1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
b'MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
3EN8A 1W6YA 3NHXA 2BMRB 3MG1A 1BUQA 2F86B 4STDA 3MSOA 4H3UA 4Q53A 3BLZA 1TUHA 1O7MB 1HKXA 3EF8A 3CU3A 2A15A 2RGQA 3H3HA 2B1XB 2GBXB 3FGYA 1O7NB 1W01A 1DMNA 4HM5B 1AR0A 3M8CA 1OHOA 1A2KA 3NV0A 3RGAA 3EQQB 2XSHB 2UX0A 1ZX2A 2XR8B 3H51A 4XBTA 4GB5A 4J8TA 4HJLB 1OGZA 5FW5A 3OWYA 4HZBB 2CHCA 2HMKB 4X2OA 3SOAA 8CHOA 3NV0B 4FCJA 3CNXA 5BXQA 2IMJA 3NXJA 5IG3A 2K54A 4X2HA 1STDA 2BNGA 4U13A 1GS3A 2BMOB 2QGUA 3DMCA 1OF5A 2YFIB 3F9SA 4IIAA 1C7HA 5G2GA 1JB5A 3NM2A 3T8UA 4WP5A 3FF2A 3I0YA 3G16A 3GZRA 3F7SA 2RCDA 3VSYA 3G8ZA 3FSDA 4LMIA 4CDLA 1UUVB 2JQ5A 1OF5B 1O7GB 3F8HA 1JB4A 1EA2A 1Z1SA 3F8XA 4R9KA 5DRVA 3BB9A 3KE7A 4LEHA 3CPOA 2CKFB 4XBYA 2RFRA 3DM8A 5IF6A 3OXAA 1OH0A 2STDA 1O7WB 2HMMB 1OGXA 3MG3A 2HMNB 3UNLA 3UJMA 4HM1B 2R4IA 1OUNA 5EVHA 4LGQA 3ER7A 3T8NA 4XB5A 1QMAA 3EHCA 3DUKA 3HZPA 3GWRA 5AIFA 7STDA 5KP4A 3HX8A 1JB2A 3EBYA 3K0ZA 2HMOB 3G0KA 3FLJA 5IERA 3JUMA 1OPYA 3IPTA 3FKAA 4HKVB 1QJGA 4ORLA 1DMMA 1NU3A 3ROBA 2Z77A 1TP6A 1OCVA 3OX9A 3GZXB 5IENA 2GEYA 1GYBA 1S5AA 3EN1B 5IG5A 3S5CA 4OVMA 3FH1A 3KZTA 3JUPA 3NUVA 5AI1A 1WQLB 1GY5A 2Z76A 5IEPA 3NBRA 2OWPA 4KVHA 4K1VA 4XDWA 2F99A 4WYKA 4FCMA 2W2CA 4PEJA 1ZO2A 3GZYB 3JUQA 3MG2A 5IG0A 1EG9B 3KSPA 4K1UA 2XRXB 3CNMA 1CQSA 2BMQB 4HZ9B 5AIHA 6STDA 3F7XA 5D81A 5AEWB 2F98A 2GXFA 1ULIB 1IDPA 3JUNA 5JPPA 2YFJB 3MHEA 5CLKA 1K41A 4XDVA 3DXOA 2QIYA 3EC9A 3LZAA 2GEXA 1OHSA 3MKIA 1O7PB 4MJDA 3MYTA 4RZMA 1Q40A 5KP3A 3WMDA 1ULJB 3EJVA 1E3VA 5KP1A 5AIIA 3GRDA 3HK4A 3RGRA 3KKGA 4L8OA 3Q90A 5IEOA 4HVNA 5D83A 5BVBA 4I4KA 1GY7A 1OHPA 1W00A 1GY6A 3B8LA 5D82A 5CF1A 1W02A 5IG4A 2B24B 1Q40B 3JUOA 1O7HB 2I9WA 1ASKA 4L8PA 4OUQA 5HGRA 5DREA 1SJWA 2HMLB 4WWUC 1JN5A 3VGNA 3LYGA 5CF2A 2GBWB 3FZWA 4HM8B 4HM2B 1VZZA 2INXA 3GZBA 3A76A 3K7CA 4N3VA 3B4OA 1UUWB 1E97A 2HMJB 3F14A 3FF0A 5JPUA 4HM0B 1JN5B 5CXOA 1Q42A 4R9LA 1ISKA 4HM6B 3SEDA 2Z7AA 3STDA 1DMQA 4HM3B 3OWUA 1JKGA 4XBXA 4XM4A 3B4PA 1NWWA 4J9AA 1NDOB 1U5OA 3DZLA 3SOYA 5TGNA 3E99A 3OV4A 4R1KA 4HM7B 3OWSA 5AIGA 4HM4B 4L7KA 5STDA 5CK6A 5AEUB 4WYKB 2XSOB 2PZVA 3D9RA 1JKGB 2YFLB 3ECFA 1E3RA 3EX9A 3EBTA 3B7CA 3F40A
chains in the Genus database with same CATH superfamily
1RN1A 2O9UX 3EN8A 1W6YA 4H61A 3NHXA 2Y73A 2BMRB 3CCL3 1QALA 4FMCA 5M1AA 3MG1A 1TRPA 1Q824 1M1XB 1BUQA 2XF3A 2F86B 3D3LA 1RLSA 2FXTA 3NBJA 4STDA 3MSOA 3QK9A 4H3UA 4RNZA 5EEOA 1VQ43 1HU9A 4Q53A 1BRSA 1FGRA 3BLZA 1IQ8A 1IV7A 1I2FA 1TUHA 1YGEA 1O7MB 1HKXA 2GSPA 3V92A 3EF8A 3CU3A 2A15A 2RGQA 1IYYA 1W2B2 3PZWA 3I553 3SVAA 1QVG2 1G0TA 3H3HA 4EC6A 2OQEC 1JNQA 1MWUA 1UCLA 1IK3A 2B1XB 2GBXB 3FGYA 1O7NB 1EKMA 1RNTA 1W01A 2ML5A 1LXEA 3CCS3 1DVDA 1MWRA 1DMNA 3AHWA 2FNQA 4HM5B 2KF4A 4MMZB 1AR0A 4FR9A 2V1LA 3M8CA 1OHOA 1A2KA 2LYXA 2KXGA 1FGQA 4O8SA 2R41A 4K61A 3NV0A 3RGAA 3EQQB 2XSHB 2UGIA 2UX0A 3T0UA 1SIIA 3PS8A 1VQQA 1CYVA 1B2SA 1ZX2A 2P09A 4R80A 2C10A 2P05A 2XR8B 1BNFA 1UGIA 3H51A 5ELUA 3WODG 2CW9A 4XBTA 1GSPA 1PY3A 4GB5A 1DE3A 4R4KA 2ZDJA 3MPHA 4FMAA 4BTWA 4J8TA 1TTOA 4IPBA 4KFEA 4CCVA 3CCR3 4HJLB 1KWIA 1LQGC 3CD63 1OGZA 1WMOA 3G6E3 2Q07A 5FW5A 1UW1A 3FCSB 2RNTA 3OWYA 3N54B 3Q3FA 3SXXA 1QVF2 3WDGB 1B2ZA 2CHCA 1GMPA 2HMKB 1RCKA 4HZBB 4BTYA 1K8A4 4MMYB 3NQZA 1DVCA 3PCRA 3I563 1VQM3 3CC43 3ZG5A 4X2OA 1GMQA 4KFDA 3SOAA 8CHOA 3NV0B 1KD14 1TU5A 4FCJA 4AKYA 3CNXA 4BTXA 2IMJA 3NXJA 5BXQA 5IG3A 2K54A 1B2XA 1G02A 2E2UA 4X2HA 2CFDA 2OQEA 1STDA 2BNGA 1B2UA 4RNYA 3CCQ3 2CFWA 3HIGA 2CFGA 1GS3A 1UCJA 2BMOB 4U13A 1B2MA 2L4VA 2QGUA 4N6LA 3DMCA 4ZM8A 1C54A 1OF5A 2YFIB 1BSEA 4IT7A 3AGNA 1VQ93 3J7Yd 3F9SA 1AQZA 4IIAA 1C7HA 1QAKA 1CEWI 2W04A 1JB5A 3NM2A 5G2GA 3T8UA 1CYUA 2M7OA 4BIRA 2P0MA 4N6NB 1IQXA 1S723 1RNBA 2ZHXB 4WP5A 3FF2A 1GOYA 1I2EA 3I0YA 1AVLA 3G16A 3GZRA 3DY5A 1BNIA 1RGFA 1T3BA 1Q864 3F7SA 2RCDA 4NPBA 3VSYA 1RRLA 4N6V0 3G8ZA 3FSDA 1VQK3 3S29A 4LMIA 4CDLA 1STFI 1UUVB 2XFTA 1Q7Y4 1BRNL 1M9GA 2JQ5A 1OF5B 1UI8A 1O7GB 2XGNA 3S28A 3F8HA 1JB4A 2WO0A 2J8XB 1EA2A 1TIJA 3UL5A 1RRHA 2AADA 1I8VA 1FUTA 1Z1SA 2BIRA 2K3DA 3F8XA 4R9KA 5DRVA 1IVWA 3BB9A 1X1UA 1BOXA 3KE7A 1EQKA 4LEHA 3CPOA 1A67A 2CKFB 4XBYA 3UB1A 2RFRA 3WOFB 1KC84 6RNTA 1N8R4 2XFSA 3AGOA 3DM8A 3OXAA 4LSOA 5IF6A 1K9M4 4KZ1A 1OH0A 2STDA 4CJNA 1LOYA 1O7WB 2KF6A 1RHLA 1V58A 3UL6A 5LC7A 2HMMB 3LTDA 5IW9A 1M904 1BUJA 1NO3A 2C11A 1JZOA 1U8CB 4MEIA 2MC8A 1OGXA 3MG3A 2OOVA 1IV9A 3KCHA 2Y74A 3PGBA 2HMNB 3UNLA 4AEQA 1KQS2 3UJMA 1RCLA 1BRIA 1JZDA 2H0HA 1VQP3 4HM1B 1EUIC 1N9JA 2R4IA 1OUNA 2WOHA 3CCJ3 5EVHA 1BNSA 2QA43 1B20A 1LNHA 4LGQA 3D5GA 1VQ63 1N9EA 3ER7A 1NB5I 3T8NA 4XB5A 2ML6A 1QMAA 2IUJA 1B3SA 1UCKA 3D5IA 1IT7A 3EHCA 1Y4KA 4CPKA 3DUKA 2UUGC 1BANA 3FG4A 3HZPA 3GWRA 1ROAA 2HOHA 1F8NA 1MNLA 1YGWA 2F5MA 3K5TA 2CWUA 5AIFA 5LC6A 7STDA 5KP4A 3HIIA 3HX8A 1JB2A 2BT3A 4N6OB 3U97A 3EBYA 4NHFA 4EXRA 3K0ZA 2HMOB 1JV2B 3G0KA 3FLJA 3LTCA 4HOHA 1NJI4 1IVUA 5IERA 3A5EA 3JUMA 3BU4A 4LYLB 1OPYA 1T2HA 3IPTA 3D79A 3FKAA 1WNHA 1A90A 2H0GA 1W2ZA 1QJGA 1RTUA 4FCZA 4HKVB 4ORLA 5G1LA 2CX1A 1DMMA 1LOXA 1NU3A 1FGMA 1B21A 3X40A 5I97A 2D42A 3ROBA 2W56A 2Z77A 3FG3A 4WFOA 1VQN3 1TP6A 4GHOA 2F56A 1OCVA 2QEX3 3OX9A 3LMLA 1BSDA 5AYRB 1D6ZA 3RNTA 5RNTA 5A0OB 4LZIA 3WOEB 3GZXB 3AHSA 3HOHA 1T5YA 5IENA 1FUWA 1JJ22 3CCM3 2GEYA 3URPA 1AVKA 1GYBA 1RSNA 1ZGXA 1S5AA 3EN1B 3ZFZA 1N5HA 5IG5A 1BGSA 2SBLA 1MWTA 3S5CA 1I3IA 2CG1A 4OVMA 2W6JH 3FH1A 3KZTA 1W6GA 3EB8A 1TRQA 2CWTA 3DGMA 3DGLA 3SX1A 2CIUA 1CH0A 2W56B 2ZA4A 4KFFA 3MWZA 2D1WA 3JUPA 2W0QA 1KSIA 4N6TA 1QAFA 1A2PA 3LH4A 3NUVA 4JRFA 1BAOA 5AI1A 1VQO3 3X3YA 1IVVA 3PCSA 3CME3 1WQLB 1UDII 2KRTA 1GY5A 4J5KA 3S27A 3G4S3 1SIHA 1YIJ3 1BU4A 1BIRA 1GD4A 2Z76A 3QRDA 5IEPA 3N8BA 2KF3A 1GOVA 1N8QA 1D6YA 4FMBA 3NBRA 3FG1A 4NREA 1YJ93 2P38A 4RNTA 5JBSA 2OWPA 4ILFA 1BNGA 1PFPA 4KVHA 1UGHI 1LRAA 1TFOA 5ELJA 4K1VA 5GSPA 1W6CA 3KFQC 4XDWA 2IA7A 3V98A 2L1SA 2F99A 3BNDA 3LT9A 2IY2A 3WA2X 3IMAB 1GMRA 1T2IA 4WYKA 4FCMA 2W2CA 3IJEB 1US1A 1SPUA 1ZO2A 2OCTA 4O2HA 4PEJA 1YI23 1JBRA 1BNRA 4EYCA 3LTBA 3GZYB 3JUQA 1RN4A 3MG2A 3LXUX 5IG0A 4G1MB 1EG9B 3KSPA 5FGOA 1YIT3 9RNTA 4K1UA 2XRXB 2E2VA 3CNMA 3TDGA 1CQSA 2BMQB 4HZ9B 5AIHA 3DGNA 6STDA 2RBIA 3F7XA 5D81A 2OTJ3 3BNBA 2E2TA 7RNTA 5AEWB 2F98A 1IT8A 4BL2A 3X3ZA 1WMNA 1Q814 2GXFA 1ULIB 1IDPA 1TJDA 3JUNA 1I2GA 5JPPA 1GD3A 1RDSA 1W7CA 2W03A 2YFJB 3MHEA 5CLKA 2W9QA 4O3VA 3WR2A 1FUSA 3CXC2 1K41A 1G96A 3GAXA 3X3XA 3D4AA 1JRQA 2GU3A 2FGTA 3BNEA 4XDVA 3KSED 3DXOA 1RGKA 1MWSA 2W9PA 2QIYA 3EC9A 3O8YA 3LZAA 3SLUA 2GEXA 1OHSA 2AAEA 1Q9EA 1W4NA 1A2VA 3MKIA 1WTHA 1O7PB 4MJDA 3DGOA 3MYTA 4RZMA 3X41A 1NNVA 8RNTA 2MF7A 1FZUA 1RGLA 1Q40A 1IVXA 2SARA 1B27A 5KP3A 1UCIA 3CMA3 2K0MA 1RKYA 2F4YA 4BU4A 3WMDA 4GL6A 1BVIA 1ULJB 3EJVA 1E3VA 4MMXB 5KP1A 1V74A 1VQL3 5AIIA 2CWVA 1FGOA 3GRDA 3HK4A 2LQVA 3RGRA 1RMSA 3KKGA 1EEJA 3Q90A 4L8OA 1BRGA 2GU1A 2JDIH 4QWTA 5IEOA 1UUGB 4EV5A 4WHAA 2CC3A 2WGQA 1BRKA 2CK3H 3L0RA 4HVNA 1RGCA 5D83A 5G1KA 3LOYA 2YX9A 2Z6BA 5BVBA 3BIRA 2BO9B 2RSXA 3EE1A 1SQWA 4I4KA 1GY7A 1OHPA 1I70A 1R4YA 2CH9A 1W00A 1TFKA 1GY6A 1V57A 3B8LA 4K90B 5D82A 1W02A 5CF1A 1FW7A 1JBTA 3Q1CA 5BIRA 1BSAA 5IG4A 1AY7A 4EBGA 2B24B 1Q40B 1RGHA 3JUOA 1JBSA 1K734 3GSPA 1RGGA 4FMDA 4I5QA 1O7HB 1BRHA 2CX0A 1HYFA 2I9WA 2KCDA 3ZG0A 4DKIA 1FA3A 1ASKA 3NX0A 3V99A 1LNIA 1YVSA 1SARA 3K9MC 4L8PA 4OUQA 5HGRA 3WHOA 5DREA 4HAAA 1SJWA 2XEPA 2HMLB 5HOHA 3HI7A 4WWUC 1BSBA 1JN5A 4TX4A 1LVNA 3VGNA 1I3FA 3LYGA 5CF2A 2GBWB 1R4CA 3AMOA 3FZWA 4HBRA 1J2BA 4HYZA 1GOUA 3CC73 2IUKA 4HM8B 2ZL8A 1Q7HA 4HM2B 1YHQ3 1RN7A 1IU7A 2O3OA 1RJOA 3ALAA 1M1K4 1VQ73 6GSPA 2OTL3 3K63A 1VZZA 2INXA 1LQMB 1YJW3 1LOWA 3GZBA 1BNJA 2CG0A 3A76A 3K7CA 4J5GA 4N6MA 2CFKA 4N3VA 5BU4A 3B4OA 3CC23 1UUWB 3KN4A 1E97A 2HMJB 3F14A 1MGRA 3FF0A 5JPUA 1N5PA 3VF1A 1AV4A 5M18A 4HM0B 3NQYA 1JN5B 1DYUA 3PXMA 3KIIA 5CXOA 1ZS7A 1Q42A 1YNVX 4O02B 1UI7A 2CFLA 3AMOB 4R9LA 1ISKA 4RBNA 1PYLA 2F5WA 1L5GB 5M19A 3U1WA 4HM6B 4EW5A 3RDEA 3SEDA 3CCE3 2OOVC 2Z7AA 3STDA 3CCV3 1DMQA 1WMPA 3JVCA 4HM3B 2BHMA 4EV2A 5AYSC 3X42A 3OWUA 3SYUA 1VQ53 1JKGA 2WGOA 1ROVA 1HZ1A 1X1WA 1MGWA 2IYJA 1I0VA 1MOLA 4XBXA 3NBBA 4XM4A 3B4PA 1NWWA 4J9AA 4N6UA 1NDOB 3S67A 7GSPA 1U5OA 2PNCA 1BRJA 1LOVA 2BU4A 5EQLA 2XH9A 3DZLA 3N9HA 1RGEA 2XGLA 2P0XA 2WOFA 5TGNA 3SOYA 3LT8A 3NM7A 3CCU3 3E99A 3OV4A 4R1KA 3PYJA 1D6UA 3OW22 4HM7B 1IQYA 3OWSA 1W5ZA 3DH2A 1VQ83 5AIGA 4HM4B 4BL3A 4L7KA 3WA3A 1FGTA 1NB3I 5STDA 3LTAA 1RGAA 5CK6A 5AEUB 4WYKB 2XSOB 2C4BA 2PZVA 1OACA 1YVBI 1X1YA 3D9RA 1DETA 1JKGB 1FYSA 2YFLB 4AKZA 1PU4A 1I0XA 3ECFA 1E3RA 4GSPA 1BSCA 2H0IA 3Q2PA 1BNEA 3EX9A 4OK0A 4JF8A 3EBTA 3B7CA 2KF5A 1YJN3 3DGYA 1K28A 3F40A 4KT3B 2KAAA 3CPW2 3G713 1X1XA 3BNCA
chains in the Genus database with same CATH topology
2O9UX 3EN8A 1W6YA 4H61A 3NHXA 2Y73A 2BMRB 3CCL3 1QALA 4FMCA 1Q824 3MG1A 1M1XB 1BUQA 2XF3A 2F86B 3D3LA 2FXTA 3NBJA 4STDA 3MSOA 3QK9A 4H3UA 4RNZA 5EEOA 1VQ43 1HU9A 4Q53A 1FGRA 3BLZA 1IQ8A 1IV7A 1TUHA 1YGEA 1O7MB 1HKXA 3V92A 3EF8A 3CU3A 2A15A 2RGQA 1W2B2 3PZWA 3I553 3SVAA 1QVG2 3H3HA 4EC6A 2OQEC 1JNQA 1IK3A 2B1XB 2GBXB 3FGYA 1O7NB 1EKMA 1W01A 2ML5A 1LXEA 3CCS3 1DVDA 1DMNA 2FNQA 4HM5B 4MMZB 1AR0A 4FR9A 2V1LA 3M8CA 1OHOA 1A2KA 2LYXA 2KXGA 1FGQA 4O8SA 4K61A 3NV0A 3RGAA 3EQQB 2XSHB 2UX0A 3T0UA 1SIIA 3PS8A 1CYVA 1ZX2A 2P09A 4R80A 2C10A 2P05A 2XR8B 3H51A 5ELUA 3WODG 2CW9A 4XBTA 4GB5A 4R4KA 2ZDJA 3MPHA 4FMAA 4BTWA 4J8TA 4CCVA 4IPBA 4KFEA 3CCR3 4HJLB 1KWIA 3CD63 1OGZA 1WMOA 3G6E3 2Q07A 5FW5A 1UW1A 3FCSB 3OWYA 3N54B 3SXXA 1QVF2 3WDGB 4HZBB 2CHCA 4BTYA 2HMKB 1K8A4 4MMYB 3NQZA 1DVCA 3PCRA 3I563 1VQM3 3CC43 4X2OA 4KFDA 3SOAA 8CHOA 3NV0B 1KD14 1TU5A 4FCJA 4AKYA 3CNXA 4BTXA 2IMJA 3NXJA 5BXQA 5IG3A 2K54A 2E2UA 4X2HA 2CFDA 2OQEA 1STDA 2BNGA 4RNYA 3CCQ3 2CFWA 3HIGA 2CFGA 1GS3A 2BMOB 4U13A 2L4VA 2QGUA 4N6LA 3DMCA 4ZM8A 1OF5A 2YFIB 4IT7A 1VQ93 3J7Yd 3F9SA 4IIAA 1C7HA 1QAKA 1CEWI 2W04A 1JB5A 3NM2A 5G2GA 3T8UA 1CYUA 2M7OA 2P0MA 4N6NB 1IQXA 1S723 4WP5A 3FF2A 3I0YA 1AVLA 3G16A 3GZRA 3DY5A 1Q864 3F7SA 2RCDA 3VSYA 1RRLA 4N6V0 3G8ZA 3FSDA 1VQK3 3S29A 4LMIA 4CDLA 1STFI 1UUVB 2XFTA 1Q7Y4 1M9GA 2JQ5A 1OF5B 1UI8A 1O7GB 2XGNA 3S28A 3F8HA 1JB4A 2WO0A 1EA2A 1TIJA 3UL5A 1RRHA 1Z1SA 3F8XA 4R9KA 5DRVA 1IVWA 3BB9A 3KE7A 1EQKA 4LEHA 3CPOA 1A67A 2CKFB 4XBYA 3UB1A 2RFRA 3WOFB 1KC84 1N8R4 2XFSA 3DM8A 3OXAA 5IF6A 4LSOA 1K9M4 4KZ1A 1OH0A 2STDA 1O7WB 3UL6A 5LC7A 2HMMB 3LTDA 5IW9A 1M904 1NO3A 2C11A 1U8CB 4MEIA 2MC8A 1OGXA 3MG3A 2OOVA 1IV9A 2Y74A 3PGBA 2HMNB 3UNLA 4AEQA 1KQS2 3UJMA 1VQP3 4HM1B 2R4IA 1N9JA 2WOHA 1OUNA 3CCJ3 5EVHA 2QA43 1LNHA 4LGQA 1VQ63 1N9EA 3ER7A 1NB5I 3T8NA 4XB5A 2ML6A 1QMAA 2IUJA 3EHCA 1IT7A 1Y4KA 3DUKA 3FG4A 3HZPA 3GWRA 1ROAA 1F8NA 1MNLA 3K5TA 2CWUA 5AIFA 5LC6A 7STDA 5KP4A 3HIIA 3HX8A 1JB2A 2BT3A 4N6OB 3U97A 3EBYA 4NHFA 4EXRA 3K0ZA 2HMOB 1JV2B 3G0KA 3FLJA 3LTCA 1NJI4 1IVUA 5IERA 3JUMA 1OPYA 3IPTA 3FKAA 1WNHA 1A90A 1W2ZA 1QJGA 4FCZA 4HKVB 4ORLA 1DMMA 1LOXA 1NU3A 1FGMA 3X40A 5I97A 2D42A 3ROBA 2W56A 2Z77A 3FG3A 4WFOA 1VQN3 1TP6A 1OCVA 2QEX3 3OX9A 3LMLA 5AYRB 1D6ZA 5A0OB 4LZIA 3WOEB 3GZXB 1T5YA 5IENA 1FUWA 1JJ22 3CCM3 2GEYA 1AVKA 1GYBA 1S5AA 3EN1B 5IG5A 1N5HA 2SBLA 3S5CA 2CG1A 4OVMA 2W6JH 3FH1A 3KZTA 1W6GA 3EB8A 2CWTA 3DGMA 3DGLA 3SX1A 2CIUA 2W56B 4KFFA 3MWZA 2D1WA 3JUPA 2W0QA 1KSIA 4N6TA 1QAFA 3LH4A 3NUVA 4JRFA 5AI1A 1VQO3 3X3YA 1IVVA 3PCSA 3CME3 1WQLB 3G4S3 2KRTA 1GY5A 3S27A 1YIJ3 1SIHA 1GD4A 2Z76A 3QRDA 5IEPA 3N8BA 1N8QA 1D6YA 4FMBA 3NBRA 3FG1A 4NREA 1YJ93 2P38A 5JBSA 2OWPA 1PFPA 4KVHA 1TFOA 5ELJA 4K1VA 1W6CA 3KFQC 4XDWA 2IA7A 3V98A 2F99A 3BNDA 3LT9A 3WA2X 3IMAB 4WYKA 4FCMA 2W2CA 3IJEB 1US1A 1SPUA 1ZO2A 2OCTA 4O2HA 4PEJA 1YI23 4EYCA 3LTBA 3GZYB 3JUQA 3MG2A 3LXUX 5IG0A 4G1MB 1EG9B 3KSPA 5FGOA 1YIT3 4K1UA 2XRXB 2E2VA 3CNMA 3TDGA 1CQSA 2BMQB 4HZ9B 5AIHA 3DGNA 6STDA 3F7XA 5D81A 2OTJ3 3BNBA 2E2TA 5AEWB 2F98A 1IT8A 3X3ZA 1WMNA 1Q814 2GXFA 1ULIB 1IDPA 3JUNA 5JPPA 1GD3A 1W7CA 2W03A 2YFJB 3MHEA 5CLKA 2W9QA 4O3VA 3CXC2 1K41A 1G96A 3GAXA 3X3XA 1JRQA 2GU3A 2FGTA 3BNEA 4XDVA 3KSED 3DXOA 2W9PA 2QIYA 3EC9A 3O8YA 3LZAA 3SLUA 2GEXA 1OHSA 1W4NA 1A2VA 3MKIA 1WTHA 1O7PB 4MJDA 3DGOA 3MYTA 4RZMA 3X41A 2MF7A 1Q40A 1IVXA 5KP3A 3CMA3 2K0MA 1RKYA 3WMDA 4GL6A 1ULJB 3EJVA 1E3VA 4MMXB 5KP1A 1V74A 1VQL3 5AIIA 2CWVA 1FGOA 3GRDA 3HK4A 2LQVA 3RGRA 3KKGA 4L8OA 3Q90A 2GU1A 2JDIH 5IEOA 4QWTA 4EV5A 4WHAA 2CC3A 2WGQA 2CK3H 3L0RA 4HVNA 5D83A 3LOYA 2YX9A 2Z6BA 5BVBA 2BO9B 2RSXA 3EE1A 1SQWA 4I4KA 1GY7A 1OHPA 2CH9A 1W00A 1TFKA 1GY6A 3B8LA 4K90B 5D82A 5CF1A 1W02A 3Q1CA 5IG4A 4EBGA 2B24B 1Q40B 3JUOA 1K734 4FMDA 1O7HB 2I9WA 2KCDA 1FA3A 1ASKA 3NX0A 3V99A 3K9MC 4L8PA 4OUQA 5HGRA 5DREA 1SJWA 2XEPA 2HMLB 3HI7A 4WWUC 1JN5A 4TX4A 1LVNA 3VGNA 3LYGA 5CF2A 2GBWB 1R4CA 3AMOA 3FZWA 4HBRA 1J2BA 4HYZA 3CC73 2IUKA 4HM8B 2ZL8A 4HM2B 1YHQ3 1RN7A 1IU7A 2O3OA 1RJOA 3ALAA 1M1K4 1VQ73 2OTL3 3K63A 1VZZA 2INXA 1YJW3 3GZBA 2CG0A 3A76A 3K7CA 4N6MA 2CFKA 4N3VA 3B4OA 3CC23 1UUWB 3KN4A 1E97A 2HMJB 3F14A 3FF0A 5JPUA 1N5PA 3VF1A 1AV4A 4HM0B 3NQYA 1JN5B 1DYUA 3PXMA 3KIIA 5CXOA 1Q42A 4O02B 1UI7A 2CFLA 3AMOB 4R9LA 1ISKA 4RBNA 1L5GB 3U1WA 4HM6B 3RDEA 3SEDA 3CCE3 2OOVC 2Z7AA 3STDA 3CCV3 1DMQA 1WMPA 3JVCA 4HM3B 2BHMA 4EV2A 5AYSC 3X42A 3OWUA 1VQ53 1JKGA 2WGOA 1ROVA 1MOLA 4XBXA 3NBBA 4XM4A 3B4PA 1NWWA 4J9AA 4N6UA 1NDOB 3S67A 1U5OA 2PNCA 5EQLA 2XH9A 3DZLA 3N9HA 2XGLA 2P0XA 2WOFA 5TGNA 3SOYA 3LT8A 3NM7A 3CCU3 3E99A 3OV4A 4R1KA 3PYJA 1D6UA 3OW22 4HM7B 1IQYA 3OWSA 1W5ZA 1VQ83 5AIGA 4HM4B 4L7KA 3WA3A 1FGTA 1NB3I 5STDA 3LTAA 5CK6A 5AEUB 4WYKB 2XSOB 2PZVA 1OACA 1YVBI 3D9RA 1JKGB 2YFLB 4AKZA 1PU4A 3ECFA 1E3RA 3Q2PA 3EX9A 4OK0A 4JF8A 3EBTA 3B7CA 1YJN3 1K28A 3F40A 3CPW2 3G713 3BNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN8 A;  1W6Y A;  3NHX A;  2BMR B;  3MG1 A;  1BUQ A;  2F86 B;  4STD A;  3MSO A;  4H3U A;  4Q53 A;  3BLZ A;  1TUH A;  1O7M B;  1HKX A;  3EF8 A;  3CU3 A;  2A15 A;  2RGQ A;  3H3H A;  2B1X B;  2GBX B;  3FGY A;  1O7N B;  1W01 A;  1DMN A;  4HM5 B;  1AR0 A;  3M8C A;  1OHO A;  1A2K A;  3NV0 A;  3RGA A;  3EQQ B;  2XSH B;  2UX0 A;  1ZX2 A;  2XR8 B;  3H51 A;  4XBT A;  4GB5 A;  4J8T A;  4HJL B;  1OGZ A;  5FW5 A;  3OWY A;  4HZB B;  2CHC A;  2HMK B;  4X2O A;  3SOA A;  8CHO A;  3NV0 B;  4FCJ A;  3CNX A;  5BXQ A;  2IMJ A;  3NXJ A;  5IG3 A;  2K54 A;  4X2H A;  1STD A;  2BNG A;  4U13 A;  1GS3 A;  2BMO B;  2QGU A;  3DMC A;  1OF5 A;  2YFI B;  3F9S A;  4IIA A;  1C7H A;  5G2G A;  1JB5 A;  3NM2 A;  3T8U A;  4WP5 A;  3FF2 A;  3I0Y A;  3G16 A;  3GZR A;  3F7S A;  2RCD A;  3VSY A;  3G8Z A;  3FSD A;  4LMI A;  4CDL A;  1UUV B;  2JQ5 A;  1OF5 B;  1O7G B;  3F8H A;  1JB4 A;  1EA2 A;  1Z1S A;  3F8X A;  4R9K A;  5DRV A;  3BB9 A;  3KE7 A;  4LEH A;  3CPO A;  2CKF B;  4XBY A;  2RFR A;  3DM8 A;  5IF6 A;  3OXA A;  1OH0 A;  2STD A;  1O7W B;  2HMM B;  1OGX A;  3MG3 A;  2HMN B;  3UNL A;  3UJM A;  4HM1 B;  2R4I A;  1OUN A;  5EVH A;  4LGQ A;  3ER7 A;  3T8N A;  4XB5 A;  1QMA A;  3EHC A;  3DUK A;  3HZP A;  3GWR A;  5AIF A;  7STD A;  5KP4 A;  3HX8 A;  1JB2 A;  3EBY A;  3K0Z A;  2HMO B;  3G0K A;  3FLJ A;  5IER A;  3JUM A;  1OPY A;  3IPT A;  3FKA A;  4HKV B;  1QJG A;  4ORL A;  1DMM A;  1NU3 A;  3ROB A;  2Z77 A;  1TP6 A;  1OCV A;  3OX9 A;  3GZX B;  5IEN A;  2GEY A;  1GYB A;  1S5A A;  3EN1 B;  5IG5 A;  3S5C A;  4OVM A;  3FH1 A;  3KZT A;  3JUP A;  3NUV A;  5AI1 A;  1WQL B;  1GY5 A;  2Z76 A;  5IEP A;  3NBR A;  2OWP A;  4KVH A;  4K1V A;  4XDW A;  2F99 A;  4WYK A;  4FCM A;  2W2C A;  4PEJ A;  1ZO2 A;  3GZY B;  3JUQ A;  3MG2 A;  5IG0 A;  1EG9 B;  3KSP A;  4K1U A;  2XRX B;  3CNM A;  1CQS A;  2BMQ B;  4HZ9 B;  5AIH A;  6STD A;  3F7X A;  5D81 A;  5AEW B;  2F98 A;  2GXF A;  1ULI B;  1IDP A;  3JUN A;  5JPP A;  2YFJ B;  3MHE A;  5CLK A;  1K41 A;  4XDV A;  3DXO A;  2QIY A;  3EC9 A;  3LZA A;  2GEX A;  1OHS A;  3MKI A;  1O7P B;  4MJD A;  3MYT A;  4RZM A;  1Q40 A;  5KP3 A;  3WMD A;  1ULJ B;  3EJV A;  1E3V A;  5KP1 A;  5AII A;  3GRD A;  3HK4 A;  3RGR A;  3KKG A;  4L8O A;  3Q90 A;  5IEO A;  4HVN A;  5D83 A;  5BVB A;  4I4K A;  1GY7 A;  1OHP A;  1W00 A;  1GY6 A;  3B8L A;  5D82 A;  5CF1 A;  1W02 A;  5IG4 A;  2B24 B;  1Q40 B;  3JUO A;  1O7H B;  2I9W A;  1ASK A;  4L8P A;  4OUQ A;  5HGR A;  5DRE A;  1SJW A;  2HML B;  4WWU C;  1JN5 A;  3VGN A;  3LYG A;  5CF2 A;  2GBW B;  3FZW A;  4HM8 B;  4HM2 B;  1VZZ A;  2INX A;  3GZB A;  3A76 A;  3K7C A;  4N3V A;  3B4O A;  1UUW B;  1E97 A;  2HMJ B;  3F14 A;  3FF0 A;  5JPU A;  4HM0 B;  1JN5 B;  5CXO A;  1Q42 A;  4R9L A;  1ISK A;  4HM6 B;  3SED A;  2Z7A A;  3STD A;  1DMQ A;  4HM3 B;  3OWU A;  1JKG A;  4XBX A;  4XM4 A;  3B4P A;  1NWW A;  4J9A A;  1NDO B;  1U5O A;  3DZL A;  3SOY A;  5TGN A;  3E99 A;  3OV4 A;  4R1K A;  4HM7 B;  3OWS A;  5AIG A;  4HM4 B;  4L7K A;  5STD A;  5CK6 A;  5AEU B;  4WYK B;  2XSO B;  2PZV A;  3D9R A;  1JKG B;  2YFL B;  3ECF A;  1E3R A;  3EX9 A;  3EBT A;  3B7C A;  3F40 A; 
#chains in the Genus database with same CATH topology
 1RN1 A;  2O9U X;  3EN8 A;  1W6Y A;  4H61 A;  3NHX A;  2Y73 A;  2BMR B;  3CCL 3;  1QAL A;  4FMC A;  5M1A A;  3MG1 A;  1TRP A;  1Q82 4;  1M1X B;  1BUQ A;  2XF3 A;  2F86 B;  3D3L A;  1RLS A;  2FXT A;  3NBJ A;  4STD A;  3MSO A;  3QK9 A;  4H3U A;  4RNZ A;  5EEO A;  1VQ4 3;  1HU9 A;  4Q53 A;  1BRS A;  1FGR A;  3BLZ A;  1IQ8 A;  1IV7 A;  1I2F A;  1TUH A;  1YGE A;  1O7M B;  1HKX A;  2GSP A;  3V92 A;  3EF8 A;  3CU3 A;  2A15 A;  2RGQ A;  1IYY A;  1W2B 2;  3PZW A;  3I55 3;  3SVA A;  1QVG 2;  1G0T A;  3H3H A;  4EC6 A;  2OQE C;  1JNQ A;  1MWU A;  1UCL A;  1IK3 A;  2B1X B;  2GBX B;  3FGY A;  1O7N B;  1EKM A;  1RNT A;  1W01 A;  2ML5 A;  1LXE A;  3CCS 3;  1DVD A;  1MWR A;  1DMN A;  3AHW A;  2FNQ A;  4HM5 B;  2KF4 A;  4MMZ B;  1AR0 A;  4FR9 A;  2V1L A;  3M8C A;  1OHO A;  1A2K A;  2LYX A;  2KXG A;  1FGQ A;  4O8S A;  2R41 A;  4K61 A;  3NV0 A;  3RGA A;  3EQQ B;  2XSH B;  2UGI A;  2UX0 A;  3T0U A;  1SII A;  3PS8 A;  1VQQ A;  1CYV A;  1B2S A;  1ZX2 A;  2P09 A;  4R80 A;  2C10 A;  2P05 A;  2XR8 B;  1BNF A;  1UGI A;  3H51 A;  5ELU A;  3WOD G;  2CW9 A;  4XBT A;  1GSP A;  1PY3 A;  4GB5 A;  1DE3 A;  4R4K A;  2ZDJ A;  3MPH A;  4FMA A;  4BTW A;  4J8T A;  1TTO A;  4IPB A;  4KFE A;  4CCV A;  3CCR 3;  4HJL B;  1KWI A;  1LQG C;  3CD6 3;  1OGZ A;  1WMO A;  3G6E 3;  2Q07 A;  5FW5 A;  1UW1 A;  3FCS B;  2RNT A;  3OWY A;  3N54 B;  3Q3F A;  3SXX A;  1QVF 2;  3WDG B;  1B2Z A;  2CHC A;  1GMP A;  2HMK B;  1RCK A;  4HZB B;  4BTY A;  1K8A 4;  4MMY B;  3NQZ A;  1DVC A;  3PCR A;  3I56 3;  1VQM 3;  3CC4 3;  3ZG5 A;  4X2O A;  1GMQ A;  4KFD A;  3SOA A;  8CHO A;  3NV0 B;  1KD1 4;  1TU5 A;  4FCJ A;  4AKY A;  3CNX A;  4BTX A;  2IMJ A;  3NXJ A;  5BXQ A;  5IG3 A;  2K54 A;  1B2X A;  1G02 A;  2E2U A;  4X2H A;  2CFD A;  2OQE A;  1STD A;  2BNG A;  1B2U A;  4RNY A;  3CCQ 3;  2CFW A;  3HIG A;  2CFG A;  1GS3 A;  1UCJ A;  2BMO B;  4U13 A;  1B2M A;  2L4V A;  2QGU A;  4N6L A;  3DMC A;  4ZM8 A;  1C54 A;  1OF5 A;  2YFI B;  1BSE A;  4IT7 A;  3AGN A;  1VQ9 3;  3J7Y d;  3F9S A;  1AQZ A;  4IIA A;  1C7H A;  1QAK A;  1CEW I;  2W04 A;  1JB5 A;  3NM2 A;  5G2G A;  3T8U A;  1CYU A;  2M7O A;  4BIR A;  2P0M A;  4N6N B;  1IQX A;  1S72 3;  1RNB A;  2ZHX B;  4WP5 A;  3FF2 A;  1GOY A;  1I2E A;  3I0Y A;  1AVL A;  3G16 A;  3GZR A;  3DY5 A;  1BNI A;  1RGF A;  1T3B A;  1Q86 4;  3F7S A;  2RCD A;  4NPB A;  3VSY A;  1RRL A;  4N6V 0;  3G8Z A;  3FSD A;  1VQK 3;  3S29 A;  4LMI A;  4CDL A;  1STF I;  1UUV B;  2XFT A;  1Q7Y 4;  1BRN L;  1M9G A;  2JQ5 A;  1OF5 B;  1UI8 A;  1O7G B;  2XGN A;  3S28 A;  3F8H A;  1JB4 A;  2WO0 A;  2J8X B;  1EA2 A;  1TIJ A;  3UL5 A;  1RRH A;  2AAD A;  1I8V A;  1FUT A;  1Z1S A;  2BIR A;  2K3D A;  3F8X A;  4R9K A;  5DRV A;  1IVW A;  3BB9 A;  1X1U A;  1BOX A;  3KE7 A;  1EQK A;  4LEH A;  3CPO A;  1A67 A;  2CKF B;  4XBY A;  3UB1 A;  2RFR A;  3WOF B;  1KC8 4;  6RNT A;  1N8R 4;  2XFS A;  3AGO A;  3DM8 A;  3OXA A;  4LSO A;  5IF6 A;  1K9M 4;  4KZ1 A;  1OH0 A;  2STD A;  4CJN A;  1LOY A;  1O7W B;  2KF6 A;  1RHL A;  1V58 A;  3UL6 A;  5LC7 A;  2HMM B;  3LTD A;  5IW9 A;  1M90 4;  1BUJ A;  1NO3 A;  2C11 A;  1JZO A;  1U8C B;  4MEI A;  2MC8 A;  1OGX A;  3MG3 A;  2OOV A;  1IV9 A;  3KCH A;  2Y74 A;  3PGB A;  2HMN B;  3UNL A;  4AEQ A;  1KQS 2;  3UJM A;  1RCL A;  1BRI A;  1JZD A;  2H0H A;  1VQP 3;  4HM1 B;  1EUI C;  1N9J A;  2R4I A;  1OUN A;  2WOH A;  3CCJ 3;  5EVH A;  1BNS A;  2QA4 3;  1B20 A;  1LNH A;  4LGQ A;  3D5G A;  1VQ6 3;  1N9E A;  3ER7 A;  1NB5 I;  3T8N A;  4XB5 A;  2ML6 A;  1QMA A;  2IUJ A;  1B3S A;  1UCK A;  3D5I A;  1IT7 A;  3EHC A;  1Y4K A;  4CPK A;  3DUK A;  2UUG C;  1BAN A;  3FG4 A;  3HZP A;  3GWR A;  1ROA A;  2HOH A;  1F8N A;  1MNL A;  1YGW A;  2F5M A;  3K5T A;  2CWU A;  5AIF A;  5LC6 A;  7STD A;  5KP4 A;  3HII A;  3HX8 A;  1JB2 A;  2BT3 A;  4N6O B;  3U97 A;  3EBY A;  4NHF A;  4EXR A;  3K0Z A;  2HMO B;  1JV2 B;  3G0K A;  3FLJ A;  3LTC A;  4HOH A;  1NJI 4;  1IVU A;  5IER A;  3A5E A;  3JUM A;  3BU4 A;  4LYL B;  1OPY A;  1T2H A;  3IPT A;  3D79 A;  3FKA A;  1WNH A;  1A90 A;  2H0G A;  1W2Z A;  1QJG A;  1RTU A;  4FCZ A;  4HKV B;  4ORL A;  5G1L A;  2CX1 A;  1DMM A;  1LOX A;  1NU3 A;  1FGM A;  1B21 A;  3X40 A;  5I97 A;  2D42 A;  3ROB A;  2W56 A;  2Z77 A;  3FG3 A;  4WFO A;  1VQN 3;  1TP6 A;  4GHO A;  2F56 A;  1OCV A;  2QEX 3;  3OX9 A;  3LML A;  1BSD A;  5AYR B;  1D6Z A;  3RNT A;  5RNT A;  5A0O B;  4LZI A;  3WOE B;  3GZX B;  3AHS A;  3HOH A;  1T5Y A;  5IEN A;  1FUW A;  1JJ2 2;  3CCM 3;  2GEY A;  3URP A;  1AVK A;  1GYB A;  1RSN A;  1ZGX A;  1S5A A;  3EN1 B;  3ZFZ A;  1N5H A;  5IG5 A;  1BGS A;  2SBL A;  1MWT A;  3S5C A;  1I3I A;  2CG1 A;  4OVM A;  2W6J H;  3FH1 A;  3KZT A;  1W6G A;  3EB8 A;  1TRQ A;  2CWT A;  3DGM A;  3DGL A;  3SX1 A;  2CIU A;  1CH0 A;  2W56 B;  2ZA4 A;  4KFF A;  3MWZ A;  2D1W A;  3JUP A;  2W0Q A;  1KSI A;  4N6T A;  1QAF A;  1A2P A;  3LH4 A;  3NUV A;  4JRF A;  1BAO A;  5AI1 A;  1VQO 3;  3X3Y A;  1IVV A;  3PCS A;  3CME 3;  1WQL B;  1UDI I;  2KRT A;  1GY5 A;  4J5K A;  3S27 A;  3G4S 3;  1SIH A;  1YIJ 3;  1BU4 A;  1BIR A;  1GD4 A;  2Z76 A;  3QRD A;  5IEP A;  3N8B A;  2KF3 A;  1GOV A;  1N8Q A;  1D6Y A;  4FMB A;  3NBR A;  3FG1 A;  4NRE A;  1YJ9 3;  2P38 A;  4RNT A;  5JBS A;  2OWP A;  4ILF A;  1BNG A;  1PFP A;  4KVH A;  1UGH I;  1LRA A;  1TFO A;  5ELJ A;  4K1V A;  5GSP A;  1W6C A;  3KFQ C;  4XDW A;  2IA7 A;  3V98 A;  2L1S A;  2F99 A;  3BND A;  3LT9 A;  2IY2 A;  3WA2 X;  3IMA B;  1GMR A;  1T2I A;  4WYK A;  4FCM A;  2W2C A;  3IJE B;  1US1 A;  1SPU A;  1ZO2 A;  2OCT A;  4O2H A;  4PEJ A;  1YI2 3;  1JBR A;  1BNR A;  4EYC A;  3LTB A;  3GZY B;  3JUQ A;  1RN4 A;  3MG2 A;  3LXU X;  5IG0 A;  4G1M B;  1EG9 B;  3KSP A;  5FGO A;  1YIT 3;  9RNT A;  4K1U A;  2XRX B;  2E2V A;  3CNM A;  3TDG A;  1CQS A;  2BMQ B;  4HZ9 B;  5AIH A;  3DGN A;  6STD A;  2RBI A;  3F7X A;  5D81 A;  2OTJ 3;  3BNB A;  2E2T A;  7RNT A;  5AEW B;  2F98 A;  1IT8 A;  4BL2 A;  3X3Z A;  1WMN A;  1Q81 4;  2GXF A;  1ULI B;  1IDP A;  1TJD A;  3JUN A;  1I2G A;  5JPP A;  1GD3 A;  1RDS A;  1W7C A;  2W03 A;  2YFJ B;  3MHE A;  5CLK A;  2W9Q A;  4O3V A;  3WR2 A;  1FUS A;  3CXC 2;  1K41 A;  1G96 A;  3GAX A;  3X3X A;  3D4A A;  1JRQ A;  2GU3 A;  2FGT A;  3BNE A;  4XDV A;  3KSE D;  3DXO A;  1RGK A;  1MWS A;  2W9P A;  2QIY A;  3EC9 A;  3O8Y A;  3LZA A;  3SLU A;  2GEX A;  1OHS A;  2AAE A;  1Q9E A;  1W4N A;  1A2V A;  3MKI A;  1WTH A;  1O7P B;  4MJD A;  3DGO A;  3MYT A;  4RZM A;  3X41 A;  1NNV A;  8RNT A;  2MF7 A;  1FZU A;  1RGL A;  1Q40 A;  1IVX A;  2SAR A;  1B27 A;  5KP3 A;  1UCI A;  3CMA 3;  2K0M A;  1RKY A;  2F4Y A;  4BU4 A;  3WMD A;  4GL6 A;  1BVI A;  1ULJ B;  3EJV A;  1E3V A;  4MMX B;  5KP1 A;  1V74 A;  1VQL 3;  5AII A;  2CWV A;  1FGO A;  3GRD A;  3HK4 A;  2LQV A;  3RGR A;  1RMS A;  3KKG A;  1EEJ A;  3Q90 A;  4L8O A;  1BRG A;  2GU1 A;  2JDI H;  4QWT A;  5IEO A;  1UUG B;  4EV5 A;  4WHA A;  2CC3 A;  2WGQ A;  1BRK A;  2CK3 H;  3L0R A;  4HVN A;  1RGC A;  5D83 A;  5G1K A;  3LOY A;  2YX9 A;  2Z6B A;  5BVB A;  3BIR A;  2BO9 B;  2RSX A;  3EE1 A;  1SQW A;  4I4K A;  1GY7 A;  1OHP A;  1I70 A;  1R4Y A;  2CH9 A;  1W00 A;  1TFK A;  1GY6 A;  1V57 A;  3B8L A;  4K90 B;  5D82 A;  1W02 A;  5CF1 A;  1FW7 A;  1JBT A;  3Q1C A;  5BIR A;  1BSA A;  5IG4 A;  1AY7 A;  4EBG A;  2B24 B;  1Q40 B;  1RGH A;  3JUO A;  1JBS A;  1K73 4;  3GSP A;  1RGG A;  4FMD A;  4I5Q A;  1O7H B;  1BRH A;  2CX0 A;  1HYF A;  2I9W A;  2KCD A;  3ZG0 A;  4DKI A;  1FA3 A;  1ASK A;  3NX0 A;  3V99 A;  1LNI A;  1YVS A;  1SAR A;  3K9M C;  4L8P A;  4OUQ A;  5HGR A;  3WHO A;  5DRE A;  4HAA A;  1SJW A;  2XEP A;  2HML B;  5HOH A;  3HI7 A;  4WWU C;  1BSB A;  1JN5 A;  4TX4 A;  1LVN A;  3VGN A;  1I3F A;  3LYG A;  5CF2 A;  2GBW B;  1R4C A;  3AMO A;  3FZW A;  4HBR A;  1J2B A;  4HYZ A;  1GOU A;  3CC7 3;  2IUK A;  4HM8 B;  2ZL8 A;  1Q7H A;  4HM2 B;  1YHQ 3;  1RN7 A;  1IU7 A;  2O3O A;  1RJO A;  3ALA A;  1M1K 4;  1VQ7 3;  6GSP A;  2OTL 3;  3K63 A;  1VZZ A;  2INX A;  1LQM B;  1YJW 3;  1LOW A;  3GZB A;  1BNJ A;  2CG0 A;  3A76 A;  3K7C A;  4J5G A;  4N6M A;  2CFK A;  4N3V A;  5BU4 A;  3B4O A;  3CC2 3;  1UUW B;  3KN4 A;  1E97 A;  2HMJ B;  3F14 A;  1MGR A;  3FF0 A;  5JPU A;  1N5P A;  3VF1 A;  1AV4 A;  5M18 A;  4HM0 B;  3NQY A;  1JN5 B;  1DYU A;  3PXM A;  3KII A;  5CXO A;  1ZS7 A;  1Q42 A;  1YNV X;  4O02 B;  1UI7 A;  2CFL A;  3AMO B;  4R9L A;  1ISK A;  4RBN A;  1PYL A;  2F5W A;  1L5G B;  5M19 A;  3U1W A;  4HM6 B;  4EW5 A;  3RDE A;  3SED A;  3CCE 3;  2OOV C;  2Z7A A;  3STD A;  3CCV 3;  1DMQ A;  1WMP A;  3JVC A;  4HM3 B;  2BHM A;  4EV2 A;  5AYS C;  3X42 A;  3OWU A;  3SYU A;  1VQ5 3;  1JKG A;  2WGO A;  1ROV A;  1HZ1 A;  1X1W A;  1MGW A;  2IYJ A;  1I0V A;  1MOL A;  4XBX A;  3NBB A;  4XM4 A;  3B4P A;  1NWW A;  4J9A A;  4N6U A;  1NDO B;  3S67 A;  7GSP A;  1U5O A;  2PNC A;  1BRJ A;  1LOV A;  2BU4 A;  5EQL A;  2XH9 A;  3DZL A;  3N9H A;  1RGE A;  2XGL A;  2P0X A;  2WOF A;  5TGN A;  3SOY A;  3LT8 A;  3NM7 A;  3CCU 3;  3E99 A;  3OV4 A;  4R1K A;  3PYJ A;  1D6U A;  3OW2 2;  4HM7 B;  1IQY A;  3OWS A;  1W5Z A;  3DH2 A;  1VQ8 3;  5AIG A;  4HM4 B;  4BL3 A;  4L7K A;  3WA3 A;  1FGT A;  1NB3 I;  5STD A;  3LTA A;  1RGA A;  5CK6 A;  5AEU B;  4WYK B;  2XSO B;  2C4B A;  2PZV A;  1OAC A;  1YVB I;  1X1Y A;  3D9R A;  1DET A;  1JKG B;  1FYS A;  2YFL B;  4AKZ A;  1PU4 A;  1I0X A;  3ECF A;  1E3R A;  4GSP A;  1BSC A;  2H0I A;  3Q2P A;  1BNE A;  3EX9 A;  4OK0 A;  4JF8 A;  3EBT A;  3B7C A;  2KF5 A;  1YJN 3;  3DGY A;  1K28 A;  3F40 A;  4KT3 B;  2KAA A;  3CPW 2;  3G71 3;  1X1X A;  3BNC A; 
#chains in the Genus database with same CATH homology
 2O9U X;  3EN8 A;  1W6Y A;  4H61 A;  3NHX A;  2Y73 A;  2BMR B;  3CCL 3;  1QAL A;  4FMC A;  1Q82 4;  3MG1 A;  1M1X B;  1BUQ A;  2XF3 A;  2F86 B;  3D3L A;  2FXT A;  3NBJ A;  4STD A;  3MSO A;  3QK9 A;  4H3U A;  4RNZ A;  5EEO A;  1VQ4 3;  1HU9 A;  4Q53 A;  1FGR A;  3BLZ A;  1IQ8 A;  1IV7 A;  1TUH A;  1YGE A;  1O7M B;  1HKX A;  3V92 A;  3EF8 A;  3CU3 A;  2A15 A;  2RGQ A;  1W2B 2;  3PZW A;  3I55 3;  3SVA A;  1QVG 2;  3H3H A;  4EC6 A;  2OQE C;  1JNQ A;  1IK3 A;  2B1X B;  2GBX B;  3FGY A;  1O7N B;  1EKM A;  1W01 A;  2ML5 A;  1LXE A;  3CCS 3;  1DVD A;  1DMN A;  2FNQ A;  4HM5 B;  4MMZ B;  1AR0 A;  4FR9 A;  2V1L A;  3M8C A;  1OHO A;  1A2K A;  2LYX A;  2KXG A;  1FGQ A;  4O8S A;  4K61 A;  3NV0 A;  3RGA A;  3EQQ B;  2XSH B;  2UX0 A;  3T0U A;  1SII A;  3PS8 A;  1CYV A;  1ZX2 A;  2P09 A;  4R80 A;  2C10 A;  2P05 A;  2XR8 B;  3H51 A;  5ELU A;  3WOD G;  2CW9 A;  4XBT A;  4GB5 A;  4R4K A;  2ZDJ A;  3MPH A;  4FMA A;  4BTW A;  4J8T A;  4CCV A;  4IPB A;  4KFE A;  3CCR 3;  4HJL B;  1KWI A;  3CD6 3;  1OGZ A;  1WMO A;  3G6E 3;  2Q07 A;  5FW5 A;  1UW1 A;  3FCS B;  3OWY A;  3N54 B;  3SXX A;  1QVF 2;  3WDG B;  4HZB B;  2CHC A;  4BTY A;  2HMK B;  1K8A 4;  4MMY B;  3NQZ A;  1DVC A;  3PCR A;  3I56 3;  1VQM 3;  3CC4 3;  4X2O A;  4KFD A;  3SOA A;  8CHO A;  3NV0 B;  1KD1 4;  1TU5 A;  4FCJ A;  4AKY A;  3CNX A;  4BTX A;  2IMJ A;  3NXJ A;  5BXQ A;  5IG3 A;  2K54 A;  2E2U A;  4X2H A;  2CFD A;  2OQE A;  1STD A;  2BNG A;  4RNY A;  3CCQ 3;  2CFW A;  3HIG A;  2CFG A;  1GS3 A;  2BMO B;  4U13 A;  2L4V A;  2QGU A;  4N6L A;  3DMC A;  4ZM8 A;  1OF5 A;  2YFI B;  4IT7 A;  1VQ9 3;  3J7Y d;  3F9S A;  4IIA A;  1C7H A;  1QAK A;  1CEW I;  2W04 A;  1JB5 A;  3NM2 A;  5G2G A;  3T8U A;  1CYU A;  2M7O A;  2P0M A;  4N6N B;  1IQX A;  1S72 3;  4WP5 A;  3FF2 A;  3I0Y A;  1AVL A;  3G16 A;  3GZR A;  3DY5 A;  1Q86 4;  3F7S A;  2RCD A;  3VSY A;  1RRL A;  4N6V 0;  3G8Z A;  3FSD A;  1VQK 3;  3S29 A;  4LMI A;  4CDL A;  1STF I;  1UUV B;  2XFT A;  1Q7Y 4;  1M9G A;  2JQ5 A;  1OF5 B;  1UI8 A;  1O7G B;  2XGN A;  3S28 A;  3F8H A;  1JB4 A;  2WO0 A;  1EA2 A;  1TIJ A;  3UL5 A;  1RRH A;  1Z1S A;  3F8X A;  4R9K A;  5DRV A;  1IVW A;  3BB9 A;  3KE7 A;  1EQK A;  4LEH A;  3CPO A;  1A67 A;  2CKF B;  4XBY A;  3UB1 A;  2RFR A;  3WOF B;  1KC8 4;  1N8R 4;  2XFS A;  3DM8 A;  3OXA A;  5IF6 A;  4LSO A;  1K9M 4;  4KZ1 A;  1OH0 A;  2STD A;  1O7W B;  3UL6 A;  5LC7 A;  2HMM B;  3LTD A;  5IW9 A;  1M90 4;  1NO3 A;  2C11 A;  1U8C B;  4MEI A;  2MC8 A;  1OGX A;  3MG3 A;  2OOV A;  1IV9 A;  2Y74 A;  3PGB A;  2HMN B;  3UNL A;  4AEQ A;  1KQS 2;  3UJM A;  1VQP 3;  4HM1 B;  2R4I A;  1N9J A;  2WOH A;  1OUN A;  3CCJ 3;  5EVH A;  2QA4 3;  1LNH A;  4LGQ A;  1VQ6 3;  1N9E A;  3ER7 A;  1NB5 I;  3T8N A;  4XB5 A;  2ML6 A;  1QMA A;  2IUJ A;  3EHC A;  1IT7 A;  1Y4K A;  3DUK A;  3FG4 A;  3HZP A;  3GWR A;  1ROA A;  1F8N A;  1MNL A;  3K5T A;  2CWU A;  5AIF A;  5LC6 A;  7STD A;  5KP4 A;  3HII A;  3HX8 A;  1JB2 A;  2BT3 A;  4N6O B;  3U97 A;  3EBY A;  4NHF A;  4EXR A;  3K0Z A;  2HMO B;  1JV2 B;  3G0K A;  3FLJ A;  3LTC A;  1NJI 4;  1IVU A;  5IER A;  3JUM A;  1OPY A;  3IPT A;  3FKA A;  1WNH A;  1A90 A;  1W2Z A;  1QJG A;  4FCZ A;  4HKV B;  4ORL A;  1DMM A;  1LOX A;  1NU3 A;  1FGM A;  3X40 A;  5I97 A;  2D42 A;  3ROB A;  2W56 A;  2Z77 A;  3FG3 A;  4WFO A;  1VQN 3;  1TP6 A;  1OCV A;  2QEX 3;  3OX9 A;  3LML A;  5AYR B;  1D6Z A;  5A0O B;  4LZI A;  3WOE B;  3GZX B;  1T5Y A;  5IEN A;  1FUW A;  1JJ2 2;  3CCM 3;  2GEY A;  1AVK A;  1GYB A;  1S5A A;  3EN1 B;  5IG5 A;  1N5H A;  2SBL A;  3S5C A;  2CG1 A;  4OVM A;  2W6J H;  3FH1 A;  3KZT A;  1W6G A;  3EB8 A;  2CWT A;  3DGM A;  3DGL A;  3SX1 A;  2CIU A;  2W56 B;  4KFF A;  3MWZ A;  2D1W A;  3JUP A;  2W0Q A;  1KSI A;  4N6T A;  1QAF A;  3LH4 A;  3NUV A;  4JRF A;  5AI1 A;  1VQO 3;  3X3Y A;  1IVV A;  3PCS A;  3CME 3;  1WQL B;  3G4S 3;  2KRT A;  1GY5 A;  3S27 A;  1YIJ 3;  1SIH A;  1GD4 A;  2Z76 A;  3QRD A;  5IEP A;  3N8B A;  1N8Q A;  1D6Y A;  4FMB A;  3NBR A;  3FG1 A;  4NRE A;  1YJ9 3;  2P38 A;  5JBS A;  2OWP A;  1PFP A;  4KVH A;  1TFO A;  5ELJ A;  4K1V A;  1W6C A;  3KFQ C;  4XDW A;  2IA7 A;  3V98 A;  2F99 A;  3BND A;  3LT9 A;  3WA2 X;  3IMA B;  4WYK A;  4FCM A;  2W2C A;  3IJE B;  1US1 A;  1SPU A;  1ZO2 A;  2OCT A;  4O2H A;  4PEJ A;  1YI2 3;  4EYC A;  3LTB A;  3GZY B;  3JUQ A;  3MG2 A;  3LXU X;  5IG0 A;  4G1M B;  1EG9 B;  3KSP A;  5FGO A;  1YIT 3;  4K1U A;  2XRX B;  2E2V A;  3CNM A;  3TDG A;  1CQS A;  2BMQ B;  4HZ9 B;  5AIH A;  3DGN A;  6STD A;  3F7X A;  5D81 A;  2OTJ 3;  3BNB A;  2E2T A;  5AEW B;  2F98 A;  1IT8 A;  3X3Z A;  1WMN A;  1Q81 4;  2GXF A;  1ULI B;  1IDP A;  3JUN A;  5JPP A;  1GD3 A;  1W7C A;  2W03 A;  2YFJ B;  3MHE A;  5CLK A;  2W9Q A;  4O3V A;  3CXC 2;  1K41 A;  1G96 A;  3GAX A;  3X3X A;  1JRQ A;  2GU3 A;  2FGT A;  3BNE A;  4XDV A;  3KSE D;  3DXO A;  2W9P A;  2QIY A;  3EC9 A;  3O8Y A;  3LZA A;  3SLU A;  2GEX A;  1OHS A;  1W4N A;  1A2V A;  3MKI A;  1WTH A;  1O7P B;  4MJD A;  3DGO A;  3MYT A;  4RZM A;  3X41 A;  2MF7 A;  1Q40 A;  1IVX A;  5KP3 A;  3CMA 3;  2K0M A;  1RKY A;  3WMD A;  4GL6 A;  1ULJ B;  3EJV A;  1E3V A;  4MMX B;  5KP1 A;  1V74 A;  1VQL 3;  5AII A;  2CWV A;  1FGO A;  3GRD A;  3HK4 A;  2LQV A;  3RGR A;  3KKG A;  4L8O A;  3Q90 A;  2GU1 A;  2JDI H;  5IEO A;  4QWT A;  4EV5 A;  4WHA A;  2CC3 A;  2WGQ A;  2CK3 H;  3L0R A;  4HVN A;  5D83 A;  3LOY A;  2YX9 A;  2Z6B A;  5BVB A;  2BO9 B;  2RSX A;  3EE1 A;  1SQW A;  4I4K A;  1GY7 A;  1OHP A;  2CH9 A;  1W00 A;  1TFK A;  1GY6 A;  3B8L A;  4K90 B;  5D82 A;  5CF1 A;  1W02 A;  3Q1C A;  5IG4 A;  4EBG A;  2B24 B;  1Q40 B;  3JUO A;  1K73 4;  4FMD A;  1O7H B;  2I9W A;  2KCD A;  1FA3 A;  1ASK A;  3NX0 A;  3V99 A;  3K9M C;  4L8P A;  4OUQ A;  5HGR A;  5DRE A;  1SJW A;  2XEP A;  2HML B;  3HI7 A;  4WWU C;  1JN5 A;  4TX4 A;  1LVN A;  3VGN A;  3LYG A;  5CF2 A;  2GBW B;  1R4C A;  3AMO A;  3FZW A;  4HBR A;  1J2B A;  4HYZ A;  3CC7 3;  2IUK A;  4HM8 B;  2ZL8 A;  4HM2 B;  1YHQ 3;  1RN7 A;  1IU7 A;  2O3O A;  1RJO A;  3ALA A;  1M1K 4;  1VQ7 3;  2OTL 3;  3K63 A;  1VZZ A;  2INX A;  1YJW 3;  3GZB A;  2CG0 A;  3A76 A;  3K7C A;  4N6M A;  2CFK A;  4N3V A;  3B4O A;  3CC2 3;  1UUW B;  3KN4 A;  1E97 A;  2HMJ B;  3F14 A;  3FF0 A;  5JPU A;  1N5P A;  3VF1 A;  1AV4 A;  4HM0 B;  3NQY A;  1JN5 B;  1DYU A;  3PXM A;  3KII A;  5CXO A;  1Q42 A;  4O02 B;  1UI7 A;  2CFL A;  3AMO B;  4R9L A;  1ISK A;  4RBN A;  1L5G B;  3U1W A;  4HM6 B;  3RDE A;  3SED A;  3CCE 3;  2OOV C;  2Z7A A;  3STD A;  3CCV 3;  1DMQ A;  1WMP A;  3JVC A;  4HM3 B;  2BHM A;  4EV2 A;  5AYS C;  3X42 A;  3OWU A;  1VQ5 3;  1JKG A;  2WGO A;  1ROV A;  1MOL A;  4XBX A;  3NBB A;  4XM4 A;  3B4P A;  1NWW A;  4J9A A;  4N6U A;  1NDO B;  3S67 A;  1U5O A;  2PNC A;  5EQL A;  2XH9 A;  3DZL A;  3N9H A;  2XGL A;  2P0X A;  2WOF A;  5TGN A;  3SOY A;  3LT8 A;  3NM7 A;  3CCU 3;  3E99 A;  3OV4 A;  4R1K A;  3PYJ A;  1D6U A;  3OW2 2;  4HM7 B;  1IQY A;  3OWS A;  1W5Z A;  1VQ8 3;  5AIG A;  4HM4 B;  4L7K A;  3WA3 A;  1FGT A;  1NB3 I;  5STD A;  3LTA A;  5CK6 A;  5AEU B;  4WYK B;  2XSO B;  2PZV A;  1OAC A;  1YVB I;  3D9R A;  1JKG B;  2YFL B;  4AKZ A;  1PU4 A;  3ECF A;  1E3R A;  3Q2P A;  3EX9 A;  4OK0 A;  4JF8 A;  3EBT A;  3B7C A;  1YJN 3;  1K28 A;  3F40 A;  3CPW 2;  3G71 3;  3BNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...