XFSA 1Q40A 5D81A 1BRKA 4L8PA 5JBSA 2GSPA 5AYRB 7GSPA 1VQN3 1Q9EA 1BU4A 1B2XA 3X42A 3SEDA 5IW9A 3EB8A 1NWWA 2UGIA 2RSXA 4LEHA 1STFI 2K0MA 1SIIA 1I2EA 5IG5A 1GMRA 1AVKA 3UNLA 3CC23 4HM2B 1R4CA 3CNXA 1BIRA 3N9HA 1RGLA 1BSDA 4J9AA 1RN1A 3GSPA 2HOHA 3S5CA 1O7GB 1LRAA 1RGAA 3NBBA 5I97A 3CME3 1EG9B 4FR9A 3S29A 1DETA 2FNQA 4STDA 1SQWA 3V99A 2O3OA 5DRVA 6GSPA 3G8ZA 4N3VA 2WGQA 3PS8A 1YGEA 2F4YA 2CWUA 1W6CA
chains in the Genus database with same CATH topology
3DGLA 3BLZA 4HM3B 5EEOA 2IUKA 3LH4A 4NREA 1OPYA 2W6JH 1QAKA 7STDA 1RJOA 2SBLA 1GYBA 1G96A 3EE1A 5AYSC 1CQSA 3EHCA 3CCV3 1W01A 1FGQA 2GBWB 4FMDA 2OTL3 2IMJA 1TUHA 1N8R4 4GL6A 3OWYA 3WDGB 4HM0B 1JKGB 5A0OB 3F8HA 3K0ZA 1DVCA 3D3LA 3CNMA 5BXQA 1NB5I 4EV2A 1VQO3 3KKGA 2GEYA 4CCVA 1NU3A 2Z7AA 1LVNA 4EBGA 1N9EA 1Q42A 3Q2PA 2CG1A 2P05A 3B7CA 4KFEA 3F8XA 3CCM3 5HGRA 3JUNA 1AVLA 1Q814 2W56A 5IENA 1ASKA 4XB5A 3CC43 2HMMB 1KSIA 4FCJA 3HK4A 4MMYB 2BMOB 5CXOA 2BMRB 1AV4A 3RGRA 2M7OA 1CYVA 3EBTA 3JVCA 1NJI4 2MC8A 3KIIA 5IEOA 4NHFA 4L7KA 1O7WB 1GY5A 2FGTA 4R4KA 3MYTA 3MSOA 4O8SA 3DMCA 2CKFB 2MF7A 1GD3A 4GB5A 4FCZA 3CCL3 1MNLA 2GXFA 1YJN3 3BNEA 2WOFA 3WOFB 2Q07A 2P0XA 3F9SA 3G6E3 1LXEA 2B24B 4RBNA 3FCSB 3CCQ3 3F7SA 3TDGA 1TP6A 1OACA 3ALAA 4N6UA 2GU1A 4FMCA 4WWUC 2F98A 3NM2A 1A90A 3DY5A 2RFRA 4H3UA 4EYCA 1FGRA 1WMPA 2XSOB 3FF0A 1ROAA 2XEPA 1ZX2A 4HJLB 3U97A 1FUWA 3K7CA 1OGXA 5AIFA 1SPUA 5KP3A 2P38A 1JB4A 1QJGA 3GZBA 2V1LA 1OHOA 2ZDJA 4KZ1A 4XM4A 2L4VA 2W04A 3NX0A 1PFPA 3G0KA 3MG2A 2I9WA 3KN4A 3CC73 1YIT3 4Q53A 1LNHA 2CFLA 2HMJB 4FMBA 2P0MA 4HM7B 3RGAA 3BNCA 4IIAA 3VGNA 3EQQB 1PU4A 3K9MC 3I563 3NM7A 2BO9B 3I0YA 3LYGA 4X2HA 1S723 1VQL3 4L8OA 4LSOA 1QAFA 1OGZA 2CH9A 3BB9A 2A15A 2CG0A 4IT7A 3DGOA 3PGBA 1J2BA 2WGOA 2O9UX 4LGQA 1E3RA 4R1KA 1OUNA 1DMNA 3MWZA 1ISKA 3CPOA 4N6OB 5FGOA 1Q40B 1C7HA 3LTBA 4BTWA 3V98A 2XRXB 3F7XA 2LQVA 3MPHA 4O2HA 4WYKA 1GY7A 1W5ZA 3LT9A 3LOYA 3CCJ3 3S27A 4N6MA 2KRTA 3CU3A 3VSYA 4XBYA 3Q1CA 1U8CB 3B8LA 4FMAA 2IUJA 1IVWA 1OH0A 2XGNA 2CIUA 1L5GB 3FH1A 1QMAA 3K63A 3G16A 2XH9A 2E2TA 3UL6A 1LOXA 1US1A 2ZL8A 5D83A 3UL5A 3CXC2 3VF1A 1FA3A 4BTXA 1VQ63 1YIJ3 3SOAA 2Y73A 1VQK3 3KSPA 2OTJ3 2C10A 4O3VA 5FW5A 3FGYA 1DMQA 2HMLB 5AEUB 5EVHA 1IVVA 3STDA 1O7MB 3KFQC 3NBRA 1W2B2 2R4IA 4XDVA 3FSDA 1CEWI 1ULIB 2BMQB 2GBXB 2CWVA 1W7CA 3IPTA 3EX9A 1WNHA 4XBXA 1KC84 2CFDA 1N9JA 3D9RA 3PCRA 4K61A 2BNGA 5AIGA 3G713 2GU3A 3EJVA 4XBTA 4HVNA 3NQZA 3FG3A 4KFFA 3CMA3 1FGOA 4WHAA 1JNQA 1VQ43 1E3VA 5LC6A 1IVXA 4KVHA 3DUKA 3FF2A 4R9LA 2W03A 2YFIB 3NUVA 3RDEA 3AMOB 3FG4A 3U1WA 4HM6B 5AEWB 2W9PA 1IQXA 1UI7A 3PZWA 3SLUA 2QEX3 3H51A 1S5AA 1HKXA 3T8UA 3WOEB 1OF5A 3NXJA 5AIHA 1BUQA 2CHCA 1GS3A 4RNYA 3IJEB 3E99A 2UX0A 2YFJB 1KWIA 3EF8A 1NB3I 3OXAA 1E97A 3BNDA 2YFLB 4R9KA 3PCSA 1Q824 3EBYA 5DREA 3DGNA 2W2CA 3WA3A 5D82A 2ML6A 1UI8A 3KZTA 4AKZA 5JPPA 1W6YA 1A67A 1K41A 3UB1A 3H3HA 3F14A 5CF1A 2E2VA 5BVBA 1N8QA 2QGUA 1CYUA 3EC9A 3X3ZA 1Y4KA 3HI7A 3LXUX 3DZLA 4BTYA 4HYZA 5G2GA 1OF5B 3L0RA 1YHQ3 2K54A 1A2VA 2P09A 1JV2B 4LMIA 3I553 1SJWA 4HKVB 3JUPA 1M904 1Z1SA 2B1XB 2BT3A 4EC6A 3LTDA 4RZMA 3GWRA 1M1XB 3SOYA 2Y74A 1JB5A 5CLKA 2Z6BA 3KE7A 1QVG2 3MG1A 2HMNB 1M1K4 1QALA 4N6TA 3HIGA 1STDA 3PXMA 1VQ73 1K28A 1IV9A 3K5TA 3NV0A 1RRLA 5LC7A 3SX1A 1V74A 2CFKA 4CDLA 4HM5B 4EV5A 1WQLB 3HX8A 2INXA 4J8TA 4O02B 2PZVA 2GEXA 1KD14 3A76A 1O7HB 4XDWA 1JRQA 1UW1A 1IQYA 3NV0B 3JUOA 3WODG 5IG3A 2CK3H 5CF2A 4FCMA 1D6UA 1W02A 3OW22 4LZIA 6STDA 4OK0A 1IU7A 3ER7A 1UUWB 3CCS3 3WA2X 1K734 1W00A 4WP5A 5IF6A 1DMMA 4U13A 2HMOB 3S28A 4G1MB 5ELJA 4N6LA 3FLJA 4X2OA 3OWUA 8CHOA 4WFOA 3MG3A 1RRHA 1O7NB 3N54B 4MMZB 2CC3A 4AEQA 3UJMA 3HIIA 2XF3A 4MEIA 1OHSA 2OOVA 5IERA 5STDA 1U5OA 5KP4A 2FXTA 1AR0A 2WO0A 1IDPA 1OCVA 2XSHB 3FG1A 4ZM8A 4WYKB 2OQEC 1VQ53 1IVUA 2XR8B 1JB2A 3V92A 3PYJA 4HM4B 2W0QA 1YVBI 5TGNA 3X3YA 3QRDA 3X3XA 3DXOA 2OQEA 1TFKA 4K1UA 3Q90A 2ML5A 1Q7Y4 1RKYA 3NHXA 4HZ9B 2YX9A 1FGTA 2PNCA 3JUMA 1IT7A 3LMLA 1DYUA 1JKGA 1NO3A 4TX4A 5AIIA 1DVDA 2OOVC 2XFTA 3LTAA 3G4S3 1JN5B 3T0UA 1JN5A 1WMOA 3MHEA 3OV4A 4I4KA 3X41A 2RGQA 1O7PB 2KCDA 2HMKB 2W9QA 1IV7A 2F86B 5JPUA 1T5YA 3O8YA 3B4OA 3J7Yd 1GD4A 4OUQA 3IMAB 4HBRA 4H61A 4RNZA 3GRDA 3JUQA 1A2KA 1ZO2A 4HM1B 2QA43 1Q864 1QVF2 2RCDA 1IQ8A 3T8NA 2JQ5A 3LZAA 3SXXA 1IT8A 2WOHA 2KXGA 1VQM3 3FKAA 1WMNA 4QWTA 1EKMA 4EXRA 4HZBB 1TU5A 1K8A4 3EN1B 4JF8A 4OVMA 4PEJA 4N6V0 3N8BA 1D6YA 2IA7A 2XGLA 3AMOA 5IEPA 2E2UA 1VZZA 3GAXA 3X40A 1EQKA 3ROBA 3BNBA 4MMXB 3CCU3 1RN7A 2BHMA 4MJDA 5EQLA 3LTCA 2JDIH 1ROVA 2CW9A 3ECFA 2D42A 1TIJA 2CFWA 1TFOA 1FGMA 1IK3A 1JJ22 4K1VA 3GZYB 3GZXB 3QK9A 4K90B 1SIHA 3CPW2 3HZPA 3KSED 1NDOB 1K9M4 1W4NA 1N5PA 4HM8B 2W56B 1YGEA 3OWSA 3CCE3 2C11A 4R80A 3FZWA 5ELUA 1YJ93 4AKYA 1MOLA 4ORLA 3B4PA 1EA2A 3CCR3 2Z76A 5IG0A 1VQP3 2F99A 1GY6A 3F40A 2D1WA 5CK6A 1WTHA 3WMDA 5KP1A 2QIYA 4N6NB 3GZRA 3CD63 1OHPA 3EN8A 1N5HA 4JRFA 2CFGA 3NQYA 1YI23 4KFDA 3LT8A 1ULJB 5AI1A 3S67A 3NBJA 3SVAA 2Z77A 5IG4A 1F8NA 1VQ93 1YJW3 2LYXA 1KQS2 3MKIA 3DGMA 3DM8A 3OX9A 2STDA 1VQ83 1HU9A 2CWTA 1D6ZA 1UUVB 1W2ZA 3M8CA 4IPBA 1M9GA 2OWPA 1W6GA 2XFSA 1Q40A 5D81A 4L8PA 5JBSA 5AYRB 1VQN3 3X42A 3SEDA 5IW9A 3EB8A 1NWWA 4LEHA 2RSXA 1STFI 2K0MA 1SIIA 5IG5A 3CC23 1AVKA 3UNLA 4HM2B 1R4CA 3CNXA 3N9HA 4J9AA 5I97A 3S5CA 1O7GB 3NBBA 3CME3 1EG9B 4FR9A 3S29A 2FNQA 4STDA 1SQWA 3V99A 2O3OA 5DRVA 3G8ZA 4N3VA 2WGQA 3PS8A 2OCTA 2CWUA 1W6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K54 A;  1Q40 B;  1C7H A;  3BLZ A;  4HM3 B;  2RCD A;  1OPY A;  4LMI A;  1SJW A;  2XRX B;  3F7X A;  4HKV B;  7STD A;  3JUP A;  1Z1S A;  1GYB A;  2B1X B;  4WYK A;  2JQ5 A;  3T8N A;  1GY7 A;  3LZA A;  1CQS A;  4RZM A;  3CU3 A;  3GWR A;  3VSY A;  3EHC A;  3SOY A;  3FKA A;  1W01 A;  1JB5 A;  4XBY A;  5CLK A;  2GBW B;  3B8L A;  1OH0 A;  2IMJ A;  1TUH A;  3KE7 A;  4HZB B;  3MG1 A;  2HMN B;  3OWY A;  3EN1 B;  3FH1 A;  1JKG B;  1QMA A;  4HM0 B;  4OVM A;  3F8H A;  4PEJ A;  3K0Z A;  3CNM A;  3G16 A;  5BXQ A;  3KKG A;  2GEY A;  1NU3 A;  2Z7A A;  5D83 A;  1STD A;  5IEP A;  1VZZ A;  1Q42 A;  3SOA A;  3ROB A;  3B7C A;  3F8X A;  3KSP A;  5FW5 A;  3NV0 A;  5HGR A;  3JUN A;  3FGY A;  1DMQ A;  4MJD A;  2HML B;  4CDL A;  4HM5 B;  5AEU B;  1WQL B;  3HX8 A;  5IEN A;  5EVH A;  1ASK A;  2INX A;  4J8T A;  4XB5 A;  2HMM B;  2GEX A;  2PZV A;  3ECF A;  3A76 A;  3STD A;  4FCJ A;  1O7M B;  1O7H B;  3HK4 A;  2BMO B;  4XDW A;  5CXO A;  2BMR B;  3NBR A;  3GZY B;  3JUO A;  3GZX B;  3NV0 B;  2R4I A;  4K1V A;  4XDV A;  5CF2 A;  4FCM A;  3RGR A;  1W02 A;  3FSD A;  3HZP A;  2BMQ B;  1ULI B;  2GBX B;  3EBT A;  1NDO B;  3EX9 A;  3IPT A;  4XBX A;  6STD A;  3ER7 A;  1UUW B;  4HM8 B;  5IEO A;  3D9R A;  3OWS A;  5AIG A;  2BNG A;  1W00 A;  5IG3 A;  3FZW A;  4WP5 A;  3EJV A;  4L7K A;  4XBT A;  1O7W B;  1DMM A;  1GY5 A;  2HMO B;  4HVN A;  3MYT A;  4U13 A;  4ORL A;  5IF6 A;  3B4P A;  1EA2 A;  3MSO A;  2Z76 A;  3DMC A;  2CKF B;  5IG0 A;  2F99 A;  1GY6 A;  3F40 A;  4GB5 A;  3FLJ A;  1E3V A;  4X2O A;  3OWU A;  4KVH A;  5CK6 A;  2GXF A;  3DUK A;  3FF2 A;  4R9L A;  3WMD A;  3MG3 A;  8CHO A;  1O7N B;  5KP1 A;  2QIY A;  3F9S A;  3GZR A;  2YFI B;  3NUV A;  1OHP A;  2B24 B;  3EN8 A;  3UJM A;  3F7S A;  5IER A;  1OHS A;  5STD A;  1U5O A;  4HM6 B;  1TP6 A;  5AEW B;  5KP4 A;  1AR0 A;  1ULJ B;  1IDP A;  5AI1 A;  4WWU C;  2F98 A;  1OCV A;  3NM2 A;  2XSH B;  2Z77 A;  2RFR A;  4H3U A;  4WYK B;  5IG4 A;  2XSO B;  3H51 A;  1S5A A;  1HKX A;  3FF0 A;  2XR8 B;  3MKI A;  1ZX2 A;  3DM8 A;  4HJL B;  3K7C A;  3T8U A;  1JB2 A;  1OGX A;  2STD A;  3OX9 A;  5AIF A;  1OF5 A;  3NXJ A;  4HM4 B;  5TGN A;  5AIH A;  1BUQ A;  2CHC A;  5KP3 A;  1JB4 A;  1QJG A;  3DXO A;  1GS3 A;  1OHO A;  1UUV B;  3GZB A;  3M8C A;  3Q90 A;  4K1U A;  2OWP A;  3E99 A;  4XM4 A;  1Q40 A;  2UX0 A;  3NHX A;  4HZ9 B;  4L8P A;  5D81 A;  3JUM A;  2YFJ B;  3G0K A;  3EF8 A;  3MG2 A;  2I9W A;  1E97 A;  1JKG A;  2YFL B;  3OXA A;  5AII A;  3SED A;  1NWW A;  4LEH A;  4Q53 A;  1JN5 B;  5IG5 A;  3EBY A;  5DRE A;  2HMJ B;  2W2C A;  3UNL A;  1JN5 A;  4HM2 B;  3CNX A;  3MHE A;  3OV4 A;  4I4K A;  2RGQ A;  4HM7 B;  5D82 A;  3RGA A;  3KZT A;  4J9A A;  4IIA A;  3VGN A;  3EQQ B;  1O7P B;  5JPP A;  1W6Y A;  1K41 A;  3H3H A;  3F14 A;  3I0Y A;  3LYG A;  4X2H A;  1O7G B;  2HMK B;  3S5C A;  5CF1 A;  4L8O A;  1EG9 B;  2F86 B;  2QGU A;  5BVB A;  1OGZ A;  3EC9 A;  4STD A;  3B4O A;  5JPU A;  3BB9 A;  2A15 A;  5DRV A;  4OUQ A;  3G8Z A;  3DZL A;  4N3V A;  3GRD A;  3JUQ A;  4LGQ A;  1E3R A;  4R1K A;  1A2K A;  1OUN A;  1DMN A;  1ZO2 A;  4HM1 B;  5G2G A;  4R9K A;  1ISK A;  3CPO A;  1OF5 B; 
#chains in the Genus database with same CATH topology
 3DGL A;  3BLZ A;  4HM3 B;  5EEO A;  2IUK A;  3LH4 A;  4NRE A;  1OPY A;  1BSC A;  2W6J H;  1QAK A;  7STD A;  1RJO A;  2SBL A;  1GYB A;  1G96 A;  3EE1 A;  5AYS C;  1CQS A;  1BOX A;  1B20 A;  3EHC A;  3CCV 3;  1W01 A;  1FGQ A;  2GBW B;  1PY3 A;  4FMD A;  2OTL 3;  2IMJ A;  3Q3F A;  1TUH A;  5BU4 A;  1N8R 4;  2AAE A;  4GL6 A;  3OWY A;  3WDG B;  4HM0 B;  1JKG B;  2F5M A;  5A0O B;  3F8H A;  3K0Z A;  1DVC A;  3D3L A;  3CNM A;  5BXQ A;  1BNF A;  4EV2 A;  1VQO 3;  3KKG A;  2GEY A;  4CCV A;  1NB5 I;  1NU3 A;  2Z7A A;  1LVN A;  1LOY A;  4EBG A;  1YNV X;  1N9E A;  1Q42 A;  3Q2P A;  2CG1 A;  1I2G A;  2P05 A;  3B7C A;  4KFE A;  3F8X A;  3CCM 3;  2KF3 A;  5HGR A;  1RNT A;  3JUN A;  1AVL A;  1B3S A;  1Q81 4;  2W56 A;  3D5G A;  5IEN A;  1ASK A;  4XB5 A;  3CC4 3;  2HMM B;  1KSI A;  1YVS A;  4FCJ A;  3HK4 A;  4MMY B;  2BMO B;  5CXO A;  1B2U A;  1HZ1 A;  3DGY A;  2BMR B;  1AV4 A;  3RGR A;  2M7O A;  1CYV A;  3EBT A;  3JVC A;  1VQQ A;  1NJI 4;  5GSP A;  1GOU A;  2MC8 A;  1B2Z A;  3KII A;  2CX0 A;  5IEO A;  4NHF A;  1X1W A;  1EUI C;  4L7K A;  1O7W B;  1GY5 A;  1RMS A;  2FGT A;  4R4K A;  3MYT A;  3MSO A;  4O8S A;  3DMC A;  2CKF B;  2MF7 A;  5M19 A;  1GD3 A;  2IY2 A;  1RGF A;  4FCZ A;  4GB5 A;  3CCL 3;  1MNL A;  3RNT A;  2GXF A;  1RGK A;  3BNE A;  2WOF A;  3WOF B;  1YJN 3;  1RTU A;  2Q07 A;  2P0X A;  3F9S A;  3G6E 3;  1LXE A;  2B24 B;  4RBN A;  3FCS B;  4DKI A;  3F7S A;  3CCQ 3;  3TDG A;  1TP6 A;  1OAC A;  3ALA A;  3D5I A;  3DH2 A;  4N6U A;  4BIR A;  2GU1 A;  4FMC A;  2KF6 A;  2F98 A;  3NM2 A;  4WWU C;  3ZFZ A;  1A90 A;  2KF5 A;  2ZHX B;  3DY5 A;  2RFR A;  4H3U A;  4EYC A;  1FGR A;  1WMP A;  2XSO B;  1B2S A;  3FF0 A;  1ROA A;  2XEP A;  1ZX2 A;  2RBI A;  4HJL B;  3U97 A;  1FUW A;  3K7C A;  1G0T A;  1OGX A;  5AIF A;  1SPU A;  1JZO A;  5KP3 A;  2P38 A;  1JB4 A;  1QJG A;  3GZB A;  2V1L A;  1OHO A;  2ZDJ A;  4KZ1 A;  4XM4 A;  2L4V A;  2W04 A;  3NX0 A;  1PFP A;  3G0K A;  3MG2 A;  2I9W A;  3KN4 A;  3CC7 3;  1YIT 3;  4Q53 A;  4CPK A;  1LNH A;  2BU4 A;  2CFL A;  2HMJ B;  1Q7H A;  4FMB A;  1MWR A;  2P0M A;  4HM7 B;  3RGA A;  1RNB A;  3BNC A;  4IIA A;  3VGN A;  3EQQ B;  1PU4 A;  3K9M C;  3I56 3;  1GMP A;  2BO9 B;  3I0Y A;  3LYG A;  3NM7 A;  2H0H A;  4X2H A;  1S72 3;  1VQL 3;  4L8O A;  4LSO A;  1QAF A;  1BNS A;  1OGZ A;  1V58 A;  2CH9 A;  3BB9 A;  2A15 A;  2RNT A;  1RDS A;  2CG0 A;  4IT7 A;  1BNE A;  3DGO A;  3PGB A;  2WGO A;  2O9U X;  4LGQ A;  1E3R A;  4R1K A;  3D79 A;  1J2B A;  1OUN A;  1DMN A;  3MWZ A;  1ISK A;  3CPO A;  4N6O B;  5FGO A;  1Q40 B;  1C7H A;  3LTB A;  4BTW A;  1JBR A;  2R41 A;  3V98 A;  2XRX B;  3F7X A;  1RCL A;  2LQV A;  3MPH A;  4O2H A;  4WYK A;  1GY7 A;  1W5Z A;  3LT9 A;  3LOY A;  3CCJ 3;  1BUJ A;  3S27 A;  4N6M A;  2KRT A;  3CU3 A;  3VSY A;  1R4Y A;  4XBY A;  8RNT A;  1UCI A;  1U8C B;  3Q1C A;  3B8L A;  4FMA A;  2IUJ A;  1IVW A;  1OH0 A;  1UGH I;  2XGN A;  2CIU A;  1L5G B;  3AHW A;  1QMA A;  3FH1 A;  3K63 A;  3G16 A;  2XH9 A;  2E2T A;  3UL6 A;  1LOX A;  1US1 A;  2ZL8 A;  5D83 A;  3UL5 A;  3CXC 2;  3VF1 A;  1FA3 A;  4BTX A;  1BVI A;  1VQ6 3;  1YIJ 3;  3SOA A;  2Y73 A;  1VQK 3;  3KSP A;  2OTJ 3;  2C10 A;  4O3V A;  5FW5 A;  3FGY A;  1DMQ A;  2HML B;  5AEU B;  5EVH A;  1IVV A;  3STD A;  1I0V A;  1O7M B;  1I2F A;  1X1Y A;  3KFQ C;  3NBR A;  1W2B 2;  2R4I A;  4XDV A;  2KAA A;  3FSD A;  3KCH A;  1CEW I;  1ULI B;  2BMQ B;  2GBX B;  2CWV A;  1LQG C;  1W7C A;  3EX9 A;  1WNH A;  3IPT A;  1MWS A;  4XBX A;  1KC8 4;  1AY7 A;  2CFD A;  1X1X A;  3D4A A;  1N9J A;  3D9R A;  3PCR A;  4K61 A;  2BNG A;  5AIG A;  3G71 3;  2GU3 A;  3EJV A;  4LYL B;  4XBT A;  4HVN A;  3NQZ A;  3FG3 A;  2UUG C;  4KFF A;  4EW5 A;  1LOV A;  5RNT A;  3CMA 3;  1FGO A;  4WHA A;  1JNQ A;  2J8X B;  1VQ4 3;  1E3V A;  5LC6 A;  1IVX A;  1TJD A;  4KVH A;  3DUK A;  3FF2 A;  4R9L A;  2W03 A;  3ZG0 A;  1G02 A;  2YFI B;  3NUV A;  3RDE A;  3AMO B;  3FG4 A;  3U1W A;  4HM6 B;  5AEW B;  2W9P A;  3ZG5 A;  1IQX A;  1UI7 A;  3PZW A;  1UCL A;  1C54 A;  3SLU A;  4NPB A;  2QEX 3;  3H51 A;  1S5A A;  1HKX A;  1UCK A;  3T8U A;  3WOE B;  1BSE A;  1OF5 A;  3NXJ A;  5AIH A;  1BUQ A;  2CHC A;  1GS3 A;  3SYU A;  4RNY A;  3IJE B;  3E99 A;  2UX0 A;  2YFJ B;  1GSP A;  1KWI A;  3EF8 A;  1NB3 I;  3OXA A;  1E97 A;  3BND A;  2YFL B;  4R9K A;  4J5G A;  3PCS A;  2OCT A;  1TRQ A;  1Q82 4;  3EBY A;  5DRE A;  3DGN A;  2W2C A;  3WA3 A;  1B2M A;  5D82 A;  2ML6 A;  5M1A A;  1UI8 A;  3KZT A;  1JZD A;  4AKZ A;  5JPP A;  1W6Y A;  1A67 A;  1K41 A;  3UB1 A;  3H3H A;  3F14 A;  5CF1 A;  2E2V A;  1LOW A;  5BVB A;  1N8Q A;  2QGU A;  1BNR A;  3EC9 A;  1CYU A;  3X3Z A;  1Y4K A;  3HI7 A;  3LXU X;  1T2I A;  6RNT A;  3DZL A;  4BTY A;  4HYZ A;  5G2G A;  1OF5 B;  3L0R A;  1YHQ 3;  2K54 A;  1A2V A;  2P09 A;  1JV2 B;  1FUT A;  4LMI A;  5G1L A;  1I0X A;  1SJW A;  3I55 3;  4HKV B;  3JUP A;  1M90 4;  1Z1S A;  2B1X B;  2BT3 A;  4EC6 A;  3LTD A;  1MWT A;  1SAR A;  4RZM A;  2ZA4 A;  3GWR A;  1M1X B;  3SOY A;  2KF4 A;  2Y74 A;  1JB5 A;  5CLK A;  5HOH A;  2Z6B A;  3KE7 A;  1QVG 2;  2L1S A;  3MG1 A;  2HMN B;  1M1K 4;  4I5Q A;  4J5K A;  1QAL A;  4GHO A;  1BRJ A;  4N6T A;  1RGE A;  2AAD A;  1V57 A;  3HIG A;  1STD A;  1BNJ A;  3PXM A;  4HAA A;  1VQ7 3;  1K28 A;  1IV9 A;  3K5T A;  3NV0 A;  1RRL A;  5LC7 A;  3SX1 A;  1V74 A;  2CFK A;  4CDL A;  4HM5 B;  4EV5 A;  1WQL B;  3HX8 A;  2INX A;  4J8T A;  3BIR A;  1JBT A;  4O02 B;  2PZV A;  2GEX A;  1KD1 4;  1DE3 A;  3A76 A;  1O7H B;  4XDW A;  1JRQ A;  1UDI I;  1UW1 A;  1IQY A;  3NV0 B;  3JUO A;  3WOD G;  5IG3 A;  2CK3 H;  5CF2 A;  1I3F A;  4FCM A;  1D6U A;  1W02 A;  3OW2 2;  4LZI A;  1FZU A;  6STD A;  4OK0 A;  1IU7 A;  3ER7 A;  1UUW B;  3A5E A;  3CCS 3;  3WA2 X;  1T2H A;  1K73 4;  1W00 A;  4WP5 A;  3URP A;  5IF6 A;  1DMM A;  4U13 A;  2HMO B;  3S28 A;  4G1M B;  5ELJ A;  4N6L A;  3FLJ A;  4X2O A;  1LQM B;  3OWU A;  8CHO A;  4WFO A;  3MG3 A;  1RRH A;  1O7N B;  3N54 B;  4MMZ B;  2SAR A;  1BSB A;  2CC3 A;  2CX1 A;  4AEQ A;  3UJM A;  3HII A;  2XF3 A;  4MEI A;  1OHS A;  1X1U A;  2OOV A;  5STD A;  1U5O A;  5IER A;  1RHL A;  5KP4 A;  1HYF A;  2FXT A;  1AR0 A;  2WO0 A;  1RN4 A;  1IDP A;  1LNI A;  1AQZ A;  1OCV A;  2XSH B;  5M18 A;  3FG1 A;  4ZM8 A;  4WYK B;  2OQE C;  1VQ5 3;  1EEJ A;  1IVU A;  2XR8 B;  2H0G A;  2C4B A;  1JB2 A;  4HOH A;  3V92 A;  3PYJ A;  4HM4 B;  2W0Q A;  1MGR A;  1GMQ A;  1TTO A;  1YVB I;  5TGN A;  3QRD A;  3X3Y A;  3X3X A;  1IYY A;  3DXO A;  1RGH A;  2OQE A;  1TFK A;  4K1U A;  3Q90 A;  2ML5 A;  1Q7Y 4;  1RKY A;  3AGN A;  3NHX A;  2YX9 A;  1FGT A;  2PNC A;  4HZ9 B;  3JUM A;  1IT7 A;  1UGI A;  3LML A;  1DYU A;  1JKG A;  1NO3 A;  4TX4 A;  5AII A;  2BIR A;  1DVD A;  2OOV C;  2XFT A;  3LTA A;  1BAN A;  1JN5 B;  1I3I A;  1YGW A;  3T0U A;  3G4S 3;  4BU4 A;  1JN5 A;  1WMO A;  3MHE A;  3OV4 A;  4I4K A;  3X41 A;  2RGQ A;  4RNT A;  1JBS A;  4BL2 A;  1O7P B;  2KCD A;  4CJN A;  2HMK B;  2W9Q A;  1IV7 A;  2F86 B;  5JPU A;  1T5Y A;  3O8Y A;  2H0I A;  3B4O A;  1TRP A;  3J7Y d;  1GD4 A;  4OUQ A;  3IMA B;  4HBR A;  1PYL A;  4H61 A;  3GRD A;  3JUQ A;  4RNZ A;  1A2K A;  1ZO2 A;  4HM1 B;  2QA4 3;  1Q86 4;  1ZGX A;  1QVF 2;  1FUS A;  5G1K A;  2RCD A;  1IQ8 A;  3HOH A;  1RLS A;  3T8N A;  1BAO A;  2JQ5 A;  1RGC A;  3LZA A;  1UUG B;  3SXX A;  1BRH A;  1IT8 A;  2WOH A;  2KXG A;  1VQM 3;  3FKA A;  1WMN A;  4QWT A;  1EKM A;  4GSP A;  4EXR A;  4HZB B;  3AGO A;  1TU5 A;  1K8A 4;  3EN1 B;  4JF8 A;  4OVM A;  4PEJ A;  4N6V 0;  1BRS A;  3N8B A;  1D6Y A;  1GOY A;  1BRI A;  2IA7 A;  2XGL A;  3AMO A;  5IEP A;  2E2U A;  1VZZ A;  3GAX A;  3X40 A;  2F5W A;  1EQK A;  3ROB A;  3BNB A;  4MMX B;  3CCU 3;  1RN7 A;  1NNV A;  2BHM A;  1BGS A;  4BL3 A;  4MJD A;  5EQL A;  3LTC A;  1I8V A;  2JDI H;  1ROV A;  4KT3 B;  2CW9 A;  3ECF A;  2D42 A;  1FW7 A;  1TIJ A;  2CFW A;  2IYJ A;  1RGG A;  1TFO A;  1FGM A;  1IK3 A;  1JJ2 2;  4K1V A;  3GZY B;  3GZX B;  3QK9 A;  4K90 B;  1SIH A;  2K3D A;  3CPW 2;  1UCJ A;  3HZP A;  3KSE D;  1NDO B;  1K9M 4;  1W4N A;  1N5P A;  4HM8 B;  1BNG A;  2W56 B;  3CCE 3;  1MWU A;  3OWS A;  1B21 A;  2C11 A;  4R80 A;  3FZW A;  5ELU A;  1YJ9 3;  7RNT A;  4AKY A;  1MOL A;  4ORL A;  3B4P A;  1EA2 A;  1ZS7 A;  3CCR 3;  2Z76 A;  5IG0 A;  1VQP 3;  2F99 A;  3WR2 A;  1GY6 A;  2F56 A;  3F40 A;  1BNI A;  1CH0 A;  2D1W A;  5CK6 A;  1WTH A;  3WMD A;  5KP1 A;  1RSN A;  2QIY A;  4N6N B;  3GZR A;  3CD6 3;  1OHP A;  3EN8 A;  1N5H A;  4JRF A;  1GOV A;  2CFG A;  3NQY A;  9RNT A;  1YI2 3;  4KFD A;  1A2P A;  1T3B A;  3LT8 A;  1FYS A;  1ULJ B;  1BRG A;  1BSA A;  5AI1 A;  3S67 A;  3NBJ A;  3SVA A;  2Z77 A;  5IG4 A;  1F8N A;  1BRN L;  1I70 A;  1RCK A;  1VQ9 3;  1YJW 3;  1B27 A;  2LYX A;  3WHO A;  3MKI A;  1KQS 2;  3DGM A;  3DM8 A;  3OX9 A;  2STD A;  1MGW A;  3BU4 A;  1VQ8 3;  1HU9 A;  5BIR A;  2CWT A;  1D6Z A;  1UUV B;  1W2Z A;  3AHS A;  3M8C A;  4IPB A;  4ILF A;  1M9G A;  2OWP A;  1W6G A;  2XFS A;  1Q40 A;  5D81 A;  1BRK A;  4L8P A;  5JBS A;  2GSP A;  5AYR B;  7GSP A;  1VQN 3;  1Q9E A;  1BU4 A;  1B2X A;  3X42 A;  3SED A;  5IW9 A;  3EB8 A;  1NWW A;  2UGI A;  2RSX A;  4LEH A;  1STF I;  2K0M A;  1SII A;  1I2E A;  5IG5 A;  1GMR A;  1AVK A;  3UNL A;  3CC2 3;  4HM2 B;  1R4C A;  3CNX A;  1BIR A;  3N9H A;  1RGL A;  1BSD A;  4J9A A;  1RN1 A;  3GSP A;  2HOH A;  3S5C A;  1O7G B;  1LRA A;  1RGA A;  3NBB A;  5I97 A;  3CME 3;  1EG9 B;  4FR9 A;  3S29 A;  1DET A;  2FNQ A;  4STD A;  1SQW A;  3V99 A;  2O3O A;  5DRV A;  6GSP A;  3G8Z A;  4N3V A;  2WGQ A;  3PS8 A;  1YGE A;  2F4Y A;  2CWU A;  1W6C A; 
#chains in the Genus database with same CATH homology
 3DGL A;  3BLZ A;  4HM3 B;  5EEO A;  2IUK A;  3LH4 A;  4NRE A;  1OPY A;  2W6J H;  1QAK A;  7STD A;  1RJO A;  2SBL A;  1GYB A;  1G96 A;  3EE1 A;  5AYS C;  1CQS A;  3EHC A;  3CCV 3;  1W01 A;  1FGQ A;  2GBW B;  4FMD A;  2OTL 3;  2IMJ A;  1TUH A;  1N8R 4;  4GL6 A;  3OWY A;  3WDG B;  4HM0 B;  1JKG B;  5A0O B;  3F8H A;  3K0Z A;  1DVC A;  3D3L A;  3CNM A;  5BXQ A;  1NB5 I;  4EV2 A;  1VQO 3;  3KKG A;  2GEY A;  4CCV A;  1NU3 A;  2Z7A A;  1LVN A;  4EBG A;  1N9E A;  1Q42 A;  3Q2P A;  2CG1 A;  2P05 A;  3B7C A;  4KFE A;  3F8X A;  3CCM 3;  5HGR A;  3JUN A;  1AVL A;  1Q81 4;  2W56 A;  5IEN A;  1ASK A;  4XB5 A;  3CC4 3;  2HMM B;  1KSI A;  4FCJ A;  3HK4 A;  4MMY B;  2BMO B;  5CXO A;  2BMR B;  1AV4 A;  3RGR A;  2M7O A;  1CYV A;  3EBT A;  3JVC A;  1NJI 4;  2MC8 A;  3KII A;  5IEO A;  4NHF A;  4L7K A;  1O7W B;  1GY5 A;  2FGT A;  4R4K A;  3MYT A;  3MSO A;  4O8S A;  3DMC A;  2CKF B;  2MF7 A;  1GD3 A;  4GB5 A;  4FCZ A;  3CCL 3;  1MNL A;  2GXF A;  1YJN 3;  3BNE A;  2WOF A;  3WOF B;  2Q07 A;  2P0X A;  3F9S A;  3G6E 3;  1LXE A;  2B24 B;  4RBN A;  3FCS B;  3CCQ 3;  3F7S A;  3TDG A;  1TP6 A;  1OAC A;  3ALA A;  4N6U A;  2GU1 A;  4FMC A;  4WWU C;  2F98 A;  3NM2 A;  1A90 A;  3DY5 A;  2RFR A;  4H3U A;  4EYC A;  1FGR A;  1WMP A;  2XSO B;  3FF0 A;  1ROA A;  2XEP A;  1ZX2 A;  4HJL B;  3U97 A;  1FUW A;  3K7C A;  1OGX A;  5AIF A;  1SPU A;  5KP3 A;  2P38 A;  1JB4 A;  1QJG A;  3GZB A;  2V1L A;  1OHO A;  2ZDJ A;  4KZ1 A;  4XM4 A;  2L4V A;  2W04 A;  3NX0 A;  1PFP A;  3G0K A;  3MG2 A;  2I9W A;  3KN4 A;  3CC7 3;  1YIT 3;  4Q53 A;  1LNH A;  2CFL A;  2HMJ B;  4FMB A;  2P0M A;  4HM7 B;  3RGA A;  3BNC A;  4IIA A;  3VGN A;  3EQQ B;  1PU4 A;  3K9M C;  3I56 3;  3NM7 A;  2BO9 B;  3I0Y A;  3LYG A;  4X2H A;  1S72 3;  1VQL 3;  4L8O A;  4LSO A;  1QAF A;  1OGZ A;  2CH9 A;  3BB9 A;  2A15 A;  2CG0 A;  4IT7 A;  3DGO A;  3PGB A;  1J2B A;  2WGO A;  2O9U X;  4LGQ A;  1E3R A;  4R1K A;  1OUN A;  1DMN A;  3MWZ A;  1ISK A;  3CPO A;  4N6O B;  5FGO A;  1Q40 B;  1C7H A;  3LTB A;  4BTW A;  3V98 A;  2XRX B;  3F7X A;  2LQV A;  3MPH A;  4O2H A;  4WYK A;  1GY7 A;  1W5Z A;  3LT9 A;  3LOY A;  3CCJ 3;  3S27 A;  4N6M A;  2KRT A;  3CU3 A;  3VSY A;  4XBY A;  3Q1C A;  1U8C B;  3B8L A;  4FMA A;  2IUJ A;  1IVW A;  1OH0 A;  2XGN A;  2CIU A;  1L5G B;  3FH1 A;  1QMA A;  3K63 A;  3G16 A;  2XH9 A;  2E2T A;  3UL6 A;  1LOX A;  1US1 A;  2ZL8 A;  5D83 A;  3UL5 A;  3CXC 2;  3VF1 A;  1FA3 A;  4BTX A;  1VQ6 3;  1YIJ 3;  3SOA A;  2Y73 A;  1VQK 3;  3KSP A;  2OTJ 3;  2C10 A;  4O3V A;  5FW5 A;  3FGY A;  1DMQ A;  2HML B;  5AEU B;  5EVH A;  1IVV A;  3STD A;  1O7M B;  3KFQ C;  3NBR A;  1W2B 2;  2R4I A;  4XDV A;  3FSD A;  1CEW I;  1ULI B;  2BMQ B;  2GBX B;  2CWV A;  1W7C A;  3IPT A;  3EX9 A;  1WNH A;  4XBX A;  1KC8 4;  2CFD A;  1N9J A;  3D9R A;  3PCR A;  4K61 A;  2BNG A;  5AIG A;  3G71 3;  2GU3 A;  3EJV A;  4XBT A;  4HVN A;  3NQZ A;  3FG3 A;  4KFF A;  3CMA 3;  1FGO A;  4WHA A;  1JNQ A;  1VQ4 3;  1E3V A;  5LC6 A;  1IVX A;  4KVH A;  3DUK A;  3FF2 A;  4R9L A;  2W03 A;  2YFI B;  3NUV A;  3RDE A;  3AMO B;  3FG4 A;  3U1W A;  4HM6 B;  5AEW B;  2W9P A;  1IQX A;  1UI7 A;  3PZW A;  3SLU A;  2QEX 3;  3H51 A;  1S5A A;  1HKX A;  3T8U A;  3WOE B;  1OF5 A;  3NXJ A;  5AIH A;  1BUQ A;  2CHC A;  1GS3 A;  4RNY A;  3IJE B;  3E99 A;  2UX0 A;  2YFJ B;  1KWI A;  3EF8 A;  1NB3 I;  3OXA A;  1E97 A;  3BND A;  2YFL B;  4R9K A;  3PCS A;  1Q82 4;  3EBY A;  5DRE A;  3DGN A;  2W2C A;  3WA3 A;  5D82 A;  2ML6 A;  1UI8 A;  3KZT A;  4AKZ A;  5JPP A;  1W6Y A;  1A67 A;  1K41 A;  3UB1 A;  3H3H A;  3F14 A;  5CF1 A;  2E2V A;  5BVB A;  1N8Q A;  2QGU A;  1CYU A;  3EC9 A;  3X3Z A;  1Y4K A;  3HI7 A;  3LXU X;  3DZL A;  4BTY A;  4HYZ A;  5G2G A;  1OF5 B;  3L0R A;  1YHQ 3;  2K54 A;  1A2V A;  2P09 A;  1JV2 B;  4LMI A;  3I55 3;  1SJW A;  4HKV B;  3JUP A;  1M90 4;  1Z1S A;  2B1X B;  2BT3 A;  4EC6 A;  3LTD A;  4RZM A;  3GWR A;  1M1X B;  3SOY A;  2Y74 A;  1JB5 A;  5CLK A;  2Z6B A;  3KE7 A;  1QVG 2;  3MG1 A;  2HMN B;  1M1K 4;  1QAL A;  4N6T A;  3HIG A;  1STD A;  3PXM A;  1VQ7 3;  1K28 A;  1IV9 A;  3K5T A;  3NV0 A;  1RRL A;  5LC7 A;  3SX1 A;  1V74 A;  2CFK A;  4CDL A;  4HM5 B;  4EV5 A;  1WQL B;  3HX8 A;  2INX A;  4J8T A;  4O02 B;  2PZV A;  2GEX A;  1KD1 4;  3A76 A;  1O7H B;  4XDW A;  1JRQ A;  1UW1 A;  1IQY A;  3NV0 B;  3JUO A;  3WOD G;  5IG3 A;  2CK3 H;  5CF2 A;  4FCM A;  1D6U A;  1W02 A;  3OW2 2;  4LZI A;  6STD A;  4OK0 A;  1IU7 A;  3ER7 A;  1UUW B;  3CCS 3;  3WA2 X;  1K73 4;  1W00 A;  4WP5 A;  5IF6 A;  1DMM A;  4U13 A;  2HMO B;  3S28 A;  4G1M B;  5ELJ A;  4N6L A;  3FLJ A;  4X2O A;  3OWU A;  8CHO A;  4WFO A;  3MG3 A;  1RRH A;  1O7N B;  3N54 B;  4MMZ B;  2CC3 A;  4AEQ A;  3UJM A;  3HII A;  2XF3 A;  4MEI A;  1OHS A;  2OOV A;  5IER A;  5STD A;  1U5O A;  5KP4 A;  2FXT A;  1AR0 A;  2WO0 A;  1IDP A;  1OCV A;  2XSH B;  3FG1 A;  4ZM8 A;  4WYK B;  2OQE C;  1VQ5 3;  1IVU A;  2XR8 B;  1JB2 A;  3V92 A;  3PYJ A;  4HM4 B;  2W0Q A;  1YVB I;  5TGN A;  3X3Y A;  3QRD A;  3X3X A;  3DXO A;  2OQE A;  1TFK A;  4K1U A;  3Q90 A;  2ML5 A;  1Q7Y 4;  1RKY A;  3NHX A;  4HZ9 B;  2YX9 A;  1FGT A;  2PNC A;  3JUM A;  1IT7 A;  3LML A;  1DYU A;  1JKG A;  1NO3 A;  4TX4 A;  5AII A;  1DVD A;  2OOV C;  2XFT A;  3LTA A;  3G4S 3;  1JN5 B;  3T0U A;  1JN5 A;  1WMO A;  3MHE A;  3OV4 A;  4I4K A;  3X41 A;  2RGQ A;  1O7P B;  2KCD A;  2HMK B;  2W9Q A;  1IV7 A;  2F86 B;  5JPU A;  1T5Y A;  3O8Y A;  3B4O A;  3J7Y d;  1GD4 A;  4OUQ A;  3IMA B;  4HBR A;  4H61 A;  4RNZ A;  3GRD A;  3JUQ A;  1A2K A;  1ZO2 A;  4HM1 B;  2QA4 3;  1Q86 4;  1QVF 2;  2RCD A;  1IQ8 A;  3T8N A;  2JQ5 A;  3LZA A;  3SXX A;  1IT8 A;  2WOH A;  2KXG A;  1VQM 3;  3FKA A;  1WMN A;  4QWT A;  1EKM A;  4EXR A;  4HZB B;  1TU5 A;  1K8A 4;  3EN1 B;  4JF8 A;  4OVM A;  4PEJ A;  4N6V 0;  3N8B A;  1D6Y A;  2IA7 A;  2XGL A;  3AMO A;  5IEP A;  2E2U A;  1VZZ A;  3GAX A;  3X40 A;  1EQK A;  3ROB A;  3BNB A;  4MMX B;  3CCU 3;  1RN7 A;  2BHM A;  4MJD A;  5EQL A;  3LTC A;  2JDI H;  1ROV A;  2CW9 A;  3ECF A;  2D42 A;  1TIJ A;  2CFW A;  1TFO A;  1FGM A;  1IK3 A;  1JJ2 2;  4K1V A;  3GZY B;  3GZX B;  3QK9 A;  4K90 B;  1SIH A;  3CPW 2;  3HZP A;  3KSE D;  1NDO B;  1K9M 4;  1W4N A;  1N5P A;  4HM8 B;  2W56 B;  1YGE A;  3OWS A;  3CCE 3;  2C11 A;  4R80 A;  3FZW A;  5ELU A;  1YJ9 3;  4AKY A;  1MOL A;  4ORL A;  3B4P A;  1EA2 A;  3CCR 3;  2Z76 A;  5IG0 A;  1VQP 3;  2F99 A;  1GY6 A;  3F40 A;  2D1W A;  5CK6 A;  1WTH A;  3WMD A;  5KP1 A;  2QIY A;  4N6N B;  3GZR A;  3CD6 3;  1OHP A;  3EN8 A;  1N5H A;  4JRF A;  2CFG A;  3NQY A;  1YI2 3;  4KFD A;  3LT8 A;  1ULJ B;  5AI1 A;  3S67 A;  3NBJ A;  3SVA A;  2Z77 A;  5IG4 A;  1F8N A;  1VQ9 3;  1YJW 3;  2LYX A;  1KQS 2;  3MKI A;  3DGM A;  3DM8 A;  3OX9 A;  2STD A;  1VQ8 3;  1HU9 A;  2CWT A;  1D6Z A;  1UUV B;  1W2Z A;  3M8C A;  4IPB A;  1M9G A;  2OWP A;  1W6G A;  2XFS A;  1Q40 A;  5D81 A;  4L8P A;  5JBS A;  5AYR B;  1VQN 3;  3X42 A;  3SED A;  5IW9 A;  3EB8 A;  1NWW A;  4LEH A;  2RSX A;  1STF I;  2K0M A;  1SII A;  5IG5 A;  3CC2 3;  1AVK A;  3UNL A;  4HM2 B;  1R4C A;  3CNX A;  3N9H A;  4J9A A;  5I97 A;  3S5C A;  1O7G B;  3NBB A;  3CME 3;  1EG9 B;  4FR9 A;  3S29 A;  2FNQ A;  4STD A;  1SQW A;  3V99 A;  2O3O A;  5DRV A;  3G8Z A;  4N3V A;  2WGQ A;  3PS8 A;  2OCT A;  2CWU A;  1W6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...