1BNFA

Barnase t70c/s92c disulfide mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRCWREADINYTSGFRNSDRILYSCDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Disulfide mutants of barnase. I: Changes in stability and structure assessed by biophysical methods and X-ray crystallography.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnfA00
3Q3FA 4J5GA 4RNTA 1LOYA 1I0VA 1RGHA 3AGNA 1G02A 3A5EA 1RNTA 1LRAA 1RHLA 1TRQA 3BU4A 1UCLA 1Q9EA 4GHOA 1LOVA 3D5IA 1BRHA 2AADA 1PYLA 1TTOA 1RN4A 3BIRA 5RNTA 1BRNL 1BNEA 1UCIA 1BSCA 3DH2A 1BIRA 1TRPA 2F5MA 2KF4A 1JBRA 1BSAA 1FUTA 1DE3A 1YGWA 2F56A 1I70A 2BU4A 5HOHA 4BIRA 2KAAA 1GMQA 1FZUA 1YVSA 1RGGA 5GSPA 1BNRA 3WHOA 1BGSA 2KF6A 1RTUA 1BNIA 2GSPA 1RNBA 1X1WA 1JBSA 1C54A 1RLSA 1X1UA 3HOHA 1X1XA 2BIRA 1B2XA 2HOHA 6GSPA 1I8VA 1B3SA 4HOHA 1YNVX 4BU4A 1BAOA 1DETA 5BU4A 8RNTA 1BSBA 3D5GA 2AAEA 1B27A 1BU4A 1RCLA 1BRGA 1LNIA 9RNTA 1RGFA 2RNTA 3D4AA 1BRKA 1BNJA 7RNTA 1LOWA 4HAAA 1UCJA 1IYYA 1FW7A 1RMSA 1GOVA 1SARA 1BSEA 1A2PA 1RSNA 1BNGA 1HZ1A 1MGWA 2F4YA 1CH0A 4GSPA 1BSDA 1B2MA 1GMPA 1B21A 3AHWA 2ZA4A 3AHSA 2RBIA 3SYUA 1BRIA 1FUSA 5BIRA 1BNSA 1RGEA 1BVIA 6RNTA 1GSPA 1BRJA 1T2HA 1I0XA 1GOYA 1AQZA 2KF3A 1MGRA 3GSPA 3RNTA 7GSPA 1B2SA 2C4BA 2KF5A 3KCHA 1BANA 1T2IA 1RGCA 1AY7A 1GOUA 2F5WA 1X1YA 1I3IA 1I2EA 1BNFA 1JBTA 1RGLA 1B2ZA 1RGKA 1FYSA 1ZGXA 4J5KA 1I2GA 1HYFA 1B20A 1PY3A 2SARA 3URPA 1GMRA 1BRSA 1RDSA 1B2UA 1R4YA 1BOXA 3DGYA 1I2FA 1RCKA 1RGAA 1UCKA 1RN1A 1I3FA 3AGOA 3WR2A 1BUJA
chains in the Genus database with same CATH superfamily
1UUGB 3MG2A 3RDEA 4FMCA 4LZIA 1W6CA 1YJ93 2UUGC 3B4OA 1JZDA 3DGNA 2BMOB 1OF5A 4FMBA 3CXC2 1TRQA 2Z77A 2IYJA 1UCLA 3BNEA 4HM6B 3GRDA 3H3HA 3S28A 1V57A 5STDA 3ZFZA 4HYZA 1T5YA 4HKVB 1M1K4 1T3BA 2A15A 3NBBA 5JPPA 1YJW3 5IG3A 2P0XA 3FF2A 1NJI4 2W03A 1RN4A 3DXOA 1VQ43 3KN4A 3F8XA 1N9JA 2BMQB 2CG1A 4XM4A 2CFGA 3KZTA 3D79A 4O3VA 1QVG2 1TRPA 2B1XB 4GB5A 2YFIB 1Q40A 5DRVA 3S29A 1FUTA 2F86B 5IEPA 1RRLA 2CX1A 3OX9A 1I70A 2BU4A 3CCS3 1BNRA 1FA3A 3GAXA 1TP6A 2HMNB 2YFLB 1BGSA 2KF6A 4FMAA 1UW1A 1RTUA 1DVDA 1NU3A 1BNIA 3FG3A 4K1UA 4KT3B 4EV5A 3X3XA 1NDOB 1WMOA 2R4IA 1CYVA 1E3VA 4FR9A 4CPKA 1BUQA 1JN5B 1NB3I 2QIYA 3EHCA 4KFEA 6GSPA 1I8VA 3OWUA 3B4PA 3SOYA 3K63A 5I97A 8RNTA 3ECFA 3CNXA 1R4CA 1OPYA 1VQO3 1VQ83 5JBSA 1MOLA 2AAEA 1RCLA 1RGFA 1VZZA 3BB9A 5M18A 1LQMB 1OACA 1STDA 1BNJA 3NV0B 1UI7A 1TIJA 1DMNA 2W6JH 4EYCA 1YI23 1A2PA 1ULIB 2F4YA 3L0RA 2WGOA 1CH0A 3G4S3 1BSDA 5IG5A 1GMPA 2F99A 3JUNA 1SQWA 4LYLB 3G6E3 4L8PA 1FUSA 2FNQA 1BNSA 5KP1A 3F8HA 1E3RA 2W04A 3U1WA 3NUVA 5IEOA 3N8BA 2WOHA 2CIUA 5A0OB 3U97A 3UL6A 1Y4KA 1AQZA 4KZ1A 2MC8A 1MGRA 1JZOA 3RNTA 7GSPA 4JF8A 4IPBA 4RBNA 3X3ZA 3KCHA 1RGCA 2D1WA 1LOXA 1O7WB 1X1YA 2ML6A 4R1KA 1K41A 2IMJA 4BL3A 1KSIA 1IU7A 1JKGB 4FMDA 1OCVA 3IMAB 1VQ93 1FYSA 1RKYA 1ZGXA 4I5QA 2XFSA 2WGQA 4K90B 1W4NA 1QAFA 2P09A 3GZYB 1BRSA 3MPHA 3I563 1SJWA 2HMKB 2ML5A 2O3OA 1NWWA 2RCDA 1VQ63 1KD14 3WOEB 2WO0A 1RGAA 3KFQC 1ZO2A 1LVNA 4XDVA 3HZPA 3QK9A 3CCE3 3DMCA 1W2B2 5ELJA 3HIGA 3DGOA 2K54A 1G0TA 3GZXB 3KE7A 4J5GA 3S5CA 1OGXA 2KCDA 2SBLA 2GBXB 2W56B 1C7HA 2BNGA 1WMNA 5LC7A 3V99A 3AGNA 2W9PA 1G02A 1LRAA 3MKIA 1M1XB 5AIFA 1LXEA 3DZLA 1Q9EA 3K9MC 4STDA 5AIGA 1L5GB 1N9EA 3QRDA 1QALA 1N5PA 1FGTA 3BLZA 4GL6A 3X40A 5M19A 2AADA 2XRXB 4HM3B 3EC9A 5TGNA 1O7NB 1TTOA 5G2GA 3KKGA 2GU3A 1VQP3 1N8QA 2CWTA 2IUJA 1BNEA 4NHFA 2YX9A 3CNMA 4MMXB 1ROVA 1UCIA 1AR0A 3EN1B 1BIRA 2CFKA 2F5MA 3OWYA 3EN8A 1YGEA 4FCZA 1SIHA 4N6OB 2YFJB 1LNHA 3M8CA 4CCVA 4JRFA 2FGTA 2XEPA 2P05A 2RSXA 3WODG 1W2ZA 1WTHA 3OWSA 3PZWA 4OUQA 5AYSC 3ZG5A 2KAAA 1O7HB 1A90A 3VF1A 1OHSA 1DMMA 3MYTA 3Q2PA 1MWSA 2CG0A 5EQLA 3CD63 1JV2B 1YVBI 2H0GA 3HK4A 4K61A 2GBWB 2H0IA 5G1LA 1Q824 4NREA 5AIIA 2Y74A 3ER7A 4MMZB 2OTL3 3PXMA 1X1UA 3OW22 2HMOB 2W2CA 2BIRA 4LGQA 1OGZA 5IG4A 3G713 1JN5A 1B3SA 1ISKA 1YNVX 1VQ73 3F7XA 2CX0A 3D5GA 2Z6BA 3MG1A 2M7OA 3Q90A 4J8TA 9RNTA 1BRGA 1TJDA 3IPTA 3CC23 2RNTA 3B7CA 3PCRA 2CFLA 1A2KA 3WMDA 1M9GA 4HAAA 1UCJA 5CXOA 1MNLA 3HX8A 3SOAA 3ZG0A 1IYYA 1ZS7A 5EVHA 2CW9A 1GOVA 3GWRA 3DGMA 1PFPA 3EB8A 1VQ53 3FH1A 1UGIA 1BNGA 1MGWA 1CQSA 4I4KA 3EE1A 1S723 1HKXA 3FKAA 1FGQA 5KP4A 3CC43 3AHSA 1RRHA 1EG9B 1BRIA 1EA2A 1W00A 3AMOA 5KP3A 1GSPA 1M904 3TDGA 2V1LA 1I0XA 2ZL8A 2LQVA 1UI8A 4WYKB 2J8XB 1GOYA 3T8UA 1Z1SA 4N6UA 1IQYA 1Q7HA 3GSPA 3VSYA 2R41A 1B2SA 3LXUX 4IIAA 3CCR3 3F7SA 5G1KA 2Z76A 1TFKA 1GOUA 4FCMA 1OF5B 1GD4A 2JQ5A 3UNLA 2FXTA 1I2EA 1V74A 4WFOA 2E2VA 1JBTA 1JKGA 3LYGA 3PGBA 4WP5A 2KRTA 3PS8A 1YIT3 1W6GA 3FGYA 3LH4A 1IDPA 4J5KA 4OK0A 3G8ZA 3I0YA 4XB5A 1W5ZA 4WHAA 3CPW2 3URPA 5D81A 4HVNA 1D6UA 2O9UX 4MEIA 4ORLA 1UGHI 2W0QA 3K7CA 4HBRA 1BOXA 2GXFA 2H0HA 1GY5A 3T8NA 3IJEB 1UCKA 4XBTA 1RN7A 2E2TA 1BUJA 5AIHA 1OHPA 2CFWA 5HGRA 3FG1A 1IV9A 5CLKA 1ASKA 4RNTA 1IVXA 1LOYA 2INXA 3S27A 5CF2A 3CCL3 3A76A 1RGHA 1IK3A 3CC73 2W56A 1Q814 3FCSB 2RGQA 1A2VA 3V92A 1JB5A 3WDGB 4GHOA 3D5IA 2CHCA 3EX9A 1ROAA 1UDII 5BXQA 4HZBB 1K9M4 4HM8B 3CPOA 3K5TA 3MHEA 4R4KA 1PYLA 1DVCA 1Q42A 1HU9A 1D6ZA 4PEJA 5FW5A 2HMLB 5EEOA 3BIRA 3GZBA 5IF6A 5RNTA 3CCQ3 1BRNL 4H61A 4RNYA 3RGAA 1VQM3 4AKYA 2OCTA 1BSCA 3DY5A 6STDA 3BNDA 4HM4B 1JNQA 1JBRA 1AVKA 2CWUA 3CCV3 3LOYA 1DE3A 2JDIH 1QJGA 1YGWA 2F56A 3CU3A 3LTCA 3MSOA 4BIRA 1O7MB 1JRQA 1YVSA 2PNCA 3E99A 3NM7A 4BL2A 1STFI 4BTWA 4K1VA 5GSPA 1Q864 1QVF2 4AEQA 2HMJB 1A67A 3DM8A 1YHQ3 2P38A 2GSPA 1RNBA 2Y73A 3RGRA 1JBSA 3LZAA 3D3LA 3EBYA 1C54A 1J2BA 2BO9B 1RLSA 3F40A 3HOHA 3NBRA 4HM0B 3EJVA 3JUQA 3NHXA 1GY7A 3CCJ3 1WMPA 2HOHA 1US1A 3X42A 3SLUA 4EV2A 1FUWA 2KXGA 4R9LA 2QEX3 1BAOA 1IV7A 1DETA 1SPUA 5BU4A 1TU5A 1BSBA 1K28A 1JB2A 1SIIA 4J9AA 1LNIA 4BTYA 2XSOB 3FZWA 2CFDA 5IENA 3FSDA 1LOWA 1CEWI 2L4VA 2CH9A 2RFRA 2OWPA 4H3UA 5M1AA 1RMSA 3SXXA 1DMQA 1RJOA 1HZ1A 4CJNA 1GY6A 4EXRA 4O02B 4GSPA 3CCM3 1B21A 2XGLA 3SYUA 1NO3A 4R9KA 1KWIA 1FGOA 1RGEA 5DREA 3UB1A 2OTJ3 2XSHB 4ILFA 6RNTA 3X3YA 2B24B 3DGLA 4L7KA 1KQS2 1GYBA 3LTDA 5ELUA 3LTAA 1Q7Y4 1GD3A 1IQ8A 5IW9A 3F9SA 4KVHA 2HMMB 2C4BA 1PU4A 2UX0A 3FG4A 1W6YA 3N54B 1AY7A 3LT8A 2I9WA 5AEUB 2Z7AA 1GS3A 5FGOA 1I3IA 1ULJB 3WOFB 1JB4A 4Q53A 1OH0A 2D42A 4LMIA 3S67A 4N6MA 3JUOA 1B2ZA 3NV0A 2IA7A 2QA43 5CF1A 1NNVA 4DKIA 4ZM8A 4HM2B 3SX1A 1HYFA 1B20A 1EUIC 1PY3A 4O8SA 5AYRB 3D9RA 3V98A 4HZ9B 1IQXA 4G1MB 3UL5A 3SVAA 3ALAA 2IY2A 3JVCA 1VQQA 2GU1A 1R4YA 3KIIA 4CDLA 4EW5A 3DUKA 1I2FA 3PYJA 1RCKA 2C10A 5IERA 3EQQB 3EF8A 2K0MA 2XFTA 1RN1A 1W7CA 4FCJA 4EBGA 4KFDA 3CME3 3EBTA 2OQEA 1CYUA 3Q3FA 4RNZA 2GEXA 5CK6A 4TX4A 1E97A 1D6YA 4HJLB 3WA2X 2MF7A 3LT9A 4HM5B 2STDA 1VQK3 1I0VA 2Q07A 2ZDJA 3A5EA 1TUHA 4U13A 5AEWB 1RNTA 2BT3A 1RHLA 3STDA 3BU4A 5IG0A 2BHMA 4IT7A 1YJN3 1LOVA 2UGIA 1DYUA 5AI1A 2CC3A 2IUKA 1EQKA 1BRHA 4R80A 7STDA 1MWUA 2OQEC 3LTBA 4KFFA 3NM2A 4MJDA 2PZVA 1VQL3 5D82A 1IT7A 2ZHXB 5JPUA 4X2OA 2E2UA 3DH2A 1Q40B 2KF4A 3WA3A 1N5HA 1BSAA 3J7Yd 5HOHA 3JUMA 1GMQA 1FZUA 3G16A 3VGNA 1JJ22 1RGGA 3N9HA 5BVBA 3WHOA 3GZRA 1G96A 3PCSA 4BTXA 4WYKA 3NQYA 2L1SA 3G0KA 3CMA3 1X1WA 1N8R4 3AMOB 3HI7A 1X1XA 4LSOA 3I553 3KSED 1IVVA 1B2XA 1W02A 4HOHA 2XR8B 3MWZA 3ROBA 4AKZA 4BU4A 1KC84 1FGMA 1O7PB 1B27A 1BU4A 3BNCA 1K8A4 4MMYB 2CK3H 3D4AA 1BRKA 2P0MA 7RNTA 1VQN3 1FW7A 1QMAA 1U5OA 1NB5I 2CKFB 1WNHA 4NPBA 1SARA 1BSEA 1EKMA 3NBJA 4HM7B 3FF0A 3NX0A 4WWUC 1RSNA 3H51A 2W9QA 1W01A 3B8LA 1B2MA 4O2HA 3UJMA 3SEDA 3AHWA 4RZMA 2ZA4A 2RBIA 3Q1CA 2QGUA 2F98A 3NXJA 4L8OA 5BIRA 2LYXA 4HM1B 3KSPA 1MWTA 1BVIA 2XF3A 4LEHA 3K0ZA 1BRJA 1T2HA 4X2HA 2CWVA 3OXAA 1K734 2XH9A 1S5AA 2KF3A 3JUPA 2WOFA 3NQZA 1AVLA 2OOVA 1UUVB 4XBYA 5D83A 2KF5A 3F14A 4N6V0 1BANA 1T2IA 4N6LA 4QWTA 2F5WA 3FLJA 1TFOA 2GEYA 3LMLA 3O8YA 1AV4A 1BNFA 1RGLA 4N6TA 1RGKA 3BNBA 1F8NA 1WQLB 4XDWA 1U8CB 3T0UA 1QAKA 1I2GA 2XGNA 3CCU3 1V58A 4N6NB 3MG3A 2SARA 8CHOA 1IVWA 1EEJA 2OOVC 4XBXA 1GMRA 5LC6A 4OVMA 4EC6A 1IVUA 3X41A 1RDSA 2BMRB 1LQGC 1O7GB 1B2UA 2K3DA 3HIIA 3DGYA 1OHOA 1ZX2A 4N3VA 1FGRA 1OUNA 1IT8A 1I3FA 1UUWB 2C11A 3AGOA 3OV4A 3WR2A 1YIJ3 1MWRA
chains in the Genus database with same CATH topology
3Q3FA 4J5GA 4RNTA 1LOYA 1I0VA 1RGHA 3AGNA 1G02A 3A5EA 1RNTA 1LRAA 1RHLA 1TRQA 3BU4A 1UCLA 1Q9EA 4GHOA 1LOVA 3D5IA 1BRHA 2AADA 1PYLA 1TTOA 1RN4A 3BIRA 5RNTA 1BRNL 1BNEA 1UCIA 1BSCA 3DH2A 1BIRA 1TRPA 2F5MA 2KF4A 1JBRA 1BSAA 1FUTA 1DE3A 1YGWA 2F56A 1I70A 2BU4A 5HOHA 4BIRA 2KAAA 1GMQA 1FZUA 1YVSA 1RGGA 5GSPA 1BNRA 3WHOA 1BGSA 2KF6A 1RTUA 1BNIA 2GSPA 1RNBA 1X1WA 1JBSA 1C54A 1RLSA 1X1UA 3HOHA 1X1XA 2BIRA 1B2XA 2HOHA 6GSPA 1I8VA 1B3SA 4HOHA 1YNVX 4BU4A 1BAOA 1DETA 5BU4A 8RNTA 1BSBA 3D5GA 2AAEA 1B27A 1BU4A 1RCLA 1BRGA 1LNIA 9RNTA 1RGFA 2RNTA 3D4AA 1BRKA 1BNJA 7RNTA 1LOWA 4HAAA 1UCJA 1IYYA 1FW7A 1RMSA 1GOVA 1SARA 1BSEA 1A2PA 1RSNA 1BNGA 1HZ1A 1MGWA 2F4YA 1CH0A 4GSPA 1BSDA 1B2MA 1GMPA 1B21A 3AHWA 2ZA4A 3AHSA 2RBIA 3SYUA 1BRIA 1FUSA 5BIRA 1BNSA 1RGEA 1BVIA 6RNTA 1GSPA 1BRJA 1T2HA 1I0XA 1GOYA 1AQZA 2KF3A 1MGRA 3GSPA 3RNTA 7GSPA 1B2SA 2C4BA 2KF5A 3KCHA 1BANA 1T2IA 1RGCA 1AY7A 1GOUA 2F5WA 1X1YA 1I3IA 1I2EA 1BNFA 1JBTA 1RGLA 1B2ZA 1RGKA 1FYSA 1ZGXA 4J5KA 1I2GA 1HYFA 1B20A 1PY3A 2SARA 3URPA 1GMRA 1BRSA 1RDSA 1B2UA 1R4YA 1BOXA 3DGYA 1I2FA 1RCKA 1RGAA 1UCKA 1RN1A 1I3FA 3AGOA 3WR2A 1BUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3F A;  4J5G A;  4RNT A;  1LOY A;  1I0V A;  1RGH A;  3AGN A;  1G02 A;  3A5E A;  1RNT A;  1LRA A;  1RHL A;  1TRQ A;  3BU4 A;  1UCL A;  1Q9E A;  4GHO A;  1LOV A;  3D5I A;  1BRH A;  2AAD A;  1PYL A;  1TTO A;  1RN4 A;  3BIR A;  5RNT A;  1BRN L;  1BNE A;  1UCI A;  1BSC A;  3DH2 A;  1BIR A;  1TRP A;  2F5M A;  2KF4 A;  1JBR A;  1BSA A;  1FUT A;  1DE3 A;  1YGW A;  2F56 A;  1I70 A;  2BU4 A;  5HOH A;  4BIR A;  2KAA A;  1GMQ A;  1FZU A;  1YVS A;  1RGG A;  5GSP A;  1BNR A;  3WHO A;  1BGS A;  2KF6 A;  1RTU A;  1BNI A;  2GSP A;  1RNB A;  1X1W A;  1JBS A;  1C54 A;  1RLS A;  1X1U A;  3HOH A;  1X1X A;  2BIR A;  1B2X A;  2HOH A;  6GSP A;  1I8V A;  1B3S A;  4HOH A;  1YNV X;  4BU4 A;  1BAO A;  1DET A;  5BU4 A;  8RNT A;  1BSB A;  3D5G A;  2AAE A;  1B27 A;  1BU4 A;  1RCL A;  1BRG A;  1LNI A;  9RNT A;  1RGF A;  2RNT A;  3D4A A;  1BRK A;  1BNJ A;  7RNT A;  1LOW A;  4HAA A;  1UCJ A;  1IYY A;  1FW7 A;  1RMS A;  1GOV A;  1SAR A;  1BSE A;  1A2P A;  1RSN A;  1BNG A;  1HZ1 A;  1MGW A;  2F4Y A;  1CH0 A;  4GSP A;  1BSD A;  1B2M A;  1GMP A;  1B21 A;  3AHW A;  2ZA4 A;  3AHS A;  2RBI A;  3SYU A;  1BRI A;  1FUS A;  5BIR A;  1BNS A;  1RGE A;  1BVI A;  6RNT A;  1GSP A;  1BRJ A;  1T2H A;  1I0X A;  1GOY A;  1AQZ A;  2KF3 A;  1MGR A;  3GSP A;  3RNT A;  7GSP A;  1B2S A;  2C4B A;  2KF5 A;  3KCH A;  1BAN A;  1T2I A;  1RGC A;  1AY7 A;  1GOU A;  2F5W A;  1X1Y A;  1I3I A;  1I2E A;  1BNF A;  1JBT A;  1RGL A;  1B2Z A;  1RGK A;  1FYS A;  1ZGX A;  4J5K A;  1I2G A;  1HYF A;  1B20 A;  1PY3 A;  2SAR A;  3URP A;  1GMR A;  1BRS A;  1RDS A;  1B2U A;  1R4Y A;  1BOX A;  3DGY A;  1I2F A;  1RCK A;  1RGA A;  1UCK A;  1RN1 A;  1I3F A;  3AGO A;  3WR2 A;  1BUJ A; 
#chains in the Genus database with same CATH topology
 1UUG B;  3MG2 A;  3RDE A;  4FMC A;  4LZI A;  1W6C A;  1YJ9 3;  2UUG C;  3B4O A;  1JZD A;  3DGN A;  2BMO B;  1OF5 A;  4FMB A;  3CXC 2;  1TRQ A;  2Z77 A;  2IYJ A;  1UCL A;  3BNE A;  4HM6 B;  3GRD A;  3H3H A;  3S28 A;  1V57 A;  5STD A;  3ZFZ A;  4HYZ A;  1T5Y A;  4HKV B;  1M1K 4;  1T3B A;  2A15 A;  3NBB A;  5JPP A;  1YJW 3;  5IG3 A;  2P0X A;  3FF2 A;  1NJI 4;  2W03 A;  1RN4 A;  3DXO A;  1VQ4 3;  3KN4 A;  3F8X A;  1N9J A;  2BMQ B;  2CG1 A;  4XM4 A;  2CFG A;  3KZT A;  3D79 A;  4O3V A;  1QVG 2;  1TRP A;  2B1X B;  4GB5 A;  2YFI B;  1Q40 A;  5DRV A;  3S29 A;  1FUT A;  2F86 B;  5IEP A;  1RRL A;  2CX1 A;  3OX9 A;  1I70 A;  2BU4 A;  3CCS 3;  1BNR A;  1FA3 A;  3GAX A;  1TP6 A;  2HMN B;  2YFL B;  1BGS A;  2KF6 A;  4FMA A;  1UW1 A;  1RTU A;  1DVD A;  1NU3 A;  1BNI A;  3FG3 A;  4K1U A;  4KT3 B;  4EV5 A;  3X3X A;  1NDO B;  1WMO A;  2R4I A;  1CYV A;  1E3V A;  4FR9 A;  4CPK A;  1BUQ A;  1JN5 B;  1NB3 I;  2QIY A;  3EHC A;  4KFE A;  6GSP A;  1I8V A;  3OWU A;  3B4P A;  3SOY A;  3K63 A;  5I97 A;  8RNT A;  3ECF A;  3CNX A;  1R4C A;  1OPY A;  1VQO 3;  1VQ8 3;  5JBS A;  1MOL A;  2AAE A;  1RCL A;  1RGF A;  1VZZ A;  3BB9 A;  5M18 A;  1LQM B;  1OAC A;  1STD A;  1BNJ A;  3NV0 B;  1UI7 A;  1TIJ A;  1DMN A;  2W6J H;  4EYC A;  1YI2 3;  1A2P A;  1ULI B;  2F4Y A;  3L0R A;  2WGO A;  1CH0 A;  3G4S 3;  1BSD A;  5IG5 A;  1GMP A;  2F99 A;  3JUN A;  1SQW A;  4LYL B;  3G6E 3;  4L8P A;  1FUS A;  2FNQ A;  1BNS A;  5KP1 A;  3F8H A;  1E3R A;  2W04 A;  3U1W A;  3NUV A;  5IEO A;  3N8B A;  2WOH A;  2CIU A;  5A0O B;  3U97 A;  3UL6 A;  1Y4K A;  1AQZ A;  4KZ1 A;  2MC8 A;  1MGR A;  1JZO A;  3RNT A;  7GSP A;  4JF8 A;  4IPB A;  4RBN A;  3X3Z A;  3KCH A;  1RGC A;  2D1W A;  1LOX A;  1O7W B;  1X1Y A;  2ML6 A;  4R1K A;  1K41 A;  2IMJ A;  4BL3 A;  1KSI A;  1IU7 A;  1JKG B;  4FMD A;  1OCV A;  3IMA B;  1VQ9 3;  1FYS A;  1RKY A;  1ZGX A;  4I5Q A;  2XFS A;  2WGQ A;  4K90 B;  1W4N A;  1QAF A;  2P09 A;  3GZY B;  1BRS A;  3MPH A;  3I56 3;  1SJW A;  2HMK B;  2ML5 A;  2O3O A;  1NWW A;  2RCD A;  1VQ6 3;  1KD1 4;  3WOE B;  2WO0 A;  1RGA A;  3KFQ C;  1ZO2 A;  1LVN A;  4XDV A;  3HZP A;  3QK9 A;  3CCE 3;  3DMC A;  1W2B 2;  5ELJ A;  3HIG A;  3DGO A;  2K54 A;  1G0T A;  3GZX B;  3KE7 A;  4J5G A;  3S5C A;  1OGX A;  2KCD A;  2SBL A;  2GBX B;  2W56 B;  1C7H A;  2BNG A;  1WMN A;  5LC7 A;  3V99 A;  3AGN A;  2W9P A;  1G02 A;  1LRA A;  3MKI A;  1M1X B;  5AIF A;  1LXE A;  3DZL A;  1Q9E A;  3K9M C;  4STD A;  5AIG A;  1L5G B;  1N9E A;  3QRD A;  1QAL A;  1N5P A;  1FGT A;  3BLZ A;  4GL6 A;  3X40 A;  5M19 A;  2AAD A;  2XRX B;  4HM3 B;  3EC9 A;  5TGN A;  1O7N B;  1TTO A;  5G2G A;  3KKG A;  2GU3 A;  1VQP 3;  1N8Q A;  2CWT A;  2IUJ A;  1BNE A;  4NHF A;  2YX9 A;  3CNM A;  4MMX B;  1ROV A;  1UCI A;  1AR0 A;  3EN1 B;  1BIR A;  2CFK A;  2F5M A;  3OWY A;  3EN8 A;  1YGE A;  4FCZ A;  1SIH A;  4N6O B;  2YFJ B;  1LNH A;  3M8C A;  4CCV A;  4JRF A;  2FGT A;  2XEP A;  2P05 A;  2RSX A;  3WOD G;  1W2Z A;  1WTH A;  3OWS A;  3PZW A;  4OUQ A;  5AYS C;  3ZG5 A;  2KAA A;  1O7H B;  1A90 A;  3VF1 A;  1OHS A;  1DMM A;  3MYT A;  3Q2P A;  1MWS A;  2CG0 A;  5EQL A;  3CD6 3;  1JV2 B;  1YVB I;  2H0G A;  3HK4 A;  4K61 A;  2GBW B;  2H0I A;  5G1L A;  1Q82 4;  4NRE A;  5AII A;  2Y74 A;  3ER7 A;  4MMZ B;  2OTL 3;  3PXM A;  1X1U A;  3OW2 2;  2HMO B;  2W2C A;  2BIR A;  4LGQ A;  1OGZ A;  5IG4 A;  3G71 3;  1JN5 A;  1B3S A;  1ISK A;  1YNV X;  1VQ7 3;  3F7X A;  2CX0 A;  3D5G A;  2Z6B A;  3MG1 A;  2M7O A;  3Q90 A;  4J8T A;  9RNT A;  1BRG A;  1TJD A;  3IPT A;  3CC2 3;  2RNT A;  3B7C A;  3PCR A;  2CFL A;  1A2K A;  3WMD A;  1M9G A;  4HAA A;  1UCJ A;  5CXO A;  1MNL A;  3HX8 A;  3SOA A;  3ZG0 A;  1IYY A;  1ZS7 A;  5EVH A;  2CW9 A;  1GOV A;  3GWR A;  3DGM A;  1PFP A;  3EB8 A;  1VQ5 3;  3FH1 A;  1UGI A;  1BNG A;  1MGW A;  1CQS A;  4I4K A;  3EE1 A;  1S72 3;  1HKX A;  3FKA A;  1FGQ A;  5KP4 A;  3CC4 3;  3AHS A;  1RRH A;  1EG9 B;  1BRI A;  1EA2 A;  1W00 A;  3AMO A;  5KP3 A;  1GSP A;  1M90 4;  3TDG A;  2V1L A;  1I0X A;  2ZL8 A;  2LQV A;  1UI8 A;  4WYK B;  2J8X B;  1GOY A;  3T8U A;  1Z1S A;  4N6U A;  1IQY A;  1Q7H A;  3GSP A;  3VSY A;  2R41 A;  1B2S A;  3LXU X;  4IIA A;  3CCR 3;  3F7S A;  5G1K A;  2Z76 A;  1TFK A;  1GOU A;  4FCM A;  1OF5 B;  1GD4 A;  2JQ5 A;  3UNL A;  2FXT A;  1I2E A;  1V74 A;  4WFO A;  2E2V A;  1JBT A;  1JKG A;  3LYG A;  3PGB A;  4WP5 A;  2KRT A;  3PS8 A;  1YIT 3;  1W6G A;  3FGY A;  3LH4 A;  1IDP A;  4J5K A;  4OK0 A;  3G8Z A;  3I0Y A;  4XB5 A;  1W5Z A;  4WHA A;  3CPW 2;  3URP A;  5D81 A;  4HVN A;  1D6U A;  2O9U X;  4MEI A;  4ORL A;  1UGH I;  2W0Q A;  3K7C A;  4HBR A;  1BOX A;  2GXF A;  2H0H A;  1GY5 A;  3T8N A;  3IJE B;  1UCK A;  4XBT A;  1RN7 A;  2E2T A;  1BUJ A;  5AIH A;  1OHP A;  2CFW A;  5HGR A;  3FG1 A;  1IV9 A;  5CLK A;  1ASK A;  4RNT A;  1IVX A;  1LOY A;  2INX A;  3S27 A;  5CF2 A;  3CCL 3;  3A76 A;  1RGH A;  1IK3 A;  3CC7 3;  2W56 A;  1Q81 4;  3FCS B;  2RGQ A;  1A2V A;  3V92 A;  1JB5 A;  3WDG B;  4GHO A;  3D5I A;  2CHC A;  3EX9 A;  1ROA A;  1UDI I;  5BXQ A;  4HZB B;  1K9M 4;  4HM8 B;  3CPO A;  3K5T A;  3MHE A;  4R4K A;  1PYL A;  1DVC A;  1Q42 A;  1HU9 A;  1D6Z A;  4PEJ A;  5FW5 A;  2HML B;  5EEO A;  3BIR A;  3GZB A;  5IF6 A;  5RNT A;  3CCQ 3;  1BRN L;  4H61 A;  4RNY A;  3RGA A;  1VQM 3;  4AKY A;  2OCT A;  1BSC A;  3DY5 A;  6STD A;  3BND A;  4HM4 B;  1JNQ A;  1JBR A;  1AVK A;  2CWU A;  3CCV 3;  3LOY A;  1DE3 A;  2JDI H;  1QJG A;  1YGW A;  2F56 A;  3CU3 A;  3LTC A;  3MSO A;  4BIR A;  1O7M B;  1JRQ A;  1YVS A;  2PNC A;  3E99 A;  3NM7 A;  4BL2 A;  1STF I;  4BTW A;  4K1V A;  5GSP A;  1Q86 4;  1QVF 2;  4AEQ A;  2HMJ B;  1A67 A;  3DM8 A;  1YHQ 3;  2P38 A;  2GSP A;  1RNB A;  2Y73 A;  3RGR A;  1JBS A;  3LZA A;  3D3L A;  3EBY A;  1C54 A;  1J2B A;  2BO9 B;  1RLS A;  3F40 A;  3HOH A;  3NBR A;  4HM0 B;  3EJV A;  3JUQ A;  3NHX A;  1GY7 A;  3CCJ 3;  1WMP A;  2HOH A;  1US1 A;  3X42 A;  3SLU A;  4EV2 A;  1FUW A;  2KXG A;  4R9L A;  2QEX 3;  1BAO A;  1IV7 A;  1DET A;  1SPU A;  5BU4 A;  1TU5 A;  1BSB A;  1K28 A;  1JB2 A;  1SII A;  4J9A A;  1LNI A;  4BTY A;  2XSO B;  3FZW A;  2CFD A;  5IEN A;  3FSD A;  1LOW A;  1CEW I;  2L4V A;  2CH9 A;  2RFR A;  2OWP A;  4H3U A;  5M1A A;  1RMS A;  3SXX A;  1DMQ A;  1RJO A;  1HZ1 A;  4CJN A;  1GY6 A;  4EXR A;  4O02 B;  4GSP A;  3CCM 3;  1B21 A;  2XGL A;  3SYU A;  1NO3 A;  4R9K A;  1KWI A;  1FGO A;  1RGE A;  5DRE A;  3UB1 A;  2OTJ 3;  2XSH B;  4ILF A;  6RNT A;  3X3Y A;  2B24 B;  3DGL A;  4L7K A;  1KQS 2;  1GYB A;  3LTD A;  5ELU A;  3LTA A;  1Q7Y 4;  1GD3 A;  1IQ8 A;  5IW9 A;  3F9S A;  4KVH A;  2HMM B;  2C4B A;  1PU4 A;  2UX0 A;  3FG4 A;  1W6Y A;  3N54 B;  1AY7 A;  3LT8 A;  2I9W A;  5AEU B;  2Z7A A;  1GS3 A;  5FGO A;  1I3I A;  1ULJ B;  3WOF B;  1JB4 A;  4Q53 A;  1OH0 A;  2D42 A;  4LMI A;  3S67 A;  4N6M A;  3JUO A;  1B2Z A;  3NV0 A;  2IA7 A;  2QA4 3;  5CF1 A;  1NNV A;  4DKI A;  4ZM8 A;  4HM2 B;  3SX1 A;  1HYF A;  1B20 A;  1EUI C;  1PY3 A;  4O8S A;  5AYR B;  3D9R A;  3V98 A;  4HZ9 B;  1IQX A;  4G1M B;  3UL5 A;  3SVA A;  3ALA A;  2IY2 A;  3JVC A;  1VQQ A;  2GU1 A;  1R4Y A;  3KII A;  4CDL A;  4EW5 A;  3DUK A;  1I2F A;  3PYJ A;  1RCK A;  2C10 A;  5IER A;  3EQQ B;  3EF8 A;  2K0M A;  2XFT A;  1RN1 A;  1W7C A;  4FCJ A;  4EBG A;  4KFD A;  3CME 3;  3EBT A;  2OQE A;  1CYU A;  3Q3F A;  4RNZ A;  2GEX A;  5CK6 A;  4TX4 A;  1E97 A;  1D6Y A;  4HJL B;  3WA2 X;  2MF7 A;  3LT9 A;  4HM5 B;  2STD A;  1VQK 3;  1I0V A;  2Q07 A;  2ZDJ A;  3A5E A;  1TUH A;  4U13 A;  5AEW B;  1RNT A;  2BT3 A;  1RHL A;  3STD A;  3BU4 A;  5IG0 A;  2BHM A;  4IT7 A;  1YJN 3;  1LOV A;  2UGI A;  1DYU A;  5AI1 A;  2CC3 A;  2IUK A;  1EQK A;  1BRH A;  4R80 A;  7STD A;  1MWU A;  2OQE C;  3LTB A;  4KFF A;  3NM2 A;  4MJD A;  2PZV A;  1VQL 3;  5D82 A;  1IT7 A;  2ZHX B;  5JPU A;  4X2O A;  2E2U A;  3DH2 A;  1Q40 B;  2KF4 A;  3WA3 A;  1N5H A;  1BSA A;  3J7Y d;  5HOH A;  3JUM A;  1GMQ A;  1FZU A;  3G16 A;  3VGN A;  1JJ2 2;  1RGG A;  3N9H A;  5BVB A;  3WHO A;  3GZR A;  1G96 A;  3PCS A;  4BTX A;  4WYK A;  3NQY A;  2L1S A;  3G0K A;  3CMA 3;  1X1W A;  1N8R 4;  3AMO B;  3HI7 A;  1X1X A;  4LSO A;  3I55 3;  3KSE D;  1IVV A;  1B2X A;  1W02 A;  4HOH A;  2XR8 B;  3MWZ A;  3ROB A;  4AKZ A;  4BU4 A;  1KC8 4;  1FGM A;  1O7P B;  1B27 A;  1BU4 A;  3BNC A;  1K8A 4;  4MMY B;  2CK3 H;  3D4A A;  1BRK A;  2P0M A;  7RNT A;  1VQN 3;  1FW7 A;  1QMA A;  1U5O A;  1NB5 I;  2CKF B;  1WNH A;  4NPB A;  1SAR A;  1BSE A;  1EKM A;  3NBJ A;  4HM7 B;  3FF0 A;  3NX0 A;  4WWU C;  1RSN A;  3H51 A;  2W9Q A;  1W01 A;  3B8L A;  1B2M A;  4O2H A;  3UJM A;  3SED A;  3AHW A;  4RZM A;  2ZA4 A;  2RBI A;  3Q1C A;  2QGU A;  2F98 A;  3NXJ A;  4L8O A;  5BIR A;  2LYX A;  4HM1 B;  3KSP A;  1MWT A;  1BVI A;  2XF3 A;  4LEH A;  3K0Z A;  1BRJ A;  1T2H A;  4X2H A;  2CWV A;  3OXA A;  1K73 4;  2XH9 A;  1S5A A;  2KF3 A;  3JUP A;  2WOF A;  3NQZ A;  1AVL A;  2OOV A;  1UUV B;  4XBY A;  5D83 A;  2KF5 A;  3F14 A;  4N6V 0;  1BAN A;  1T2I A;  4N6L A;  4QWT A;  2F5W A;  3FLJ A;  1TFO A;  2GEY A;  3LML A;  3O8Y A;  1AV4 A;  1BNF A;  1RGL A;  4N6T A;  1RGK A;  3BNB A;  1F8N A;  1WQL B;  4XDW A;  1U8C B;  3T0U A;  1QAK A;  1I2G A;  2XGN A;  3CCU 3;  1V58 A;  4N6N B;  3MG3 A;  2SAR A;  8CHO A;  1IVW A;  1EEJ A;  2OOV C;  4XBX A;  1GMR A;  5LC6 A;  4OVM A;  4EC6 A;  1IVU A;  3X41 A;  1RDS A;  2BMR B;  1LQG C;  1O7G B;  1B2U A;  2K3D A;  3HII A;  3DGY A;  1OHO A;  1ZX2 A;  4N3V A;  1FGR A;  1OUN A;  1IT8 A;  1I3F A;  1UUW B;  2C11 A;  3AGO A;  3OV4 A;  3WR2 A;  1YIJ 3;  1MWR A; 
#chains in the Genus database with same CATH homology
 3Q3F A;  4J5G A;  4RNT A;  1LOY A;  1I0V A;  1RGH A;  3AGN A;  1G02 A;  3A5E A;  1RNT A;  1LRA A;  1RHL A;  1TRQ A;  3BU4 A;  1UCL A;  1Q9E A;  4GHO A;  1LOV A;  3D5I A;  1BRH A;  2AAD A;  1PYL A;  1TTO A;  1RN4 A;  3BIR A;  5RNT A;  1BRN L;  1BNE A;  1UCI A;  1BSC A;  3DH2 A;  1BIR A;  1TRP A;  2F5M A;  2KF4 A;  1JBR A;  1BSA A;  1FUT A;  1DE3 A;  1YGW A;  2F56 A;  1I70 A;  2BU4 A;  5HOH A;  4BIR A;  2KAA A;  1GMQ A;  1FZU A;  1YVS A;  1RGG A;  5GSP A;  1BNR A;  3WHO A;  1BGS A;  2KF6 A;  1RTU A;  1BNI A;  2GSP A;  1RNB A;  1X1W A;  1JBS A;  1C54 A;  1RLS A;  1X1U A;  3HOH A;  1X1X A;  2BIR A;  1B2X A;  2HOH A;  6GSP A;  1I8V A;  1B3S A;  4HOH A;  1YNV X;  4BU4 A;  1BAO A;  1DET A;  5BU4 A;  8RNT A;  1BSB A;  3D5G A;  2AAE A;  1B27 A;  1BU4 A;  1RCL A;  1BRG A;  1LNI A;  9RNT A;  1RGF A;  2RNT A;  3D4A A;  1BRK A;  1BNJ A;  7RNT A;  1LOW A;  4HAA A;  1UCJ A;  1IYY A;  1FW7 A;  1RMS A;  1GOV A;  1SAR A;  1BSE A;  1A2P A;  1RSN A;  1BNG A;  1HZ1 A;  1MGW A;  2F4Y A;  1CH0 A;  4GSP A;  1BSD A;  1B2M A;  1GMP A;  1B21 A;  3AHW A;  2ZA4 A;  3AHS A;  2RBI A;  3SYU A;  1BRI A;  1FUS A;  5BIR A;  1BNS A;  1RGE A;  1BVI A;  6RNT A;  1GSP A;  1BRJ A;  1T2H A;  1I0X A;  1GOY A;  1AQZ A;  2KF3 A;  1MGR A;  3GSP A;  3RNT A;  7GSP A;  1B2S A;  2C4B A;  2KF5 A;  3KCH A;  1BAN A;  1T2I A;  1RGC A;  1AY7 A;  1GOU A;  2F5W A;  1X1Y A;  1I3I A;  1I2E A;  1BNF A;  1JBT A;  1RGL A;  1B2Z A;  1RGK A;  1FYS A;  1ZGX A;  4J5K A;  1I2G A;  1HYF A;  1B20 A;  1PY3 A;  2SAR A;  3URP A;  1GMR A;  1BRS A;  1RDS A;  1B2U A;  1R4Y A;  1BOX A;  3DGY A;  1I2F A;  1RCK A;  1RGA A;  1UCK A;  1RN1 A;  1I3F A;  3AGO A;  3WR2 A;  1BUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...