1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
3B4OA 1E97A 4K1UA 4X2OA 3MYTA 3H3HA 1OF5B 2I9WA 4Q53A 1JB4A 3UNLA 3F8XA 4PEJA 3EBYA 1ISKA 3GRDA 3NBRA 3STDA 4XBYA 1GY7A 5JPUA 2HMOB 1W00A 1ZO2A 3VGNA 4X2HA 4MJDA 3MG2A 5AIHA 4XM4A 1TP6A 3K7CA 2QIYA 2HMMB 3KKGA 3NXJA 8CHOA 3MHEA 4HM7B 3OXAA 4HZBB 1ZX2A 3LYGA 4IIAA 5IG3A 5G2GA 3NV0B 1W02A 2YFJB 3F14A 5CK6A 3NHXA 4HM6B 5FW5A 2Z7AA 3WMDA 5KP3A 2Z76A 4J9AA 3OWSA 1ASKA 2STDA 5AIGA 2B1XB 1UUWB 1ULJB 4H3UA 3EHCA 1HKXA 5JPPA 3FH1A 3RGAA 3G16A 1EA2A 1ULIB 3EC9A 5CLKA 1EG9B 1O7GB 3SOAA 2XR8B 3KZTA 1OGXA 4OVMA 5BVBA 4WWUC 5IG0A 1OUNA 1UUVB 1OPYA 2HMJB 4R9LA 2CHCA 4LGQA 3GZXB 3F7XA 3OV4A 5TGNA 1S5AA 2XSOB 5DREA 5IEPA 1GY6A 4K1VA 1E3RA 3B4PA 2HMKB 5IEOA 4U13A 1GY5A 3A76A 2XRXB 3DM8A 4J8TA 4L8PA 4HVNA 3OWUA 3NV0A 5EVHA 3EX9A 4FCJA 1K41A 2RGQA 3CPOA 4R1KA 3JUQA 4XDWA 1O7HB 3GZRA 4XBXA 2IMJA 3RGRA 4R9KA 3FF0A 3FSDA 5CF2A 2Z77A 2YFLB 2F86B 3LZAA 4HM5B 4N3VA 1JKGA 4HM3B 3B7CA 1Q42A 3NUVA 1NDOB 3KE7A 1DMQA 5AEWB 1JB2A 3FKAA 3BB9A 3ECFA 2HMNB 3EBTA 2BMRB 3JUMA 5AI1A 5CXOA 3M8CA 1AR0A 4HJLB 3EJVA 4WYKA 1GYBA 3ER7A 5IG4A 3SOYA 4HKVB 1JKGB 4HZ9B 1OGZA 1SJWA 5BXQA 1E3VA 4LMIA 4HM1B 2B24B 3D9RA 4WP5A 5CF1A 3HZPA 2GXFA 3DXOA 3JUOA 3IPTA 1JN5A 3OWYA 3DZLA 3HK4A 1A2KA 1DMMA 4XBTA 1OHSA 1OH0A 3HX8A 4OUQA 2QGUA 1NWWA 5KP1A 5D81A 4WYKB 3GZYB 1W6YA 3VSYA 2F98A 3MKIA 4HM2B 4RZMA 2R4IA 3EN1B 4ORLA 1VZZA 2UX0A 2CKFB 3H51A 5IF6A 1JN5B 3CNMA 2BMOB 5DRVA 1U5OA 3NM2A 2GEYA 4XDVA 2HMLB 3Q90A 4L7KA 3S5CA 4STDA 2W2CA 5IERA 3ROBA 6STDA 4LEHA 3MSOA 1QJGA 3F8HA 5HGRA 2RFRA 4GB5A 3EQQB 2GBXB 1QMAA 3FF2A 1W01A 3FZWA 4FCMA 4HM0B 3MG3A 2OWPA 4CDLA 5AEUB 3GWRA 2GBWB 1O7PB 1NU3A 1OHOA 3OX9A 2INXA 3DMCA 3FLJA 5AIIA 1JB5A 2YFIB 3E99A 5IENA 1GS3A 7STDA 2BNGA 3B8LA 3UJMA 3G8ZA 4I4KA 1STDA 1Z1SA 1WQLB 1TUHA 3DUKA 1IDPA 3KSPA 3BLZA 4L8OA 3F9SA 3GZBA 2BMQB 3CU3A 5STDA 3F40A 1OCVA 3T8NA 2A15A 4HM8B 1Q40A 1O7NB 2GEXA 3I0YA 1OHPA 1O7WB 3EN8A 1C7HA 2XSHB 3JUNA 2F99A 2K54A 3MG1A 3EF8A 1OF5A 3CNXA 5D83A 1DMNA 3F7SA 4XB5A 1BUQA 3T8UA 1CQSA 3JUPA 2PZVA 5AIFA 2RCDA 2JQ5A 3SEDA 5KP4A 3G0KA 4HM4B 1Q40B 3K0ZA 4KVHA 1O7MB 5D82A 5IG5A 3FGYA
chains in the Genus database with same CATH superfamily
3CCS3 4KFDA 1G0TA 2ML6A 3B4OA 1IV7A 1LRAA 1SIIA 1E97A 4K1UA 4J5KA 3ZG0A 2XGLA 4X2OA 3V98A 4IT7A 3EE1A 1JJ22 3CCM3 3MYTA 3H3HA 3N9HA 1OF5B 4HYZA 2I9WA 3AGOA 1RDSA 4Q53A 1LVNA 1JB4A 3UNLA 1I70A 1NO3A 1CYVA 2L4VA 3F8XA 4PEJA 4EXRA 2H0HA 2OQEC 1JBTA 1RSNA 1YGWA 3NM7A 1K734 3EBYA 2GU1A 2H0IA 1ISKA 1FUSA 3GRDA 3NBRA 3STDA 3DY5A 1I2GA 4XBYA 1GY7A 5G1LA 4EC6A 5JPUA 1N9EA 2XH9A 3ZFZA 2FXTA 2HMOB 4MMYB 2OTL3 1W00A 1ZO2A 4AKZA 2KRTA 2L1SA 4KZ1A 1FGQA 3PCRA 1PU4A 3VGNA 3CCJ3 1DVCA 4X2HA 1LQGC 3WOFB 1SIHA 4MJDA 3MG2A 5AIHA 3JVCA 4XM4A 1TP6A 3K7CA 2QIYA 3K5TA 4N6LA 1N5PA 2HMMB 3I553 1IT8A 1RNTA 3CC23 3KKGA 3NXJA 8CHOA 3MHEA 4HM7B 3OXAA 4HZBB 1RGEA 2XFSA 1M904 1SPUA 1T2IA 1ZX2A 3EB8A 3LYGA 4IIAA 4RNTA 5IG3A 1YHQ3 1RTUA 1MWTA 1V74A 2Y73A 4N6UA 5G2GA 1L5GB 3NV0B 2ZA4A 3O8YA 1W02A 2YFJB 3F14A 5CK6A 5LC6A 2WO0A 3SLUA 3NHXA 1LOYA 4HM6B 3RNTA 3OW22 2PNCA 1W7CA 5FW5A 3V99A 2LQVA 1FA3A 1IVUA 1RGKA 1UDII 4WHAA 2WGOA 2Z7AA 3FG3A 3URPA 4LZIA 3WMDA 4NHFA 1FGOA 5KP3A 1MGWA 2Z76A 5IW9A 3D5IA 3A5EA 4J9AA 3OWSA 1ASKA 2STDA 5AIGA 6GSPA 2B1XB 5BU4A 1UUWB 1CYUA 4FMBA 1ULJB 1IU7A 1IYYA 1BOXA 4H3UA 3EHCA 1VQP3 1HKXA 5JPPA 4GL6A 3FH1A 4EW5A 2CG1A 3RGAA 3G16A 1GD4A 2IUKA 3CCR3 1EA2A 3BNDA 3WDGB 5AYSC 1ULIB 1Q9EA 2BT3A 3D5GA 3EC9A 5CLKA 3X3XA 1IVWA 1EG9B 1O7GB 3DGOA 3SOAA 1K9M4 2XR8B 5ELUA 3KZTA 1OGXA 1YGEA 1N5HA 1B27A 1BSBA 4OVMA 5BVBA 4WWUC 2ML5A 1BRHA 5IG0A 1A2VA 1GOVA 3DGNA 4JRFA 1TRQA 5M1AA 3SVAA 2F5MA 1FUWA 1OUNA 4CCVA 1YIJ3 3AMOA 3ZG5A 1UUVB 3BNBA 2W03A 1OPYA 1I0VA 2HMJB 1DE3A 1QAFA 2F56A 4R9LA 1BNFA 3K9MC 2H0GA 2CHCA 4LGQA 3F7XA 3GZXB 4N6NB 4EV2A 3OV4A 3WOEB 4KFFA 2CFGA 5TGNA 1BU4A 1TIJA 1YJW3 1D6ZA 1BNSA 3BNCA 1S5AA 2K3DA 2XSOB 4QWTA 9RNTA 1BNIA 3PS8A 3NQYA 5DREA 5IEPA 1GY6A 4K1VA 1E3RA 1NB3I 1AQZA 2WOFA 2W0QA 3X41A 1BRGA 3TDGA 1KD14 2AAEA 3B4PA 1UGIA 2QA43 1RRLA 3VF1A 1G02A 4O2HA 2HMKB 5IEOA 1FGTA 1C54A 3LMLA 2C4BA 2P09A 4U13A 1GY5A 3V92A 1QAKA 1B3SA 2YX9A 4LYLB 1JV2B 3SXXA 3A76A 3ALAA 4J5GA 2XRXB 3DM8A 3UL6A 4J8TA 1VQ73 2BO9B 4L8PA 1AY7A 3U1WA 1QVF2 4HVNA 3OWUA 5M19A 3NV0A 4FMAA 3D3LA 3EX9A 1BVIA 1DETA 4FCJA 1F8NA 1K41A 2RGQA 3Q1CA 1K8A4 1AVLA 3KFQC 3CPOA 1I8VA 4R1KA 3WHOA 1BRIA 1RN7A 1W2B2 2E2TA 3CD63 1BNJA 1YI23 1NJI4 3JUQA 3KIIA 4XDWA 1O7HB 3AMOB 3DGLA 3GZRA 4XBXA 2IMJA 3RGRA 2XF3A 4R9KA 3FF0A 3FSDA 1US1A 3AHWA 2Y74A 4ILFA 5CF2A 1M1XB 2Z77A 2CFKA 2YFLB 2CX0A 4BL2A 2F86B 4N6TA 3LZAA 4HM5B 4N3VA 1UI7A 1JKGA 3QK9A 3CME3 4O3VA 1IV9A 4HM3B 3B7CA 3UL5A 2R41A 2OCTA 1Q42A 3PYJA 2BIRA 1BANA 3NUVA 1Q864 2KF4A 4R4KA 2ZL8A 1RGGA 1BSAA 1NDOB 5GSPA 4O02B 1T5YA 1BNEA 3KE7A 4RNYA 2CIUA 5RNTA 1BUJA 1YNVX 1DMQA 3DGMA 5AEWB 3D79A 1JB2A 1RGHA 1TFOA 2CW9A 3FKAA 2SBLA 2CG0A 1BRKA 1QALA 3BB9A 3ECFA 1RKYA 1UI8A 4GSPA 1NB5I 2HMNB 3EBTA 3N8BA 4N6OB 2CH9A 1HU9A 2BMRB 3JUMA 3LTBA 3NQZA 1UUGB 4I5QA 2CX1A 5AI1A 1GOYA 1BRNL 1RNBA 1FGRA 4GHOA 5CXOA 2FGTA 2KXGA 4EV5A 3M8CA 1W5ZA 1AR0A 4HJLB 3EJVA 4WYKA 1YJN3 2O3OA 3J7Yd 1I2FA 1ZGXA 1GYBA 3NX0A 2UGIA 3ER7A 1IK3A 5IG4A 2RBIA 5I97A 3BIRA 1JZDA 3AHSA 4R80A 1I0XA 2C11A 1RLSA 4KFEA 3SOYA 4FMDA 4HKVB 1JKGB 4HZ9B 4G1MB 1OGZA 2P05A 3I563 1UGHI 1FZUA 1LNHA 2FNQA 2KCDA 3SYUA 2BHMA 1KC84 1SJWA 5BXQA 3IMAB 5HOHA 1E3VA 4LMIA 1Q814 2CC3A 4HM1B 3X3ZA 2B24B 3N54B 1OACA 3D9RA 4WP5A 5CF1A 1BSCA 1BAOA 1FUTA 1JZOA 3HZPA 3MWZA 1X1WA 3S27A 5M18A 1FW7A 5ELJA 2GXFA 3DXOA 3GSPA 2Z6BA 3IPTA 3JUOA 2WGQA 1B21A 2F5WA 4HBRA 1JN5A 1PFPA 2LYXA 3KSED 3OWYA 3DZLA 1UCJA 2IYJA 2W9QA 4H61A 3HK4A 2OOVA 1A2KA 1DMMA 1B2ZA 1JBSA 1MNLA 1W6CA 4BTWA 4O8SA 1A90A 4XBTA 4MMXB 3Q3FA 1OHSA 3L0RA 1OH0A 3QRDA 1PY3A 3RDEA 1YVSA 1G96A 3HX8A 1RCKA 1JRQA 4OUQA 2QGUA 1GMPA 1KSIA 1NWWA 3LT8A 4MMZB 4AEQA 1RN1A 2XFTA 1SARA 2XGNA 5KP1A 4BTXA 1MWSA 3K63A 5D81A 4WYKB 5A0OB 1EQKA 1GSPA 3GZYB 1N9JA 3LTAA 3S28A 1W6YA 3BU4A 1W4NA 1M1K4 5EEOA 4KT3B 3VSYA 2F98A 2MF7A 1MOLA 5JBSA 1TJDA 4N6MA 3MKIA 2ZDJA 1VQN3 1Q7Y4 1BRSA 4HM2B 4RZMA 2W56A 1BNRA 2CWUA 2R4IA 3EN1B 1B2UA 1IVXA 1LOWA 4ORLA 1ROAA 1QVG2 4DKIA 1UCLA 2E2VA 1BIRA 1VZZA 3CC43 2WOHA 2UX0A 3HIIA 2W04A 2CFDA 2CKFB 2IY2A 3H51A 5IF6A 1JN5B 3CNMA 2BMOB 1NNVA 5DRVA 1U5OA 2CFWA 3NM2A 4FR9A 2GEYA 4XDVA 2HMLB 1D6YA 3Q90A 4L7KA 4LSOA 4TX4A 3S5CA 4STDA 2W2CA 2KF6A 5IERA 3CCU3 1TTOA 1RHLA 1V58A 1LNIA 2GU3A 3ROBA 1B2MA 6STDA 3PZWA 4LEHA 1X1YA 1YIT3 3MSOA 2AADA 1QJGA 5EVHA 2MC8A 1VQ83 1JBRA 3F8HA 2D1WA 2M7OA 2XEPA 5HGRA 3IJEB 3BNEA 3LTCA 2F4YA 4WFOA 2RFRA 1IQ8A 1HZ1A 3MPHA 4GB5A 5FGOA 3S67A 1GMQA 3EQQB 2GBXB 1QMAA 1RN4A 2V1LA 3FF2A 3FG1A 1VQK3 3HOHA 3LXUX 1W01A 1VQ63 3LT9A 1X1UA 3FZWA 1RCLA 1VQO3 4FCMA 6RNTA 4RNZA 2C10A 1RGFA 4HM0B 1AVKA 1IT7A 1S723 3CCV3 1GD3A 1VQL3 1N8QA 3MG3A 4FCZA 5EQLA 4ZM8A 4EYCA 2W56B 1UCKA 2OWPA 3PGBA 3LTDA 2CK3H 2E2UA 4CDLA 1MWUA 5AYRB 2P0MA 1Q7HA 3WODG 1IVVA 5AEUB 3GWRA 3CCQ3 2GSPA 2GBWB 1O7PB 2J8XB 5LC7A 3CCL3 3HIGA 2K0MA 2HOHA 1NU3A 1OHOA 2SARA 3OX9A 4MEIA 2INXA 3Q2PA 3HI7A 3S29A 3WR2A 1UCIA 8RNTA 1KQS2 4HAAA 1RGCA 1X1XA 2D42A 3DMCA 1LQMB 3FLJA 5AIIA 1R4YA 1JB5A 2W6JH 4N6V0 1TFKA 2YFIB 4NREA 1HYFA 2KF3A 1EEJA 3G6E3 1T2HA 3E99A 5IENA 1Y4KA 4OK0A 1VQ93 1T3BA 1N8R4 1GS3A 7RNTA 1IQYA 7STDA 2BNGA 3X42A 1ROVA 2CWVA 7GSPA 1U8CB 3CXC2 3LH4A 3SX1A 3B8LA 1TU5A 3UJMA 3G8ZA 3X40A 4I4KA 4BTYA 1J2BA 1RMSA 1ZS7A 1BRJA 1STDA 2CFLA 1Z1SA 1JNQA 1WQLB 3WA3A 1TUHA 2QEX3 3DUKA 1W2ZA 4RBNA 3CCE3 1IDPA 3KSPA 2UUGC 3BLZA 1A67A 1D6UA 3CPW2 4L8OA 2W9PA 3F9SA 3GZBA 2BMQB 4HOHA 3CU3A 5STDA 3WA2X 1STFI 1BNGA 2P0XA 2JDIH 1WMPA 1RGAA 3F40A 4AKYA 1OCVA 3T8NA 1WMOA 1YVBI 2A15A 1IQXA 3DH2A 1BSEA 3KN4A 3CC73 3CMA3 1TRPA 1GMRA 4HM8B 1FGMA 3NBJA 1VQ43 1Q40A 4NPBA 1O7NB 1WNHA 2GEXA 3I0YA 2O9UX 1OHPA 1RGLA 2KF5A 1O7WB 3AGNA 3EN8A 3GAXA 1C7HA 2XSHB 3T0UA 1CEWI 1RRHA 4JF8A 3JUNA 3LOYA 2OQEA 1VQM3 2IUJA 2F99A 2K54A 1R4CA 3FG4A 3MG1A 4K61A 1DYUA 1BGSA 3EF8A 3NBBA 1Q824 4BIRA 1LOVA 3D4AA 1B20A 1RJOA 1OF5A 3CNXA 2Q07A 3KCHA 5D83A 3PCSA 4FMCA 5BIRA 1AV4A 1PYLA 2IA7A 1WMNA 1DVDA 1DMNA 3F7SA 4XB5A 3DGYA 1FYSA 1YJ93 1I2EA 4CPKA 2P38A 1BUQA 2RSXA 3X3YA 1UW1A 3T8UA 1KWIA 3G4S3 1CQSA 1EKMA 3JUPA 4IPBA 1WTHA 2KAAA 1LXEA 2PZVA 5AIFA 1VQ53 1I3FA 2BU4A 1B2SA 2JQ5A 2RCDA 3SEDA 1CH0A 3U97A 5KP4A 1B2XA 4CJNA 3UB1A 3G0KA 4HM4B 4EBGA 4BU4A 1GOUA 2ZHXB 2CWTA 1I3IA 1A2PA 1W6GA 1VQQA 3FCSB 1M9GA 1Q40B 1LOXA 1V57A 2OTJ3 1K28A 1BSDA 4K90B 1SQWA 5G1KA 1MWRA 3K0ZA 2RNTA 3G713 4KVHA 1O7MB 1EUIC 4BL3A 5D82A 5IG5A 3FGYA 3PXMA 2OOVC 1MGRA
chains in the Genus database with same CATH topology
3CCS3 4KFDA 2ML6A 3B4OA 1IV7A 1SIIA 1E97A 4K1UA 2XGLA 4X2OA 3V98A 4IT7A 3EE1A 1JJ22 3CCM3 3MYTA 3H3HA 3N9HA 1OF5B 4HYZA 2I9WA 4Q53A 1LVNA 1JB4A 3UNLA 1NO3A 1CYVA 2L4VA 3F8XA 4PEJA 4EXRA 2OQEC 3NM7A 1K734 3EBYA 2GU1A 1ISKA 3GRDA 3NBRA 3STDA 3DY5A 4XBYA 1GY7A 4EC6A 5JPUA 1N9EA 2XH9A 2FXTA 2HMOB 4MMYB 2OTL3 1W00A 1ZO2A 4AKZA 2KRTA 4KZ1A 1FGQA 3PCRA 1PU4A 3VGNA 3CCJ3 1DVCA 4X2HA 3WOFB 1SIHA 4MJDA 3MG2A 5AIHA 3JVCA 4XM4A 1TP6A 3K7CA 2QIYA 3K5TA 4N6LA 1N5PA 2HMMB 3I553 1IT8A 3CC23 3KKGA 3NXJA 8CHOA 3MHEA 4HM7B 3OXAA 4HZBB 2XFSA 1M904 1SPUA 1ZX2A 3EB8A 3LYGA 4IIAA 5IG3A 1YHQ3 1V74A 2Y73A 4N6UA 5G2GA 1L5GB 3NV0B 3O8YA 1W02A 2YFJB 3F14A 5CK6A 5LC6A 2WO0A 3SLUA 3NHXA 4HM6B 3OW22 2PNCA 1W7CA 5FW5A 3V99A 2LQVA 1FA3A 1IVUA 4WHAA 2WGOA 2Z7AA 3FG3A 4LZIA 3WMDA 4NHFA 1FGOA 5KP3A 2Z76A 5IW9A 4J9AA 3OWSA 1ASKA 2STDA 5AIGA 2B1XB 1UUWB 1CYUA 4FMBA 1ULJB 1IU7A 4H3UA 3EHCA 1VQP3 1HKXA 5JPPA 4GL6A 3FH1A 2CG1A 3RGAA 3G16A 1GD4A 2IUKA 3CCR3 1EA2A 3BNDA 3WDGB 5AYSC 1ULIB 2BT3A 3EC9A 3X3XA 5CLKA 1IVWA 1EG9B 1O7GB 3DGOA 3SOAA 1K9M4 2XR8B 5ELUA 3KZTA 1OGXA 1YGEA 1N5HA 4OVMA 5BVBA 4WWUC 2ML5A 5IG0A 1A2VA 3DGNA 4JRFA 3SVAA 1FUWA 1OUNA 4CCVA 1YIJ3 3AMOA 1UUVB 3BNBA 2W03A 1OPYA 2HMJB 1QAFA 4R9LA 3K9MC 4N6NB 2CHCA 4LGQA 3F7XA 3GZXB 4EV2A 3OV4A 3WOEB 4KFFA 2CFGA 5TGNA 1TIJA 1YJW3 1D6ZA 3BNCA 1S5AA 2XSOB 4QWTA 3PS8A 3NQYA 5DREA 5IEPA 1GY6A 4K1VA 1E3RA 1NB3I 2WOFA 2W0QA 3X41A 1KD14 3TDGA 3B4PA 2QA43 1RRLA 3VF1A 4O2HA 2HMKB 5IEOA 1FGTA 3LMLA 2P09A 4U13A 1GY5A 3V92A 1QAKA 2YX9A 1JV2B 3SXXA 3A76A 3ALAA 2XRXB 3DM8A 3UL6A 4J8TA 1VQ73 2BO9B 4L8PA 3U1WA 1QVF2 4HVNA 3OWUA 3NV0A 4FMAA 3D3LA 3EX9A 4FCJA 5EVHA 1K8A4 1F8NA 1K41A 2RGQA 3Q1CA 1AVLA 3KFQC 3CPOA 4R1KA 1RN7A 1W2B2 3CD63 2E2TA 1YI23 1NJI4 3JUQA 3KIIA 4XDWA 1O7HB 3AMOB 3DGLA 3GZRA 4XBXA 2IMJA 3RGRA 2XF3A 4R9KA 3FF0A 3FSDA 1US1A 5CF2A 2Y74A 1M1XB 2Z77A 2YFLB 2F86B 4N6TA 3LZAA 4HM5B 4N3VA 1UI7A 1JKGA 3QK9A 3CME3 4O3VA 1IV9A 4HM3B 3B7CA 3UL5A 2OCTA 1Q42A 3PYJA 3NUVA 1Q864 4R4KA 2ZL8A 1NDOB 4O02B 1T5YA 3KE7A 4RNYA 2CIUA 1DMQA 3DGMA 5AEWB 1JB2A 1TFOA 2CW9A 3FKAA 2SBLA 2CG0A 1QALA 3BB9A 3ECFA 1RKYA 1UI8A 1NB5I 2HMNB 3EBTA 3N8BA 4N6OB 2CH9A 1HU9A 2BMRB 3JUMA 3LTBA 3NQZA 5AI1A 1FGRA 5CXOA 2FGTA 2KXGA 4EV5A 3M8CA 1W5ZA 1AR0A 4HJLB 3EJVA 4WYKA 1YJN3 2O3OA 3J7Yd 3NX0A 1GYBA 1IK3A 3ER7A 5IG4A 5I97A 4R80A 2C11A 4KFEA 3SOYA 4FMDA 4HKVB 1JKGB 4HZ9B 4G1MB 1OGZA 2P05A 3I563 2FNQA 1KC84 1LNHA 2KCDA 2BHMA 1SJWA 5BXQA 3IMAB 1E3VA 4LMIA 1Q814 2CC3A 4HM1B 3X3ZA 2B24B 3N54B 1OACA 3D9RA 4WP5A 5CF1A 3HZPA 3MWZA 3S27A 5ELJA 2GXFA 3DXOA 2Z6BA 3IPTA 3JUOA 2WGQA 4HBRA 1JN5A 1PFPA 2LYXA 3KSED 3OWYA 3DZLA 2OOVA 2W9QA 4H61A 3HK4A 1A2KA 1DMMA 1MNLA 1W6CA 4BTWA 4O8SA 1A90A 4XBTA 4MMXB 1OHSA 3L0RA 1OH0A 3QRDA 3RDEA 1G96A 3HX8A 1JRQA 4OUQA 2QGUA 1NWWA 1KSIA 3LT8A 4MMZB 4AEQA 2XFTA 2XGNA 5KP1A 4BTXA 3K63A 5D81A 4WYKB 5A0OB 1EQKA 3GZYB 1N9JA 3LTAA 3S28A 1W6YA 1W4NA 1M1K4 5EEOA 3VSYA 2F98A 2MF7A 1MOLA 5JBSA 4N6MA 3MKIA 2ZDJA 1VQN3 1Q7Y4 4HM2B 4RZMA 2W56A 2CWUA 2R4IA 3EN1B 1IVXA 4ORLA 1QVG2 1ROAA 2E2VA 1VZZA 3CC43 2WOHA 2UX0A 3HIIA 2W04A 2CFDA 2CKFB 3H51A 5IF6A 1JN5B 3CNMA 2BMOB 5DRVA 1U5OA 2CFWA 3NM2A 4FR9A 2GEYA 4XDVA 2HMLB 1D6YA 3Q90A 4L7KA 4LSOA 4TX4A 3S5CA 4STDA 2W2CA 5IERA 3CCU3 3ROBA 2GU3A 6STDA 3PZWA 4LEHA 1YIT3 3MSOA 1QJGA 1VQ83 2MC8A 3F8HA 2D1WA 2M7OA 2XEPA 5HGRA 3IJEB 3BNEA 3LTCA 4WFOA 3S67A 2RFRA 1IQ8A 3MPHA 4GB5A 5FGOA 3EQQB 2GBXB 1QMAA 2V1LA 1VQK3 3FF2A 3FG1A 3LXUX 1W01A 1VQ63 3LT9A 3FZWA 1VQO3 4FCMA 4RNZA 2C10A 4HM0B 1AVKA 1IT7A 1S723 3CCV3 1GD3A 1VQL3 1N8QA 3MG3A 4FCZA 5EQLA 4ZM8A 4EYCA 2W56B 3PGBA 2OWPA 3LTDA 2CK3H 2E2UA 4CDLA 5AYRB 2P0MA 3WODG 1IVVA 5AEUB 3GWRA 3CCQ3 2GBWB 1O7PB 5LC7A 3CCL3 3HIGA 2K0MA 1NU3A 1OHOA 3OX9A 4MEIA 2INXA 3Q2PA 3HI7A 3S29A 1KQS2 2D42A 3DMCA 3FLJA 5AIIA 1JB5A 2W6JH 4N6V0 1TFKA 2YFIB 4NREA 3G6E3 3E99A 5IENA 1Y4KA 4OK0A 1VQ93 1N8R4 1GS3A 1IQYA 7STDA 2BNGA 3X42A 1ROVA 2CWVA 1U8CB 3CXC2 3LH4A 3SX1A 3B8LA 1TU5A 3UJMA 3G8ZA 3X40A 4I4KA 4BTYA 1J2BA 1STDA 2CFLA 1Z1SA 1JNQA 1WQLB 3WA3A 1TUHA 2QEX3 3DUKA 1W2ZA 4RBNA 3CCE3 1IDPA 3KSPA 3BLZA 1A67A 1D6UA 3CPW2 4L8OA 2W9PA 3F9SA 3GZBA 2BMQB 3CU3A 5STDA 3WA2X 1STFI 2P0XA 2JDIH 1WMPA 3F40A 4AKYA 1OCVA 3T8NA 1WMOA 1YVBI 2A15A 1IQXA 3CC73 3KN4A 3CMA3 4HM8B 1FGMA 3NBJA 1VQ43 1Q40A 1O7NB 1WNHA 2GEXA 3I0YA 2O9UX 1OHPA 1O7WB 3EN8A 3GAXA 1C7HA 2XSHB 3T0UA 1CEWI 1RRHA 4JF8A 3JUNA 3LOYA 2OQEA 1VQM3 2IUJA 2F99A 2K54A 1R4CA 3FG4A 3MG1A 4K61A 1DYUA 3EF8A 3NBBA 1Q824 1RJOA 1OF5A 3CNXA 2Q07A 5D83A 3PCSA 4FMCA 1AV4A 2IA7A 1WMNA 1DVDA 1DMNA 3F7SA 4XB5A 1YJ93 2P38A 1BUQA 2RSXA 3X3YA 1UW1A 3T8UA 1KWIA 3G4S3 1CQSA 1EKMA 3JUPA 4IPBA 1WTHA 2PZVA 1LXEA 1VQ53 5AIFA 2RCDA 2JQ5A 3SEDA 3U97A 5KP4A 4EBGA 3UB1A 3G0KA 4HM4B 2CWTA 1W6GA 3FCSB 1M9GA 1Q40B 1LOXA 2OTJ3 1K28A 4K90B 1SQWA 3K0ZA 3G713 4KVHA 1O7MB 5D82A 5IG5A 3FGYA 3PXMA 2OOVC 2CFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4O A;  1E97 A;  4K1U A;  4X2O A;  3MYT A;  3H3H A;  1OF5 B;  2I9W A;  4Q53 A;  1JB4 A;  3UNL A;  3F8X A;  4PEJ A;  3EBY A;  1ISK A;  3GRD A;  3NBR A;  3STD A;  4XBY A;  1GY7 A;  5JPU A;  2HMO B;  1W00 A;  1ZO2 A;  3VGN A;  4X2H A;  4MJD A;  3MG2 A;  5AIH A;  4XM4 A;  1TP6 A;  3K7C A;  2QIY A;  2HMM B;  3KKG A;  3NXJ A;  8CHO A;  3MHE A;  4HM7 B;  3OXA A;  4HZB B;  1ZX2 A;  3LYG A;  4IIA A;  5IG3 A;  5G2G A;  3NV0 B;  1W02 A;  2YFJ B;  3F14 A;  5CK6 A;  3NHX A;  4HM6 B;  5FW5 A;  2Z7A A;  3WMD A;  5KP3 A;  2Z76 A;  4J9A A;  3OWS A;  1ASK A;  2STD A;  5AIG A;  2B1X B;  1UUW B;  1ULJ B;  4H3U A;  3EHC A;  1HKX A;  5JPP A;  3FH1 A;  3RGA A;  3G16 A;  1EA2 A;  1ULI B;  3EC9 A;  5CLK A;  1EG9 B;  1O7G B;  3SOA A;  2XR8 B;  3KZT A;  1OGX A;  4OVM A;  5BVB A;  4WWU C;  5IG0 A;  1OUN A;  1UUV B;  1OPY A;  2HMJ B;  4R9L A;  2CHC A;  4LGQ A;  3GZX B;  3F7X A;  3OV4 A;  5TGN A;  1S5A A;  2XSO B;  5DRE A;  5IEP A;  1GY6 A;  4K1V A;  1E3R A;  3B4P A;  2HMK B;  5IEO A;  4U13 A;  1GY5 A;  3A76 A;  2XRX B;  3DM8 A;  4J8T A;  4L8P A;  4HVN A;  3OWU A;  3NV0 A;  5EVH A;  3EX9 A;  4FCJ A;  1K41 A;  2RGQ A;  3CPO A;  4R1K A;  3JUQ A;  4XDW A;  1O7H B;  3GZR A;  4XBX A;  2IMJ A;  3RGR A;  4R9K A;  3FF0 A;  3FSD A;  5CF2 A;  2Z77 A;  2YFL B;  2F86 B;  3LZA A;  4HM5 B;  4N3V A;  1JKG A;  4HM3 B;  3B7C A;  1Q42 A;  3NUV A;  1NDO B;  3KE7 A;  1DMQ A;  5AEW B;  1JB2 A;  3FKA A;  3BB9 A;  3ECF A;  2HMN B;  3EBT A;  2BMR B;  3JUM A;  5AI1 A;  5CXO A;  3M8C A;  1AR0 A;  4HJL B;  3EJV A;  4WYK A;  1GYB A;  3ER7 A;  5IG4 A;  3SOY A;  4HKV B;  1JKG B;  4HZ9 B;  1OGZ A;  1SJW A;  5BXQ A;  1E3V A;  4LMI A;  4HM1 B;  2B24 B;  3D9R A;  4WP5 A;  5CF1 A;  3HZP A;  2GXF A;  3DXO A;  3JUO A;  3IPT A;  1JN5 A;  3OWY A;  3DZL A;  3HK4 A;  1A2K A;  1DMM A;  4XBT A;  1OHS A;  1OH0 A;  3HX8 A;  4OUQ A;  2QGU A;  1NWW A;  5KP1 A;  5D81 A;  4WYK B;  3GZY B;  1W6Y A;  3VSY A;  2F98 A;  3MKI A;  4HM2 B;  4RZM A;  2R4I A;  3EN1 B;  4ORL A;  1VZZ A;  2UX0 A;  2CKF B;  3H51 A;  5IF6 A;  1JN5 B;  3CNM A;  2BMO B;  5DRV A;  1U5O A;  3NM2 A;  2GEY A;  4XDV A;  2HML B;  3Q90 A;  4L7K A;  3S5C A;  4STD A;  2W2C A;  5IER A;  3ROB A;  6STD A;  4LEH A;  3MSO A;  1QJG A;  3F8H A;  5HGR A;  2RFR A;  4GB5 A;  3EQQ B;  2GBX B;  1QMA A;  3FF2 A;  1W01 A;  3FZW A;  4FCM A;  4HM0 B;  3MG3 A;  2OWP A;  4CDL A;  5AEU B;  3GWR A;  2GBW B;  1O7P B;  1NU3 A;  1OHO A;  3OX9 A;  2INX A;  3DMC A;  3FLJ A;  5AII A;  1JB5 A;  2YFI B;  3E99 A;  5IEN A;  1GS3 A;  7STD A;  2BNG A;  3B8L A;  3UJM A;  3G8Z A;  4I4K A;  1STD A;  1Z1S A;  1WQL B;  1TUH A;  3DUK A;  1IDP A;  3KSP A;  3BLZ A;  4L8O A;  3F9S A;  3GZB A;  2BMQ B;  3CU3 A;  5STD A;  3F40 A;  1OCV A;  3T8N A;  2A15 A;  4HM8 B;  1Q40 A;  1O7N B;  2GEX A;  3I0Y A;  1OHP A;  1O7W B;  3EN8 A;  1C7H A;  2XSH B;  3JUN A;  2F99 A;  2K54 A;  3MG1 A;  3EF8 A;  1OF5 A;  3CNX A;  5D83 A;  1DMN A;  3F7S A;  4XB5 A;  1BUQ A;  3T8U A;  1CQS A;  3JUP A;  2PZV A;  5AIF A;  2RCD A;  2JQ5 A;  3SED A;  5KP4 A;  3G0K A;  4HM4 B;  1Q40 B;  3K0Z A;  4KVH A;  1O7M B;  5D82 A;  5IG5 A;  3FGY A; 
#chains in the Genus database with same CATH topology
 3CCS 3;  4KFD A;  1G0T A;  2ML6 A;  3B4O A;  1IV7 A;  1LRA A;  1SII A;  1E97 A;  4K1U A;  4J5K A;  3ZG0 A;  2XGL A;  4X2O A;  3V98 A;  4IT7 A;  3EE1 A;  1JJ2 2;  3CCM 3;  3MYT A;  3H3H A;  3N9H A;  1OF5 B;  4HYZ A;  2I9W A;  3AGO A;  1RDS A;  4Q53 A;  1LVN A;  1JB4 A;  3UNL A;  1I70 A;  1NO3 A;  1CYV A;  2L4V A;  3F8X A;  4PEJ A;  4EXR A;  2H0H A;  2OQE C;  1JBT A;  1RSN A;  1YGW A;  3NM7 A;  1K73 4;  3EBY A;  2GU1 A;  2H0I A;  1ISK A;  1FUS A;  3GRD A;  3NBR A;  3STD A;  3DY5 A;  1I2G A;  4XBY A;  1GY7 A;  5G1L A;  4EC6 A;  5JPU A;  1N9E A;  2XH9 A;  3ZFZ A;  2FXT A;  2HMO B;  4MMY B;  2OTL 3;  1W00 A;  1ZO2 A;  4AKZ A;  2KRT A;  2L1S A;  4KZ1 A;  1FGQ A;  3PCR A;  1PU4 A;  3VGN A;  3CCJ 3;  1DVC A;  4X2H A;  1LQG C;  3WOF B;  1SIH A;  4MJD A;  3MG2 A;  5AIH A;  3JVC A;  4XM4 A;  1TP6 A;  3K7C A;  2QIY A;  3K5T A;  4N6L A;  1N5P A;  2HMM B;  3I55 3;  1IT8 A;  1RNT A;  3CC2 3;  3KKG A;  3NXJ A;  8CHO A;  3MHE A;  4HM7 B;  3OXA A;  4HZB B;  1RGE A;  2XFS A;  1M90 4;  1SPU A;  1T2I A;  1ZX2 A;  3EB8 A;  3LYG A;  4IIA A;  4RNT A;  5IG3 A;  1YHQ 3;  1RTU A;  1MWT A;  1V74 A;  2Y73 A;  4N6U A;  5G2G A;  1L5G B;  3NV0 B;  2ZA4 A;  3O8Y A;  1W02 A;  2YFJ B;  3F14 A;  5CK6 A;  5LC6 A;  2WO0 A;  3SLU A;  3NHX A;  1LOY A;  4HM6 B;  3RNT A;  3OW2 2;  2PNC A;  1W7C A;  5FW5 A;  3V99 A;  2LQV A;  1FA3 A;  1IVU A;  1RGK A;  1UDI I;  4WHA A;  2WGO A;  2Z7A A;  3FG3 A;  3URP A;  4LZI A;  3WMD A;  4NHF A;  1FGO A;  5KP3 A;  1MGW A;  2Z76 A;  5IW9 A;  3D5I A;  3A5E A;  4J9A A;  3OWS A;  1ASK A;  2STD A;  5AIG A;  6GSP A;  2B1X B;  5BU4 A;  1UUW B;  1CYU A;  4FMB A;  1ULJ B;  1IU7 A;  1IYY A;  1BOX A;  4H3U A;  3EHC A;  1VQP 3;  1HKX A;  5JPP A;  4GL6 A;  3FH1 A;  4EW5 A;  2CG1 A;  3RGA A;  3G16 A;  1GD4 A;  2IUK A;  3CCR 3;  1EA2 A;  3BND A;  3WDG B;  5AYS C;  1ULI B;  1Q9E A;  2BT3 A;  3D5G A;  3EC9 A;  5CLK A;  3X3X A;  1IVW A;  1EG9 B;  1O7G B;  3DGO A;  3SOA A;  1K9M 4;  2XR8 B;  5ELU A;  3KZT A;  1OGX A;  1YGE A;  1N5H A;  1B27 A;  1BSB A;  4OVM A;  5BVB A;  4WWU C;  2ML5 A;  1BRH A;  5IG0 A;  1A2V A;  1GOV A;  3DGN A;  4JRF A;  1TRQ A;  5M1A A;  3SVA A;  2F5M A;  1FUW A;  1OUN A;  4CCV A;  1YIJ 3;  3AMO A;  3ZG5 A;  1UUV B;  3BNB A;  2W03 A;  1OPY A;  1I0V A;  2HMJ B;  1DE3 A;  1QAF A;  2F56 A;  4R9L A;  1BNF A;  3K9M C;  2H0G A;  2CHC A;  4LGQ A;  3F7X A;  3GZX B;  4N6N B;  4EV2 A;  3OV4 A;  3WOE B;  4KFF A;  2CFG A;  5TGN A;  1BU4 A;  1TIJ A;  1YJW 3;  1D6Z A;  1BNS A;  3BNC A;  1S5A A;  2K3D A;  2XSO B;  4QWT A;  9RNT A;  1BNI A;  3PS8 A;  3NQY A;  5DRE A;  5IEP A;  1GY6 A;  4K1V A;  1E3R A;  1NB3 I;  1AQZ A;  2WOF A;  2W0Q A;  3X41 A;  1BRG A;  3TDG A;  1KD1 4;  2AAE A;  3B4P A;  1UGI A;  2QA4 3;  1RRL A;  3VF1 A;  1G02 A;  4O2H A;  2HMK B;  5IEO A;  1FGT A;  1C54 A;  3LML A;  2C4B A;  2P09 A;  4U13 A;  1GY5 A;  3V92 A;  1QAK A;  1B3S A;  2YX9 A;  4LYL B;  1JV2 B;  3SXX A;  3A76 A;  3ALA A;  4J5G A;  2XRX B;  3DM8 A;  3UL6 A;  4J8T A;  1VQ7 3;  2BO9 B;  4L8P A;  1AY7 A;  3U1W A;  1QVF 2;  4HVN A;  3OWU A;  5M19 A;  3NV0 A;  4FMA A;  3D3L A;  3EX9 A;  1BVI A;  1DET A;  4FCJ A;  1F8N A;  1K41 A;  2RGQ A;  3Q1C A;  1K8A 4;  1AVL A;  3KFQ C;  3CPO A;  1I8V A;  4R1K A;  3WHO A;  1BRI A;  1RN7 A;  1W2B 2;  2E2T A;  3CD6 3;  1BNJ A;  1YI2 3;  1NJI 4;  3JUQ A;  3KII A;  4XDW A;  1O7H B;  3AMO B;  3DGL A;  3GZR A;  4XBX A;  2IMJ A;  3RGR A;  2XF3 A;  4R9K A;  3FF0 A;  3FSD A;  1US1 A;  3AHW A;  2Y74 A;  4ILF A;  5CF2 A;  1M1X B;  2Z77 A;  2CFK A;  2YFL B;  2CX0 A;  4BL2 A;  2F86 B;  4N6T A;  3LZA A;  4HM5 B;  4N3V A;  1UI7 A;  1JKG A;  3QK9 A;  3CME 3;  4O3V A;  1IV9 A;  4HM3 B;  3B7C A;  3UL5 A;  2R41 A;  2OCT A;  1Q42 A;  3PYJ A;  2BIR A;  1BAN A;  3NUV A;  1Q86 4;  2KF4 A;  4R4K A;  2ZL8 A;  1RGG A;  1BSA A;  1NDO B;  5GSP A;  4O02 B;  1T5Y A;  1BNE A;  3KE7 A;  4RNY A;  2CIU A;  5RNT A;  1BUJ A;  1YNV X;  1DMQ A;  3DGM A;  5AEW B;  3D79 A;  1JB2 A;  1RGH A;  1TFO A;  2CW9 A;  3FKA A;  2SBL A;  2CG0 A;  1BRK A;  1QAL A;  3BB9 A;  3ECF A;  1RKY A;  1UI8 A;  4GSP A;  1NB5 I;  2HMN B;  3EBT A;  3N8B A;  4N6O B;  2CH9 A;  1HU9 A;  2BMR B;  3JUM A;  3LTB A;  3NQZ A;  1UUG B;  4I5Q A;  2CX1 A;  5AI1 A;  1GOY A;  1BRN L;  1RNB A;  1FGR A;  4GHO A;  5CXO A;  2FGT A;  2KXG A;  4EV5 A;  3M8C A;  1W5Z A;  1AR0 A;  4HJL B;  3EJV A;  4WYK A;  1YJN 3;  2O3O A;  3J7Y d;  1I2F A;  1ZGX A;  1GYB A;  3NX0 A;  2UGI A;  3ER7 A;  1IK3 A;  5IG4 A;  2RBI A;  5I97 A;  3BIR A;  1JZD A;  3AHS A;  4R80 A;  1I0X A;  2C11 A;  1RLS A;  4KFE A;  3SOY A;  4FMD A;  4HKV B;  1JKG B;  4HZ9 B;  4G1M B;  1OGZ A;  2P05 A;  3I56 3;  1UGH I;  1FZU A;  1LNH A;  2FNQ A;  2KCD A;  3SYU A;  2BHM A;  1KC8 4;  1SJW A;  5BXQ A;  3IMA B;  5HOH A;  1E3V A;  4LMI A;  1Q81 4;  2CC3 A;  4HM1 B;  3X3Z A;  2B24 B;  3N54 B;  1OAC A;  3D9R A;  4WP5 A;  5CF1 A;  1BSC A;  1BAO A;  1FUT A;  1JZO A;  3HZP A;  3MWZ A;  1X1W A;  3S27 A;  5M18 A;  1FW7 A;  5ELJ A;  2GXF A;  3DXO A;  3GSP A;  2Z6B A;  3IPT A;  3JUO A;  2WGQ A;  1B21 A;  2F5W A;  4HBR A;  1JN5 A;  1PFP A;  2LYX A;  3KSE D;  3OWY A;  3DZL A;  1UCJ A;  2IYJ A;  2W9Q A;  4H61 A;  3HK4 A;  2OOV A;  1A2K A;  1DMM A;  1B2Z A;  1JBS A;  1MNL A;  1W6C A;  4BTW A;  4O8S A;  1A90 A;  4XBT A;  4MMX B;  3Q3F A;  1OHS A;  3L0R A;  1OH0 A;  3QRD A;  1PY3 A;  3RDE A;  1YVS A;  1G96 A;  3HX8 A;  1RCK A;  1JRQ A;  4OUQ A;  2QGU A;  1GMP A;  1KSI A;  1NWW A;  3LT8 A;  4MMZ B;  4AEQ A;  1RN1 A;  2XFT A;  1SAR A;  2XGN A;  5KP1 A;  4BTX A;  1MWS A;  3K63 A;  5D81 A;  4WYK B;  5A0O B;  1EQK A;  1GSP A;  3GZY B;  1N9J A;  3LTA A;  3S28 A;  1W6Y A;  3BU4 A;  1W4N A;  1M1K 4;  5EEO A;  4KT3 B;  3VSY A;  2F98 A;  2MF7 A;  1MOL A;  5JBS A;  1TJD A;  4N6M A;  3MKI A;  2ZDJ A;  1VQN 3;  1Q7Y 4;  1BRS A;  4HM2 B;  4RZM A;  2W56 A;  1BNR A;  2CWU A;  2R4I A;  3EN1 B;  1B2U A;  1IVX A;  1LOW A;  4ORL A;  1ROA A;  1QVG 2;  4DKI A;  1UCL A;  2E2V A;  1BIR A;  1VZZ A;  3CC4 3;  2WOH A;  2UX0 A;  3HII A;  2W04 A;  2CFD A;  2CKF B;  2IY2 A;  3H51 A;  5IF6 A;  1JN5 B;  3CNM A;  2BMO B;  1NNV A;  5DRV A;  1U5O A;  2CFW A;  3NM2 A;  4FR9 A;  2GEY A;  4XDV A;  2HML B;  1D6Y A;  3Q90 A;  4L7K A;  4LSO A;  4TX4 A;  3S5C A;  4STD A;  2W2C A;  2KF6 A;  5IER A;  3CCU 3;  1TTO A;  1RHL A;  1V58 A;  1LNI A;  2GU3 A;  3ROB A;  1B2M A;  6STD A;  3PZW A;  4LEH A;  1X1Y A;  1YIT 3;  3MSO A;  2AAD A;  1QJG A;  5EVH A;  2MC8 A;  1VQ8 3;  1JBR A;  3F8H A;  2D1W A;  2M7O A;  2XEP A;  5HGR A;  3IJE B;  3BNE A;  3LTC A;  2F4Y A;  4WFO A;  2RFR A;  1IQ8 A;  1HZ1 A;  3MPH A;  4GB5 A;  5FGO A;  3S67 A;  1GMQ A;  3EQQ B;  2GBX B;  1QMA A;  1RN4 A;  2V1L A;  3FF2 A;  3FG1 A;  1VQK 3;  3HOH A;  3LXU X;  1W01 A;  1VQ6 3;  3LT9 A;  1X1U A;  3FZW A;  1RCL A;  1VQO 3;  4FCM A;  6RNT A;  4RNZ A;  2C10 A;  1RGF A;  4HM0 B;  1AVK A;  1IT7 A;  1S72 3;  3CCV 3;  1GD3 A;  1VQL 3;  1N8Q A;  3MG3 A;  4FCZ A;  5EQL A;  4ZM8 A;  4EYC A;  2W56 B;  1UCK A;  2OWP A;  3PGB A;  3LTD A;  2CK3 H;  2E2U A;  4CDL A;  1MWU A;  5AYR B;  2P0M A;  1Q7H A;  3WOD G;  1IVV A;  5AEU B;  3GWR A;  3CCQ 3;  2GSP A;  2GBW B;  1O7P B;  2J8X B;  5LC7 A;  3CCL 3;  3HIG A;  2K0M A;  2HOH A;  1NU3 A;  1OHO A;  2SAR A;  3OX9 A;  4MEI A;  2INX A;  3Q2P A;  3HI7 A;  3S29 A;  3WR2 A;  1UCI A;  8RNT A;  1KQS 2;  4HAA A;  1RGC A;  1X1X A;  2D42 A;  3DMC A;  1LQM B;  3FLJ A;  5AII A;  1R4Y A;  1JB5 A;  2W6J H;  4N6V 0;  1TFK A;  2YFI B;  4NRE A;  1HYF A;  2KF3 A;  1EEJ A;  3G6E 3;  1T2H A;  3E99 A;  5IEN A;  1Y4K A;  4OK0 A;  1VQ9 3;  1T3B A;  1N8R 4;  1GS3 A;  7RNT A;  1IQY A;  7STD A;  2BNG A;  3X42 A;  1ROV A;  2CWV A;  7GSP A;  1U8C B;  3CXC 2;  3LH4 A;  3SX1 A;  3B8L A;  1TU5 A;  3UJM A;  3G8Z A;  3X40 A;  4I4K A;  4BTY A;  1J2B A;  1RMS A;  1ZS7 A;  1BRJ A;  1STD A;  2CFL A;  1Z1S A;  1JNQ A;  1WQL B;  3WA3 A;  1TUH A;  2QEX 3;  3DUK A;  1W2Z A;  4RBN A;  3CCE 3;  1IDP A;  3KSP A;  2UUG C;  3BLZ A;  1A67 A;  1D6U A;  3CPW 2;  4L8O A;  2W9P A;  3F9S A;  3GZB A;  2BMQ B;  4HOH A;  3CU3 A;  5STD A;  3WA2 X;  1STF I;  1BNG A;  2P0X A;  2JDI H;  1WMP A;  1RGA A;  3F40 A;  4AKY A;  1OCV A;  3T8N A;  1WMO A;  1YVB I;  2A15 A;  1IQX A;  3DH2 A;  1BSE A;  3KN4 A;  3CC7 3;  3CMA 3;  1TRP A;  1GMR A;  4HM8 B;  1FGM A;  3NBJ A;  1VQ4 3;  1Q40 A;  4NPB A;  1O7N B;  1WNH A;  2GEX A;  3I0Y A;  2O9U X;  1OHP A;  1RGL A;  2KF5 A;  1O7W B;  3AGN A;  3EN8 A;  3GAX A;  1C7H A;  2XSH B;  3T0U A;  1CEW I;  1RRH A;  4JF8 A;  3JUN A;  3LOY A;  2OQE A;  1VQM 3;  2IUJ A;  2F99 A;  2K54 A;  1R4C A;  3FG4 A;  3MG1 A;  4K61 A;  1DYU A;  1BGS A;  3EF8 A;  3NBB A;  1Q82 4;  4BIR A;  1LOV A;  3D4A A;  1B20 A;  1RJO A;  1OF5 A;  3CNX A;  2Q07 A;  3KCH A;  5D83 A;  3PCS A;  4FMC A;  5BIR A;  1AV4 A;  1PYL A;  2IA7 A;  1WMN A;  1DVD A;  1DMN A;  3F7S A;  4XB5 A;  3DGY A;  1FYS A;  1YJ9 3;  1I2E A;  4CPK A;  2P38 A;  1BUQ A;  2RSX A;  3X3Y A;  1UW1 A;  3T8U A;  1KWI A;  3G4S 3;  1CQS A;  1EKM A;  3JUP A;  4IPB A;  1WTH A;  2KAA A;  1LXE A;  2PZV A;  5AIF A;  1VQ5 3;  1I3F A;  2BU4 A;  1B2S A;  2JQ5 A;  2RCD A;  3SED A;  1CH0 A;  3U97 A;  5KP4 A;  1B2X A;  4CJN A;  3UB1 A;  3G0K A;  4HM4 B;  4EBG A;  4BU4 A;  1GOU A;  2ZHX B;  2CWT A;  1I3I A;  1A2P A;  1W6G A;  1VQQ A;  3FCS B;  1M9G A;  1Q40 B;  1LOX A;  1V57 A;  2OTJ 3;  1K28 A;  1BSD A;  4K90 B;  1SQW A;  5G1K A;  1MWR A;  3K0Z A;  2RNT A;  3G71 3;  4KVH A;  1O7M B;  1EUI C;  4BL3 A;  5D82 A;  5IG5 A;  3FGY A;  3PXM A;  2OOV C;  1MGR A; 
#chains in the Genus database with same CATH homology
 3CCS 3;  4KFD A;  2ML6 A;  3B4O A;  1IV7 A;  1SII A;  1E97 A;  4K1U A;  2XGL A;  4X2O A;  3V98 A;  4IT7 A;  3EE1 A;  1JJ2 2;  3CCM 3;  3MYT A;  3H3H A;  3N9H A;  1OF5 B;  4HYZ A;  2I9W A;  4Q53 A;  1LVN A;  1JB4 A;  3UNL A;  1NO3 A;  1CYV A;  2L4V A;  3F8X A;  4PEJ A;  4EXR A;  2OQE C;  3NM7 A;  1K73 4;  3EBY A;  2GU1 A;  1ISK A;  3GRD A;  3NBR A;  3STD A;  3DY5 A;  4XBY A;  1GY7 A;  4EC6 A;  5JPU A;  1N9E A;  2XH9 A;  2FXT A;  2HMO B;  4MMY B;  2OTL 3;  1W00 A;  1ZO2 A;  4AKZ A;  2KRT A;  4KZ1 A;  1FGQ A;  3PCR A;  1PU4 A;  3VGN A;  3CCJ 3;  1DVC A;  4X2H A;  3WOF B;  1SIH A;  4MJD A;  3MG2 A;  5AIH A;  3JVC A;  4XM4 A;  1TP6 A;  3K7C A;  2QIY A;  3K5T A;  4N6L A;  1N5P A;  2HMM B;  3I55 3;  1IT8 A;  3CC2 3;  3KKG A;  3NXJ A;  8CHO A;  3MHE A;  4HM7 B;  3OXA A;  4HZB B;  2XFS A;  1M90 4;  1SPU A;  1ZX2 A;  3EB8 A;  3LYG A;  4IIA A;  5IG3 A;  1YHQ 3;  1V74 A;  2Y73 A;  4N6U A;  5G2G A;  1L5G B;  3NV0 B;  3O8Y A;  1W02 A;  2YFJ B;  3F14 A;  5CK6 A;  5LC6 A;  2WO0 A;  3SLU A;  3NHX A;  4HM6 B;  3OW2 2;  2PNC A;  1W7C A;  5FW5 A;  3V99 A;  2LQV A;  1FA3 A;  1IVU A;  4WHA A;  2WGO A;  2Z7A A;  3FG3 A;  4LZI A;  3WMD A;  4NHF A;  1FGO A;  5KP3 A;  2Z76 A;  5IW9 A;  4J9A A;  3OWS A;  1ASK A;  2STD A;  5AIG A;  2B1X B;  1UUW B;  1CYU A;  4FMB A;  1ULJ B;  1IU7 A;  4H3U A;  3EHC A;  1VQP 3;  1HKX A;  5JPP A;  4GL6 A;  3FH1 A;  2CG1 A;  3RGA A;  3G16 A;  1GD4 A;  2IUK A;  3CCR 3;  1EA2 A;  3BND A;  3WDG B;  5AYS C;  1ULI B;  2BT3 A;  3EC9 A;  3X3X A;  5CLK A;  1IVW A;  1EG9 B;  1O7G B;  3DGO A;  3SOA A;  1K9M 4;  2XR8 B;  5ELU A;  3KZT A;  1OGX A;  1YGE A;  1N5H A;  4OVM A;  5BVB A;  4WWU C;  2ML5 A;  5IG0 A;  1A2V A;  3DGN A;  4JRF A;  3SVA A;  1FUW A;  1OUN A;  4CCV A;  1YIJ 3;  3AMO A;  1UUV B;  3BNB A;  2W03 A;  1OPY A;  2HMJ B;  1QAF A;  4R9L A;  3K9M C;  4N6N B;  2CHC A;  4LGQ A;  3F7X A;  3GZX B;  4EV2 A;  3OV4 A;  3WOE B;  4KFF A;  2CFG A;  5TGN A;  1TIJ A;  1YJW 3;  1D6Z A;  3BNC A;  1S5A A;  2XSO B;  4QWT A;  3PS8 A;  3NQY A;  5DRE A;  5IEP A;  1GY6 A;  4K1V A;  1E3R A;  1NB3 I;  2WOF A;  2W0Q A;  3X41 A;  1KD1 4;  3TDG A;  3B4P A;  2QA4 3;  1RRL A;  3VF1 A;  4O2H A;  2HMK B;  5IEO A;  1FGT A;  3LML A;  2P09 A;  4U13 A;  1GY5 A;  3V92 A;  1QAK A;  2YX9 A;  1JV2 B;  3SXX A;  3A76 A;  3ALA A;  2XRX B;  3DM8 A;  3UL6 A;  4J8T A;  1VQ7 3;  2BO9 B;  4L8P A;  3U1W A;  1QVF 2;  4HVN A;  3OWU A;  3NV0 A;  4FMA A;  3D3L A;  3EX9 A;  4FCJ A;  5EVH A;  1K8A 4;  1F8N A;  1K41 A;  2RGQ A;  3Q1C A;  1AVL A;  3KFQ C;  3CPO A;  4R1K A;  1RN7 A;  1W2B 2;  3CD6 3;  2E2T A;  1YI2 3;  1NJI 4;  3JUQ A;  3KII A;  4XDW A;  1O7H B;  3AMO B;  3DGL A;  3GZR A;  4XBX A;  2IMJ A;  3RGR A;  2XF3 A;  4R9K A;  3FF0 A;  3FSD A;  1US1 A;  5CF2 A;  2Y74 A;  1M1X B;  2Z77 A;  2YFL B;  2F86 B;  4N6T A;  3LZA A;  4HM5 B;  4N3V A;  1UI7 A;  1JKG A;  3QK9 A;  3CME 3;  4O3V A;  1IV9 A;  4HM3 B;  3B7C A;  3UL5 A;  2OCT A;  1Q42 A;  3PYJ A;  3NUV A;  1Q86 4;  4R4K A;  2ZL8 A;  1NDO B;  4O02 B;  1T5Y A;  3KE7 A;  4RNY A;  2CIU A;  1DMQ A;  3DGM A;  5AEW B;  1JB2 A;  1TFO A;  2CW9 A;  3FKA A;  2SBL A;  2CG0 A;  1QAL A;  3BB9 A;  3ECF A;  1RKY A;  1UI8 A;  1NB5 I;  2HMN B;  3EBT A;  3N8B A;  4N6O B;  2CH9 A;  1HU9 A;  2BMR B;  3JUM A;  3LTB A;  3NQZ A;  5AI1 A;  1FGR A;  5CXO A;  2FGT A;  2KXG A;  4EV5 A;  3M8C A;  1W5Z A;  1AR0 A;  4HJL B;  3EJV A;  4WYK A;  1YJN 3;  2O3O A;  3J7Y d;  3NX0 A;  1GYB A;  1IK3 A;  3ER7 A;  5IG4 A;  5I97 A;  4R80 A;  2C11 A;  4KFE A;  3SOY A;  4FMD A;  4HKV B;  1JKG B;  4HZ9 B;  4G1M B;  1OGZ A;  2P05 A;  3I56 3;  2FNQ A;  1KC8 4;  1LNH A;  2KCD A;  2BHM A;  1SJW A;  5BXQ A;  3IMA B;  1E3V A;  4LMI A;  1Q81 4;  2CC3 A;  4HM1 B;  3X3Z A;  2B24 B;  3N54 B;  1OAC A;  3D9R A;  4WP5 A;  5CF1 A;  3HZP A;  3MWZ A;  3S27 A;  5ELJ A;  2GXF A;  3DXO A;  2Z6B A;  3IPT A;  3JUO A;  2WGQ A;  4HBR A;  1JN5 A;  1PFP A;  2LYX A;  3KSE D;  3OWY A;  3DZL A;  2OOV A;  2W9Q A;  4H61 A;  3HK4 A;  1A2K A;  1DMM A;  1MNL A;  1W6C A;  4BTW A;  4O8S A;  1A90 A;  4XBT A;  4MMX B;  1OHS A;  3L0R A;  1OH0 A;  3QRD A;  3RDE A;  1G96 A;  3HX8 A;  1JRQ A;  4OUQ A;  2QGU A;  1NWW A;  1KSI A;  3LT8 A;  4MMZ B;  4AEQ A;  2XFT A;  2XGN A;  5KP1 A;  4BTX A;  3K63 A;  5D81 A;  4WYK B;  5A0O B;  1EQK A;  3GZY B;  1N9J A;  3LTA A;  3S28 A;  1W6Y A;  1W4N A;  1M1K 4;  5EEO A;  3VSY A;  2F98 A;  2MF7 A;  1MOL A;  5JBS A;  4N6M A;  3MKI A;  2ZDJ A;  1VQN 3;  1Q7Y 4;  4HM2 B;  4RZM A;  2W56 A;  2CWU A;  2R4I A;  3EN1 B;  1IVX A;  4ORL A;  1QVG 2;  1ROA A;  2E2V A;  1VZZ A;  3CC4 3;  2WOH A;  2UX0 A;  3HII A;  2W04 A;  2CFD A;  2CKF B;  3H51 A;  5IF6 A;  1JN5 B;  3CNM A;  2BMO B;  5DRV A;  1U5O A;  2CFW A;  3NM2 A;  4FR9 A;  2GEY A;  4XDV A;  2HML B;  1D6Y A;  3Q90 A;  4L7K A;  4LSO A;  4TX4 A;  3S5C A;  4STD A;  2W2C A;  5IER A;  3CCU 3;  3ROB A;  2GU3 A;  6STD A;  3PZW A;  4LEH A;  1YIT 3;  3MSO A;  1QJG A;  1VQ8 3;  2MC8 A;  3F8H A;  2D1W A;  2M7O A;  2XEP A;  5HGR A;  3IJE B;  3BNE A;  3LTC A;  4WFO A;  3S67 A;  2RFR A;  1IQ8 A;  3MPH A;  4GB5 A;  5FGO A;  3EQQ B;  2GBX B;  1QMA A;  2V1L A;  1VQK 3;  3FF2 A;  3FG1 A;  3LXU X;  1W01 A;  1VQ6 3;  3LT9 A;  3FZW A;  1VQO 3;  4FCM A;  4RNZ A;  2C10 A;  4HM0 B;  1AVK A;  1IT7 A;  1S72 3;  3CCV 3;  1GD3 A;  1VQL 3;  1N8Q A;  3MG3 A;  4FCZ A;  5EQL A;  4ZM8 A;  4EYC A;  2W56 B;  3PGB A;  2OWP A;  3LTD A;  2CK3 H;  2E2U A;  4CDL A;  5AYR B;  2P0M A;  3WOD G;  1IVV A;  5AEU B;  3GWR A;  3CCQ 3;  2GBW B;  1O7P B;  5LC7 A;  3CCL 3;  3HIG A;  2K0M A;  1NU3 A;  1OHO A;  3OX9 A;  4MEI A;  2INX A;  3Q2P A;  3HI7 A;  3S29 A;  1KQS 2;  2D42 A;  3DMC A;  3FLJ A;  5AII A;  1JB5 A;  2W6J H;  4N6V 0;  1TFK A;  2YFI B;  4NRE A;  3G6E 3;  3E99 A;  5IEN A;  1Y4K A;  4OK0 A;  1VQ9 3;  1N8R 4;  1GS3 A;  1IQY A;  7STD A;  2BNG A;  3X42 A;  1ROV A;  2CWV A;  1U8C B;  3CXC 2;  3LH4 A;  3SX1 A;  3B8L A;  1TU5 A;  3UJM A;  3G8Z A;  3X40 A;  4I4K A;  4BTY A;  1J2B A;  1STD A;  2CFL A;  1Z1S A;  1JNQ A;  1WQL B;  3WA3 A;  1TUH A;  2QEX 3;  3DUK A;  1W2Z A;  4RBN A;  3CCE 3;  1IDP A;  3KSP A;  3BLZ A;  1A67 A;  1D6U A;  3CPW 2;  4L8O A;  2W9P A;  3F9S A;  3GZB A;  2BMQ B;  3CU3 A;  5STD A;  3WA2 X;  1STF I;  2P0X A;  2JDI H;  1WMP A;  3F40 A;  4AKY A;  1OCV A;  3T8N A;  1WMO A;  1YVB I;  2A15 A;  1IQX A;  3CC7 3;  3KN4 A;  3CMA 3;  4HM8 B;  1FGM A;  3NBJ A;  1VQ4 3;  1Q40 A;  1O7N B;  1WNH A;  2GEX A;  3I0Y A;  2O9U X;  1OHP A;  1O7W B;  3EN8 A;  3GAX A;  1C7H A;  2XSH B;  3T0U A;  1CEW I;  1RRH A;  4JF8 A;  3JUN A;  3LOY A;  2OQE A;  1VQM 3;  2IUJ A;  2F99 A;  2K54 A;  1R4C A;  3FG4 A;  3MG1 A;  4K61 A;  1DYU A;  3EF8 A;  3NBB A;  1Q82 4;  1RJO A;  1OF5 A;  3CNX A;  2Q07 A;  5D83 A;  3PCS A;  4FMC A;  1AV4 A;  2IA7 A;  1WMN A;  1DVD A;  1DMN A;  3F7S A;  4XB5 A;  1YJ9 3;  2P38 A;  1BUQ A;  2RSX A;  3X3Y A;  1UW1 A;  3T8U A;  1KWI A;  3G4S 3;  1CQS A;  1EKM A;  3JUP A;  4IPB A;  1WTH A;  2PZV A;  1LXE A;  1VQ5 3;  5AIF A;  2RCD A;  2JQ5 A;  3SED A;  3U97 A;  5KP4 A;  4EBG A;  3UB1 A;  3G0K A;  4HM4 B;  2CWT A;  1W6G A;  3FCS B;  1M9G A;  1Q40 B;  1LOX A;  2OTJ 3;  1K28 A;  4K90 B;  1SQW A;  3K0Z A;  3G71 3;  4KVH A;  1O7M B;  5D82 A;  5IG5 A;  3FGY A;  3PXM A;  2OOV C;  2CFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...