1BNFA

Barnase t70c/s92c disulfide mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRCWREADINYTSGFRNSDRILYSCDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Disulfide mutants of barnase. I: Changes in stability and structure assessed by biophysical methods and X-ray crystallography.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 32
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1bnfA00
1BRIA 1X1YA 3AGNA 1BNJA 1I2GA 2F5MA 1I3FA 1RLSA 1BAOA 1BOXA 1RNTA 1T2IA 1BGSA 2AADA 3GSPA 1RGAA 1X1XA 5BU4A 1RN4A 1YVSA 2KF5A 1BSBA 1UCJA 1RGFA 3D5IA 1BNIA 1BU4A 5GSPA 1HZ1A 1B2XA 4HAAA 1FUTA 1GMQA 1B2ZA 4GHOA 2BU4A 1ZGXA 1PY3A 1AQZA 1I70A 2F5WA 1CH0A 3RNTA 1RNBA 1RHLA 1BSDA 8RNTA 1I3IA 2KF4A 2KAAA 1GMRA 1I0VA 2GSPA 3D5GA 1BRGA 4RNTA 3D4AA 1RDSA 2RBIA 1BNRA 1LNIA 2BIRA 3WHOA 1B3SA 1BSAA 1LOVA 2C4BA 1YNVX 3BU4A 4GSPA 2AAEA 1MGRA 2F56A 3SYUA 1BVIA 1BIRA 1B2UA 7RNTA 1LOWA 1GOVA 2HOHA 5HOHA 1RN1A 1RTUA 4BU4A 1RGEA 4HOHA 1B27A 3BIRA 1UCLA 3Q3FA 1BNSA 1BRJA 3A5EA 1BRKA 1B20A 3WR2A 1BRNL 3AHSA 1DETA 1I0XA 1MGWA 1B2MA 1BNFA 1RGLA 1I8VA 1B21A 1X1UA 2F4YA 3URPA 1C54A 1LOYA 4J5KA 1B2SA 1HYFA 5BIRA 1BANA 1BSEA 2RNTA 1GOUA 2ZA4A 1RMSA 1R4YA 9RNTA 1I2FA 1BSCA 1FUSA 1Q9EA 1RCKA 1AY7A 1RGKA 1YGWA 6RNTA 1LRAA 4BIRA 1BNGA 1RSNA 7GSPA 2SARA 1BNEA 1RGCA 1BRSA 5RNTA 1RCLA 2KF3A 3DH2A 1G02A 1X1WA 1BRHA 1RGHA 2KF6A 1JBRA 3AHWA 1JBTA 3AGOA 3HOHA 4J5GA 1UCIA 1UCKA 1TTOA 1FZUA 1GMPA 1I2EA 1GOYA 1RGGA 1TRPA 1JBSA 3KCHA 1A2PA 1FW7A 1TRQA 1SARA 1T2HA 1DE3A 1IYYA 1GSPA 3DGYA 1FYSA 6GSPA 1PYLA 1BUJA
chains in the Genus database with same CATH superfamily
5IEOA 1X1YA 4ORLA 4CPKA 1D6UA 1I2GA 3SOYA 1EQKA 1T2IA 1A2VA 2PZVA 4IIAA 5G1KA 2P38A 4HZBB 5G2GA 3G4S3 1N8R4 5CF1A 1BSBA 1UCJA 2Z6BA 3B4OA 1JNQA 3D79A 4FCZA 4RNZA 5AI1A 3RDEA 3Q1CA 2Z7AA 4XDWA 2OQEA 4O8SA 4TX4A 1YJ93 4H61A 3PCSA 2OQEC 3CC73 1CYUA 1ROAA 4O02B 1YIJ3 1B2ZA 1US1A 3OX9A 2Y73A 1JB2A 4RBNA 3CCE3 1MWRA 2W56A 1WMOA 3UL6A 1RHLA 3CCQ3 3MG2A 3EC9A 1LQGC 4EV2A 2CHCA 8RNTA 3E99A 2FNQA 4QWTA 1TP6A 1IQXA 1I0VA 3LT8A 4RNTA 1RN7A 2XF3A 5G1LA 3CC23 1M1XB 1YIT3 2GEYA 2WO0A 1YNVX 1G96A 3BU4A 1WMNA 1OF5A 3D3LA 1S5AA 1OACA 1AR0A 4J9AA 4JRFA 1AVKA 2AAEA 1MGRA 3SYUA 1BVIA 5IERA 1JN5A 1STDA 1A2KA 1KSIA 5HOHA 3OWUA 1B27A 1W4NA 5EVHA 3VGNA 3Q3FA 3VSYA 3I563 3SLUA 3A5EA 3AHSA 1I0XA 1IV9A 1O7PB 4FMCA 1ZX2A 1BNFA 1CYVA 3V98A 1Q7HA 2YFIB 3HI7A 1ZS7A 1PFPA 3IJEB 3CD63 4J5KA 3X3ZA 3AMOB 1HYFA 3CNMA 5BIRA 3ZG0A 2OWPA 1QMAA 2RNTA 5AYRB 1VQK3 2A15A 1HU9A 1Q40A 1UUWB 3ALAA 3JUPA 8CHOA 5IG5A 1OPYA 2RCDA 1RCKA 3ZFZA 3WA3A 5DRVA 1IV7A 1O7WB 3DUKA 5M19A 3LT9A 1LRAA 2OTJ3 1IU7A 5FGOA 4HM4B 1EG9B 2SARA 3O8YA 4MMZB 1A67A 1FGOA 1BNEA 1BRSA 5RNTA 1C7HA 1QALA 2KF3A 3DH2A 4K61A 5AIHA 2YFLB 1X1WA 2FGTA 1NWWA 1W02A 2YX9A 4KVHA 1IK3A 3CCV3 4N6V0 1RGHA 3GAXA 3K5TA 5D81A 5EEOA 4XB5A 5JPUA 3G713 3FG3A 3AGOA 3FLJA 1IT8A 5JPPA 1NJI4 2O9UX 2E2UA 1TTOA 3TDGA 1IVWA 1W6YA 1I2EA 1VQN3 3F8XA 1QAKA 1JBSA 2RFRA 3KCHA 5A0OB 4FMDA 1FW7A 2XFSA 4N6TA 2CK3H 4O3VA 2IA7A 4WFOA 3NXJA 1IVUA 1DE3A 2CG0A 4KFFA 4LGQA 3MHEA 1VQM3 1PYLA 1EEJA 3FG4A 2CFDA 3OV4A 4BTXA 4DKIA 1BRIA 1UDII 3KIIA 1N9EA 3FGYA 3UJMA 3OXAA 3WODG 1ZO2A 2BO9B 1JB4A 3U1WA 1GYBA 4HM0B 1K41A 1IVVA 1O7HB 2XSHB 3EB8A 2P05A 1X1XA 4NHFA 1RN4A 1MWUA 3BLZA 3LH4A 1TU5A 1IT7A 3DZLA 1VQ63 5AIIA 3NHXA 3MG1A 1RGFA 4X2HA 3D5IA 5GSPA 1B2XA 4HAAA 1T5YA 4N6NB 2PNCA 3FCSB 2E2TA 3CU3A 1PY3A 4EXRA 1W01A 2F5WA 5D83A 3UL5A 3DGOA 1CH0A 3RNTA 4AKZA 4BTYA 1EKMA 1TFOA 1I3IA 4LSOA 4WHAA 1E3VA 1RRHA 4OVMA 4WWUC 1GMRA 1Q42A 3JUQA 2STDA 3GRDA 4R80A 1IDPA 1GD4A 3LTCA 1R4CA 2W56B 4I5QA 1RDSA 4J8TA 3GWRA 3NQZA 3V99A 5HGRA 1YVBI 3FF0A 3DM8A 4FCJA 5KP4A 1Q814 1B3SA 1BSAA 3B7CA 3PYJA 2C4BA 4OK0A 4R9LA 3ZG5A 4CCVA 1STFI 3F9SA 3KSED 4FMBA 4HZ9B 2HMJB 1KWIA 2XGLA 3JUNA 5ELUA 3T8NA 2W04A 1HKXA 1SIIA 1V58A 2HMMB 3KSPA 2Z77A 1OGZA 1UGIA 4BU4A 3DY5A 4HOHA 3BIRA 1UCLA 3WMDA 4R1KA 3EX9A 1NU3A 1B20A 2MF7A 4XM4A 1SPUA 4PEJA 3J7Yd 1JJ22 1BRNL 1VQ43 5IENA 2ZHXB 3CC43 1I8VA 1B21A 5BVBA 4BL2A 3UNLA 2CIUA 2F4YA 1C54A 5CK6A 1LOYA 1QVF2 1B2SA 3NQYA 2CFWA 2ML5A 3EE1A 1GY7A 1MWTA 4BL3A 3CCR3 1ISKA 2K3DA 5IF6A 1RMSA 9RNTA 1G0TA 1I2FA 1IQ8A 4K90B 4XDVA 1WTHA 4LYLB 2F98A 4L8PA 1TFKA 1AY7A 1Z1SA 1RSNA 7GSPA 1AV4A 2MC8A 3NX0A 3EF8A 1CEWI 4JF8A 5FW5A 2D42A 5DREA 1SQWA 3UB1A 5IG3A 3BNEA 2O3OA 2CWVA 3HIGA 1EA2A 3AHWA 3PCRA 3B8LA 5AIGA 2OOVC 1IVXA 3CPW2 1YI23 1D6ZA 2XGNA 4GL6A 1UCKA 4R4KA 1RRLA 1FZUA 1OHPA 1UGHI 2UUGC 3G0KA 5TGNA 3IMAB 3KZTA 3S67A 4H3UA 1TRPA 3N8BA 1FA3A 4XBXA 2V1LA 4N6UA 3FZWA 1WQLB 3GZRA 3MPHA 1YJN3 4KFEA 1A2PA 1W6CA 3STDA 3X3YA 3BNDA 1TRQA 6STDA 2K54A 2CH9A 2CWUA 4STDA 3RGAA 2BNGA 1MNLA 2BMQB 3K9MC 4KZ1A 3LZAA 3RGRA 1JB5A 3CCS3 1CQSA 1IYYA 1DYUA 3CXC2 3MG3A 4BTWA 7STDA 2JQ5A 6GSPA 3NV0B 1FUWA 1RJOA 2UX0A 3AGNA 1BNJA 4R9KA 1I3FA 2IUKA 3CNXA 1JZOA 2CFGA 3LYGA 4HM5B 1W2ZA 3VF1A 3V92A 1O7GB 4HKVB 4WYKA 1UW1A 2BT3A 3QRDA 1BGSA 1Q824 2AADA 2H0GA 3GSPA 4EYCA 1RGAA 1ASKA 1KQS2 4G1MB 1NB5I 5BU4A 1YGEA 5AEWB 3IPTA 1U5OA 1VQQA 3DGMA 3HIIA 2IUJA 1VZZA 3KE7A 1EUIC 1BNIA 1BU4A 2W9QA 3BNBA 3SXXA 4ZM8A 1HZ1A 3SVAA 3GZXB 3LTAA 3NM2A 3N9HA 3K0ZA 4LEHA 4EW5A 4EC6A 2E2VA 4GHOA 3SEDA 1ZGXA 1NNVA 1AQZA 3X3XA 2CX1A 1WMPA 1VQ83 2W6JH 2ML6A 1UI8A 2CWTA 3AMOA 3EQQB 1UI7A 5M18A 3T0UA 1RNBA 2KCDA 2GBXB 3MKIA 1BSDA 1JKGB 1N5HA 2KRTA 1LNHA 3H51A 5EQLA 2KAAA 3JUOA 5IW9A 3DMCA 3EN8A 4HM8B 2CC3A 2GSPA 1BRGA 3D5GA 2GXFA 1W5ZA 2INXA 3KFQC 1JZDA 2RBIA 2GEXA 4HM6B 1K9M4 1LNIA 4XBYA 1VQP3 2BIRA 4U13A 1DVCA 1LOVA 1V57A 1N5PA 2B24B 3SX1A 4GSPA 3WOEB 4N6OB 1W2B2 1RKYA 1VQ53 3I0YA 5AYSC 3FKAA 4HM2B 1BIRA 2CG1A 1GOVA 2HMNB 3Q90A 2CKFB 1OHSA 1RN1A 4WP5A 1K28A 1O7NB 1RGEA 1Y4KA 3LTBA 2D1WA 3LOYA 2GBWB 3NM7A 1FGQA 4GB5A 3OWSA 4MJDA 4KFDA 1ROVA 2CW9A 1BRKA 3EJVA 3WDGB 1DETA 1MGWA 1B2MA 1Q7Y4 4AEQA 1QVG2 2CFKA 2Z76A 1N8QA 3EHCA 2R4IA 3MWZA 1K8A4 4K1UA 5JBSA 1BANA 1S723 1GOUA 2ZA4A 1TJDA 2XSOB 1PU4A 2R41A 2WOHA 2LQVA 2YFJB 4FMAA 3N54B 5KP1A 1M904 1E3RA 2P0XA 4HJLB 3X42A 4K1VA 6RNTA 3S27A 4BIRA 1YHQ3 3PZWA 4L8OA 2WGOA 2W03A 1DVDA 3PGBA 1W7CA 1OF5B 1RGCA 4FCMA 3M8CA 3WA2X 1UUGB 3FSDA 5I97A 1DMQA 1DMMA 1JN5B 4LZIA 2KF6A 1LOXA 3JVCA 1QAFA 2GU3A 1JBTA 4MMXB 3HOHA 3KKGA 2RSXA 1O7MB 2I9WA 1VQ73 4HM1B 1KD14 1GS3A 3D9RA 4IT7A 4Q53A 3X41A 3L0RA 1F8NA 3Q2PA 2SBLA 1GOYA 1GY5A 1RGGA 1VQ93 2OCTA 5M1AA 1MOLA 1QJGA 3A76A 1FGRA 3K7CA 2IY2A 3BNCA 2BMOB 1SARA 5AIFA 3CPOA 3BB9A 1JV2B 1Q40B 5CLKA 1NDOB 1FGTA 2XRXB 3F40A 1GY6A 1FYSA 2QIYA 2KXGA 3PS8A 5KP3A 1YJW3 2XH9A 1BUJA 1D6YA 1OCVA 3F7SA 3JUMA 4EBGA 2F5MA 2F86B 1MWSA 4HYZA 4ILFA 1LXEA 1OH0A 4L7KA 1Q864 1RLSA 5STDA 3SOAA 1BAOA 1BOXA 1RNTA 2OOVA 5AEUB 1KC84 3LXUX 1U8CB 3DGLA 4RZMA 3CMA3 2HMKB 5LC6A 1N9JA 4HVNA 2BMRB 2LYXA 5IG4A 4CDLA 4I4KA 1YVSA 2KF5A 1J2BA 4WYKB 2JDIH 2W0QA 1M9GA 4N3VA 4XBTA 2QEX3 1FGMA 3DXOA 2H0IA 2C10A 2M7OA 3LTDA 1FUTA 1GMQA 2C11A 1OGXA 1LVNA 3EBTA 2BU4A 1AVLA 3LMLA 4OUQA 2UGIA 3FG1A 1LQMB 1NB3I 2HMOB 2F99A 1I70A 3GZYB 4RNYA 2L1SA 2Y74A 2KF4A 1ULJB 4LMIA 3FH1A 2RGQA 3ROBA 3KN4A 2L4VA 3D4AA 1M1K4 3F8HA 5BXQA 3G8ZA 1BNRA 2CFLA 1DMNA 3S28A 3WHOA 2Q07A 4IPBA 2P09A 3F14A 1SJWA 4HBRA 1JRQA 3OWYA 2F56A 2XR8B 3OW22 3NBRA 4AKYA 7RNTA 1B2UA 1LOWA 2HOHA 2B1XB 3GZBA 3HZPA 1RTUA 3K63A 1SIHA 2K0MA 1W00A 2H0HA 2J8XB 3MYTA 3F7XA 1BNSA 1BRJA 3WR2A 4N6LA 3B4PA 4KT3B 2OTL3 2ZL8A 1RGLA 3NBJA 1X1UA 3URPA 2IMJA 3CCL3 4HM7B 3ER7A 1BSEA 3WOFB 3T8UA 4FR9A 2GU1A 3U97A 1R4YA 5ELJA 1BSCA 1T3BA 3FF2A 3G16A 1FUSA 1Q9EA 1RGKA 3QK9A 1YGWA 2W2CA 4MMYB 3I553 4X2OA 1TUHA 1TIJA 3HX8A 1BNGA 3NV0A 5IG0A 2QGUA 3CME3 1WNHA 1E97A 3EN1B 2BHMA 2XEPA 3G6E3 5IEPA 1RCLA 2IYJA 3EBYA 4EV5A 1G02A 2W9PA 3NBBA 1V74A 3S5CA 4MEIA 3CCM3 2P0MA 1IQYA 1BRHA 4N6MA 2ZDJA 1GD3A 1JBRA 3H3HA 2WGQA 4J5GA 3S29A 2WOFA 3DGNA 3CCU3 3CCJ3 2QA43 1UCIA 3HK4A 3NUVA 1BUQA 1GMPA 2XFTA 3ECFA 4NREA 5CF2A 4CJNA 2FXTA 1OHOA 1W6GA 1K734 5CXOA 1OUNA 1L5GB 5LC7A 4NPBA 1VQO3 1UUVB 2CX0A 1VQL3 1JKGA 3X40A 2HMLB 1A90A 3MSOA 1T2HA 3PXMA 1ULIB 4O2HA 5D82A 1GSPA 3DGYA 4HM3B 1NO3A
chains in the Genus database with same CATH topology
1BRIA 1X1YA 3AGNA 1BNJA 1I2GA 2F5MA 1I3FA 1RLSA 1BAOA 1BOXA 1RNTA 1T2IA 1BGSA 2AADA 3GSPA 1RGAA 1X1XA 5BU4A 1RN4A 1YVSA 2KF5A 1BSBA 1UCJA 1RGFA 3D5IA 1BNIA 1BU4A 5GSPA 1HZ1A 1B2XA 4HAAA 1FUTA 1GMQA 1B2ZA 4GHOA 2BU4A 1ZGXA 1PY3A 1AQZA 1I70A 2F5WA 1CH0A 3RNTA 1RNBA 1RHLA 1BSDA 8RNTA 1I3IA 2KF4A 2KAAA 1GMRA 1I0VA 2GSPA 3D5GA 1BRGA 4RNTA 3D4AA 1RDSA 2RBIA 1BNRA 1LNIA 2BIRA 3WHOA 1B3SA 1BSAA 1LOVA 2C4BA 1YNVX 3BU4A 4GSPA 2AAEA 1MGRA 2F56A 3SYUA 1BVIA 1BIRA 1B2UA 7RNTA 1LOWA 1GOVA 2HOHA 5HOHA 1RN1A 1RTUA 4BU4A 1RGEA 4HOHA 1B27A 3BIRA 1UCLA 3Q3FA 1BNSA 1BRJA 3A5EA 1BRKA 1B20A 3WR2A 1BRNL 3AHSA 1DETA 1I0XA 1MGWA 1B2MA 1BNFA 1RGLA 1I8VA 1B21A 1X1UA 2F4YA 3URPA 1C54A 1LOYA 4J5KA 1B2SA 1HYFA 5BIRA 1BANA 1BSEA 2RNTA 1GOUA 2ZA4A 1RMSA 1R4YA 9RNTA 1I2FA 1BSCA 1FUSA 1Q9EA 1RCKA 1AY7A 1RGKA 1YGWA 6RNTA 1LRAA 4BIRA 1BNGA 1RSNA 7GSPA 2SARA 1BNEA 1RGCA 1BRSA 5RNTA 1RCLA 2KF3A 3DH2A 1G02A 1X1WA 1BRHA 1RGHA 2KF6A 1JBRA 3AHWA 1JBTA 3AGOA 3HOHA 4J5GA 1UCIA 1UCKA 1TTOA 1FZUA 1GMPA 1I2EA 1GOYA 1RGGA 1TRPA 1JBSA 3KCHA 1A2PA 1FW7A 1TRQA 1SARA 1T2HA 1DE3A 1IYYA 1GSPA 3DGYA 1FYSA 6GSPA 1PYLA 1BUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRI A;  1X1Y A;  3AGN A;  1BNJ A;  1I2G A;  2F5M A;  1I3F A;  1RLS A;  1BAO A;  1BOX A;  1RNT A;  1T2I A;  1BGS A;  2AAD A;  3GSP A;  1RGA A;  1X1X A;  5BU4 A;  1RN4 A;  1YVS A;  2KF5 A;  1BSB A;  1UCJ A;  1RGF A;  3D5I A;  1BNI A;  1BU4 A;  5GSP A;  1HZ1 A;  1B2X A;  4HAA A;  1FUT A;  1GMQ A;  1B2Z A;  4GHO A;  2BU4 A;  1ZGX A;  1PY3 A;  1AQZ A;  1I70 A;  2F5W A;  1CH0 A;  3RNT A;  1RNB A;  1RHL A;  1BSD A;  8RNT A;  1I3I A;  2KF4 A;  2KAA A;  1GMR A;  1I0V A;  2GSP A;  3D5G A;  1BRG A;  4RNT A;  3D4A A;  1RDS A;  2RBI A;  1BNR A;  1LNI A;  2BIR A;  3WHO A;  1B3S A;  1BSA A;  1LOV A;  2C4B A;  1YNV X;  3BU4 A;  4GSP A;  2AAE A;  1MGR A;  2F56 A;  3SYU A;  1BVI A;  1BIR A;  1B2U A;  7RNT A;  1LOW A;  1GOV A;  2HOH A;  5HOH A;  1RN1 A;  1RTU A;  4BU4 A;  1RGE A;  4HOH A;  1B27 A;  3BIR A;  1UCL A;  3Q3F A;  1BNS A;  1BRJ A;  3A5E A;  1BRK A;  1B20 A;  3WR2 A;  1BRN L;  3AHS A;  1DET A;  1I0X A;  1MGW A;  1B2M A;  1BNF A;  1RGL A;  1I8V A;  1B21 A;  1X1U A;  2F4Y A;  3URP A;  1C54 A;  1LOY A;  4J5K A;  1B2S A;  1HYF A;  5BIR A;  1BAN A;  1BSE A;  2RNT A;  1GOU A;  2ZA4 A;  1RMS A;  1R4Y A;  9RNT A;  1I2F A;  1BSC A;  1FUS A;  1Q9E A;  1RCK A;  1AY7 A;  1RGK A;  1YGW A;  6RNT A;  1LRA A;  4BIR A;  1BNG A;  1RSN A;  7GSP A;  2SAR A;  1BNE A;  1RGC A;  1BRS A;  5RNT A;  1RCL A;  2KF3 A;  3DH2 A;  1G02 A;  1X1W A;  1BRH A;  1RGH A;  2KF6 A;  1JBR A;  3AHW A;  1JBT A;  3AGO A;  3HOH A;  4J5G A;  1UCI A;  1UCK A;  1TTO A;  1FZU A;  1GMP A;  1I2E A;  1GOY A;  1RGG A;  1TRP A;  1JBS A;  3KCH A;  1A2P A;  1FW7 A;  1TRQ A;  1SAR A;  1T2H A;  1DE3 A;  1IYY A;  1GSP A;  3DGY A;  1FYS A;  6GSP A;  1PYL A;  1BUJ A; 
#chains in the Genus database with same CATH topology
 5IEO A;  1X1Y A;  4ORL A;  4CPK A;  1D6U A;  1I2G A;  3SOY A;  1EQK A;  1T2I A;  1A2V A;  2PZV A;  4IIA A;  5G1K A;  2P38 A;  4HZB B;  5G2G A;  3G4S 3;  1N8R 4;  5CF1 A;  1BSB A;  1UCJ A;  2Z6B A;  3B4O A;  1JNQ A;  3D79 A;  4FCZ A;  4RNZ A;  5AI1 A;  3RDE A;  3Q1C A;  2Z7A A;  4XDW A;  2OQE A;  4O8S A;  4TX4 A;  1YJ9 3;  4H61 A;  3PCS A;  2OQE C;  3CC7 3;  1CYU A;  1ROA A;  4O02 B;  1YIJ 3;  1B2Z A;  1US1 A;  3OX9 A;  2Y73 A;  1JB2 A;  4RBN A;  3CCE 3;  1MWR A;  2W56 A;  1WMO A;  3UL6 A;  1RHL A;  3CCQ 3;  3MG2 A;  3EC9 A;  1LQG C;  4EV2 A;  2CHC A;  8RNT A;  3E99 A;  2FNQ A;  4QWT A;  1TP6 A;  1IQX A;  1I0V A;  3LT8 A;  4RNT A;  1RN7 A;  2XF3 A;  5G1L A;  3CC2 3;  1M1X B;  1YIT 3;  2GEY A;  2WO0 A;  1YNV X;  1G96 A;  3BU4 A;  1WMN A;  1OF5 A;  3D3L A;  1S5A A;  1OAC A;  1AR0 A;  4J9A A;  4JRF A;  1AVK A;  2AAE A;  1MGR A;  3SYU A;  1BVI A;  5IER A;  1JN5 A;  1STD A;  1A2K A;  1KSI A;  5HOH A;  3OWU A;  1B27 A;  1W4N A;  5EVH A;  3VGN A;  3Q3F A;  3VSY A;  3I56 3;  3SLU A;  3A5E A;  3AHS A;  1I0X A;  1IV9 A;  1O7P B;  4FMC A;  1ZX2 A;  1BNF A;  1CYV A;  3V98 A;  1Q7H A;  2YFI B;  3HI7 A;  1ZS7 A;  1PFP A;  3IJE B;  3CD6 3;  4J5K A;  3X3Z A;  3AMO B;  1HYF A;  3CNM A;  5BIR A;  3ZG0 A;  2OWP A;  1QMA A;  2RNT A;  5AYR B;  1VQK 3;  2A15 A;  1HU9 A;  1Q40 A;  1UUW B;  3ALA A;  3JUP A;  8CHO A;  5IG5 A;  1OPY A;  2RCD A;  1RCK A;  3ZFZ A;  3WA3 A;  5DRV A;  1IV7 A;  1O7W B;  3DUK A;  5M19 A;  3LT9 A;  1LRA A;  2OTJ 3;  1IU7 A;  5FGO A;  4HM4 B;  1EG9 B;  2SAR A;  3O8Y A;  4MMZ B;  1A67 A;  1FGO A;  1BNE A;  1BRS A;  5RNT A;  1C7H A;  1QAL A;  2KF3 A;  3DH2 A;  4K61 A;  5AIH A;  2YFL B;  1X1W A;  2FGT A;  1NWW A;  1W02 A;  2YX9 A;  4KVH A;  1IK3 A;  3CCV 3;  4N6V 0;  1RGH A;  3GAX A;  3K5T A;  5D81 A;  5EEO A;  4XB5 A;  5JPU A;  3G71 3;  3FG3 A;  3AGO A;  3FLJ A;  1IT8 A;  5JPP A;  1NJI 4;  2O9U X;  2E2U A;  1TTO A;  3TDG A;  1IVW A;  1W6Y A;  1I2E A;  1VQN 3;  3F8X A;  1QAK A;  1JBS A;  2RFR A;  3KCH A;  5A0O B;  4FMD A;  1FW7 A;  2XFS A;  4N6T A;  2CK3 H;  4O3V A;  2IA7 A;  4WFO A;  3NXJ A;  1IVU A;  1DE3 A;  2CG0 A;  4KFF A;  4LGQ A;  3MHE A;  1VQM 3;  1PYL A;  1EEJ A;  3FG4 A;  2CFD A;  3OV4 A;  4BTX A;  4DKI A;  1BRI A;  1UDI I;  3KII A;  1N9E A;  3FGY A;  3UJM A;  3OXA A;  3WOD G;  1ZO2 A;  2BO9 B;  1JB4 A;  3U1W A;  1GYB A;  4HM0 B;  1K41 A;  1IVV A;  1O7H B;  2XSH B;  3EB8 A;  2P05 A;  1X1X A;  4NHF A;  1RN4 A;  1MWU A;  3BLZ A;  3LH4 A;  1TU5 A;  1IT7 A;  3DZL A;  1VQ6 3;  5AII A;  3NHX A;  3MG1 A;  1RGF A;  4X2H A;  3D5I A;  5GSP A;  1B2X A;  4HAA A;  1T5Y A;  4N6N B;  2PNC A;  3FCS B;  2E2T A;  3CU3 A;  1PY3 A;  4EXR A;  1W01 A;  2F5W A;  5D83 A;  3UL5 A;  3DGO A;  1CH0 A;  3RNT A;  4AKZ A;  4BTY A;  1EKM A;  1TFO A;  1I3I A;  4LSO A;  4WHA A;  1E3V A;  1RRH A;  4OVM A;  4WWU C;  1GMR A;  1Q42 A;  3JUQ A;  2STD A;  3GRD A;  4R80 A;  1IDP A;  1GD4 A;  3LTC A;  1R4C A;  2W56 B;  4I5Q A;  1RDS A;  4J8T A;  3GWR A;  3NQZ A;  3V99 A;  5HGR A;  1YVB I;  3FF0 A;  3DM8 A;  4FCJ A;  5KP4 A;  1Q81 4;  1B3S A;  1BSA A;  3B7C A;  3PYJ A;  2C4B A;  4OK0 A;  4R9L A;  3ZG5 A;  4CCV A;  1STF I;  3F9S A;  3KSE D;  4FMB A;  4HZ9 B;  2HMJ B;  1KWI A;  2XGL A;  3JUN A;  5ELU A;  3T8N A;  2W04 A;  1HKX A;  1SII A;  1V58 A;  2HMM B;  3KSP A;  2Z77 A;  1OGZ A;  1UGI A;  4BU4 A;  3DY5 A;  4HOH A;  3BIR A;  1UCL A;  3WMD A;  4R1K A;  3EX9 A;  1NU3 A;  1B20 A;  2MF7 A;  4XM4 A;  1SPU A;  4PEJ A;  3J7Y d;  1JJ2 2;  1BRN L;  1VQ4 3;  5IEN A;  2ZHX B;  3CC4 3;  1I8V A;  1B21 A;  5BVB A;  4BL2 A;  3UNL A;  2CIU A;  2F4Y A;  1C54 A;  5CK6 A;  1LOY A;  1QVF 2;  1B2S A;  3NQY A;  2CFW A;  2ML5 A;  3EE1 A;  1GY7 A;  1MWT A;  4BL3 A;  3CCR 3;  1ISK A;  2K3D A;  5IF6 A;  1RMS A;  9RNT A;  1G0T A;  1I2F A;  1IQ8 A;  4K90 B;  4XDV A;  1WTH A;  4LYL B;  2F98 A;  4L8P A;  1TFK A;  1AY7 A;  1Z1S A;  1RSN A;  7GSP A;  1AV4 A;  2MC8 A;  3NX0 A;  3EF8 A;  1CEW I;  4JF8 A;  5FW5 A;  2D42 A;  5DRE A;  1SQW A;  3UB1 A;  5IG3 A;  3BNE A;  2O3O A;  2CWV A;  3HIG A;  1EA2 A;  3AHW A;  3PCR A;  3B8L A;  5AIG A;  2OOV C;  1IVX A;  3CPW 2;  1YI2 3;  1D6Z A;  2XGN A;  4GL6 A;  1UCK A;  4R4K A;  1RRL A;  1FZU A;  1OHP A;  1UGH I;  2UUG C;  3G0K A;  5TGN A;  3IMA B;  3KZT A;  3S67 A;  4H3U A;  1TRP A;  3N8B A;  1FA3 A;  4XBX A;  2V1L A;  4N6U A;  3FZW A;  1WQL B;  3GZR A;  3MPH A;  1YJN 3;  4KFE A;  1A2P A;  1W6C A;  3STD A;  3X3Y A;  3BND A;  1TRQ A;  6STD A;  2K54 A;  2CH9 A;  2CWU A;  4STD A;  3RGA A;  2BNG A;  1MNL A;  2BMQ B;  3K9M C;  4KZ1 A;  3LZA A;  3RGR A;  1JB5 A;  3CCS 3;  1CQS A;  1IYY A;  1DYU A;  3CXC 2;  3MG3 A;  4BTW A;  7STD A;  2JQ5 A;  6GSP A;  3NV0 B;  1FUW A;  1RJO A;  2UX0 A;  3AGN A;  1BNJ A;  4R9K A;  1I3F A;  2IUK A;  3CNX A;  1JZO A;  2CFG A;  3LYG A;  4HM5 B;  1W2Z A;  3VF1 A;  3V92 A;  1O7G B;  4HKV B;  4WYK A;  1UW1 A;  2BT3 A;  3QRD A;  1BGS A;  1Q82 4;  2AAD A;  2H0G A;  3GSP A;  4EYC A;  1RGA A;  1ASK A;  1KQS 2;  4G1M B;  1NB5 I;  5BU4 A;  1YGE A;  5AEW B;  3IPT A;  1U5O A;  1VQQ A;  3DGM A;  3HII A;  2IUJ A;  1VZZ A;  3KE7 A;  1EUI C;  1BNI A;  1BU4 A;  2W9Q A;  3BNB A;  3SXX A;  4ZM8 A;  1HZ1 A;  3SVA A;  3GZX B;  3LTA A;  3NM2 A;  3N9H A;  3K0Z A;  4LEH A;  4EW5 A;  4EC6 A;  2E2V A;  4GHO A;  3SED A;  1ZGX A;  1NNV A;  1AQZ A;  3X3X A;  2CX1 A;  1WMP A;  1VQ8 3;  2W6J H;  2ML6 A;  1UI8 A;  2CWT A;  3AMO A;  3EQQ B;  1UI7 A;  5M18 A;  3T0U A;  1RNB A;  2KCD A;  2GBX B;  3MKI A;  1BSD A;  1JKG B;  1N5H A;  2KRT A;  1LNH A;  3H51 A;  5EQL A;  2KAA A;  3JUO A;  5IW9 A;  3DMC A;  3EN8 A;  4HM8 B;  2CC3 A;  2GSP A;  1BRG A;  3D5G A;  2GXF A;  1W5Z A;  2INX A;  3KFQ C;  1JZD A;  2RBI A;  2GEX A;  4HM6 B;  1K9M 4;  1LNI A;  4XBY A;  1VQP 3;  2BIR A;  4U13 A;  1DVC A;  1LOV A;  1V57 A;  1N5P A;  2B24 B;  3SX1 A;  4GSP A;  3WOE B;  4N6O B;  1W2B 2;  1RKY A;  1VQ5 3;  3I0Y A;  5AYS C;  3FKA A;  4HM2 B;  1BIR A;  2CG1 A;  1GOV A;  2HMN B;  3Q90 A;  2CKF B;  1OHS A;  1RN1 A;  4WP5 A;  1K28 A;  1O7N B;  1RGE A;  1Y4K A;  3LTB A;  2D1W A;  3LOY A;  2GBW B;  3NM7 A;  1FGQ A;  4GB5 A;  3OWS A;  4MJD A;  4KFD A;  1ROV A;  2CW9 A;  1BRK A;  3EJV A;  3WDG B;  1DET A;  1MGW A;  1B2M A;  1Q7Y 4;  4AEQ A;  1QVG 2;  2CFK A;  2Z76 A;  1N8Q A;  3EHC A;  2R4I A;  3MWZ A;  1K8A 4;  4K1U A;  5JBS A;  1BAN A;  1S72 3;  1GOU A;  2ZA4 A;  1TJD A;  2XSO B;  1PU4 A;  2R41 A;  2WOH A;  2LQV A;  2YFJ B;  4FMA A;  3N54 B;  5KP1 A;  1M90 4;  1E3R A;  2P0X A;  4HJL B;  3X42 A;  4K1V A;  6RNT A;  3S27 A;  4BIR A;  1YHQ 3;  3PZW A;  4L8O A;  2WGO A;  2W03 A;  1DVD A;  3PGB A;  1W7C A;  1OF5 B;  1RGC A;  4FCM A;  3M8C A;  3WA2 X;  1UUG B;  3FSD A;  5I97 A;  1DMQ A;  1DMM A;  1JN5 B;  4LZI A;  2KF6 A;  1LOX A;  3JVC A;  1QAF A;  2GU3 A;  1JBT A;  4MMX B;  3HOH A;  3KKG A;  2RSX A;  1O7M B;  2I9W A;  1VQ7 3;  4HM1 B;  1KD1 4;  1GS3 A;  3D9R A;  4IT7 A;  4Q53 A;  3X41 A;  3L0R A;  1F8N A;  3Q2P A;  2SBL A;  1GOY A;  1GY5 A;  1RGG A;  1VQ9 3;  2OCT A;  5M1A A;  1MOL A;  1QJG A;  3A76 A;  1FGR A;  3K7C A;  2IY2 A;  3BNC A;  2BMO B;  1SAR A;  5AIF A;  3CPO A;  3BB9 A;  1JV2 B;  1Q40 B;  5CLK A;  1NDO B;  1FGT A;  2XRX B;  3F40 A;  1GY6 A;  1FYS A;  2QIY A;  2KXG A;  3PS8 A;  5KP3 A;  1YJW 3;  2XH9 A;  1BUJ A;  1D6Y A;  1OCV A;  3F7S A;  3JUM A;  4EBG A;  2F5M A;  2F86 B;  1MWS A;  4HYZ A;  4ILF A;  1LXE A;  1OH0 A;  4L7K A;  1Q86 4;  1RLS A;  5STD A;  3SOA A;  1BAO A;  1BOX A;  1RNT A;  2OOV A;  5AEU B;  1KC8 4;  3LXU X;  1U8C B;  3DGL A;  4RZM A;  3CMA 3;  2HMK B;  5LC6 A;  1N9J A;  4HVN A;  2BMR B;  2LYX A;  5IG4 A;  4CDL A;  4I4K A;  1YVS A;  2KF5 A;  1J2B A;  4WYK B;  2JDI H;  2W0Q A;  1M9G A;  4N3V A;  4XBT A;  2QEX 3;  1FGM A;  3DXO A;  2H0I A;  2C10 A;  2M7O A;  3LTD A;  1FUT A;  1GMQ A;  2C11 A;  1OGX A;  1LVN A;  3EBT A;  2BU4 A;  1AVL A;  3LML A;  4OUQ A;  2UGI A;  3FG1 A;  1LQM B;  1NB3 I;  2HMO B;  2F99 A;  1I70 A;  3GZY B;  4RNY A;  2L1S A;  2Y74 A;  2KF4 A;  1ULJ B;  4LMI A;  3FH1 A;  2RGQ A;  3ROB A;  3KN4 A;  2L4V A;  3D4A A;  1M1K 4;  3F8H A;  5BXQ A;  3G8Z A;  1BNR A;  2CFL A;  1DMN A;  3S28 A;  3WHO A;  2Q07 A;  4IPB A;  2P09 A;  3F14 A;  1SJW A;  4HBR A;  1JRQ A;  3OWY A;  2F56 A;  2XR8 B;  3OW2 2;  3NBR A;  4AKY A;  7RNT A;  1B2U A;  1LOW A;  2HOH A;  2B1X B;  3GZB A;  3HZP A;  1RTU A;  3K63 A;  1SIH A;  2K0M A;  1W00 A;  2H0H A;  2J8X B;  3MYT A;  3F7X A;  1BNS A;  1BRJ A;  3WR2 A;  4N6L A;  3B4P A;  4KT3 B;  2OTL 3;  2ZL8 A;  1RGL A;  3NBJ A;  1X1U A;  3URP A;  2IMJ A;  3CCL 3;  4HM7 B;  3ER7 A;  1BSE A;  3WOF B;  3T8U A;  4FR9 A;  2GU1 A;  3U97 A;  1R4Y A;  5ELJ A;  1BSC A;  1T3B A;  3FF2 A;  3G16 A;  1FUS A;  1Q9E A;  1RGK A;  3QK9 A;  1YGW A;  2W2C A;  4MMY B;  3I55 3;  4X2O A;  1TUH A;  1TIJ A;  3HX8 A;  1BNG A;  3NV0 A;  5IG0 A;  2QGU A;  3CME 3;  1WNH A;  1E97 A;  3EN1 B;  2BHM A;  2XEP A;  3G6E 3;  5IEP A;  1RCL A;  2IYJ A;  3EBY A;  4EV5 A;  1G02 A;  2W9P A;  3NBB A;  1V74 A;  3S5C A;  4MEI A;  3CCM 3;  2P0M A;  1IQY A;  1BRH A;  4N6M A;  2ZDJ A;  1GD3 A;  1JBR A;  3H3H A;  2WGQ A;  4J5G A;  3S29 A;  2WOF A;  3DGN A;  3CCU 3;  3CCJ 3;  2QA4 3;  1UCI A;  3HK4 A;  3NUV A;  1BUQ A;  1GMP A;  2XFT A;  3ECF A;  4NRE A;  5CF2 A;  4CJN A;  2FXT A;  1OHO A;  1W6G A;  1K73 4;  5CXO A;  1OUN A;  1L5G B;  5LC7 A;  4NPB A;  1VQO 3;  1UUV B;  2CX0 A;  1VQL 3;  1JKG A;  3X40 A;  2HML B;  1A90 A;  3MSO A;  1T2H A;  3PXM A;  1ULI B;  4O2H A;  5D82 A;  1GSP A;  3DGY A;  4HM3 B;  1NO3 A; 
#chains in the Genus database with same CATH homology
 1BRI A;  1X1Y A;  3AGN A;  1BNJ A;  1I2G A;  2F5M A;  1I3F A;  1RLS A;  1BAO A;  1BOX A;  1RNT A;  1T2I A;  1BGS A;  2AAD A;  3GSP A;  1RGA A;  1X1X A;  5BU4 A;  1RN4 A;  1YVS A;  2KF5 A;  1BSB A;  1UCJ A;  1RGF A;  3D5I A;  1BNI A;  1BU4 A;  5GSP A;  1HZ1 A;  1B2X A;  4HAA A;  1FUT A;  1GMQ A;  1B2Z A;  4GHO A;  2BU4 A;  1ZGX A;  1PY3 A;  1AQZ A;  1I70 A;  2F5W A;  1CH0 A;  3RNT A;  1RNB A;  1RHL A;  1BSD A;  8RNT A;  1I3I A;  2KF4 A;  2KAA A;  1GMR A;  1I0V A;  2GSP A;  3D5G A;  1BRG A;  4RNT A;  3D4A A;  1RDS A;  2RBI A;  1BNR A;  1LNI A;  2BIR A;  3WHO A;  1B3S A;  1BSA A;  1LOV A;  2C4B A;  1YNV X;  3BU4 A;  4GSP A;  2AAE A;  1MGR A;  2F56 A;  3SYU A;  1BVI A;  1BIR A;  1B2U A;  7RNT A;  1LOW A;  1GOV A;  2HOH A;  5HOH A;  1RN1 A;  1RTU A;  4BU4 A;  1RGE A;  4HOH A;  1B27 A;  3BIR A;  1UCL A;  3Q3F A;  1BNS A;  1BRJ A;  3A5E A;  1BRK A;  1B20 A;  3WR2 A;  1BRN L;  3AHS A;  1DET A;  1I0X A;  1MGW A;  1B2M A;  1BNF A;  1RGL A;  1I8V A;  1B21 A;  1X1U A;  2F4Y A;  3URP A;  1C54 A;  1LOY A;  4J5K A;  1B2S A;  1HYF A;  5BIR A;  1BAN A;  1BSE A;  2RNT A;  1GOU A;  2ZA4 A;  1RMS A;  1R4Y A;  9RNT A;  1I2F A;  1BSC A;  1FUS A;  1Q9E A;  1RCK A;  1AY7 A;  1RGK A;  1YGW A;  6RNT A;  1LRA A;  4BIR A;  1BNG A;  1RSN A;  7GSP A;  2SAR A;  1BNE A;  1RGC A;  1BRS A;  5RNT A;  1RCL A;  2KF3 A;  3DH2 A;  1G02 A;  1X1W A;  1BRH A;  1RGH A;  2KF6 A;  1JBR A;  3AHW A;  1JBT A;  3AGO A;  3HOH A;  4J5G A;  1UCI A;  1UCK A;  1TTO A;  1FZU A;  1GMP A;  1I2E A;  1GOY A;  1RGG A;  1TRP A;  1JBS A;  3KCH A;  1A2P A;  1FW7 A;  1TRQ A;  1SAR A;  1T2H A;  1DE3 A;  1IYY A;  1GSP A;  3DGY A;  1FYS A;  6GSP A;  1PYL A;  1BUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...