1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
3EJVA 3EQQB 3MSOA 5IG0A 3KSPA 4HJLB 3GZXB 1DMNA 5EVHA 2GEXA 4J8TA 3JUOA 3NHXA 2XSOB 5AI1A 2STDA 5D82A 4XB5A 4HVNA 1TUHA 1UUVB 2GBXB 7STDA 3F40A 4WYKA 1OHPA 2YFIB 4WP5A 2HMLB 3H3HA 1OCVA 1QMAA 1JN5B 2PZVA 4KVHA 1Z1SA 3NM2A 3VGNA 1OF5A 5AEWB 3EN1B 3MG3A 1C7HA 3B4PA 3OX9A 1WQLB 3ER7A 4XBTA 3HK4A 2XR8B 2QGUA 3T8NA 4XDVA 3ROBA 3IPTA 4OVMA 1S5AA 1O7GB 3EHCA 2W2CA 1VZZA 3EBYA 2BNGA 5DREA 2I9WA 1ULIB 2RCDA 5JPUA 1JKGB 4X2OA 3CNXA 4HM0B 4L8OA 1GY7A 2CHCA 4HM2B 1JB4A 5CK6A 3EBTA 2HMMB 4OUQA 3F7SA 3B8LA 4LMIA 3JUNA 3MG1A 1IDPA 3JUMA 1JB2A 1OHSA 4XBYA 4PEJA 4STDA 4R1KA 8CHOA 1JN5A 4ORLA 3A76A 3I0YA 3HZPA 3EX9A 3LYGA 2HMNB 3M8CA 3CPOA 5FW5A 1NDOB 1OF5B 3DXOA 3S5CA 4H3UA 1OPYA 1W6YA 3STDA 4WWUC 4XBXA 3UJMA 2IMJA 4L7KA 5D81A 3FH1A 4CDLA 3F8XA 3G0KA 5AIHA 2GXFA 3GWRA 3H51A 2A15A 1O7WB 1JKGA 1GYBA 4R9LA 2B1XB 3OWUA 4N3VA 5TGNA 4FCMA 2JQ5A 3Q90A 3BLZA 5BVBA 2HMKB 4HM7B 3K7CA 4HM6B 3EN8A 4HM8B 5STDA 1E3RA 1ZX2A 1DMQA 2F99A 2Z7AA 3OV4A 6STDA 2QIYA 2K54A 1NWWA 4LGQA 5IF6A 2XRXB 1K41A 3KKGA 1Q42A 2YFLB 3NV0B 3JUQA 1O7MB 3KZTA 3MKIA 4HM5B 4HM4B 5D83A 2Z77A 5G2GA 3F7XA 5AIFA 3F14A 5AIIA 5HGRA 5IERA 3MG2A 3KE7A 2UX0A 3JUPA 3DMCA 3VSYA 5DRVA 2GEYA 1E3VA 3FF0A 3RGAA 4RZMA 3LZAA 4J9AA 2HMJB 1GY6A 5CLKA 2OWPA 2HMOB 2Z76A 4XM4A 4HZBB 4HZ9B 3FGYA 3RGRA 1JB5A 3NV0A 3GZRA 3SEDA 1W01A 3F8HA 5IENA 1OGXA 2BMQB 2XSHB 3T8UA 3OWSA 1NU3A 2INXA 5CF2A 2B24B 2R4IA 1OGZA 2F86B 1TP6A 1Q40B 1E97A 3GZYB 1O7PB 3WMDA 3SOYA 1A2KA 3GRDA 4HKVB 3DZLA 4K1UA 3MYTA 5CF1A 3DM8A 3NBRA 4HM3B 1CQSA 4R9KA 5JPPA 1GS3A 3FSDA 1EG9B 1ZO2A 3CNMA 1BUQA 3G8ZA 3BB9A 5CXOA 2YFJB 4MJDA 3UNLA 1W00A 3DUKA 5AIGA 2BMRB 5IG3A 1OUNA 3B7CA 4Q53A 4XDWA 5IG4A 5IEPA 1GY5A 3SOAA 1ASKA 1U5OA 3K0ZA 2GBWB 1OH0A 1Q40A 1W02A 5KP3A 3CU3A 3D9RA 2BMOB 4I4KA 4FCJA 1SJWA 4IIAA 3FKAA 3HX8A 1UUWB 3ECFA 3NUVA 2RFRA 5BXQA 4GB5A 3E99A 4LEHA 3OXAA 1ISKA 2F98A 2RGQA 3FF2A 1QJGA 4WYKB 3B4OA 4X2HA 4U13A 5AEUB 3EF8A 4K1VA 3EC9A 2CKFB 5IG5A 1STDA 5KP1A 1ULJB 3MHEA 3FZWA 1EA2A 1AR0A 1DMMA 4L8PA 3FLJA 1O7NB 3OWYA 5KP4A 1HKXA 3F9SA 3NXJA 1OHOA 4HM1B 3G16A 1O7HB 5IEOA 3GZBA
chains in the Genus database with same CATH superfamily
2XFTA 3JVCA 1D6ZA 3WHOA 2KF3A 1VQ63 3EJVA 2AAEA 3DGYA 3EQQB 3MSOA 5IG0A 3KSPA 1RHLA 4HJLB 1IVVA 3S28A 1TRQA 3SYUA 1IQXA 1RRHA 3GZXB 1K734 1AVLA 1C54A 3CCL3 1DMNA 1KWIA 2CK3H 2ZDJA 5EVHA 9RNTA 2GEXA 2MF7A 4J8TA 4BU4A 2K3DA 3JUOA 1NJI4 1N8R4 4N6LA 3NHXA 1JBTA 3CC73 1IT8A 1LNHA 3U1WA 4RNTA 2XSOB 1LQGC 5AI1A 2STDA 4KFFA 1EUIC 2OCTA 1RGCA 2FXTA 2W6JH 1BRKA 3LH4A 1VQK3 2OQEA 3U97A 3NBJA 5D82A 4XB5A 1W7CA 4HVNA 1RGLA 1TUHA 1TU5A 3CC23 4MMZB 5LC7A 1UUVB 3BNBA 6GSPA 2BU4A 2KF4A 1BNIA 4N6NB 2L1SA 1GMRA 2GBXB 7STDA 3NQZA 3F40A 1U8CB 3NBBA 1BUJA 1RTUA 2O3OA 1RJOA 1TJDA 1GOYA 1OHPA 2XEPA 2YFIB 4WYKA 3S29A 1EEJA 5EEOA 4WP5A 1YJ93 2HMLB 5BIRA 1JV2B 2CWTA 1YI23 1SIHA 3EE1A 3H3HA 3D79A 5HOHA 4CCVA 4WHAA 1OCVA 1M1XB 1QMAA 1JN5B 1W2ZA 2OTJ3 2PZVA 2FGTA 2CX1A 2CFKA 1FUTA 4KVHA 1Z1SA 3NM2A 3VGNA 2C4BA 1OF5A 2WOFA 1GMPA 3ZFZA 5AEWB 3EN1B 1NNVA 4RNZA 3N9HA 1GOVA 3MG3A 3IMAB 1C7HA 4MMYB 3B4PA 3BIRA 3OX9A 1IYYA 3PCRA 2J8XB 1WQLB 3ER7A 2OOVC 4XBTA 4NREA 1HZ1A 3HK4A 1JZDA 1Q7Y4 2XR8B 2QGUA 3S67A 3T8NA 4XDVA 5A0OB 3LTAA 4O3VA 3CCQ3 1M904 4EBGA 2GU1A 3ROBA 4EV2A 2C11A 1BRNL 2ZHXB 2H0GA 1RN4A 1OACA 3D3LA 3IPTA 1TTOA 2W56B 4OVMA 5LC6A 1S5AA 3RNTA 1Q9EA 1VQL3 1B2MA 2XH9A 1O7GB 2ML6A 5AYSC 3QRDA 3EHCA 4AKZA 4AEQA 1AQZA 2W2CA 3WOFB 1HYFA 3CCM3 1VZZA 3EBYA 2BNGA 4GSPA 3DGNA 1VQM3 2KF5A 5DREA 1DYUA 3CCV3 1JBRA 1SARA 2I9WA 4KFEA 1N5PA 3EB8A 3N8BA 1ULIB 1I0XA 1UCJA 2RCDA 1VQ83 4ILFA 1I8VA 5JPUA 1JKGB 4X2OA 1VQN3 1BRJA 1W2B2 3CNXA 4HM0B 2Y73A 1GY7A 2CHCA 2XFSA 4L8OA 2P0XA 3TDGA 4HM2B 3RDEA 1HU9A 1JB4A 4HBRA 1KC84 5CK6A 3EBTA 3D4AA 2HMMB 3T0UA 3F7SA 4OUQA 2CWVA 3B8LA 4LMIA 1LNIA 3JUNA 3V98A 3MG1A 1IDPA 1I2FA 3X3ZA 3JUMA 1FW7A 1JB2A 1OHSA 1RGEA 4XBYA 5G1LA 3X41A 4PEJA 4STDA 1J2BA 2BT3A 1X1UA 2RBIA 4R1KA 1VQP3 1IT7A 2K0MA 3BNCA 1RN7A 8CHOA 3KCHA 1JJ22 1JN5A 1QAKA 1W5ZA 3A76A 3I0YA 4ORLA 3A5EA 3N54B 3HZPA 3WDGB 3EX9A 3NQYA 2CX0A 1WMOA 1BOXA 2CG0A 2HMNB 3LYGA 3M8CA 1IVUA 3CPOA 1WMNA 2Q07A 4N6MA 5FW5A 2P05A 2C10A 1VQQA 1NDOB 2IYJA 1FZUA 1OF5B 3DXOA 1N8QA 4FMAA 1T3BA 3S5CA 1SPUA 2WGQA 4EYCA 1NB5I 4H3UA 6RNTA 4JF8A 1OPYA 1W6YA 3LTDA 1TIJA 3STDA 1I0VA 2XGNA 4WWUC 4XBXA 1R4CA 1CYUA 3UJMA 2W56A 1RDSA 2IMJA 4L7KA 5D81A 2H0HA 3FH1A 4CDLA 1VQ43 1BVIA 1L5GB 3F8XA 3G0KA 5AIHA 3LOYA 2UUGC 2V1LA 2GXFA 3GWRA 3H51A 3MPHA 3LXUX 1FUWA 2A15A 3CMA3 1KD14 1O7WB 3HOHA 3Q3FA 1FGOA 1CYVA 2WO0A 3X3YA 5AYRB 4FMBA 1JKGA 1GYBA 1Y4KA 4R9LA 2B1XB 2HOHA 3OWUA 2E2UA 1BNGA 4N3VA 3I553 2CG1A 3CXC2 5TGNA 2CFGA 4FCMA 4FR9A 4K61A 2JQ5A 3Q90A 3BLZA 5BVBA 1KQS2 1QAFA 3HI7A 2HMKB 4HM7B 3K7CA 1UGIA 2RNTA 4HM6B 3EN8A 1BRSA 3O8YA 2KCDA 3L0RA 4BIRA 1CEWI 1Q7HA 3D5IA 4HM8B 5STDA 4GHOA 1Q824 1G96A 1FGTA 1RGFA 1E3RA 1ZX2A 1DMQA 2F99A 2Z7AA 3OV4A 4BTXA 6STDA 4EC6A 4BL3A 1BSEA 1DVCA 3KN4A 3CD63 2QIYA 5M1AA 3BNEA 4NPBA 2K54A 3ALAA 3NX0A 4N6TA 3PCSA 2W0QA 1BIRA 1NWWA 2PNCA 4LGQA 4O2HA 3CCS3 5IF6A 1Q814 2CW9A 1B2UA 2F5MA 1T2IA 2XRXB 2W9QA 1K41A 3KKGA 1Q42A 1B21A 2YFLB 3KFQC 2Y74A 3NV0B 2ZL8A 2Z6BA 4CPKA 1RGAA 4EV5A 3G6E3 1FA3A 4HOHA 3CC43 3JUQA 1O7MB 1GSPA 3KZTA 2ZA4A 1PFPA 3MKIA 4HM5B 3KIIA 4HM4B 1G0TA 4FMDA 1KSIA 3QK9A 1B3SA 5D83A 2Z77A 1RMSA 5G2GA 1AY7A 3J7Yd 1M9GA 3CPW2 3LTCA 2BO9B 2BIRA 4TX4A 1FGRA 3F7XA 4I5QA 3AGNA 2BHMA 5AIFA 2KXGA 3F14A 5AIIA 1JNQA 3PZWA 3X40A 1RN1A 5HGRA 2JDIH 2WGOA 5IERA 2CWUA 2IUKA 1BRGA 4AKYA 5EQLA 1IVWA 2F4YA 1M1K4 3MG2A 1K9M4 3KE7A 1FGMA 1GD3A 2UX0A 1STFI 1B2SA 3JUPA 3DMCA 1I70A 3VSYA 5DRVA 1R4YA 2D1WA 3IJEB 4N6V0 1RLSA 2GEYA 1E3VA 3FF0A 1YIT3 4LSOA 1SIIA 1F8NA 1LXEA 2CH9A 3RGAA 1US1A 1TRPA 4EW5A 4RZMA 3FG3A 1SQWA 1ZS7A 3LZAA 4KT3B 2R41A 4J9AA 2HMJB 1GY6A 2L4VA 3DGMA 1FUSA 4JRFA 1TFKA 2OWPA 2XGLA 4QWTA 5CLKA 1YHQ3 2HMOB 2Z76A 2IUJA 1RKYA 4XM4A 1YNVX 1RCKA 4WFOA 1MWSA 4FMCA 4MEIA 4HZBB 2F5WA 1X1YA 4KZ1A 2QA43 4ZM8A 3K5TA 4HZ9B 3AMOB 3SXXA 3FGYA 3RGRA 1JB5A 3NV0A 1TFOA 3GZRA 3FCSB 3Q1CA 4RNYA 3WR2A 3CCU3 5ELJA 1BU4A 3SEDA 1W01A 1N9EA 1NB3I 3F8HA 2MC8A 2KF6A 5IENA 1A2VA 1PU4A 1OGXA 1W6GA 2BMQB 1FGQA 1JZOA 1ROAA 1WNHA 4O8SA 2XSHB 3T8UA 1EQKA 4G1MB 3OWSA 1NU3A 2INXA 5CF2A 1B2ZA 1RNTA 1UGHI 3DGOA 2OTL3 1YGWA 2B24B 1BRHA 3LT8A 3WOEB 1UCLA 2OOVA 1IVXA 1X1XA 1RGGA 5JBSA 2R4IA 4BTYA 3HIIA 1OGZA 4J5KA 2P0MA 5IW9A 3LT9A 1IK3A 3LTBA 5ELUA 4BL2A 2F86B 1IQYA 1TP6A 4IPBA 1WMPA 1YVBI 1Q40B 7RNTA 1E97A 1VQO3 2KRTA 3UL6A 1T5YA 2KAAA 4HAAA 4O02B 4DKIA 3ZG0A 1RRLA 5M19A 1RSNA 3AHSA 3GZYB 1YJN3 1O7PB 4K90B 1IQ8A 3SOYA 1A2KA 3GRDA 3WMDA 4HKVB 3DZLA 4K1UA 4LYLB 3MYTA 2CFDA 5CF1A 3AHWA 1RNBA 4EXRA 3DM8A 8RNTA 5M18A 1RGHA 1BSAA 2F56A 2H0IA 2W03A 1BNJA 3D5GA 2ML5A 3NBRA 2UGIA 4HM3B 1CQSA 1MWUA 2GSPA 2LQVA 1MOLA 2P09A 4RBNA 3CCR3 1A90A 3PGBA 4R9KA 3SX1A 5JPPA 1IU7A 3WA2X 3CCE3 3AMOA 3DGLA 1GS3A 2E2VA 3FSDA 1BNSA 1QVG2 1V58A 2IA7A 1EG9B 1PY3A 1K8A4 2CFLA 4N6OB 1ZO2A 3G713 1YGEA 1YJW3 2P38A 1QVF2 3CNMA 1BUQA 1W4NA 4MMXB 3G8ZA 3DY5A 3BB9A 1DETA 1FYSA 1UCKA 5CXOA 2YFJB 5FGOA 4MJDA 1T2HA 1ROVA 1V57A 1LOXA 2XF3A 3URPA 3UNLA 1BAOA 5BU4A 3PYJA 1W00A 1K28A 3BNDA 3OW22 1YIJ3 1LQMB 1MGWA 2QEX3 1PYLA 1YVSA 3DUKA 1I2EA 3CCJ3 5AIGA 2BMRB 1LOWA 5IG3A 1OUNA 1MGRA 1RCLA 1V74A 3B7CA 3X42A 5RNTA 4Q53A 2FNQA 1VQ93 1A2PA 3V92A 1BSDA 2M7OA 4GL6A 4XDWA 5IG4A 1DVDA 5IEPA 1GY5A 3SOAA 1ASKA 1U5OA 3K0ZA 2GBWB 3MWZA 1W6CA 2D42A 1DE3A 2W04A 1OH0A 1NO3A 1Q40A 1W02A 2O9UX 2LYXA 1LRAA 5KP3A 1A67A 3CU3A 3D9RA 2BMOB 4I4KA 3K63A 4HYZA 4FCJA 3V99A 2SBLA 3WA3A 3ZG5A 1EKMA 2GU3A 1G02A 4OK0A 1B20A 1LVNA 1SJWA 3UL5A 4CJNA 3VF1A 2OQEC 1Q864 2CFWA 1WTHA 1I3FA 4IIAA 4IT7A 1D6UA 3FKAA 3GAXA 3PXMA 3HX8A 3CME3 1BSBA 3X3XA 4BTWA 1UUWB 1BNFA 1AVKA 4H61A 3WODG 3ECFA 1QALA 3NUVA 2RFRA 1IV7A 2CC3A 3UB1A 1UW1A 5BXQA 1AV4A 4GB5A 1MNLA 2RSXA 3HIGA 1JRQA 7GSPA 1I2GA 3G4S3 4NHFA 2SARA 2CIUA 1S723 3E99A 4LEHA 3OXAA 4LZIA 2F98A 1ISKA 2RGQA 5I97A 2AADA 3FG1A 1LOVA 1N5HA 1B27A 3FF2A 1GD4A 1QJGA 1X1WA 1D6YA 2IY2A 3B4OA 3LMLA 4WYKB 4U13A 4X2HA 5AEUB 1IV9A 1GOUA 1BRIA 1UI7A 1GMQA 3EF8A 4FCZA 1B2XA 1BANA 1LOYA 1BNEA 3KSED 4K1VA 1UUGB 1VQ73 3EC9A 2CKFB 5IG5A 1STDA 3K9MC 5KP1A 1CH0A 3I563 1RGKA 3AGOA 1ULJB 3SLUA 1ZGXA 3MHEA 3S27A 3FZWA 1MWRA 1BGSA 1I3IA 1EA2A 1N9JA 2E2TA 2W9PA 3DH2A 3FG4A 5G1KA 3NM7A 5GSPA 1AR0A 3BU4A 1UI8A 1BSCA 3PS8A 1DMMA 3SVAA 4L8PA 3FLJA 1O7NB 1JBSA 3OWYA 1BNRA 5KP4A 1MWTA 1HKXA 4KFDA 3F9SA 1UDII 3NXJA 4R4KA 1OHOA 1UCIA 2WOHA 4HM1B 4N6UA 3G16A 3Q2PA 1O7HB 5IEOA 4J5GA 4R80A 3GSPA 3GZBA 2YX9A 1VQ53
chains in the Genus database with same CATH topology
2XFTA 3JVCA 1D6ZA 1VQ63 3EJVA 3EQQB 3MSOA 5IG0A 3KSPA 4HJLB 1IVVA 3S28A 1IQXA 1RRHA 3GZXB 1K734 1AVLA 3CCL3 1DMNA 1KWIA 2CK3H 2ZDJA 5EVHA 2GEXA 2MF7A 4J8TA 1NJI4 3JUOA 1N8R4 4N6LA 3NHXA 3CC73 1IT8A 1LNHA 3U1WA 2XSOB 5AI1A 2STDA 4KFFA 2OCTA 2W6JH 2FXTA 1VQK3 3LH4A 2OQEA 3U97A 3NBJA 5D82A 4XB5A 1W7CA 4HVNA 1TUHA 1TU5A 3CC23 4MMZB 5LC7A 1UUVB 3BNBA 4N6NB 2GBXB 7STDA 3NQZA 3F40A 1U8CB 3NBBA 2O3OA 1RJOA 4WYKA 1OHPA 2XEPA 2YFIB 3S29A 5EEOA 4WP5A 1YJ93 2HMLB 1JV2B 2CWTA 1YI23 1SIHA 3EE1A 3H3HA 4CCVA 4WHAA 1OCVA 1M1XB 1QMAA 1JN5B 1W2ZA 2OTJ3 2PZVA 2FGTA 2CFKA 4KVHA 1Z1SA 3NM2A 3VGNA 1OF5A 2WOFA 5AEWB 3EN1B 4RNZA 3N9HA 3MG3A 3IMAB 1C7HA 4MMYB 3B4PA 3OX9A 3PCRA 1WQLB 3ER7A 2OOVC 4XBTA 4NREA 3HK4A 1Q7Y4 2XR8B 2QGUA 3S67A 3T8NA 4XDVA 5A0OB 3LTAA 4O3VA 3CCQ3 1M904 4EBGA 2GU1A 3ROBA 4EV2A 2C11A 3IPTA 1OACA 3D3LA 4OVMA 2W56B 5LC6A 1S5AA 1VQL3 2XH9A 1O7GB 2ML6A 5AYSC 3QRDA 3EHCA 4AKZA 4AEQA 2W2CA 3WOFB 3CCM3 1VZZA 3EBYA 2BNGA 3DGNA 1VQM3 5DREA 1DYUA 3CCV3 2I9WA 4KFEA 1N5PA 3EB8A 3N8BA 1ULIB 1VQ83 2RCDA 5JPUA 1JKGB 4X2OA 1VQN3 1W2B2 3CNXA 4HM0B 2Y73A 1GY7A 2CHCA 2XFSA 4L8OA 2P0XA 3TDGA 4HM2B 3RDEA 1HU9A 1JB4A 4HBRA 1KC84 5CK6A 3EBTA 2HMMB 3T0UA 3F7SA 4OUQA 2CWVA 3B8LA 4LMIA 3JUNA 3V98A 3MG1A 1IDPA 3X3ZA 3JUMA 1JB2A 1OHSA 4XBYA 3X41A 4PEJA 4STDA 1J2BA 2BT3A 4R1KA 1VQP3 1IT7A 2K0MA 3BNCA 1RN7A 8CHOA 1JJ22 1JN5A 1QAKA 1W5ZA 3A76A 3I0YA 4ORLA 3N54B 3HZPA 3WDGB 3EX9A 3NQYA 1WMOA 3LYGA 2CG0A 2HMNB 3M8CA 1IVUA 3CPOA 1WMNA 2Q07A 4N6MA 5FW5A 2P05A 2C10A 1NDOB 1OF5B 3DXOA 1N8QA 4FMAA 3S5CA 1SPUA 2WGQA 4EYCA 1NB5I 4H3UA 4JF8A 1OPYA 1W6YA 3LTDA 1TIJA 3STDA 2XGNA 4WWUC 4XBXA 1R4CA 1CYUA 3UJMA 2W56A 2IMJA 4L7KA 5D81A 3FH1A 4CDLA 1VQ43 1L5GB 3F8XA 3G0KA 5AIHA 3LOYA 2V1LA 2GXFA 3GWRA 3H51A 3MPHA 3LXUX 1FUWA 2A15A 3CMA3 1KD14 1O7WB 1FGOA 1CYVA 2WO0A 3X3YA 5AYRB 4FMBA 1JKGA 1GYBA 1Y4KA 4R9LA 2B1XB 3OWUA 2E2UA 4N3VA 3I553 2CG1A 3CXC2 5TGNA 2CFGA 4FCMA 4FR9A 4K61A 2JQ5A 3Q90A 3BLZA 5BVBA 1KQS2 1QAFA 3HI7A 2HMKB 4HM7B 3K7CA 4HM6B 3EN8A 3O8YA 2KCDA 3L0RA 1CEWI 4HM8B 5STDA 1Q824 1G96A 1FGTA 1E3RA 1ZX2A 1DMQA 2F99A 2Z7AA 3OV4A 4BTXA 6STDA 4EC6A 1DVCA 3KN4A 3CD63 2QIYA 3BNEA 2K54A 3ALAA 3NX0A 4N6TA 3PCSA 2W0QA 2PNCA 1NWWA 4LGQA 4O2HA 3CCS3 5IF6A 1Q814 2CW9A 2XRXB 2W9QA 1K41A 3KKGA 1Q42A 2YFLB 3KFQC 2Y74A 3NV0B 2ZL8A 2Z6BA 1FA3A 4EV5A 3G6E3 3CC43 3JUQA 1O7MB 3KZTA 1PFPA 3MKIA 4HM5B 3KIIA 4HM4B 4FMDA 1KSIA 3QK9A 5D83A 2Z77A 5G2GA 3J7Yd 1M9GA 3CPW2 3LTCA 2BO9B 4TX4A 1FGRA 3F7XA 2BHMA 5AIFA 2KXGA 3F14A 5AIIA 1JNQA 3PZWA 3X40A 5HGRA 5IERA 2JDIH 2WGOA 2CWUA 2IUKA 4AKYA 5EQLA 1IVWA 1M1K4 3MG2A 1K9M4 3KE7A 1FGMA 1GD3A 2UX0A 1STFI 3JUPA 3DMCA 3VSYA 5DRVA 2D1WA 3IJEB 4N6V0 2GEYA 1E3VA 3FF0A 1YIT3 4LSOA 1SIIA 1F8NA 1LXEA 2CH9A 3RGAA 1US1A 4RZMA 3FG3A 1SQWA 3LZAA 4J9AA 2HMJB 1GY6A 2L4VA 3DGMA 4JRFA 1TFKA 2OWPA 2XGLA 4QWTA 5CLKA 1YHQ3 2HMOB 2Z76A 2IUJA 1RKYA 4XM4A 4WFOA 4FMCA 4MEIA 4HZBB 4KZ1A 2QA43 4ZM8A 3K5TA 4HZ9B 3AMOB 3SXXA 3FGYA 3RGRA 1JB5A 3NV0A 1TFOA 3GZRA 3FCSB 3Q1CA 4RNYA 3CCU3 5ELJA 3SEDA 1W01A 1N9EA 1NB3I 3F8HA 2MC8A 5IENA 1A2VA 1PU4A 1OGXA 1W6GA 2BMQB 1FGQA 1ROAA 4O8SA 1WNHA 2XSHB 3T8UA 1EQKA 4G1MB 3OWSA 1NU3A 2INXA 5CF2A 2OTL3 3DGOA 2B24B 3LT8A 3WOEB 2OOVA 1IVXA 5JBSA 2R4IA 4BTYA 3HIIA 1OGZA 2P0MA 5IW9A 3LT9A 1IK3A 3LTBA 5ELUA 2F86B 1IQYA 1TP6A 4IPBA 1WMPA 1YVBI 1Q40B 1E97A 1VQO3 2KRTA 3UL6A 1T5YA 4O02B 1RRLA 3GZYB 1YJN3 1O7PB 4K90B 1IQ8A 3SOYA 1A2KA 3GRDA 3WMDA 4HKVB 3DZLA 4K1UA 3MYTA 2CFDA 5CF1A 4EXRA 3DM8A 2W03A 2ML5A 3NBRA 4HM3B 1CQSA 2LQVA 1MOLA 2P09A 4RBNA 3CCR3 1A90A 3PGBA 4R9KA 3SX1A 5JPPA 1IU7A 3WA2X 3CCE3 3AMOA 3DGLA 2E2VA 1GS3A 3FSDA 1QVG2 2IA7A 1EG9B 1K8A4 2CFLA 4N6OB 1ZO2A 3G713 1YGEA 1YJW3 2P38A 1QVF2 3CNMA 1BUQA 1W4NA 4MMXB 3G8ZA 3DY5A 3BB9A 5CXOA 5FGOA 2YFJB 4MJDA 1ROVA 1LOXA 2XF3A 3UNLA 3PYJA 1W00A 1K28A 3BNDA 3OW22 1YIJ3 2QEX3 3DUKA 3CCJ3 5AIGA 2BMRB 5IG3A 1OUNA 3X42A 3B7CA 1V74A 4Q53A 2FNQA 1VQ93 3V92A 2M7OA 4GL6A 4XDWA 5IG4A 1DVDA 5IEPA 1GY5A 3SOAA 1ASKA 1U5OA 3K0ZA 2GBWB 3MWZA 1W6CA 2D42A 2W04A 1OH0A 1NO3A 1Q40A 1W02A 2O9UX 2LYXA 1A67A 5KP3A 3CU3A 3D9RA 2BMOB 4I4KA 3K63A 4HYZA 4FCJA 3V99A 2SBLA 3WA3A 1EKMA 2GU3A 4OK0A 1LVNA 1SJWA 3UL5A 3VF1A 2OQEC 1Q864 2CFWA 1WTHA 4IIAA 4IT7A 1D6UA 3FKAA 3GAXA 3PXMA 3HX8A 3CME3 3X3XA 4BTWA 1UUWB 1AVKA 4H61A 3WODG 3ECFA 1QALA 3NUVA 2RFRA 1IV7A 2CC3A 3UB1A 1UW1A 5BXQA 1AV4A 4GB5A 1MNLA 2RSXA 3HIGA 1JRQA 3G4S3 4NHFA 2CIUA 1S723 3E99A 4LEHA 3OXAA 4LZIA 2F98A 1ISKA 2RGQA 5I97A 3FG1A 1N5HA 3FF2A 1GD4A 1QJGA 1D6YA 3B4OA 3LMLA 4WYKB 4X2HA 4U13A 5AEUB 1IV9A 1UI7A 3EF8A 4FCZA 3KSED 4K1VA 1VQ73 3EC9A 2CKFB 5IG5A 1STDA 3K9MC 5KP1A 3I563 1ULJB 3SLUA 3MHEA 3S27A 3FZWA 1EA2A 1N9JA 2E2TA 2W9PA 3FG4A 3NM7A 1AR0A 1UI8A 3PS8A 1DMMA 3SVAA 4L8PA 3FLJA 1O7NB 3OWYA 5KP4A 4KFDA 1HKXA 3F9SA 3NXJA 4R4KA 1OHOA 2WOHA 4HM1B 4N6UA 3G16A 3Q2PA 1O7HB 5IEOA 4R80A 3GZBA 2YX9A 1VQ53
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJV A;  3EQQ B;  3MSO A;  5IG0 A;  3KSP A;  4HJL B;  3GZX B;  1DMN A;  5EVH A;  2GEX A;  4J8T A;  3JUO A;  3NHX A;  2XSO B;  5AI1 A;  2STD A;  5D82 A;  4XB5 A;  4HVN A;  1TUH A;  1UUV B;  2GBX B;  7STD A;  3F40 A;  4WYK A;  1OHP A;  2YFI B;  4WP5 A;  2HML B;  3H3H A;  1OCV A;  1QMA A;  1JN5 B;  2PZV A;  4KVH A;  1Z1S A;  3NM2 A;  3VGN A;  1OF5 A;  5AEW B;  3EN1 B;  3MG3 A;  1C7H A;  3B4P A;  3OX9 A;  1WQL B;  3ER7 A;  4XBT A;  3HK4 A;  2XR8 B;  2QGU A;  3T8N A;  4XDV A;  3ROB A;  3IPT A;  4OVM A;  1S5A A;  1O7G B;  3EHC A;  2W2C A;  1VZZ A;  3EBY A;  2BNG A;  5DRE A;  2I9W A;  1ULI B;  2RCD A;  5JPU A;  1JKG B;  4X2O A;  3CNX A;  4HM0 B;  4L8O A;  1GY7 A;  2CHC A;  4HM2 B;  1JB4 A;  5CK6 A;  3EBT A;  2HMM B;  4OUQ A;  3F7S A;  3B8L A;  4LMI A;  3JUN A;  3MG1 A;  1IDP A;  3JUM A;  1JB2 A;  1OHS A;  4XBY A;  4PEJ A;  4STD A;  4R1K A;  8CHO A;  1JN5 A;  4ORL A;  3A76 A;  3I0Y A;  3HZP A;  3EX9 A;  3LYG A;  2HMN B;  3M8C A;  3CPO A;  5FW5 A;  1NDO B;  1OF5 B;  3DXO A;  3S5C A;  4H3U A;  1OPY A;  1W6Y A;  3STD A;  4WWU C;  4XBX A;  3UJM A;  2IMJ A;  4L7K A;  5D81 A;  3FH1 A;  4CDL A;  3F8X A;  3G0K A;  5AIH A;  2GXF A;  3GWR A;  3H51 A;  2A15 A;  1O7W B;  1JKG A;  1GYB A;  4R9L A;  2B1X B;  3OWU A;  4N3V A;  5TGN A;  4FCM A;  2JQ5 A;  3Q90 A;  3BLZ A;  5BVB A;  2HMK B;  4HM7 B;  3K7C A;  4HM6 B;  3EN8 A;  4HM8 B;  5STD A;  1E3R A;  1ZX2 A;  1DMQ A;  2F99 A;  2Z7A A;  3OV4 A;  6STD A;  2QIY A;  2K54 A;  1NWW A;  4LGQ A;  5IF6 A;  2XRX B;  1K41 A;  3KKG A;  1Q42 A;  2YFL B;  3NV0 B;  3JUQ A;  1O7M B;  3KZT A;  3MKI A;  4HM5 B;  4HM4 B;  5D83 A;  2Z77 A;  5G2G A;  3F7X A;  5AIF A;  3F14 A;  5AII A;  5HGR A;  5IER A;  3MG2 A;  3KE7 A;  2UX0 A;  3JUP A;  3DMC A;  3VSY A;  5DRV A;  2GEY A;  1E3V A;  3FF0 A;  3RGA A;  4RZM A;  3LZA A;  4J9A A;  2HMJ B;  1GY6 A;  5CLK A;  2OWP A;  2HMO B;  2Z76 A;  4XM4 A;  4HZB B;  4HZ9 B;  3FGY A;  3RGR A;  1JB5 A;  3NV0 A;  3GZR A;  3SED A;  1W01 A;  3F8H A;  5IEN A;  1OGX A;  2BMQ B;  2XSH B;  3T8U A;  3OWS A;  1NU3 A;  2INX A;  5CF2 A;  2B24 B;  2R4I A;  1OGZ A;  2F86 B;  1TP6 A;  1Q40 B;  1E97 A;  3GZY B;  1O7P B;  3WMD A;  3SOY A;  1A2K A;  3GRD A;  4HKV B;  3DZL A;  4K1U A;  3MYT A;  5CF1 A;  3DM8 A;  3NBR A;  4HM3 B;  1CQS A;  4R9K A;  5JPP A;  1GS3 A;  3FSD A;  1EG9 B;  1ZO2 A;  3CNM A;  1BUQ A;  3G8Z A;  3BB9 A;  5CXO A;  2YFJ B;  4MJD A;  3UNL A;  1W00 A;  3DUK A;  5AIG A;  2BMR B;  5IG3 A;  1OUN A;  3B7C A;  4Q53 A;  4XDW A;  5IG4 A;  5IEP A;  1GY5 A;  3SOA A;  1ASK A;  1U5O A;  3K0Z A;  2GBW B;  1OH0 A;  1Q40 A;  1W02 A;  5KP3 A;  3CU3 A;  3D9R A;  2BMO B;  4I4K A;  4FCJ A;  1SJW A;  4IIA A;  3FKA A;  3HX8 A;  1UUW B;  3ECF A;  3NUV A;  2RFR A;  5BXQ A;  4GB5 A;  3E99 A;  4LEH A;  3OXA A;  1ISK A;  2F98 A;  2RGQ A;  3FF2 A;  1QJG A;  4WYK B;  3B4O A;  4X2H A;  4U13 A;  5AEU B;  3EF8 A;  4K1V A;  3EC9 A;  2CKF B;  5IG5 A;  1STD A;  5KP1 A;  1ULJ B;  3MHE A;  3FZW A;  1EA2 A;  1AR0 A;  1DMM A;  4L8P A;  3FLJ A;  1O7N B;  3OWY A;  5KP4 A;  1HKX A;  3F9S A;  3NXJ A;  1OHO A;  4HM1 B;  3G16 A;  1O7H B;  5IEO A;  3GZB A; 
#chains in the Genus database with same CATH topology
 2XFT A;  3JVC A;  1D6Z A;  3WHO A;  2KF3 A;  1VQ6 3;  3EJV A;  2AAE A;  3DGY A;  3EQQ B;  3MSO A;  5IG0 A;  3KSP A;  1RHL A;  4HJL B;  1IVV A;  3S28 A;  1TRQ A;  3SYU A;  1IQX A;  1RRH A;  3GZX B;  1K73 4;  1AVL A;  1C54 A;  3CCL 3;  1DMN A;  1KWI A;  2CK3 H;  2ZDJ A;  5EVH A;  9RNT A;  2GEX A;  2MF7 A;  4J8T A;  4BU4 A;  2K3D A;  3JUO A;  1NJI 4;  1N8R 4;  4N6L A;  3NHX A;  1JBT A;  3CC7 3;  1IT8 A;  1LNH A;  3U1W A;  4RNT A;  2XSO B;  1LQG C;  5AI1 A;  2STD A;  4KFF A;  1EUI C;  2OCT A;  1RGC A;  2FXT A;  2W6J H;  1BRK A;  3LH4 A;  1VQK 3;  2OQE A;  3U97 A;  3NBJ A;  5D82 A;  4XB5 A;  1W7C A;  4HVN A;  1RGL A;  1TUH A;  1TU5 A;  3CC2 3;  4MMZ B;  5LC7 A;  1UUV B;  3BNB A;  6GSP A;  2BU4 A;  2KF4 A;  1BNI A;  4N6N B;  2L1S A;  1GMR A;  2GBX B;  7STD A;  3NQZ A;  3F40 A;  1U8C B;  3NBB A;  1BUJ A;  1RTU A;  2O3O A;  1RJO A;  1TJD A;  1GOY A;  1OHP A;  2XEP A;  2YFI B;  4WYK A;  3S29 A;  1EEJ A;  5EEO A;  4WP5 A;  1YJ9 3;  2HML B;  5BIR A;  1JV2 B;  2CWT A;  1YI2 3;  1SIH A;  3EE1 A;  3H3H A;  3D79 A;  5HOH A;  4CCV A;  4WHA A;  1OCV A;  1M1X B;  1QMA A;  1JN5 B;  1W2Z A;  2OTJ 3;  2PZV A;  2FGT A;  2CX1 A;  2CFK A;  1FUT A;  4KVH A;  1Z1S A;  3NM2 A;  3VGN A;  2C4B A;  1OF5 A;  2WOF A;  1GMP A;  3ZFZ A;  5AEW B;  3EN1 B;  1NNV A;  4RNZ A;  3N9H A;  1GOV A;  3MG3 A;  3IMA B;  1C7H A;  4MMY B;  3B4P A;  3BIR A;  3OX9 A;  1IYY A;  3PCR A;  2J8X B;  1WQL B;  3ER7 A;  2OOV C;  4XBT A;  4NRE A;  1HZ1 A;  3HK4 A;  1JZD A;  1Q7Y 4;  2XR8 B;  2QGU A;  3S67 A;  3T8N A;  4XDV A;  5A0O B;  3LTA A;  4O3V A;  3CCQ 3;  1M90 4;  4EBG A;  2GU1 A;  3ROB A;  4EV2 A;  2C11 A;  1BRN L;  2ZHX B;  2H0G A;  1RN4 A;  1OAC A;  3D3L A;  3IPT A;  1TTO A;  2W56 B;  4OVM A;  5LC6 A;  1S5A A;  3RNT A;  1Q9E A;  1VQL 3;  1B2M A;  2XH9 A;  1O7G B;  2ML6 A;  5AYS C;  3QRD A;  3EHC A;  4AKZ A;  4AEQ A;  1AQZ A;  2W2C A;  3WOF B;  1HYF A;  3CCM 3;  1VZZ A;  3EBY A;  2BNG A;  4GSP A;  3DGN A;  1VQM 3;  2KF5 A;  5DRE A;  1DYU A;  3CCV 3;  1JBR A;  1SAR A;  2I9W A;  4KFE A;  1N5P A;  3EB8 A;  3N8B A;  1ULI B;  1I0X A;  1UCJ A;  2RCD A;  1VQ8 3;  4ILF A;  1I8V A;  5JPU A;  1JKG B;  4X2O A;  1VQN 3;  1BRJ A;  1W2B 2;  3CNX A;  4HM0 B;  2Y73 A;  1GY7 A;  2CHC A;  2XFS A;  4L8O A;  2P0X A;  3TDG A;  4HM2 B;  3RDE A;  1HU9 A;  1JB4 A;  4HBR A;  1KC8 4;  5CK6 A;  3EBT A;  3D4A A;  2HMM B;  3T0U A;  3F7S A;  4OUQ A;  2CWV A;  3B8L A;  4LMI A;  1LNI A;  3JUN A;  3V98 A;  3MG1 A;  1IDP A;  1I2F A;  3X3Z A;  3JUM A;  1FW7 A;  1JB2 A;  1OHS A;  1RGE A;  4XBY A;  5G1L A;  3X41 A;  4PEJ A;  4STD A;  1J2B A;  2BT3 A;  1X1U A;  2RBI A;  4R1K A;  1VQP 3;  1IT7 A;  2K0M A;  3BNC A;  1RN7 A;  8CHO A;  3KCH A;  1JJ2 2;  1JN5 A;  1QAK A;  1W5Z A;  3A76 A;  3I0Y A;  4ORL A;  3A5E A;  3N54 B;  3HZP A;  3WDG B;  3EX9 A;  3NQY A;  2CX0 A;  1WMO A;  1BOX A;  2CG0 A;  2HMN B;  3LYG A;  3M8C A;  1IVU A;  3CPO A;  1WMN A;  2Q07 A;  4N6M A;  5FW5 A;  2P05 A;  2C10 A;  1VQQ A;  1NDO B;  2IYJ A;  1FZU A;  1OF5 B;  3DXO A;  1N8Q A;  4FMA A;  1T3B A;  3S5C A;  1SPU A;  2WGQ A;  4EYC A;  1NB5 I;  4H3U A;  6RNT A;  4JF8 A;  1OPY A;  1W6Y A;  3LTD A;  1TIJ A;  3STD A;  1I0V A;  2XGN A;  4WWU C;  4XBX A;  1R4C A;  1CYU A;  3UJM A;  2W56 A;  1RDS A;  2IMJ A;  4L7K A;  5D81 A;  2H0H A;  3FH1 A;  4CDL A;  1VQ4 3;  1BVI A;  1L5G B;  3F8X A;  3G0K A;  5AIH A;  3LOY A;  2UUG C;  2V1L A;  2GXF A;  3GWR A;  3H51 A;  3MPH A;  3LXU X;  1FUW A;  2A15 A;  3CMA 3;  1KD1 4;  1O7W B;  3HOH A;  3Q3F A;  1FGO A;  1CYV A;  2WO0 A;  3X3Y A;  5AYR B;  4FMB A;  1JKG A;  1GYB A;  1Y4K A;  4R9L A;  2B1X B;  2HOH A;  3OWU A;  2E2U A;  1BNG A;  4N3V A;  3I55 3;  2CG1 A;  3CXC 2;  5TGN A;  2CFG A;  4FCM A;  4FR9 A;  4K61 A;  2JQ5 A;  3Q90 A;  3BLZ A;  5BVB A;  1KQS 2;  1QAF A;  3HI7 A;  2HMK B;  4HM7 B;  3K7C A;  1UGI A;  2RNT A;  4HM6 B;  3EN8 A;  1BRS A;  3O8Y A;  2KCD A;  3L0R A;  4BIR A;  1CEW I;  1Q7H A;  3D5I A;  4HM8 B;  5STD A;  4GHO A;  1Q82 4;  1G96 A;  1FGT A;  1RGF A;  1E3R A;  1ZX2 A;  1DMQ A;  2F99 A;  2Z7A A;  3OV4 A;  4BTX A;  6STD A;  4EC6 A;  4BL3 A;  1BSE A;  1DVC A;  3KN4 A;  3CD6 3;  2QIY A;  5M1A A;  3BNE A;  4NPB A;  2K54 A;  3ALA A;  3NX0 A;  4N6T A;  3PCS A;  2W0Q A;  1BIR A;  1NWW A;  2PNC A;  4LGQ A;  4O2H A;  3CCS 3;  5IF6 A;  1Q81 4;  2CW9 A;  1B2U A;  2F5M A;  1T2I A;  2XRX B;  2W9Q A;  1K41 A;  3KKG A;  1Q42 A;  1B21 A;  2YFL B;  3KFQ C;  2Y74 A;  3NV0 B;  2ZL8 A;  2Z6B A;  4CPK A;  1RGA A;  4EV5 A;  3G6E 3;  1FA3 A;  4HOH A;  3CC4 3;  3JUQ A;  1O7M B;  1GSP A;  3KZT A;  2ZA4 A;  1PFP A;  3MKI A;  4HM5 B;  3KII A;  4HM4 B;  1G0T A;  4FMD A;  1KSI A;  3QK9 A;  1B3S A;  5D83 A;  2Z77 A;  1RMS A;  5G2G A;  1AY7 A;  3J7Y d;  1M9G A;  3CPW 2;  3LTC A;  2BO9 B;  2BIR A;  4TX4 A;  1FGR A;  3F7X A;  4I5Q A;  3AGN A;  2BHM A;  5AIF A;  2KXG A;  3F14 A;  5AII A;  1JNQ A;  3PZW A;  3X40 A;  1RN1 A;  5HGR A;  2JDI H;  2WGO A;  5IER A;  2CWU A;  2IUK A;  1BRG A;  4AKY A;  5EQL A;  1IVW A;  2F4Y A;  1M1K 4;  3MG2 A;  1K9M 4;  3KE7 A;  1FGM A;  1GD3 A;  2UX0 A;  1STF I;  1B2S A;  3JUP A;  3DMC A;  1I70 A;  3VSY A;  5DRV A;  1R4Y A;  2D1W A;  3IJE B;  4N6V 0;  1RLS A;  2GEY A;  1E3V A;  3FF0 A;  1YIT 3;  4LSO A;  1SII A;  1F8N A;  1LXE A;  2CH9 A;  3RGA A;  1US1 A;  1TRP A;  4EW5 A;  4RZM A;  3FG3 A;  1SQW A;  1ZS7 A;  3LZA A;  4KT3 B;  2R41 A;  4J9A A;  2HMJ B;  1GY6 A;  2L4V A;  3DGM A;  1FUS A;  4JRF A;  1TFK A;  2OWP A;  2XGL A;  4QWT A;  5CLK A;  1YHQ 3;  2HMO B;  2Z76 A;  2IUJ A;  1RKY A;  4XM4 A;  1YNV X;  1RCK A;  4WFO A;  1MWS A;  4FMC A;  4MEI A;  4HZB B;  2F5W A;  1X1Y A;  4KZ1 A;  2QA4 3;  4ZM8 A;  3K5T A;  4HZ9 B;  3AMO B;  3SXX A;  3FGY A;  3RGR A;  1JB5 A;  3NV0 A;  1TFO A;  3GZR A;  3FCS B;  3Q1C A;  4RNY A;  3WR2 A;  3CCU 3;  5ELJ A;  1BU4 A;  3SED A;  1W01 A;  1N9E A;  1NB3 I;  3F8H A;  2MC8 A;  2KF6 A;  5IEN A;  1A2V A;  1PU4 A;  1OGX A;  1W6G A;  2BMQ B;  1FGQ A;  1JZO A;  1ROA A;  1WNH A;  4O8S A;  2XSH B;  3T8U A;  1EQK A;  4G1M B;  3OWS A;  1NU3 A;  2INX A;  5CF2 A;  1B2Z A;  1RNT A;  1UGH I;  3DGO A;  2OTL 3;  1YGW A;  2B24 B;  1BRH A;  3LT8 A;  3WOE B;  1UCL A;  2OOV A;  1IVX A;  1X1X A;  1RGG A;  5JBS A;  2R4I A;  4BTY A;  3HII A;  1OGZ A;  4J5K A;  2P0M A;  5IW9 A;  3LT9 A;  1IK3 A;  3LTB A;  5ELU A;  4BL2 A;  2F86 B;  1IQY A;  1TP6 A;  4IPB A;  1WMP A;  1YVB I;  1Q40 B;  7RNT A;  1E97 A;  1VQO 3;  2KRT A;  3UL6 A;  1T5Y A;  2KAA A;  4HAA A;  4O02 B;  4DKI A;  3ZG0 A;  1RRL A;  5M19 A;  1RSN A;  3AHS A;  3GZY B;  1YJN 3;  1O7P B;  4K90 B;  1IQ8 A;  3SOY A;  1A2K A;  3GRD A;  3WMD A;  4HKV B;  3DZL A;  4K1U A;  4LYL B;  3MYT A;  2CFD A;  5CF1 A;  3AHW A;  1RNB A;  4EXR A;  3DM8 A;  8RNT A;  5M18 A;  1RGH A;  1BSA A;  2F56 A;  2H0I A;  2W03 A;  1BNJ A;  3D5G A;  2ML5 A;  3NBR A;  2UGI A;  4HM3 B;  1CQS A;  1MWU A;  2GSP A;  2LQV A;  1MOL A;  2P09 A;  4RBN A;  3CCR 3;  1A90 A;  3PGB A;  4R9K A;  3SX1 A;  5JPP A;  1IU7 A;  3WA2 X;  3CCE 3;  3AMO A;  3DGL A;  1GS3 A;  2E2V A;  3FSD A;  1BNS A;  1QVG 2;  1V58 A;  2IA7 A;  1EG9 B;  1PY3 A;  1K8A 4;  2CFL A;  4N6O B;  1ZO2 A;  3G71 3;  1YGE A;  1YJW 3;  2P38 A;  1QVF 2;  3CNM A;  1BUQ A;  1W4N A;  4MMX B;  3G8Z A;  3DY5 A;  3BB9 A;  1DET A;  1FYS A;  1UCK A;  5CXO A;  2YFJ B;  5FGO A;  4MJD A;  1T2H A;  1ROV A;  1V57 A;  1LOX A;  2XF3 A;  3URP A;  3UNL A;  1BAO A;  5BU4 A;  3PYJ A;  1W00 A;  1K28 A;  3BND A;  3OW2 2;  1YIJ 3;  1LQM B;  1MGW A;  2QEX 3;  1PYL A;  1YVS A;  3DUK A;  1I2E A;  3CCJ 3;  5AIG A;  2BMR B;  1LOW A;  5IG3 A;  1OUN A;  1MGR A;  1RCL A;  1V74 A;  3B7C A;  3X42 A;  5RNT A;  4Q53 A;  2FNQ A;  1VQ9 3;  1A2P A;  3V92 A;  1BSD A;  2M7O A;  4GL6 A;  4XDW A;  5IG4 A;  1DVD A;  5IEP A;  1GY5 A;  3SOA A;  1ASK A;  1U5O A;  3K0Z A;  2GBW B;  3MWZ A;  1W6C A;  2D42 A;  1DE3 A;  2W04 A;  1OH0 A;  1NO3 A;  1Q40 A;  1W02 A;  2O9U X;  2LYX A;  1LRA A;  5KP3 A;  1A67 A;  3CU3 A;  3D9R A;  2BMO B;  4I4K A;  3K63 A;  4HYZ A;  4FCJ A;  3V99 A;  2SBL A;  3WA3 A;  3ZG5 A;  1EKM A;  2GU3 A;  1G02 A;  4OK0 A;  1B20 A;  1LVN A;  1SJW A;  3UL5 A;  4CJN A;  3VF1 A;  2OQE C;  1Q86 4;  2CFW A;  1WTH A;  1I3F A;  4IIA A;  4IT7 A;  1D6U A;  3FKA A;  3GAX A;  3PXM A;  3HX8 A;  3CME 3;  1BSB A;  3X3X A;  4BTW A;  1UUW B;  1BNF A;  1AVK A;  4H61 A;  3WOD G;  3ECF A;  1QAL A;  3NUV A;  2RFR A;  1IV7 A;  2CC3 A;  3UB1 A;  1UW1 A;  5BXQ A;  1AV4 A;  4GB5 A;  1MNL A;  2RSX A;  3HIG A;  1JRQ A;  7GSP A;  1I2G A;  3G4S 3;  4NHF A;  2SAR A;  2CIU A;  1S72 3;  3E99 A;  4LEH A;  3OXA A;  4LZI A;  2F98 A;  1ISK A;  2RGQ A;  5I97 A;  2AAD A;  3FG1 A;  1LOV A;  1N5H A;  1B27 A;  3FF2 A;  1GD4 A;  1QJG A;  1X1W A;  1D6Y A;  2IY2 A;  3B4O A;  3LML A;  4WYK B;  4U13 A;  4X2H A;  5AEU B;  1IV9 A;  1GOU A;  1BRI A;  1UI7 A;  1GMQ A;  3EF8 A;  4FCZ A;  1B2X A;  1BAN A;  1LOY A;  1BNE A;  3KSE D;  4K1V A;  1UUG B;  1VQ7 3;  3EC9 A;  2CKF B;  5IG5 A;  1STD A;  3K9M C;  5KP1 A;  1CH0 A;  3I56 3;  1RGK A;  3AGO A;  1ULJ B;  3SLU A;  1ZGX A;  3MHE A;  3S27 A;  3FZW A;  1MWR A;  1BGS A;  1I3I A;  1EA2 A;  1N9J A;  2E2T A;  2W9P A;  3DH2 A;  3FG4 A;  5G1K A;  3NM7 A;  5GSP A;  1AR0 A;  3BU4 A;  1UI8 A;  1BSC A;  3PS8 A;  1DMM A;  3SVA A;  4L8P A;  3FLJ A;  1O7N B;  1JBS A;  3OWY A;  1BNR A;  5KP4 A;  1MWT A;  1HKX A;  4KFD A;  3F9S A;  1UDI I;  3NXJ A;  4R4K A;  1OHO A;  1UCI A;  2WOH A;  4HM1 B;  4N6U A;  3G16 A;  3Q2P A;  1O7H B;  5IEO A;  4J5G A;  4R80 A;  3GSP A;  3GZB A;  2YX9 A;  1VQ5 3; 
#chains in the Genus database with same CATH homology
 2XFT A;  3JVC A;  1D6Z A;  1VQ6 3;  3EJV A;  3EQQ B;  3MSO A;  5IG0 A;  3KSP A;  4HJL B;  1IVV A;  3S28 A;  1IQX A;  1RRH A;  3GZX B;  1K73 4;  1AVL A;  3CCL 3;  1DMN A;  1KWI A;  2CK3 H;  2ZDJ A;  5EVH A;  2GEX A;  2MF7 A;  4J8T A;  1NJI 4;  3JUO A;  1N8R 4;  4N6L A;  3NHX A;  3CC7 3;  1IT8 A;  1LNH A;  3U1W A;  2XSO B;  5AI1 A;  2STD A;  4KFF A;  2OCT A;  2W6J H;  2FXT A;  1VQK 3;  3LH4 A;  2OQE A;  3U97 A;  3NBJ A;  5D82 A;  4XB5 A;  1W7C A;  4HVN A;  1TUH A;  1TU5 A;  3CC2 3;  4MMZ B;  5LC7 A;  1UUV B;  3BNB A;  4N6N B;  2GBX B;  7STD A;  3NQZ A;  3F40 A;  1U8C B;  3NBB A;  2O3O A;  1RJO A;  4WYK A;  1OHP A;  2XEP A;  2YFI B;  3S29 A;  5EEO A;  4WP5 A;  1YJ9 3;  2HML B;  1JV2 B;  2CWT A;  1YI2 3;  1SIH A;  3EE1 A;  3H3H A;  4CCV A;  4WHA A;  1OCV A;  1M1X B;  1QMA A;  1JN5 B;  1W2Z A;  2OTJ 3;  2PZV A;  2FGT A;  2CFK A;  4KVH A;  1Z1S A;  3NM2 A;  3VGN A;  1OF5 A;  2WOF A;  5AEW B;  3EN1 B;  4RNZ A;  3N9H A;  3MG3 A;  3IMA B;  1C7H A;  4MMY B;  3B4P A;  3OX9 A;  3PCR A;  1WQL B;  3ER7 A;  2OOV C;  4XBT A;  4NRE A;  3HK4 A;  1Q7Y 4;  2XR8 B;  2QGU A;  3S67 A;  3T8N A;  4XDV A;  5A0O B;  3LTA A;  4O3V A;  3CCQ 3;  1M90 4;  4EBG A;  2GU1 A;  3ROB A;  4EV2 A;  2C11 A;  3IPT A;  1OAC A;  3D3L A;  4OVM A;  2W56 B;  5LC6 A;  1S5A A;  1VQL 3;  2XH9 A;  1O7G B;  2ML6 A;  5AYS C;  3QRD A;  3EHC A;  4AKZ A;  4AEQ A;  2W2C A;  3WOF B;  3CCM 3;  1VZZ A;  3EBY A;  2BNG A;  3DGN A;  1VQM 3;  5DRE A;  1DYU A;  3CCV 3;  2I9W A;  4KFE A;  1N5P A;  3EB8 A;  3N8B A;  1ULI B;  1VQ8 3;  2RCD A;  5JPU A;  1JKG B;  4X2O A;  1VQN 3;  1W2B 2;  3CNX A;  4HM0 B;  2Y73 A;  1GY7 A;  2CHC A;  2XFS A;  4L8O A;  2P0X A;  3TDG A;  4HM2 B;  3RDE A;  1HU9 A;  1JB4 A;  4HBR A;  1KC8 4;  5CK6 A;  3EBT A;  2HMM B;  3T0U A;  3F7S A;  4OUQ A;  2CWV A;  3B8L A;  4LMI A;  3JUN A;  3V98 A;  3MG1 A;  1IDP A;  3X3Z A;  3JUM A;  1JB2 A;  1OHS A;  4XBY A;  3X41 A;  4PEJ A;  4STD A;  1J2B A;  2BT3 A;  4R1K A;  1VQP 3;  1IT7 A;  2K0M A;  3BNC A;  1RN7 A;  8CHO A;  1JJ2 2;  1JN5 A;  1QAK A;  1W5Z A;  3A76 A;  3I0Y A;  4ORL A;  3N54 B;  3HZP A;  3WDG B;  3EX9 A;  3NQY A;  1WMO A;  3LYG A;  2CG0 A;  2HMN B;  3M8C A;  1IVU A;  3CPO A;  1WMN A;  2Q07 A;  4N6M A;  5FW5 A;  2P05 A;  2C10 A;  1NDO B;  1OF5 B;  3DXO A;  1N8Q A;  4FMA A;  3S5C A;  1SPU A;  2WGQ A;  4EYC A;  1NB5 I;  4H3U A;  4JF8 A;  1OPY A;  1W6Y A;  3LTD A;  1TIJ A;  3STD A;  2XGN A;  4WWU C;  4XBX A;  1R4C A;  1CYU A;  3UJM A;  2W56 A;  2IMJ A;  4L7K A;  5D81 A;  3FH1 A;  4CDL A;  1VQ4 3;  1L5G B;  3F8X A;  3G0K A;  5AIH A;  3LOY A;  2V1L A;  2GXF A;  3GWR A;  3H51 A;  3MPH A;  3LXU X;  1FUW A;  2A15 A;  3CMA 3;  1KD1 4;  1O7W B;  1FGO A;  1CYV A;  2WO0 A;  3X3Y A;  5AYR B;  4FMB A;  1JKG A;  1GYB A;  1Y4K A;  4R9L A;  2B1X B;  3OWU A;  2E2U A;  4N3V A;  3I55 3;  2CG1 A;  3CXC 2;  5TGN A;  2CFG A;  4FCM A;  4FR9 A;  4K61 A;  2JQ5 A;  3Q90 A;  3BLZ A;  5BVB A;  1KQS 2;  1QAF A;  3HI7 A;  2HMK B;  4HM7 B;  3K7C A;  4HM6 B;  3EN8 A;  3O8Y A;  2KCD A;  3L0R A;  1CEW I;  4HM8 B;  5STD A;  1Q82 4;  1G96 A;  1FGT A;  1E3R A;  1ZX2 A;  1DMQ A;  2F99 A;  2Z7A A;  3OV4 A;  4BTX A;  6STD A;  4EC6 A;  1DVC A;  3KN4 A;  3CD6 3;  2QIY A;  3BNE A;  2K54 A;  3ALA A;  3NX0 A;  4N6T A;  3PCS A;  2W0Q A;  2PNC A;  1NWW A;  4LGQ A;  4O2H A;  3CCS 3;  5IF6 A;  1Q81 4;  2CW9 A;  2XRX B;  2W9Q A;  1K41 A;  3KKG A;  1Q42 A;  2YFL B;  3KFQ C;  2Y74 A;  3NV0 B;  2ZL8 A;  2Z6B A;  1FA3 A;  4EV5 A;  3G6E 3;  3CC4 3;  3JUQ A;  1O7M B;  3KZT A;  1PFP A;  3MKI A;  4HM5 B;  3KII A;  4HM4 B;  4FMD A;  1KSI A;  3QK9 A;  5D83 A;  2Z77 A;  5G2G A;  3J7Y d;  1M9G A;  3CPW 2;  3LTC A;  2BO9 B;  4TX4 A;  1FGR A;  3F7X A;  2BHM A;  5AIF A;  2KXG A;  3F14 A;  5AII A;  1JNQ A;  3PZW A;  3X40 A;  5HGR A;  5IER A;  2JDI H;  2WGO A;  2CWU A;  2IUK A;  4AKY A;  5EQL A;  1IVW A;  1M1K 4;  3MG2 A;  1K9M 4;  3KE7 A;  1FGM A;  1GD3 A;  2UX0 A;  1STF I;  3JUP A;  3DMC A;  3VSY A;  5DRV A;  2D1W A;  3IJE B;  4N6V 0;  2GEY A;  1E3V A;  3FF0 A;  1YIT 3;  4LSO A;  1SII A;  1F8N A;  1LXE A;  2CH9 A;  3RGA A;  1US1 A;  4RZM A;  3FG3 A;  1SQW A;  3LZA A;  4J9A A;  2HMJ B;  1GY6 A;  2L4V A;  3DGM A;  4JRF A;  1TFK A;  2OWP A;  2XGL A;  4QWT A;  5CLK A;  1YHQ 3;  2HMO B;  2Z76 A;  2IUJ A;  1RKY A;  4XM4 A;  4WFO A;  4FMC A;  4MEI A;  4HZB B;  4KZ1 A;  2QA4 3;  4ZM8 A;  3K5T A;  4HZ9 B;  3AMO B;  3SXX A;  3FGY A;  3RGR A;  1JB5 A;  3NV0 A;  1TFO A;  3GZR A;  3FCS B;  3Q1C A;  4RNY A;  3CCU 3;  5ELJ A;  3SED A;  1W01 A;  1N9E A;  1NB3 I;  3F8H A;  2MC8 A;  5IEN A;  1A2V A;  1PU4 A;  1OGX A;  1W6G A;  2BMQ B;  1FGQ A;  1ROA A;  4O8S A;  1WNH A;  2XSH B;  3T8U A;  1EQK A;  4G1M B;  3OWS A;  1NU3 A;  2INX A;  5CF2 A;  2OTL 3;  3DGO A;  2B24 B;  3LT8 A;  3WOE B;  2OOV A;  1IVX A;  5JBS A;  2R4I A;  4BTY A;  3HII A;  1OGZ A;  2P0M A;  5IW9 A;  3LT9 A;  1IK3 A;  3LTB A;  5ELU A;  2F86 B;  1IQY A;  1TP6 A;  4IPB A;  1WMP A;  1YVB I;  1Q40 B;  1E97 A;  1VQO 3;  2KRT A;  3UL6 A;  1T5Y A;  4O02 B;  1RRL A;  3GZY B;  1YJN 3;  1O7P B;  4K90 B;  1IQ8 A;  3SOY A;  1A2K A;  3GRD A;  3WMD A;  4HKV B;  3DZL A;  4K1U A;  3MYT A;  2CFD A;  5CF1 A;  4EXR A;  3DM8 A;  2W03 A;  2ML5 A;  3NBR A;  4HM3 B;  1CQS A;  2LQV A;  1MOL A;  2P09 A;  4RBN A;  3CCR 3;  1A90 A;  3PGB A;  4R9K A;  3SX1 A;  5JPP A;  1IU7 A;  3WA2 X;  3CCE 3;  3AMO A;  3DGL A;  2E2V A;  1GS3 A;  3FSD A;  1QVG 2;  2IA7 A;  1EG9 B;  1K8A 4;  2CFL A;  4N6O B;  1ZO2 A;  3G71 3;  1YGE A;  1YJW 3;  2P38 A;  1QVF 2;  3CNM A;  1BUQ A;  1W4N A;  4MMX B;  3G8Z A;  3DY5 A;  3BB9 A;  5CXO A;  5FGO A;  2YFJ B;  4MJD A;  1ROV A;  1LOX A;  2XF3 A;  3UNL A;  3PYJ A;  1W00 A;  1K28 A;  3BND A;  3OW2 2;  1YIJ 3;  2QEX 3;  3DUK A;  3CCJ 3;  5AIG A;  2BMR B;  5IG3 A;  1OUN A;  3X42 A;  3B7C A;  1V74 A;  4Q53 A;  2FNQ A;  1VQ9 3;  3V92 A;  2M7O A;  4GL6 A;  4XDW A;  5IG4 A;  1DVD A;  5IEP A;  1GY5 A;  3SOA A;  1ASK A;  1U5O A;  3K0Z A;  2GBW B;  3MWZ A;  1W6C A;  2D42 A;  2W04 A;  1OH0 A;  1NO3 A;  1Q40 A;  1W02 A;  2O9U X;  2LYX A;  1A67 A;  5KP3 A;  3CU3 A;  3D9R A;  2BMO B;  4I4K A;  3K63 A;  4HYZ A;  4FCJ A;  3V99 A;  2SBL A;  3WA3 A;  1EKM A;  2GU3 A;  4OK0 A;  1LVN A;  1SJW A;  3UL5 A;  3VF1 A;  2OQE C;  1Q86 4;  2CFW A;  1WTH A;  4IIA A;  4IT7 A;  1D6U A;  3FKA A;  3GAX A;  3PXM A;  3HX8 A;  3CME 3;  3X3X A;  4BTW A;  1UUW B;  1AVK A;  4H61 A;  3WOD G;  3ECF A;  1QAL A;  3NUV A;  2RFR A;  1IV7 A;  2CC3 A;  3UB1 A;  1UW1 A;  5BXQ A;  1AV4 A;  4GB5 A;  1MNL A;  2RSX A;  3HIG A;  1JRQ A;  3G4S 3;  4NHF A;  2CIU A;  1S72 3;  3E99 A;  4LEH A;  3OXA A;  4LZI A;  2F98 A;  1ISK A;  2RGQ A;  5I97 A;  3FG1 A;  1N5H A;  3FF2 A;  1GD4 A;  1QJG A;  1D6Y A;  3B4O A;  3LML A;  4WYK B;  4X2H A;  4U13 A;  5AEU B;  1IV9 A;  1UI7 A;  3EF8 A;  4FCZ A;  3KSE D;  4K1V A;  1VQ7 3;  3EC9 A;  2CKF B;  5IG5 A;  1STD A;  3K9M C;  5KP1 A;  3I56 3;  1ULJ B;  3SLU A;  3MHE A;  3S27 A;  3FZW A;  1EA2 A;  1N9J A;  2E2T A;  2W9P A;  3FG4 A;  3NM7 A;  1AR0 A;  1UI8 A;  3PS8 A;  1DMM A;  3SVA A;  4L8P A;  3FLJ A;  1O7N B;  3OWY A;  5KP4 A;  4KFD A;  1HKX A;  3F9S A;  3NXJ A;  4R4K A;  1OHO A;  2WOH A;  4HM1 B;  4N6U A;  3G16 A;  3Q2P A;  1O7H B;  5IEO A;  4R80 A;  3GZB A;  2YX9 A;  1VQ5 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...