1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
3OWUA 5G2GA 5IG5A 3CPOA 4U13A 3UJMA 4R9LA 3E99A 4KVHA 3GZRA 4PEJA 1E3RA 1W00A 3DMCA 4HZBB 2B1XB 3F7XA 4J8TA 4R1KA 5BVBA 3RGRA 3OWSA 3H3HA 3NBRA 5AIHA 3GRDA 1E97A 4XDWA 3VSYA 5AIIA 5KP3A 5IF6A 5CF1A 2B24B 2GBWB 3MG3A 3IPTA 1WQLB 1TUHA 1O7WB 2XR8B 4I4KA 8CHOA 5KP4A 1ISKA 3T8UA 3DZLA 3NHXA 4X2OA 1Q40B 3F40A 3MG2A 3EN1B 4XM4A 1OF5B 1OGXA 3B7CA 3EX9A 3KSPA 4HM3B 3ROBA 5JPPA 1UUWB 5FW5A 2XSOB 2HMLB 3DUKA 3FZWA 4HKVB 1OHOA 5BXQA 5EVHA 1Q42A 3JUOA 4OVMA 3F8XA 4HM6B 4HM4B 1VZZA 4IIAA 3NM2A 3MHEA 4X2HA 1W01A 3WMDA 1EA2A 1W02A 2OWPA 2GEXA 3EC9A 4HM2B 3B4PA 3GZYB 4HM0B 4RZMA 5AI1A 3SOYA 3I0YA 1K41A 3FSDA 1JN5A 4XDVA 1OCVA 2K54A 2Z76A 3NV0A 2HMKB 3GZBA 3Q90A 5TGNA 2Z7AA 4XBYA 1O7HB 2UX0A 2BNGA 1ULJB 4FCMA 1O7MB 5DREA 3NXJA 1EG9B 4WWUC 1QJGA 2PZVA 4LMIA 5D83A 4MJDA 2RCDA 3D9RA 3UNLA 3EHCA 1JN5B 4GB5A 2XSHB 3SEDA 3NUVA 3NV0B 3HX8A 1OPYA 2A15A 3B4OA 3EF8A 4HM1B 4HVNA 4XBXA 5CXOA 5DRVA 1GY5A 3F14A 1E3VA 2BMQB 1CQSA 1NDOB 1GY6A 4N3VA 4HM5B 3ER7A 3K7CA 3OV4A 3STDA 1UUVB 5AIGA 5IENA 5AEWB 3FF0A 3MYTA 3HZPA 2HMNB 4HM8B 4HZ9B 1JKGA 2RGQA 4FCJA 3DM8A 4H3UA 5AIFA 2YFLB 3F9SA 4WP5A 3KZTA 5IERA 3JUNA 5IEPA 5KP1A 3T8NA 1DMNA 3S5CA 4L7KA 2W2CA 3LYGA 3MSOA 2F86B 2STDA 3CNXA 3G0KA 3EBTA 3VGNA 1STDA 2IMJA 2I9WA 1GYBA 2Z77A 4HM7B 1OH0A 1Z1SA 1OGZA 1Q40A 3JUQA 3GZXB 3FF2A 1O7GB 5JPUA 5CLKA 3MKIA 1GS3A 1HKXA 3K0ZA 3A76A 2QIYA 2GBXB 3DXOA 3FGYA 4L8OA 4WYKA 1SJWA 3FH1A 2GXFA 5CK6A 3FLJA 1DMQA 1NWWA 1ULIB 2CHCA 3MG1A 1OF5A 1TP6A 3OWYA 3JUMA 4K1UA 5IEOA 3EBYA 5AEUB 5IG4A 5CF2A 2HMOB 3ECFA 5HGRA 3JUPA 2BMRB 1S5AA 1JB4A 3BLZA 1QMAA 3GWRA 4STDA 3HK4A 3KKGA 4XB5A 3B8LA 4XBTA 2R4IA 1IDPA 3FKAA 2RFRA 4CDLA 4L8PA 1JKGB 3G8ZA 3F8HA 1BUQA 1W6YA 4R9KA 5STDA 4K1VA 3RGAA 3EN8A 3H51A 4LGQA 1U5OA 2YFJB 4WYKB 1O7NB 1ASKA 1GY7A 3OX9A 5D81A 5IG0A 2HMMB 3SOAA 1OHSA 2BMOB 3LZAA 3OXAA 7STDA 3EQQB 1A2KA 3CU3A 1ZX2A 4OUQA 5D82A 1DMMA 1O7PB 4LEHA 4Q53A 6STDA 2YFIB 3BB9A 4ORLA 1OHPA 3M8CA 3F7SA 1OUNA 2F98A 2F99A 1AR0A 2XRXB 2CKFB 1C7HA 1JB5A 1ZO2A 2QGUA 2GEYA 1JB2A 2HMJB 3EJVA 4HJLB 3CNMA 3KE7A 2JQ5A 2INXA 4J9AA 5IG3A 3G16A 1NU3A
chains in the Genus database with same CATH superfamily
3WOFB 2SBLA 3GSPA 1N5PA 3E99A 4KVHA 1TRQA 1N5HA 1RRHA 1W00A 1STFI 2MC8A 4R1KA 2CX0A 1US1A 1W6GA 1Q864 2H0HA 1MWRA 2KRTA 4XDWA 3HOHA 2OCTA 3VSYA 1W4NA 3CCM3 1K8A4 1B2XA 1ZGXA 3MG3A 4EW5A 2XR8B 1ROAA 2W9PA 3PZWA 1FGRA 1ISKA 3I563 2W9QA 3G4S3 2K3DA 2KF3A 1UCIA 1BIRA 1YHQ3 1RNBA 1Q40B 3MG2A 4XM4A 1LVNA 4MMZB 3ZFZA 2XSOB 3DUKA 1M1XB 3FZWA 3O8YA 3LOYA 1N9JA 1Q42A 1UUGB 2J8XB 2W04A 4OVMA 4R4KA 4HM6B 5BIRA 7GSPA 1VZZA 2F5MA 1I3IA 1W01A 1EA2A 1W02A 2OWPA 3EC9A 3DGYA 3KIIA 5AI1A 3X41A 1BSBA 1GD4A 1LQMB 1Y4KA 1JN5A 2Y73A 3HIGA 5GSPA 1NB3I 3NV0A 3Q90A 2HMKB 5TGNA 2ZHXB 1LOYA 4XBYA 3AMOA 4CJNA 2KXGA 4HYZA 2OOVA 1EG9B 4WWUC 5D83A 4AKYA 4H61A 2H0IA 1R4CA 2P38A 2CK3H 2XSHB 1FA3A 3NV0B 3HX8A 2P0MA 3B4OA 3EF8A 4BTWA 1IT7A 4N6V0 1GY5A 3F14A 1E3VA 3AMOB 3AGOA 3MPHA 3FG4A 4N3VA 1UCJA 3K7CA 1UCKA 1UUVB 3WOEB 3FF0A 3NX0A 5A0OB 3HZPA 3CCL3 2CFKA 2RGQA 3WA2X 2IY2A 4H3UA 1UI8A 5ELJA 1RGAA 3F9SA 4EC6A 3NQZA 4GL6A 1K9M4 1QVF2 1LOXA 3MWZA 2W2CA 2F86B 2STDA 1MWTA 3CNXA 1STDA 2IMJA 1GYBA 1T5YA 4N6TA 1Q40A 3JUQA 1SIIA 1BSDA 1HKXA 3A76A 2IA7A 2CFLA 1BSEA 1N8QA 1SJWA 4BU4A 1YIJ3 5CK6A 1NWWA 2CFWA 4K1UA 1TP6A 1EQKA 1LOVA 1RGGA 1KSIA 1RLSA 4ZM8A 3JUPA 2BMRB 4STDA 2E2VA 4EYCA 3GWRA 3UL6A 4XB5A 1RGCA 4XBTA 2RFRA 2CWTA 1JKGB 3PGBA 1GMRA 3N54B 1B2UA 2BT3A 4MMYB 4R9KA 5LC6A 4K1VA 4O3VA 3U97A 3H51A 1U5OA 3BNCA 4LZIA 1BNJA 1V74A 1ASKA 1KD14 3SOAA 1MWSA 1IQYA 1RRLA 4O02B 3EQQB 1A2KA 1BRIA 1X1WA 6STDA 2WO0A 5G1KA 1VQP3 1RGFA 2WOHA 1ZS7A 3Q3FA 1OHPA 1B20A 5G2GA 1IVUA 2F99A 2XRXB 3S28A 1JB5A 4NHFA 1JB2A 1DE3A 1CYVA 4FR9A 2UGIA 1RTUA 3RDEA 1TTOA 1RGHA 3WHOA 4J9AA 3PXMA 1SIHA 2P09A 2XF3A 1RGKA 4ILFA 2OTJ3 2UUGC 1YJN3 1G96A 1GOUA 2ML6A 2E2UA 3GZRA 4PEJA 3UB1A 1E3RA 4FMDA 4J8TA 2OQEA 3U1WA 2JDIH 5BVBA 3RGRA 1AV4A 3OWSA 5AIHA 1E97A 2CG1A 1JZOA 3AGNA 4N6NB 4RBNA 3QRDA 3IPTA 1B3SA 1TUHA 1O7WB 3KN4A 1VQ53 1R4YA 3OW22 5KP4A 1I8VA 3NHXA 1GSPA 5ELUA 1GMQA 5I97A 7RNTA 4BTYA 1OF5B 1BGSA 1OGXA 2CH9A 3B7CA 1I2GA 1LOWA 3EX9A 4JRFA 2FGTA 3ROBA 5JPPA 4K90B 2HMLB 1UW1A 1UGIA 2IYJA 3CC43 2GU3A 2KAAA 5BXQA 1LXEA 3D3LA 1BRNL 1G0TA 4HM4B 2C4BA 2F56A 1VQ93 3WDGB 1F8NA 4QWTA 1Q814 2GEXA 3B4PA 3ALAA 3I0YA 5JBSA 3FG3A 3PS8A 5M1AA 3K63A 1IQ8A 2L1SA 4HOHA 5DREA 1I0VA 3CPW2 2CC3A 2O3OA 4MJDA 2SARA 2MF7A 1JN5B 1IVXA 2F4YA 3SEDA 3NUVA 4GSPA 3D5GA 5EEOA 4HVNA 1W2B2 1LQGC 5DRVA 1B2SA 2CWVA 1CQSA 1UDII 1GY6A 2V1LA 3OV4A 5IENA 1MWUA 2BO9B 1FGOA 4HZ9B 1JKGA 1UI7A 5AIFA 4EBGA 2YFLB 1LRAA 1PFPA 1LNIA 4FMCA 3KZTA 5IERA 1VQO3 5IEPA 2AAEA 1DMNA 3S5CA 2K0MA 3MSOA 3G0KA 2ZL8A 3DH2A 3DGNA 2WGOA 5HOHA 2W56B 5BU4A 1UGHI 1Z1SA 2ZA4A 3D4AA 3GZXB 3FF2A 3NM7A 3S27A 1A2PA 1GS3A 1GD3A 3K0ZA 3RNTA 2OOVC 3DGOA 2W03A 2KF5A 1DYUA 1SPUA 2IUJA 1TFKA 1G02A 3FLJA 4G1MB 1D6UA 5IEOA 1MNLA 2HOHA 5AEUB 2XGLA 1DVCA 5IG4A 2XGNA 1BNIA 1RHLA 2CW9A 1IVWA 3AHWA 1GMPA 1S5AA 1JB4A 1HU9A 1QMAA 1X1XA 2Q07A 2WOFA 3BIRA 3BU4A 1CYUA 3LTCA 3B8LA 1JBSA 3IJEB 5M19A 1W6CA 1BNRA 1HZ1A 3V99A 3ZG0A 4LGQA 1WMNA 1FGMA 2YFJB 1A2VA 4WYKB 3A5EA 1YGWA 4N6OB 1I3FA 2HMMB 1IV7A 1OHSA 3D79A 1BVIA 5D82A 4Q53A 3S67A 1T3BA 2P0XA 1W5ZA 4DKIA 1GOYA 1AQZA 4MMXB 1NNVA 1FUTA 2F98A 4HM5B 1ZO2A 1C54A 1DETA 4O2HA 1KWIA 3CNMA 3KE7A 4IT7A 3X40A 1YJ93 1YGEA 4KZ1A 1BNEA 1RKYA 1WMOA 5IW9A 1AVKA 5IG3A 3G16A 1M904 1NU3A 2P05A 1I2FA 1JNQA 3OWUA 3WODG 1YVBI 3CPOA 4U13A 3UJMA 1NJI4 1V58A 3LXUX 4R9LA 2QEX3 3DMCA 3S29A 1S723 2B1XB 3F7XA 3LT9A 3X3YA 4EV5A 5AIIA 4KFEA 2B24B 3SX1A 2GBWB 1TU5A 3CMA3 3CCU3 8CHOA 1D6ZA 3T0UA 2BU4A 4RNZA 3T8UA 3DZLA 2BIRA 1B2MA 1RN7A 4BIRA 3EN1B 3URPA 2ZDJA 3GAXA 1UUWB 5FW5A 1X1UA 1I2EA 4EV2A 3HIIA 4HKVB 3WA3A 1OHOA 1ROVA 3LTAA 3G713 1JRQA 1D6YA 3JUOA 1HYFA 3EE1A 4FMBA 3MHEA 2GU1A 3UL5A 3WMDA 1BNSA 4HM2B 2CFGA 2C10A 3FSDA 4XDVA 3AHSA 4KFDA 1SARA 1I0XA 2Z76A 3GZBA 2Z7AA 1O7HB 2WGQA 1MGRA 4MEIA 2UX0A 4K61A 1IYYA 1ULJB 2OQEC 2C11A 3NXJA 1QJGA 2PZVA 3UNLA 3CC73 1OACA 2W6JH 3N9HA 1IK3A 1OPYA 2A15A 1YI23 1VQK3 1FGTA 3BNDA 4N6LA 2QA43 1NDOB 1Q824 3ER7A 1Q7HA 3EB8A 3QK9A 4JF8A 3STDA 2KF4A 4HM8B 4GHOA 4FMAA 4FCJA 3CCR3 3DM8A 3LH4A 1BAOA 4WP5A 5AYRB 6RNTA 1X1YA 4N6UA 2D42A 2GSPA 1YJW3 1VQ73 4WHAA 3NQYA 3EBTA 2FNQA 2I9WA 3PCRA 1Q7Y4 3DY5A 1RCKA 1K28A 2Z77A 4HM7B 1EUIC 1TJDA 1J2BA 1OGZA 5JPUA 5EQLA 3SXXA 4WYKA 3FH1A 1BOXA 5KP1A 2CHCA 1ULIB 3CC23 1UCLA 1BNGA 1BRHA 1VQL3 3FG1A 1B2ZA 1IV9A 2HMOB 4N6MA 4O8SA 5HGRA 1FYSA 1IDPA 1RSNA 4BL2A 3G8ZA 3HI7A 3F8HA 1W6YA 3Q1CA 1BRSA 2FXTA 1PYLA 4I5QA 4IPBA 1T2HA 1N8R4 1VQ83 3TDGA 4J5GA 4J5KA 3OXAA 1ZX2A 3IMAB 4OUQA 1DMMA 1O7PB 2XFTA 3L0RA 4LEHA 4ORLA 1WTHA 1FW7A 3LYGA 1RN1A 1SQWA 3EJVA 7STDA 3CXC2 2QGUA 4HJLB 3WR2A 3LTBA 1WMPA 2JQ5A 1VQM3 1QVG2 4WFOA 3BNBA 1TIJA 2Y74A 8RNTA 2PNCA 1B27A 1YIT3 1BSAA 1CH0A 4AEQA 3CCJ3 1A90A 1VQ43 1LNHA 3SYUA 2Z6BA 3LMLA 3K9MC 1JBTA 4NREA 4HZBB 2W56A 3CCQ3 4LYLB 1NB5I 3H3HA 3NBRA 3GRDA 1BSCA 5KP3A 3LTDA 3KCHA 5CF1A 1EKMA 4CCVA 5IF6A 5M18A 1WQLB 1FUWA 4I4KA 2XFSA 1RN4A 1VQ63 1PU4A 2L4VA 3DGMA 1BRKA 3KFQC 3PYJA 3BNEA 4X2OA 1MGWA 2CX1A 3F40A 1RNTA 3K5TA 4HM3B 3KSPA 4BL3A 1FUSA 1M1K4 2CFDA 1I70A 4HBRA 5EVHA 3I553 1TRPA 3F8XA 1QAKA 5LC7A 4IIAA 1BNFA 3NM2A 4X2HA 2OTL3 4HM0B 3GZYB 4RZMA 1K734 3X3ZA 1K41A 2CWUA 1OCVA 5AYSC 3X42A 2K54A 4FCZA 3V92A 3CME3 3CCE3 3CCS3 1QALA 2BNGA 1BU4A 3Q2PA 4FCMA 1JV2B 1O7MB 1BANA 3KSED 4LMIA 2RCDA 3D9RA 3N8BA 3EHCA 4LSOA 1MOLA 3G6E3 4GB5A 1VQN3 4HM1B 3DGLA 1CEWI 3NBBA 4XBXA 4TX4A 2D1WA 5CXOA 2LYXA 1NO3A 2BMQB 4NPBA 2H0GA 2CG0A 1Q9EA 5AIGA 5AEWB 3LT8A 2RSXA 3MYTA 3SVAA 1IT8A 2HMNB 1U8CB 2R41A 3PCSA 2O9UX 5G1LA 1BRGA 2AADA 4CPKA 6GSPA 1IVVA 3JUNA 3FCSB 3T8NA 1IQXA 4L7KA 2BHMA 3VGNA 1A67A 2IUKA 1EEJA 2F5WA 1RJOA 1OH0A 2XH9A 1FZUA 2XEPA 1L5GB 1N9EA 1O7GB 5CLKA 3MKIA 1T2IA 1JZDA 2QIYA 1M9GA 2GBXB 2CIUA 3DXOA 4R80A 3FGYA 1BUJA 4L8OA 3X3XA 1FGQA 2KF6A 3VF1A 2RBIA 2GXFA 2RNTA 1JJ22 1DMQA 3MG1A 2YX9A 1OF5A 3OWYA 5FGOA 1YNVX 3JUMA 3ZG5A 1B21A 1RGEA 3EBYA 1AVLA 1V57A 5CF2A 3ECFA 4KFFA 1BUQA 1QAFA 3BLZA 3HK4A 1RMSA 3KKGA 1PY3A 2R4IA 3FKAA 2LQVA 4CDLA 4HAAA 1GOVA 1W2ZA 4L8PA 1TFOA 4OK0A 3SLUA 1JBRA 5STDA 3RGAA 3EN8A 3J7Yd 3JVCA 1AY7A 1RGLA 4AKZA 1O7NB 1GY7A 5IG0A 2KCDA 3OX9A 5D81A 3V98A 4EXRA 2M7OA 1KQS2 2BMOB 4RNYA 3LZAA 3CCV3 9RNTA 3CU3A 5RNTA 1IU7A 1RCLA 2YFIB 1RDSA 3BB9A 1BRJA 4KT3B 1VQQA 3M8CA 4RNTA 3F7SA 1OUNA 1AR0A 1WNHA 2ML5A 1C7HA 2CKFB 3SOYA 5IG5A 2GEYA 2HMJB 4BTXA 1W7CA 2W0QA 3NBJA 1KC84 2E2TA 1DVDA 2INXA 1YVSA 3CD63 3D5IA
chains in the Genus database with same CATH topology
3WOFB 2SBLA 1N5PA 3E99A 4KVHA 1N5HA 1RRHA 1W00A 1STFI 2MC8A 4R1KA 1US1A 1W6GA 1Q864 2KRTA 4XDWA 3CCM3 2OCTA 3VSYA 1W4NA 1K8A4 3MG3A 2XR8B 1ROAA 2W9PA 3PZWA 1FGRA 1ISKA 3I563 2W9QA 3G4S3 1YHQ3 1Q40B 3MG2A 4XM4A 1LVNA 4MMZB 2XSOB 3DUKA 1M1XB 3FZWA 3O8YA 3LOYA 1N9JA 1Q42A 2W04A 4OVMA 4R4KA 4HM6B 1VZZA 1W01A 1EA2A 1W02A 2OWPA 3EC9A 3KIIA 5AI1A 3X41A 1GD4A 1Y4KA 1JN5A 2Y73A 3HIGA 1NB3I 3NV0A 3Q90A 2HMKB 5TGNA 4XBYA 3AMOA 2KXGA 4HYZA 2OOVA 1EG9B 4WWUC 5D83A 4AKYA 4H61A 1R4CA 2P38A 2CK3H 2XSHB 1FA3A 3NV0B 3HX8A 2P0MA 3B4OA 3EF8A 4BTWA 1IT7A 4N6V0 1GY5A 3F14A 1E3VA 3AMOB 3MPHA 3FG4A 4N3VA 3K7CA 1UUVB 3WOEB 3FF0A 3NX0A 5A0OB 3HZPA 3CCL3 2CFKA 2RGQA 3WA2X 5ELJA 4H3UA 1UI8A 3F9SA 4EC6A 3NQZA 4GL6A 1K9M4 1QVF2 1LOXA 3MWZA 2W2CA 2F86B 2STDA 3CNXA 1STDA 2IMJA 1GYBA 1T5YA 4N6TA 1Q40A 3JUQA 1SIIA 1HKXA 3A76A 2IA7A 2CFLA 1N8QA 1SJWA 1YIJ3 5CK6A 1NWWA 2CFWA 4K1UA 1TP6A 1EQKA 1KSIA 4ZM8A 3JUPA 2BMRB 4STDA 2E2VA 4EYCA 3GWRA 3UL6A 4XB5A 4XBTA 2RFRA 2CWTA 1JKGB 3PGBA 3N54B 4MMYB 2BT3A 3U97A 4R9KA 5LC6A 4K1VA 4O3VA 3H51A 1U5OA 3BNCA 4LZIA 1V74A 1ASKA 1KD14 3SOAA 1RRLA 1IQYA 4O02B 3EQQB 1A2KA 6STDA 2WO0A 1VQP3 2WOHA 1OHPA 5G2GA 1IVUA 2F99A 2XRXB 3S28A 1JB5A 4NHFA 1JB2A 1CYVA 4FR9A 3RDEA 4J9AA 3PXMA 1SIHA 2XF3A 2P09A 2OTJ3 1YJN3 1G96A 2ML6A 2E2UA 3GZRA 4PEJA 3UB1A 1E3RA 4FMDA 4J8TA 2OQEA 3U1WA 2JDIH 5BVBA 3RGRA 1AV4A 3OWSA 5AIHA 1E97A 2CG1A 4N6NB 4RBNA 3QRDA 3IPTA 1TUHA 1O7WB 3KN4A 1VQ53 3OW22 5KP4A 3NHXA 5ELUA 5I97A 4BTYA 1OF5B 1OGXA 3B7CA 2CH9A 3EX9A 3ROBA 4JRFA 2FGTA 5JPPA 4K90B 2HMLB 1UW1A 3CC43 2GU3A 5BXQA 1LXEA 3D3LA 4HM4B 1VQ93 3WDGB 1F8NA 4QWTA 1Q814 2GEXA 3B4PA 3ALAA 3I0YA 5JBSA 3FG3A 3PS8A 3K63A 1IQ8A 3CPW2 5DREA 2CC3A 2O3OA 4MJDA 2MF7A 1JN5B 1IVXA 3SEDA 3NUVA 5EEOA 4HVNA 1W2B2 5DRVA 2CWVA 1CQSA 1GY6A 2V1LA 3OV4A 5IENA 2BO9B 1FGOA 4HZ9B 1JKGA 1UI7A 5AIFA 4EBGA 2YFLB 1PFPA 4FMCA 3KZTA 5IERA 1VQO3 5IEPA 1DMNA 3S5CA 2K0MA 3MSOA 3G0KA 2ZL8A 3DGNA 2WGOA 2W56B 1Z1SA 3GZXB 3FF2A 3NM7A 3S27A 1GS3A 1GD3A 3K0ZA 2OOVC 3DGOA 2W03A 1DYUA 1SPUA 2IUJA 1TFKA 3FLJA 4G1MB 1D6UA 5IEOA 1MNLA 5AEUB 5IG4A 2XGLA 1DVCA 2XGNA 1IVWA 2CW9A 1S5AA 1JB4A 1HU9A 1QMAA 2Q07A 2WOFA 1CYUA 3LTCA 3B8LA 3IJEB 1W6CA 3V99A 4LGQA 1WMNA 1FGMA 2YFJB 1A2VA 4WYKB 4N6OB 2HMMB 1IV7A 1OHSA 5D82A 4Q53A 3S67A 2P0XA 1W5ZA 4MMXB 2F98A 4HM5B 1ZO2A 4O2HA 1KWIA 3CNMA 3KE7A 4IT7A 3X40A 1YJ93 1YGEA 4KZ1A 1RKYA 1WMOA 5IW9A 1AVKA 5IG3A 3G16A 1M904 1NU3A 2P05A 1JNQA 3OWUA 3WODG 1YVBI 3CPOA 4U13A 3UJMA 1NJI4 3LXUX 4R9LA 2QEX3 3DMCA 3S29A 1S723 2B1XB 3F7XA 3LT9A 3X3YA 4EV5A 5AIIA 4KFEA 2B24B 3SX1A 2GBWB 1TU5A 3CMA3 3CCU3 8CHOA 1D6ZA 3T0UA 4RNZA 3T8UA 3DZLA 1RN7A 3EN1B 2ZDJA 3GAXA 1UUWB 5FW5A 4EV2A 3WA3A 3HIIA 4HKVB 1OHOA 1ROVA 3LTAA 3G713 1JRQA 1D6YA 3JUOA 3EE1A 4FMBA 3MHEA 2GU1A 3UL5A 3WMDA 4HM2B 2CFGA 2C10A 3FSDA 4XDVA 4KFDA 2Z76A 3GZBA 2Z7AA 1O7HB 2WGQA 4MEIA 2UX0A 4K61A 1ULJB 2OQEC 2C11A 3NXJA 1QJGA 2PZVA 3UNLA 3CC73 1OACA 2W6JH 3N9HA 1IK3A 1OPYA 2A15A 1YI23 1VQK3 1FGTA 3BNDA 4N6LA 2QA43 1NDOB 1Q824 3ER7A 3EB8A 3QK9A 4JF8A 3STDA 4HM8B 4FMAA 4FCJA 3CCR3 3DM8A 3LH4A 4WP5A 5AYRB 4N6UA 2D42A 1YJW3 1VQ73 4WHAA 3NQYA 3EBTA 2FNQA 2I9WA 3PCRA 1Q7Y4 3DY5A 1J2BA 2Z77A 1K28A 4HM7B 1OGZA 5JPUA 5EQLA 3SXXA 4WYKA 3FH1A 5KP1A 1ULIB 2CHCA 3CC23 1VQL3 3FG1A 2HMOB 1IV9A 4N6MA 5HGRA 4O8SA 1IDPA 3G8ZA 3HI7A 3F8HA 1W6YA 3Q1CA 2FXTA 4IPBA 1N8R4 1VQ83 3TDGA 3OXAA 1ZX2A 3IMAB 4OUQA 1DMMA 1O7PB 2XFTA 3L0RA 4LEHA 4ORLA 1WTHA 3LYGA 1SQWA 3EJVA 7STDA 3CXC2 2QGUA 4HJLB 3LTBA 1WMPA 2JQ5A 1VQM3 1QVG2 4WFOA 3BNBA 1TIJA 2Y74A 2PNCA 1YIT3 4AEQA 3CCJ3 1A90A 1VQ43 1LNHA 2Z6BA 3LMLA 3K9MC 4NREA 4HZBB 2W56A 3CCQ3 1NB5I 3H3HA 3NBRA 3GRDA 5KP3A 3LTDA 5CF1A 5IF6A 1EKMA 4CCVA 1FUWA 1WQLB 4I4KA 2XFSA 1VQ63 1PU4A 2L4VA 3DGMA 3KFQC 3PYJA 3BNEA 4X2OA 3F40A 3K5TA 4HM3B 3KSPA 1M1K4 2CFDA 4HBRA 5EVHA 3I553 3F8XA 1QAKA 5LC7A 4IIAA 3NM2A 4X2HA 2OTL3 4HM0B 3GZYB 4RZMA 1K734 3X3ZA 1K41A 2CWUA 1OCVA 5AYSC 3X42A 2K54A 4FCZA 3V92A 3CME3 3CCE3 3CCS3 1QALA 2BNGA 3Q2PA 4FCMA 1JV2B 1O7MB 3KSED 4LMIA 2RCDA 3D9RA 3N8BA 3EHCA 4LSOA 1MOLA 3G6E3 4GB5A 1VQN3 4HM1B 3DGLA 1CEWI 3NBBA 4XBXA 4TX4A 2D1WA 5CXOA 2LYXA 1NO3A 2BMQB 2CG0A 5AIGA 5AEWB 3LT8A 2RSXA 3MYTA 3SVAA 1IT8A 2HMNB 1U8CB 3PCSA 2O9UX 1IVVA 3JUNA 3FCSB 3T8NA 1IQXA 4L7KA 2BHMA 3VGNA 1A67A 2IUKA 1RJOA 1OH0A 2XH9A 2XEPA 1L5GB 1N9EA 1O7GB 5CLKA 3MKIA 2QIYA 1M9GA 2GBXB 2CIUA 3DXOA 4R80A 3FGYA 4L8OA 3X3XA 1FGQA 3VF1A 2GXFA 1JJ22 1DMQA 3MG1A 2YX9A 1OF5A 3OWYA 5FGOA 3JUMA 3EBYA 1AVLA 5CF2A 3ECFA 4KFFA 1BUQA 1QAFA 3BLZA 3HK4A 3KKGA 2R4IA 4CDLA 3FKAA 2LQVA 3SLUA 4L8PA 1W2ZA 1TFOA 4OK0A 5STDA 3RGAA 3EN8A 3J7Yd 3JVCA 4AKZA 1O7NB 1GY7A 5IG0A 2KCDA 3OX9A 5D81A 3V98A 4EXRA 2M7OA 1KQS2 2BMOB 4RNYA 3LZAA 3CCV3 3CU3A 1IU7A 2YFIB 3BB9A 3M8CA 3F7SA 1OUNA 1AR0A 2ML5A 1WNHA 1C7HA 2CKFB 3SOYA 5IG5A 2GEYA 2HMJB 4BTXA 1W7CA 2W0QA 3NBJA 1KC84 2E2TA 1DVDA 2INXA 3CD63
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWU A;  5G2G A;  5IG5 A;  3CPO A;  4U13 A;  3UJM A;  4R9L A;  3E99 A;  4KVH A;  3GZR A;  4PEJ A;  1E3R A;  1W00 A;  3DMC A;  4HZB B;  2B1X B;  3F7X A;  4J8T A;  4R1K A;  5BVB A;  3RGR A;  3OWS A;  3H3H A;  3NBR A;  5AIH A;  3GRD A;  1E97 A;  4XDW A;  3VSY A;  5AII A;  5KP3 A;  5IF6 A;  5CF1 A;  2B24 B;  2GBW B;  3MG3 A;  3IPT A;  1WQL B;  1TUH A;  1O7W B;  2XR8 B;  4I4K A;  8CHO A;  5KP4 A;  1ISK A;  3T8U A;  3DZL A;  3NHX A;  4X2O A;  1Q40 B;  3F40 A;  3MG2 A;  3EN1 B;  4XM4 A;  1OF5 B;  1OGX A;  3B7C A;  3EX9 A;  3KSP A;  4HM3 B;  3ROB A;  5JPP A;  1UUW B;  5FW5 A;  2XSO B;  2HML B;  3DUK A;  3FZW A;  4HKV B;  1OHO A;  5BXQ A;  5EVH A;  1Q42 A;  3JUO A;  4OVM A;  3F8X A;  4HM6 B;  4HM4 B;  1VZZ A;  4IIA A;  3NM2 A;  3MHE A;  4X2H A;  1W01 A;  3WMD A;  1EA2 A;  1W02 A;  2OWP A;  2GEX A;  3EC9 A;  4HM2 B;  3B4P A;  3GZY B;  4HM0 B;  4RZM A;  5AI1 A;  3SOY A;  3I0Y A;  1K41 A;  3FSD A;  1JN5 A;  4XDV A;  1OCV A;  2K54 A;  2Z76 A;  3NV0 A;  2HMK B;  3GZB A;  3Q90 A;  5TGN A;  2Z7A A;  4XBY A;  1O7H B;  2UX0 A;  2BNG A;  1ULJ B;  4FCM A;  1O7M B;  5DRE A;  3NXJ A;  1EG9 B;  4WWU C;  1QJG A;  2PZV A;  4LMI A;  5D83 A;  4MJD A;  2RCD A;  3D9R A;  3UNL A;  3EHC A;  1JN5 B;  4GB5 A;  2XSH B;  3SED A;  3NUV A;  3NV0 B;  3HX8 A;  1OPY A;  2A15 A;  3B4O A;  3EF8 A;  4HM1 B;  4HVN A;  4XBX A;  5CXO A;  5DRV A;  1GY5 A;  3F14 A;  1E3V A;  2BMQ B;  1CQS A;  1NDO B;  1GY6 A;  4N3V A;  4HM5 B;  3ER7 A;  3K7C A;  3OV4 A;  3STD A;  1UUV B;  5AIG A;  5IEN A;  5AEW B;  3FF0 A;  3MYT A;  3HZP A;  2HMN B;  4HM8 B;  4HZ9 B;  1JKG A;  2RGQ A;  4FCJ A;  3DM8 A;  4H3U A;  5AIF A;  2YFL B;  3F9S A;  4WP5 A;  3KZT A;  5IER A;  3JUN A;  5IEP A;  5KP1 A;  3T8N A;  1DMN A;  3S5C A;  4L7K A;  2W2C A;  3LYG A;  3MSO A;  2F86 B;  2STD A;  3CNX A;  3G0K A;  3EBT A;  3VGN A;  1STD A;  2IMJ A;  2I9W A;  1GYB A;  2Z77 A;  4HM7 B;  1OH0 A;  1Z1S A;  1OGZ A;  1Q40 A;  3JUQ A;  3GZX B;  3FF2 A;  1O7G B;  5JPU A;  5CLK A;  3MKI A;  1GS3 A;  1HKX A;  3K0Z A;  3A76 A;  2QIY A;  2GBX B;  3DXO A;  3FGY A;  4L8O A;  4WYK A;  1SJW A;  3FH1 A;  2GXF A;  5CK6 A;  3FLJ A;  1DMQ A;  1NWW A;  1ULI B;  2CHC A;  3MG1 A;  1OF5 A;  1TP6 A;  3OWY A;  3JUM A;  4K1U A;  5IEO A;  3EBY A;  5AEU B;  5IG4 A;  5CF2 A;  2HMO B;  3ECF A;  5HGR A;  3JUP A;  2BMR B;  1S5A A;  1JB4 A;  3BLZ A;  1QMA A;  3GWR A;  4STD A;  3HK4 A;  3KKG A;  4XB5 A;  3B8L A;  4XBT A;  2R4I A;  1IDP A;  3FKA A;  2RFR A;  4CDL A;  4L8P A;  1JKG B;  3G8Z A;  3F8H A;  1BUQ A;  1W6Y A;  4R9K A;  5STD A;  4K1V A;  3RGA A;  3EN8 A;  3H51 A;  4LGQ A;  1U5O A;  2YFJ B;  4WYK B;  1O7N B;  1ASK A;  1GY7 A;  3OX9 A;  5D81 A;  5IG0 A;  2HMM B;  3SOA A;  1OHS A;  2BMO B;  3LZA A;  3OXA A;  7STD A;  3EQQ B;  1A2K A;  3CU3 A;  1ZX2 A;  4OUQ A;  5D82 A;  1DMM A;  1O7P B;  4LEH A;  4Q53 A;  6STD A;  2YFI B;  3BB9 A;  4ORL A;  1OHP A;  3M8C A;  3F7S A;  1OUN A;  2F98 A;  2F99 A;  1AR0 A;  2XRX B;  2CKF B;  1C7H A;  1JB5 A;  1ZO2 A;  2QGU A;  2GEY A;  1JB2 A;  2HMJ B;  3EJV A;  4HJL B;  3CNM A;  3KE7 A;  2JQ5 A;  2INX A;  4J9A A;  5IG3 A;  3G16 A;  1NU3 A; 
#chains in the Genus database with same CATH topology
 3WOF B;  2SBL A;  3GSP A;  1N5P A;  3E99 A;  4KVH A;  1TRQ A;  1N5H A;  1RRH A;  1W00 A;  1STF I;  2MC8 A;  4R1K A;  2CX0 A;  1US1 A;  1W6G A;  1Q86 4;  2H0H A;  1MWR A;  2KRT A;  4XDW A;  3HOH A;  2OCT A;  3VSY A;  1W4N A;  3CCM 3;  1K8A 4;  1B2X A;  1ZGX A;  3MG3 A;  4EW5 A;  2XR8 B;  1ROA A;  2W9P A;  3PZW A;  1FGR A;  1ISK A;  3I56 3;  2W9Q A;  3G4S 3;  2K3D A;  2KF3 A;  1UCI A;  1BIR A;  1YHQ 3;  1RNB A;  1Q40 B;  3MG2 A;  4XM4 A;  1LVN A;  4MMZ B;  3ZFZ A;  2XSO B;  3DUK A;  1M1X B;  3FZW A;  3O8Y A;  3LOY A;  1N9J A;  1Q42 A;  1UUG B;  2J8X B;  2W04 A;  4OVM A;  4R4K A;  4HM6 B;  5BIR A;  7GSP A;  1VZZ A;  2F5M A;  1I3I A;  1W01 A;  1EA2 A;  1W02 A;  2OWP A;  3EC9 A;  3DGY A;  3KII A;  5AI1 A;  3X41 A;  1BSB A;  1GD4 A;  1LQM B;  1Y4K A;  1JN5 A;  2Y73 A;  3HIG A;  5GSP A;  1NB3 I;  3NV0 A;  3Q90 A;  2HMK B;  5TGN A;  2ZHX B;  1LOY A;  4XBY A;  3AMO A;  4CJN A;  2KXG A;  4HYZ A;  2OOV A;  1EG9 B;  4WWU C;  5D83 A;  4AKY A;  4H61 A;  2H0I A;  1R4C A;  2P38 A;  2CK3 H;  2XSH B;  1FA3 A;  3NV0 B;  3HX8 A;  2P0M A;  3B4O A;  3EF8 A;  4BTW A;  1IT7 A;  4N6V 0;  1GY5 A;  3F14 A;  1E3V A;  3AMO B;  3AGO A;  3MPH A;  3FG4 A;  4N3V A;  1UCJ A;  3K7C A;  1UCK A;  1UUV B;  3WOE B;  3FF0 A;  3NX0 A;  5A0O B;  3HZP A;  3CCL 3;  2CFK A;  2RGQ A;  3WA2 X;  2IY2 A;  4H3U A;  1UI8 A;  5ELJ A;  1RGA A;  3F9S A;  4EC6 A;  3NQZ A;  4GL6 A;  1K9M 4;  1QVF 2;  1LOX A;  3MWZ A;  2W2C A;  2F86 B;  2STD A;  1MWT A;  3CNX A;  1STD A;  2IMJ A;  1GYB A;  1T5Y A;  4N6T A;  1Q40 A;  3JUQ A;  1SII A;  1BSD A;  1HKX A;  3A76 A;  2IA7 A;  2CFL A;  1BSE A;  1N8Q A;  1SJW A;  4BU4 A;  1YIJ 3;  5CK6 A;  1NWW A;  2CFW A;  4K1U A;  1TP6 A;  1EQK A;  1LOV A;  1RGG A;  1KSI A;  1RLS A;  4ZM8 A;  3JUP A;  2BMR B;  4STD A;  2E2V A;  4EYC A;  3GWR A;  3UL6 A;  4XB5 A;  1RGC A;  4XBT A;  2RFR A;  2CWT A;  1JKG B;  3PGB A;  1GMR A;  3N54 B;  1B2U A;  2BT3 A;  4MMY B;  4R9K A;  5LC6 A;  4K1V A;  4O3V A;  3U97 A;  3H51 A;  1U5O A;  3BNC A;  4LZI A;  1BNJ A;  1V74 A;  1ASK A;  1KD1 4;  3SOA A;  1MWS A;  1IQY A;  1RRL A;  4O02 B;  3EQQ B;  1A2K A;  1BRI A;  1X1W A;  6STD A;  2WO0 A;  5G1K A;  1VQP 3;  1RGF A;  2WOH A;  1ZS7 A;  3Q3F A;  1OHP A;  1B20 A;  5G2G A;  1IVU A;  2F99 A;  2XRX B;  3S28 A;  1JB5 A;  4NHF A;  1JB2 A;  1DE3 A;  1CYV A;  4FR9 A;  2UGI A;  1RTU A;  3RDE A;  1TTO A;  1RGH A;  3WHO A;  4J9A A;  3PXM A;  1SIH A;  2P09 A;  2XF3 A;  1RGK A;  4ILF A;  2OTJ 3;  2UUG C;  1YJN 3;  1G96 A;  1GOU A;  2ML6 A;  2E2U A;  3GZR A;  4PEJ A;  3UB1 A;  1E3R A;  4FMD A;  4J8T A;  2OQE A;  3U1W A;  2JDI H;  5BVB A;  3RGR A;  1AV4 A;  3OWS A;  5AIH A;  1E97 A;  2CG1 A;  1JZO A;  3AGN A;  4N6N B;  4RBN A;  3QRD A;  3IPT A;  1B3S A;  1TUH A;  1O7W B;  3KN4 A;  1VQ5 3;  1R4Y A;  3OW2 2;  5KP4 A;  1I8V A;  3NHX A;  1GSP A;  5ELU A;  1GMQ A;  5I97 A;  7RNT A;  4BTY A;  1OF5 B;  1BGS A;  1OGX A;  2CH9 A;  3B7C A;  1I2G A;  1LOW A;  3EX9 A;  4JRF A;  2FGT A;  3ROB A;  5JPP A;  4K90 B;  2HML B;  1UW1 A;  1UGI A;  2IYJ A;  3CC4 3;  2GU3 A;  2KAA A;  5BXQ A;  1LXE A;  3D3L A;  1BRN L;  1G0T A;  4HM4 B;  2C4B A;  2F56 A;  1VQ9 3;  3WDG B;  1F8N A;  4QWT A;  1Q81 4;  2GEX A;  3B4P A;  3ALA A;  3I0Y A;  5JBS A;  3FG3 A;  3PS8 A;  5M1A A;  3K63 A;  1IQ8 A;  2L1S A;  4HOH A;  5DRE A;  1I0V A;  3CPW 2;  2CC3 A;  2O3O A;  4MJD A;  2SAR A;  2MF7 A;  1JN5 B;  1IVX A;  2F4Y A;  3SED A;  3NUV A;  4GSP A;  3D5G A;  5EEO A;  4HVN A;  1W2B 2;  1LQG C;  5DRV A;  1B2S A;  2CWV A;  1CQS A;  1UDI I;  1GY6 A;  2V1L A;  3OV4 A;  5IEN A;  1MWU A;  2BO9 B;  1FGO A;  4HZ9 B;  1JKG A;  1UI7 A;  5AIF A;  4EBG A;  2YFL B;  1LRA A;  1PFP A;  1LNI A;  4FMC A;  3KZT A;  5IER A;  1VQO 3;  5IEP A;  2AAE A;  1DMN A;  3S5C A;  2K0M A;  3MSO A;  3G0K A;  2ZL8 A;  3DH2 A;  3DGN A;  2WGO A;  5HOH A;  2W56 B;  5BU4 A;  1UGH I;  1Z1S A;  2ZA4 A;  3D4A A;  3GZX B;  3FF2 A;  3NM7 A;  3S27 A;  1A2P A;  1GS3 A;  1GD3 A;  3K0Z A;  3RNT A;  2OOV C;  3DGO A;  2W03 A;  2KF5 A;  1DYU A;  1SPU A;  2IUJ A;  1TFK A;  1G02 A;  3FLJ A;  4G1M B;  1D6U A;  5IEO A;  1MNL A;  2HOH A;  5AEU B;  2XGL A;  1DVC A;  5IG4 A;  2XGN A;  1BNI A;  1RHL A;  2CW9 A;  1IVW A;  3AHW A;  1GMP A;  1S5A A;  1JB4 A;  1HU9 A;  1QMA A;  1X1X A;  2Q07 A;  2WOF A;  3BIR A;  3BU4 A;  1CYU A;  3LTC A;  3B8L A;  1JBS A;  3IJE B;  5M19 A;  1W6C A;  1BNR A;  1HZ1 A;  3V99 A;  3ZG0 A;  4LGQ A;  1WMN A;  1FGM A;  2YFJ B;  1A2V A;  4WYK B;  3A5E A;  1YGW A;  4N6O B;  1I3F A;  2HMM B;  1IV7 A;  1OHS A;  3D79 A;  1BVI A;  5D82 A;  4Q53 A;  3S67 A;  1T3B A;  2P0X A;  1W5Z A;  4DKI A;  1GOY A;  1AQZ A;  4MMX B;  1NNV A;  1FUT A;  2F98 A;  4HM5 B;  1ZO2 A;  1C54 A;  1DET A;  4O2H A;  1KWI A;  3CNM A;  3KE7 A;  4IT7 A;  3X40 A;  1YJ9 3;  1YGE A;  4KZ1 A;  1BNE A;  1RKY A;  1WMO A;  5IW9 A;  1AVK A;  5IG3 A;  3G16 A;  1M90 4;  1NU3 A;  2P05 A;  1I2F A;  1JNQ A;  3OWU A;  3WOD G;  1YVB I;  3CPO A;  4U13 A;  3UJM A;  1NJI 4;  1V58 A;  3LXU X;  4R9L A;  2QEX 3;  3DMC A;  3S29 A;  1S72 3;  2B1X B;  3F7X A;  3LT9 A;  3X3Y A;  4EV5 A;  5AII A;  4KFE A;  2B24 B;  3SX1 A;  2GBW B;  1TU5 A;  3CMA 3;  3CCU 3;  8CHO A;  1D6Z A;  3T0U A;  2BU4 A;  4RNZ A;  3T8U A;  3DZL A;  2BIR A;  1B2M A;  1RN7 A;  4BIR A;  3EN1 B;  3URP A;  2ZDJ A;  3GAX A;  1UUW B;  5FW5 A;  1X1U A;  1I2E A;  4EV2 A;  3HII A;  4HKV B;  3WA3 A;  1OHO A;  1ROV A;  3LTA A;  3G71 3;  1JRQ A;  1D6Y A;  3JUO A;  1HYF A;  3EE1 A;  4FMB A;  3MHE A;  2GU1 A;  3UL5 A;  3WMD A;  1BNS A;  4HM2 B;  2CFG A;  2C10 A;  3FSD A;  4XDV A;  3AHS A;  4KFD A;  1SAR A;  1I0X A;  2Z76 A;  3GZB A;  2Z7A A;  1O7H B;  2WGQ A;  1MGR A;  4MEI A;  2UX0 A;  4K61 A;  1IYY A;  1ULJ B;  2OQE C;  2C11 A;  3NXJ A;  1QJG A;  2PZV A;  3UNL A;  3CC7 3;  1OAC A;  2W6J H;  3N9H A;  1IK3 A;  1OPY A;  2A15 A;  1YI2 3;  1VQK 3;  1FGT A;  3BND A;  4N6L A;  2QA4 3;  1NDO B;  1Q82 4;  3ER7 A;  1Q7H A;  3EB8 A;  3QK9 A;  4JF8 A;  3STD A;  2KF4 A;  4HM8 B;  4GHO A;  4FMA A;  4FCJ A;  3CCR 3;  3DM8 A;  3LH4 A;  1BAO A;  4WP5 A;  5AYR B;  6RNT A;  1X1Y A;  4N6U A;  2D42 A;  2GSP A;  1YJW 3;  1VQ7 3;  4WHA A;  3NQY A;  3EBT A;  2FNQ A;  2I9W A;  3PCR A;  1Q7Y 4;  3DY5 A;  1RCK A;  1K28 A;  2Z77 A;  4HM7 B;  1EUI C;  1TJD A;  1J2B A;  1OGZ A;  5JPU A;  5EQL A;  3SXX A;  4WYK A;  3FH1 A;  1BOX A;  5KP1 A;  2CHC A;  1ULI B;  3CC2 3;  1UCL A;  1BNG A;  1BRH A;  1VQL 3;  3FG1 A;  1B2Z A;  1IV9 A;  2HMO B;  4N6M A;  4O8S A;  5HGR A;  1FYS A;  1IDP A;  1RSN A;  4BL2 A;  3G8Z A;  3HI7 A;  3F8H A;  1W6Y A;  3Q1C A;  1BRS A;  2FXT A;  1PYL A;  4I5Q A;  4IPB A;  1T2H A;  1N8R 4;  1VQ8 3;  3TDG A;  4J5G A;  4J5K A;  3OXA A;  1ZX2 A;  3IMA B;  4OUQ A;  1DMM A;  1O7P B;  2XFT A;  3L0R A;  4LEH A;  4ORL A;  1WTH A;  1FW7 A;  3LYG A;  1RN1 A;  1SQW A;  3EJV A;  7STD A;  3CXC 2;  2QGU A;  4HJL B;  3WR2 A;  3LTB A;  1WMP A;  2JQ5 A;  1VQM 3;  1QVG 2;  4WFO A;  3BNB A;  1TIJ A;  2Y74 A;  8RNT A;  2PNC A;  1B27 A;  1YIT 3;  1BSA A;  1CH0 A;  4AEQ A;  3CCJ 3;  1A90 A;  1VQ4 3;  1LNH A;  3SYU A;  2Z6B A;  3LML A;  3K9M C;  1JBT A;  4NRE A;  4HZB B;  2W56 A;  3CCQ 3;  4LYL B;  1NB5 I;  3H3H A;  3NBR A;  3GRD A;  1BSC A;  5KP3 A;  3LTD A;  3KCH A;  5CF1 A;  1EKM A;  4CCV A;  5IF6 A;  5M18 A;  1WQL B;  1FUW A;  4I4K A;  2XFS A;  1RN4 A;  1VQ6 3;  1PU4 A;  2L4V A;  3DGM A;  1BRK A;  3KFQ C;  3PYJ A;  3BNE A;  4X2O A;  1MGW A;  2CX1 A;  3F40 A;  1RNT A;  3K5T A;  4HM3 B;  3KSP A;  4BL3 A;  1FUS A;  1M1K 4;  2CFD A;  1I70 A;  4HBR A;  5EVH A;  3I55 3;  1TRP A;  3F8X A;  1QAK A;  5LC7 A;  4IIA A;  1BNF A;  3NM2 A;  4X2H A;  2OTL 3;  4HM0 B;  3GZY B;  4RZM A;  1K73 4;  3X3Z A;  1K41 A;  2CWU A;  1OCV A;  5AYS C;  3X42 A;  2K54 A;  4FCZ A;  3V92 A;  3CME 3;  3CCE 3;  3CCS 3;  1QAL A;  2BNG A;  1BU4 A;  3Q2P A;  4FCM A;  1JV2 B;  1O7M B;  1BAN A;  3KSE D;  4LMI A;  2RCD A;  3D9R A;  3N8B A;  3EHC A;  4LSO A;  1MOL A;  3G6E 3;  4GB5 A;  1VQN 3;  4HM1 B;  3DGL A;  1CEW I;  3NBB A;  4XBX A;  4TX4 A;  2D1W A;  5CXO A;  2LYX A;  1NO3 A;  2BMQ B;  4NPB A;  2H0G A;  2CG0 A;  1Q9E A;  5AIG A;  5AEW B;  3LT8 A;  2RSX A;  3MYT A;  3SVA A;  1IT8 A;  2HMN B;  1U8C B;  2R41 A;  3PCS A;  2O9U X;  5G1L A;  1BRG A;  2AAD A;  4CPK A;  6GSP A;  1IVV A;  3JUN A;  3FCS B;  3T8N A;  1IQX A;  4L7K A;  2BHM A;  3VGN A;  1A67 A;  2IUK A;  1EEJ A;  2F5W A;  1RJO A;  1OH0 A;  2XH9 A;  1FZU A;  2XEP A;  1L5G B;  1N9E A;  1O7G B;  5CLK A;  3MKI A;  1T2I A;  1JZD A;  2QIY A;  1M9G A;  2GBX B;  2CIU A;  3DXO A;  4R80 A;  3FGY A;  1BUJ A;  4L8O A;  3X3X A;  1FGQ A;  2KF6 A;  3VF1 A;  2RBI A;  2GXF A;  2RNT A;  1JJ2 2;  1DMQ A;  3MG1 A;  2YX9 A;  1OF5 A;  3OWY A;  5FGO A;  1YNV X;  3JUM A;  3ZG5 A;  1B21 A;  1RGE A;  3EBY A;  1AVL A;  1V57 A;  5CF2 A;  3ECF A;  4KFF A;  1BUQ A;  1QAF A;  3BLZ A;  3HK4 A;  1RMS A;  3KKG A;  1PY3 A;  2R4I A;  3FKA A;  2LQV A;  4CDL A;  4HAA A;  1GOV A;  1W2Z A;  4L8P A;  1TFO A;  4OK0 A;  3SLU A;  1JBR A;  5STD A;  3RGA A;  3EN8 A;  3J7Y d;  3JVC A;  1AY7 A;  1RGL A;  4AKZ A;  1O7N B;  1GY7 A;  5IG0 A;  2KCD A;  3OX9 A;  5D81 A;  3V98 A;  4EXR A;  2M7O A;  1KQS 2;  2BMO B;  4RNY A;  3LZA A;  3CCV 3;  9RNT A;  3CU3 A;  5RNT A;  1IU7 A;  1RCL A;  2YFI B;  1RDS A;  3BB9 A;  1BRJ A;  4KT3 B;  1VQQ A;  3M8C A;  4RNT A;  3F7S A;  1OUN A;  1AR0 A;  1WNH A;  2ML5 A;  1C7H A;  2CKF B;  3SOY A;  5IG5 A;  2GEY A;  2HMJ B;  4BTX A;  1W7C A;  2W0Q A;  3NBJ A;  1KC8 4;  2E2T A;  1DVD A;  2INX A;  1YVS A;  3CD6 3;  3D5I A; 
#chains in the Genus database with same CATH homology
 3WOF B;  2SBL A;  1N5P A;  3E99 A;  4KVH A;  1N5H A;  1RRH A;  1W00 A;  1STF I;  2MC8 A;  4R1K A;  1US1 A;  1W6G A;  1Q86 4;  2KRT A;  4XDW A;  3CCM 3;  2OCT A;  3VSY A;  1W4N A;  1K8A 4;  3MG3 A;  2XR8 B;  1ROA A;  2W9P A;  3PZW A;  1FGR A;  1ISK A;  3I56 3;  2W9Q A;  3G4S 3;  1YHQ 3;  1Q40 B;  3MG2 A;  4XM4 A;  1LVN A;  4MMZ B;  2XSO B;  3DUK A;  1M1X B;  3FZW A;  3O8Y A;  3LOY A;  1N9J A;  1Q42 A;  2W04 A;  4OVM A;  4R4K A;  4HM6 B;  1VZZ A;  1W01 A;  1EA2 A;  1W02 A;  2OWP A;  3EC9 A;  3KII A;  5AI1 A;  3X41 A;  1GD4 A;  1Y4K A;  1JN5 A;  2Y73 A;  3HIG A;  1NB3 I;  3NV0 A;  3Q90 A;  2HMK B;  5TGN A;  4XBY A;  3AMO A;  2KXG A;  4HYZ A;  2OOV A;  1EG9 B;  4WWU C;  5D83 A;  4AKY A;  4H61 A;  1R4C A;  2P38 A;  2CK3 H;  2XSH B;  1FA3 A;  3NV0 B;  3HX8 A;  2P0M A;  3B4O A;  3EF8 A;  4BTW A;  1IT7 A;  4N6V 0;  1GY5 A;  3F14 A;  1E3V A;  3AMO B;  3MPH A;  3FG4 A;  4N3V A;  3K7C A;  1UUV B;  3WOE B;  3FF0 A;  3NX0 A;  5A0O B;  3HZP A;  3CCL 3;  2CFK A;  2RGQ A;  3WA2 X;  5ELJ A;  4H3U A;  1UI8 A;  3F9S A;  4EC6 A;  3NQZ A;  4GL6 A;  1K9M 4;  1QVF 2;  1LOX A;  3MWZ A;  2W2C A;  2F86 B;  2STD A;  3CNX A;  1STD A;  2IMJ A;  1GYB A;  1T5Y A;  4N6T A;  1Q40 A;  3JUQ A;  1SII A;  1HKX A;  3A76 A;  2IA7 A;  2CFL A;  1N8Q A;  1SJW A;  1YIJ 3;  5CK6 A;  1NWW A;  2CFW A;  4K1U A;  1TP6 A;  1EQK A;  1KSI A;  4ZM8 A;  3JUP A;  2BMR B;  4STD A;  2E2V A;  4EYC A;  3GWR A;  3UL6 A;  4XB5 A;  4XBT A;  2RFR A;  2CWT A;  1JKG B;  3PGB A;  3N54 B;  4MMY B;  2BT3 A;  3U97 A;  4R9K A;  5LC6 A;  4K1V A;  4O3V A;  3H51 A;  1U5O A;  3BNC A;  4LZI A;  1V74 A;  1ASK A;  1KD1 4;  3SOA A;  1RRL A;  1IQY A;  4O02 B;  3EQQ B;  1A2K A;  6STD A;  2WO0 A;  1VQP 3;  2WOH A;  1OHP A;  5G2G A;  1IVU A;  2F99 A;  2XRX B;  3S28 A;  1JB5 A;  4NHF A;  1JB2 A;  1CYV A;  4FR9 A;  3RDE A;  4J9A A;  3PXM A;  1SIH A;  2XF3 A;  2P09 A;  2OTJ 3;  1YJN 3;  1G96 A;  2ML6 A;  2E2U A;  3GZR A;  4PEJ A;  3UB1 A;  1E3R A;  4FMD A;  4J8T A;  2OQE A;  3U1W A;  2JDI H;  5BVB A;  3RGR A;  1AV4 A;  3OWS A;  5AIH A;  1E97 A;  2CG1 A;  4N6N B;  4RBN A;  3QRD A;  3IPT A;  1TUH A;  1O7W B;  3KN4 A;  1VQ5 3;  3OW2 2;  5KP4 A;  3NHX A;  5ELU A;  5I97 A;  4BTY A;  1OF5 B;  1OGX A;  3B7C A;  2CH9 A;  3EX9 A;  3ROB A;  4JRF A;  2FGT A;  5JPP A;  4K90 B;  2HML B;  1UW1 A;  3CC4 3;  2GU3 A;  5BXQ A;  1LXE A;  3D3L A;  4HM4 B;  1VQ9 3;  3WDG B;  1F8N A;  4QWT A;  1Q81 4;  2GEX A;  3B4P A;  3ALA A;  3I0Y A;  5JBS A;  3FG3 A;  3PS8 A;  3K63 A;  1IQ8 A;  3CPW 2;  5DRE A;  2CC3 A;  2O3O A;  4MJD A;  2MF7 A;  1JN5 B;  1IVX A;  3SED A;  3NUV A;  5EEO A;  4HVN A;  1W2B 2;  5DRV A;  2CWV A;  1CQS A;  1GY6 A;  2V1L A;  3OV4 A;  5IEN A;  2BO9 B;  1FGO A;  4HZ9 B;  1JKG A;  1UI7 A;  5AIF A;  4EBG A;  2YFL B;  1PFP A;  4FMC A;  3KZT A;  5IER A;  1VQO 3;  5IEP A;  1DMN A;  3S5C A;  2K0M A;  3MSO A;  3G0K A;  2ZL8 A;  3DGN A;  2WGO A;  2W56 B;  1Z1S A;  3GZX B;  3FF2 A;  3NM7 A;  3S27 A;  1GS3 A;  1GD3 A;  3K0Z A;  2OOV C;  3DGO A;  2W03 A;  1DYU A;  1SPU A;  2IUJ A;  1TFK A;  3FLJ A;  4G1M B;  1D6U A;  5IEO A;  1MNL A;  5AEU B;  5IG4 A;  2XGL A;  1DVC A;  2XGN A;  1IVW A;  2CW9 A;  1S5A A;  1JB4 A;  1HU9 A;  1QMA A;  2Q07 A;  2WOF A;  1CYU A;  3LTC A;  3B8L A;  3IJE B;  1W6C A;  3V99 A;  4LGQ A;  1WMN A;  1FGM A;  2YFJ B;  1A2V A;  4WYK B;  4N6O B;  2HMM B;  1IV7 A;  1OHS A;  5D82 A;  4Q53 A;  3S67 A;  2P0X A;  1W5Z A;  4MMX B;  2F98 A;  4HM5 B;  1ZO2 A;  4O2H A;  1KWI A;  3CNM A;  3KE7 A;  4IT7 A;  3X40 A;  1YJ9 3;  1YGE A;  4KZ1 A;  1RKY A;  1WMO A;  5IW9 A;  1AVK A;  5IG3 A;  3G16 A;  1M90 4;  1NU3 A;  2P05 A;  1JNQ A;  3OWU A;  3WOD G;  1YVB I;  3CPO A;  4U13 A;  3UJM A;  1NJI 4;  3LXU X;  4R9L A;  2QEX 3;  3DMC A;  3S29 A;  1S72 3;  2B1X B;  3F7X A;  3LT9 A;  3X3Y A;  4EV5 A;  5AII A;  4KFE A;  2B24 B;  3SX1 A;  2GBW B;  1TU5 A;  3CMA 3;  3CCU 3;  8CHO A;  1D6Z A;  3T0U A;  4RNZ A;  3T8U A;  3DZL A;  1RN7 A;  3EN1 B;  2ZDJ A;  3GAX A;  1UUW B;  5FW5 A;  4EV2 A;  3WA3 A;  3HII A;  4HKV B;  1OHO A;  1ROV A;  3LTA A;  3G71 3;  1JRQ A;  1D6Y A;  3JUO A;  3EE1 A;  4FMB A;  3MHE A;  2GU1 A;  3UL5 A;  3WMD A;  4HM2 B;  2CFG A;  2C10 A;  3FSD A;  4XDV A;  4KFD A;  2Z76 A;  3GZB A;  2Z7A A;  1O7H B;  2WGQ A;  4MEI A;  2UX0 A;  4K61 A;  1ULJ B;  2OQE C;  2C11 A;  3NXJ A;  1QJG A;  2PZV A;  3UNL A;  3CC7 3;  1OAC A;  2W6J H;  3N9H A;  1IK3 A;  1OPY A;  2A15 A;  1YI2 3;  1VQK 3;  1FGT A;  3BND A;  4N6L A;  2QA4 3;  1NDO B;  1Q82 4;  3ER7 A;  3EB8 A;  3QK9 A;  4JF8 A;  3STD A;  4HM8 B;  4FMA A;  4FCJ A;  3CCR 3;  3DM8 A;  3LH4 A;  4WP5 A;  5AYR B;  4N6U A;  2D42 A;  1YJW 3;  1VQ7 3;  4WHA A;  3NQY A;  3EBT A;  2FNQ A;  2I9W A;  3PCR A;  1Q7Y 4;  3DY5 A;  1J2B A;  2Z77 A;  1K28 A;  4HM7 B;  1OGZ A;  5JPU A;  5EQL A;  3SXX A;  4WYK A;  3FH1 A;  5KP1 A;  1ULI B;  2CHC A;  3CC2 3;  1VQL 3;  3FG1 A;  2HMO B;  1IV9 A;  4N6M A;  5HGR A;  4O8S A;  1IDP A;  3G8Z A;  3HI7 A;  3F8H A;  1W6Y A;  3Q1C A;  2FXT A;  4IPB A;  1N8R 4;  1VQ8 3;  3TDG A;  3OXA A;  1ZX2 A;  3IMA B;  4OUQ A;  1DMM A;  1O7P B;  2XFT A;  3L0R A;  4LEH A;  4ORL A;  1WTH A;  3LYG A;  1SQW A;  3EJV A;  7STD A;  3CXC 2;  2QGU A;  4HJL B;  3LTB A;  1WMP A;  2JQ5 A;  1VQM 3;  1QVG 2;  4WFO A;  3BNB A;  1TIJ A;  2Y74 A;  2PNC A;  1YIT 3;  4AEQ A;  3CCJ 3;  1A90 A;  1VQ4 3;  1LNH A;  2Z6B A;  3LML A;  3K9M C;  4NRE A;  4HZB B;  2W56 A;  3CCQ 3;  1NB5 I;  3H3H A;  3NBR A;  3GRD A;  5KP3 A;  3LTD A;  5CF1 A;  5IF6 A;  1EKM A;  4CCV A;  1FUW A;  1WQL B;  4I4K A;  2XFS A;  1VQ6 3;  1PU4 A;  2L4V A;  3DGM A;  3KFQ C;  3PYJ A;  3BNE A;  4X2O A;  3F40 A;  3K5T A;  4HM3 B;  3KSP A;  1M1K 4;  2CFD A;  4HBR A;  5EVH A;  3I55 3;  3F8X A;  1QAK A;  5LC7 A;  4IIA A;  3NM2 A;  4X2H A;  2OTL 3;  4HM0 B;  3GZY B;  4RZM A;  1K73 4;  3X3Z A;  1K41 A;  2CWU A;  1OCV A;  5AYS C;  3X42 A;  2K54 A;  4FCZ A;  3V92 A;  3CME 3;  3CCE 3;  3CCS 3;  1QAL A;  2BNG A;  3Q2P A;  4FCM A;  1JV2 B;  1O7M B;  3KSE D;  4LMI A;  2RCD A;  3D9R A;  3N8B A;  3EHC A;  4LSO A;  1MOL A;  3G6E 3;  4GB5 A;  1VQN 3;  4HM1 B;  3DGL A;  1CEW I;  3NBB A;  4XBX A;  4TX4 A;  2D1W A;  5CXO A;  2LYX A;  1NO3 A;  2BMQ B;  2CG0 A;  5AIG A;  5AEW B;  3LT8 A;  2RSX A;  3MYT A;  3SVA A;  1IT8 A;  2HMN B;  1U8C B;  3PCS A;  2O9U X;  1IVV A;  3JUN A;  3FCS B;  3T8N A;  1IQX A;  4L7K A;  2BHM A;  3VGN A;  1A67 A;  2IUK A;  1RJO A;  1OH0 A;  2XH9 A;  2XEP A;  1L5G B;  1N9E A;  1O7G B;  5CLK A;  3MKI A;  2QIY A;  1M9G A;  2GBX B;  2CIU A;  3DXO A;  4R80 A;  3FGY A;  4L8O A;  3X3X A;  1FGQ A;  3VF1 A;  2GXF A;  1JJ2 2;  1DMQ A;  3MG1 A;  2YX9 A;  1OF5 A;  3OWY A;  5FGO A;  3JUM A;  3EBY A;  1AVL A;  5CF2 A;  3ECF A;  4KFF A;  1BUQ A;  1QAF A;  3BLZ A;  3HK4 A;  3KKG A;  2R4I A;  4CDL A;  3FKA A;  2LQV A;  3SLU A;  4L8P A;  1W2Z A;  1TFO A;  4OK0 A;  5STD A;  3RGA A;  3EN8 A;  3J7Y d;  3JVC A;  4AKZ A;  1O7N B;  1GY7 A;  5IG0 A;  2KCD A;  3OX9 A;  5D81 A;  3V98 A;  4EXR A;  2M7O A;  1KQS 2;  2BMO B;  4RNY A;  3LZA A;  3CCV 3;  3CU3 A;  1IU7 A;  2YFI B;  3BB9 A;  3M8C A;  3F7S A;  1OUN A;  1AR0 A;  2ML5 A;  1WNH A;  1C7H A;  2CKF B;  3SOY A;  5IG5 A;  2GEY A;  2HMJ B;  4BTX A;  1W7C A;  2W0Q A;  3NBJ A;  1KC8 4;  2E2T A;  1DVD A;  2INX A;  3CD6 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...