1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
4K1VA 3FLJA 2QIYA 3VSYA 3G0KA 3KSPA 1GY5A 3MG2A 3OWYA 1E97A 2W2CA 4OVMA 3M8CA 2XRXB 3HX8A 3ROBA 1CQSA 3NM2A 2GXFA 4XBTA 2CHCA 4HVNA 1O7GB 1JB2A 3B8LA 4KVHA 2R4IA 3EQQB 3F9SA 5DREA 5EVHA 3G8ZA 2BMQB 3CNMA 1OGXA 4L7KA 4K1UA 4LGQA 3OWUA 2GBWB 5STDA 5IF6A 1ASKA 4GB5A 3F8XA 3EC9A 3K7CA 3T8NA 1UUVB 3DZLA 1DMMA 2GEYA 3ER7A 4XBYA 2Z77A 5AIIA 3S5CA 1JN5A 5IERA 1ZO2A 4WWUC 3F8HA 3NUVA 1W01A 2HMMB 1A2KA 3GZBA 1AR0A 3OV4A 3GWRA 3D9RA 3B7CA 3F14A 3JUMA 3E99A 1IDPA 4X2HA 2F98A 2STDA 3MHEA 4LMIA 1GS3A 5AIGA 4R9LA 3KKGA 2PZVA 3Q90A 4WP5A 1ISKA 5KP1A 5JPPA 3OXAA 3WMDA 3K0ZA 2JQ5A 3T8UA 1JKGB 1WQLB 2IMJA 4J9AA 3IPTA 5IG0A 2HMNB 4HM5B 1ULJB 4HM4B 1K41A 1OHOA 1NDOB 4HM6B 4XDWA 1QJGA 5BVBA 1OGZA 1OH0A 2F86B 1Q42A 2K54A 3HZPA 1BUQA 2Z7AA 1GYBA 5CLKA 2HMJB 1VZZA 5DRVA 1ZX2A 3EBTA 5CK6A 1EG9B 5IEOA 3DMCA 3MSOA 4HM0B 5AEUB 4HKVB 5BXQA 5KP4A 5TGNA 2XSHB 1O7PB 1C7HA 1UUWB 1Z1SA 3JUOA 3G16A 1OF5B 2Z76A 3CU3A 3RGRA 2RFRA 3MKIA 2I9WA 4R9KA 2XSOB 2YFJB 1S5AA 1W02A 3MG3A 1JB5A 1NWWA 3FF2A 1Q40B 3UJMA 4LEHA 3JUQA 3I0YA 4HJLB 5IG3A 4HM8B 1O7NB 3GRDA 1OHSA 3EX9A 4WYKB 5IG5A 4XB5A 2XR8B 5IEPA 3SOAA 2YFLB 4CDLA 5AI1A 1JKGA 1QMAA 3FKAA 3FGYA 4HM7B 1E3VA 3GZXB 3F7SA 3B4OA 5AIFA 4PEJA 3EN8A 3SEDA 2HMLB 3DUKA 4FCJA 3BLZA 1O7HB 4XDVA 5G2GA 3STDA 3F40A 2B24B 5CXOA 5KP3A 3FSDA 4XBXA 1GY6A 2RCDA 4H3UA 1HKXA 4J8TA 2OWPA 3KE7A 2BMOB 4RZMA 1DMQA 6STDA 5IENA 2A15A 1OPYA 3GZRA 5CF1A 3FZWA 2BNGA 1OF5A 5FW5A 1JB4A 3ECFA 1OCVA 3A76A 4R1KA 3CPOA 3DXOA 5AIHA 3BB9A 2YFIB 4STDA 4HZ9B 3EJVA 3NV0B 2CKFB 1EA2A 3H3HA 3MG1A 1Q40A 3MYTA 3LZAA 3DM8A 2HMOB 2B1XB 1TP6A 4Q53A 3B4PA 3NBRA 5HGRA 4X2OA 1TUHA 4WYKA 2INXA 5D83A 4U13A 3EBYA 2QGUA 5D81A 1W00A 3UNLA 2RGQA 3JUNA 5CF2A 3NXJA 4HM2B 3LYGA 3OWSA 3RGAA 3KZTA 1U5OA 1O7WB 4L8PA 2HMKB 4HM3B 4ORLA 4I4KA 2UX0A 3CNXA 1OHPA 1DMNA 1SJWA 4L8OA 7STDA 1W6YA 3EHCA 3GZYB 4MJDA 4IIAA 2GBXB 4HM1B 3F7XA 4FCMA 2F99A 3H51A 1O7MB 1JN5B 3EF8A 4XM4A 3NHXA 3EN1B 3FH1A 1GY7A 5AEWB 3VGNA 3HK4A 3SOYA 3OX9A 4HZBB 1NU3A 8CHOA 2BMRB 2GEXA 1ULIB 4OUQA 4N3VA 5D82A 1OUNA 3JUPA 1STDA 5JPUA 5IG4A 1E3RA 3NV0A 3FF0A
chains in the Genus database with same CATH superfamily
4K1VA 3CCR3 4O02B 2MF7A 3FLJA 2QIYA 3URPA 3VSYA 2P05A 3V98A 4BU4A 3AMOA 3G0KA 6GSPA 3KSPA 1GY5A 1R4YA 3MG2A 2Z6BA 1I3IA 1B2UA 3OWYA 4EV5A 4BTXA 2ML5A 1E97A 2W2CA 4OVMA 1DETA 3M8CA 2XRXB 3KN4A 5M18A 1IVWA 2C4BA 3HX8A 1LRAA 3BNBA 3K9MC 1ROVA 4R4KA 3ROBA 2XGNA 3Q2PA 2Y73A 5AYRB 1CQSA 2BO9B 5M19A 1W2B2 2CX0A 1YHQ3 3NM2A 2GXFA 1AQZA 8RNTA 1BOXA 1R4CA 2KF5A 2CHCA 4HVNA 4XBTA 1O7GB 1JB2A 3X42A 5JBSA 3D3LA 1GSPA 3B8LA 1BNSA 3AHSA 4KVHA 1RCLA 3CCU3 2RBIA 2W9PA 1JNQA 2R4IA 3EQQB 4RNZA 3FCSB 3NM7A 4FR9A 1YJ93 1VQL3 1BNRA 1KWIA 3HI7A 3N54B 1IV9A 2KF4A 1RTUA 4N6UA 3F9SA 1IV7A 1B20A 1BNIA 3HIIA 1VQ63 5DREA 5EVHA 3G8ZA 2BMQB 3SLUA 3CNMA 2OOVA 1X1UA 3TDGA 3CCV3 1LOYA 2ZL8A 1OGXA 2F56A 2OOVC 1RNBA 4L7KA 4QWTA 1GMQA 4K1UA 1RHLA 2F4YA 3OWUA 3LXUX 4LGQA 1FA3A 2GBWB 3S28A 1IK3A 2W56B 2WOFA 5STDA 2RNTA 1RGCA 5IF6A 1IQ8A 1ASKA 3OW22 3KCHA 2D1WA 1VQQA 3F8XA 3EC9A 4GB5A 3K7CA 2P38A 1G0TA 1GMPA 3T8NA 5LC7A 2WGQA 4AKZA 3MWZA 4CJNA 1TRQA 3QRDA 3ZG5A 3LMLA 1UUVB 3CPW2 3WHOA 3LT8A 3DZLA 1DMMA 3CCL3 2GSPA 2GU3A 1RGKA 2GEYA 3ER7A 4XBYA 1JZOA 1BVIA 2Z77A 5AIIA 1RGGA 1CEWI 1JN5A 4FMCA 3S5CA 2BU4A 4RNYA 2V1LA 3CC23 5IERA 2CC3A 1MGRA 1ZO2A 1EUIC 1UGIA 2SBLA 3FG4A 3S29A 1BRIA 2P0MA 1Q814 4WWUC 3DGLA 1RCKA 3F8HA 1VQO3 1W5ZA 3NUVA 4EXRA 4NHFA 4R80A 1Q7Y4 1W01A 1GOVA 2FGTA 2P09A 1FGQA 2HMMB 1NB5I 1SIHA 2W9QA 1PY3A 1GD4A 1HU9A 1A2KA 2CG0A 4EC6A 3D5IA 2KCDA 4RBNA 3KSED 3CC73 1EQKA 3GZBA 1GOYA 1FUWA 1PFPA 1J2BA 1WMPA 2CFWA 3HIGA 3S27A 1AR0A 1U8CB 1T3BA 3OV4A 3RDEA 5M1AA 1UCLA 3GWRA 3CD63 4HOHA 3D9RA 2XFTA 3PXMA 1IVXA 4FMBA 1HYFA 2O3OA 1D6YA 2PNCA 2E2VA 2LQVA 1AVLA 4GHOA 1MOLA 3B7CA 3F14A 1N9EA 2CFKA 1AVKA 2FNQA 3LTAA 2OQEA 1MNLA 3JUMA 1A2VA 3E99A 3O8YA 1TRPA 5RNTA 1IDPA 3NBBA 4X2HA 3G713 2F98A 3N8BA 1WNHA 2STDA 3MHEA 4CPKA 4LMIA 2L1SA 2ZDJA 1BRNL 4FMDA 1GS3A 3DH2A 5AIGA 1UI7A 3KKGA 2PZVA 2XF3A 4R9LA 1I3FA 3Q90A 1LVNA 1WMNA 4WP5A 1RGEA 2AAEA 4AEQA 1BRGA 1JZDA 1M1K4 1ISKA 2IUKA 2R41A 2KXGA 5KP1A 1STFI 4DKIA 5JPPA 1JBRA 3OXAA 3WMDA 3K0ZA 2JQ5A 3T8UA 1JKGB 1WQLB 1WTHA 1ZGXA 3DGOA 4LYLB 1Q864 2IMJA 2BT3A 2KAAA 2QEX3 4J9AA 3IPTA 2OTJ3 5IG0A 2CG1A 3SYUA 2HMNB 4HYZA 1S723 4HM5B 1JJ22 1ULJB 1YJW3 3S67A 4HM4B 3X3YA 2M7OA 2ZA4A 4ZM8A 3RNTA 2OTL3 1K41A 1OHOA 2W6JH 1I8VA 1NDOB 1Q7HA 4MMZB 5G1LA 2L4VA 4HM6B 5I97A 2CFDA 2CX1A 1X1YA 3PZWA 3LT9A 1CYUA 2W56A 1QJGA 1RDSA 2IA7A 4XDWA 5BVBA 1N5PA 4K90B 1SPUA 3WOEB 1VQP3 1OGZA 1BRHA 1OH0A 2GU1A 1I0XA 1RGFA 4OK0A 3UL5A 1QAKA 4RNTA 1SQWA 2F86B 1BSCA 1RRHA 2W0QA 3DGNA 1BSEA 1T5YA 3ALAA 1Q42A 2K54A 4JRFA 3HZPA 1QVF2 3DGYA 1BUQA 2W03A 2WGOA 1K8A4 3EB8A 2Z7AA 1BSBA 1GYBA 5CLKA 2HMJB 1VZZA 3G4S3 3PS8A 1D6ZA 5DRVA 1ZX2A 1VQM3 3CCE3 4EBGA 3EBTA 1SIIA 5CK6A 1EG9B 3DMCA 4HM0B 3MSOA 5IEOA 1K734 5AEUB 1TTOA 3ZG0A 1VQ83 4BTYA 2QA43 4HKVB 5BXQA 3CCJ3 5KP4A 1BSAA 4N6V0 1TU5A 3X3XA 1A2PA 1BRKA 3BNCA 2KF6A 4NPBA 1FGTA 2XSHB 5TGNA 1O7PB 1C7HA 2W04A 1UUWB 1G02A 1I2EA 1YI23 1Z1SA 5A0OB 3JUOA 3G16A 1W6CA 3UL6A 1UDII 2AADA 1B2MA 2XFSA 3VF1A 3CXC2 1OF5B 2Z76A 3CU3A 2IUJA 3NX0A 3RGRA 4EV2A 1JBSA 4I5QA 2RFRA 2Y74A 1YIT3 3MKIA 3DY5A 2I9WA 1C54A 1YVBI 3IJEB 3U1WA 2CW9A 2KRTA 4R9KA 2XSOB 1KD14 2ML6A 2H0HA 2YFJB 1RN7A 1S5AA 5G1KA 4AKYA 1IT8A 4NREA 1W02A 3MG3A 1JB5A 1TFOA 1NWWA 3K5TA 4BIRA 1CYVA 2CWVA 3FF2A 3V99A 3BNEA 3AHWA 1Q40B 3UJMA 1YJN3 1UUGB 1ZS7A 4LEHA 2E2TA 4N6OB 3ZFZA 3WA2X 4O3VA 3JUQA 5IW9A 3CC43 1LXEA 3I0YA 1KC84 1UCJA 1M904 1M1XB 1B3SA 4HJLB 1MWTA 2JDIH 5IG3A 4HM8B 1FYSA 1O7NB 3GRDA 1RGHA 4LSOA 2K3DA 1MWUA 3X41A 1OHSA 1EKMA 2IY2A 2J8XB 1FGOA 1NNVA 3EX9A 4WYKB 5IG5A 4KT3B 3LTDA 4FMAA 1N8QA 4XB5A 2CFLA 2XR8B 5IEPA 3SOAA 9RNTA 1N5HA 1CH0A 2YFLB 4GL6A 2H0IA 2XGLA 1V74A 1BSDA 5ELUA 5AI1A 4J5KA 4CDLA 2HOHA 4O8SA 3D5GA 1VQ43 2E2UA 1B27A 1JKGA 1JV2B 3PCRA 3Q3FA 1QMAA 1YGWA 1DE3A 1MWSA 1DVDA 1T2HA 3FKAA 3FGYA 4HM7B 1E3VA 3GZXB 1KQS2 3F7SA 3B4OA 3L0RA 5AIFA 4PEJA 3HOHA 1X1WA 6RNTA 3LH4A 3EN8A 3SEDA 1RMSA 1YNVX 1LOWA 2CWUA 2HMLB 3DUKA 1VQK3 4FCJA 3AGNA 3PYJA 1GMRA 5BU4A 1BNJA 2SARA 3BLZA 4HAAA 4BL3A 3BU4A 1O7HB 3X40A 1W7CA 4HBRA 1BNGA 2O9UX 4XDVA 5G2GA 3STDA 1I70A 1TFKA 3F40A 2B24B 5CXOA 2CWTA 1US1A 1GOUA 3NBJA 5EEOA 2P0XA 5KP3A 3FSDA 4XBXA 1QVG2 1RKYA 1GY6A 3CCS3 4N6TA 2RCDA 3U97A 1RRLA 2BIRA 4H3UA 2RSXA 3X3ZA 1IYYA 1HKXA 1UCIA 4J8TA 2CIUA 1I2FA 1G96A 2MC8A 3UB1A 2OWPA 1B21A 2XH9A 3BNDA 1W6GA 1WMOA 1RJOA 4KFDA 3KE7A 1RLSA 1BU4A 1Q824 2BMOB 4RZMA 1BGSA 1DMQA 3SXXA 1K9M4 2ZHXB 3JVCA 1B2SA 1IQYA 1FGRA 5FGOA 1FW7A 1NO3A 1YGEA 4N6MA 1IVVA 1B2ZA 2WOHA 1OACA 6STDA 5IENA 1BRJA 1FGMA 4WHAA 3LTCA 1BNFA 2A15A 1I2GA 1BRSA 1OPYA 3GZRA 5CF1A 1FUTA 1FZUA 3FZWA 2H0GA 2BNGA 3QK9A 4LZIA 1OF5A 2IYJA 1X1XA 5FW5A 1JB4A 4GSPA 1PU4A 3DGMA 4EW5A 3ECFA 5BIRA 1IQXA 1OCVA 3A76A 4R1KA 3CPOA 3DXOA 5AIHA 2F5WA 3WODG 3CMA3 3D4AA 1Q9EA 3AGOA 1PYLA 3BB9A 3NQZA 4MEIA 2YFIB 4JF8A 4STDA 4HZ9B 3EJVA 3NV0B 3D79A 3FF0A 2CKFB 1EA2A 3KIIA 3G6E3 3H3HA 4KFFA 1RN4A 3MG1A 3AMOB 1Q40A 3MYTA 3WOFB 3LZAA 1TJDA 3DM8A 2HMOB 2B1XB 3CCM3 1TP6A 1Y4KA 1UI8A 4IPBA 1ROAA 4Q53A 3WA3A 2C10A 3B4PA 1VQ73 3NBRA 2Q07A 2D42A 3KFQC 2UUGC 1IU7A 4X2OA 5HGRA 4J5GA 1V58A 1AY7A 1RNTA 5EQLA 4O2HA 3N9HA 1TUHA 3T0UA 7RNTA 2UGIA 4WYKA 1FUSA 1VQ53 3IMAB 3PGBA 2KF3A 3WDGB 1VQ93 4MMYB 2INXA 4FCZA 5HOHA 5D83A 4U13A 4N6LA 3EBYA 2QGUA 2CK3H 1JBTA 5D81A 3SX1A 1JRQA 1LOXA 1W00A 3UNLA 2RGQA 3CCQ3 3JUNA 1BIRA 1YIJ3 1IT7A 1TIJA 5CF2A 1MGWA 1NJI4 3NXJA 4HM2B 3LYGA 1IVUA 3OWSA 3SVAA 4CCVA 3RGAA 3KZTA 2CH9A 1LQMB 1B2XA 1U5OA 3K63A 3WR2A 1F8NA 1O7WB 1LNIA 4L8PA 3I563 2HMKB 4WFOA 1AV4A 2CFGA 1LNHA 3NQYA 5ELJA 1GD3A 4HM3B 4ORLA 3FG3A 1BUJA 4I4KA 2UX0A 2FXTA 4KFEA 3CNXA 1OHPA 1DMNA 1SJWA 1QALA 1L5GB 4L8OA 1DYUA 7STDA 1HZ1A 1W6YA 3EHCA 2F5MA 1K28A 1RSNA 2C11A 4H61A 1MWRA 4TX4A 5GSPA 3GZYB 3GAXA 4MJDA 1A90A 4IIAA 1UW1A 1YVSA 2GBXB 4HM1B 3F7XA 3I553 1I0VA 4FCMA 1RGAA 2F99A 1DVCA 3H51A 2OCTA 3FG1A 1O7MB 1BAOA 1JN5B 3PCSA 5LC6A 3EF8A 2LYXA 4XM4A 1LOVA 1LQGC 3NHXA 1W4NA 3EN1B 3FH1A 1RN1A 1GY7A 3MPHA 5AEWB 1N8R4 1SARA 3VGNA 3HK4A 1UCKA 3SOYA 1VQN3 3J7Yd 3OX9A 3CME3 1N9JA 1M9GA 4HZBB 7GSPA 1NU3A 2XEPA 2BHMA 1T2IA 3GSPA 3Q1CA 4KZ1A 5AYSC 4BTWA 2OQEC 8CHOA 2BMRB 2GEXA 1A67A 4EYCA 1ULIB 4ILFA 1EEJA 2K0MA 1BANA 4N6NB 1RGLA 4BL2A 4OUQA 3LTBA 4N3VA 1QAFA 5D82A 1OUNA 2WO0A 3LOYA 3BIRA 1BNEA 3JUPA 1STDA 1UGHI 5JPUA 4K61A 1D6UA 3EE1A 5IG4A 4G1MB 3V92A 3A5EA 1E3RA 1NB3I 1W2ZA 4MMXB 3NV0A 4IT7A 1KSIA 1V57A 2YX9A
chains in the Genus database with same CATH topology
4K1VA 3CCR3 4O02B 2MF7A 3FLJA 2QIYA 3VSYA 2P05A 3V98A 3AMOA 3G0KA 3KSPA 1GY5A 3MG2A 2Z6BA 4EV5A 3OWYA 4BTXA 2ML5A 1E97A 2W2CA 4OVMA 3M8CA 2XRXB 3KN4A 1IVWA 3HX8A 3BNBA 3K9MC 3ROBA 1ROVA 4R4KA 2XGNA 3Q2PA 2Y73A 5AYRB 1CQSA 2BO9B 1W2B2 1YHQ3 3NM2A 2GXFA 1R4CA 4XBTA 2CHCA 4HVNA 1O7GB 1JB2A 3X42A 5JBSA 3D3LA 3CCU3 3B8LA 4KVHA 2W9PA 1JNQA 2R4IA 3EQQB 4RNZA 3FCSB 3NM7A 4FR9A 1YJ93 1VQL3 1KWIA 3HI7A 3N54B 1IV9A 4N6UA 3F9SA 1IV7A 3HIIA 1VQ63 5DREA 5EVHA 3G8ZA 2BMQB 3SLUA 3CNMA 2OOVA 3TDGA 3CCV3 2ZL8A 1OGXA 2OOVC 4L7KA 4QWTA 4K1UA 4LGQA 3OWUA 3LXUX 1FA3A 2GBWB 3S28A 1IK3A 2W56B 2WOFA 5STDA 5IF6A 1IQ8A 1ASKA 3OW22 2D1WA 4GB5A 3F8XA 3EC9A 3K7CA 2P38A 3T8NA 4AKZA 5LC7A 2WGQA 3MWZA 3QRDA 3LMLA 1UUVB 3CPW2 3LT8A 3DZLA 1DMMA 3CCL3 2GU3A 2GEYA 3ER7A 4XBYA 2Z77A 5AIIA 4FMCA 1CEWI 1JN5A 3S5CA 3CC23 4RNYA 2V1LA 5IERA 2CC3A 2SBLA 1ZO2A 3S29A 3FG4A 2P0MA 1Q814 4WWUC 3DGLA 3F8HA 1VQO3 1W5ZA 3NUVA 4EXRA 4NHFA 4R80A 1Q7Y4 1W01A 2FGTA 2P09A 1FGQA 2HMMB 1NB5I 1SIHA 2W9QA 1GD4A 1HU9A 1A2KA 2CG0A 4EC6A 2KCDA 4RBNA 3KSED 3CC73 1EQKA 3GZBA 1FUWA 1PFPA 1J2BA 1WMPA 2CFWA 3HIGA 3S27A 1AR0A 1U8CB 3OV4A 3RDEA 3GWRA 3CD63 3D9RA 2XFTA 3PXMA 1IVXA 4FMBA 2O3OA 1D6YA 2PNCA 2E2VA 2LQVA 1AVLA 1MOLA 3B7CA 3F14A 1N9EA 2CFKA 1AVKA 2FNQA 3LTAA 2OQEA 1MNLA 3JUMA 1A2VA 3E99A 3O8YA 1IDPA 3NBBA 4X2HA 3G713 2F98A 3N8BA 1WNHA 2STDA 3MHEA 4LMIA 2ZDJA 4FMDA 1GS3A 5AIGA 1UI7A 3KKGA 2PZVA 2XF3A 4R9LA 3Q90A 1LVNA 1WMNA 4WP5A 4AEQA 1M1K4 1ISKA 2IUKA 2KXGA 5KP1A 1STFI 5JPPA 3OXAA 3WMDA 3K0ZA 2JQ5A 3T8UA 1JKGB 1WQLB 1WTHA 3DGOA 1Q864 2IMJA 2BT3A 2QEX3 4J9AA 3IPTA 2OTJ3 5IG0A 2CG1A 2HMNB 4HYZA 1S723 4HM5B 1JJ22 1ULJB 1YJW3 3S67A 4HM4B 3X3YA 2M7OA 4ZM8A 2OTL3 1K41A 1OHOA 2W6JH 1NDOB 4MMZB 2L4VA 4HM6B 5I97A 2CFDA 3PZWA 1CYUA 3LT9A 2W56A 1QJGA 4XDWA 2IA7A 5BVBA 1N5PA 4K90B 1SPUA 3WOEB 1VQP3 1OGZA 1OH0A 2GU1A 4OK0A 3UL5A 1QAKA 1SQWA 2F86B 1RRHA 2W0QA 3DGNA 1T5YA 3ALAA 1Q42A 2K54A 4JRFA 3HZPA 1QVF2 1BUQA 2W03A 2WGOA 1K8A4 3EB8A 2Z7AA 1GYBA 5CLKA 2HMJB 1VZZA 3G4S3 3PS8A 1D6ZA 5DRVA 1ZX2A 1VQM3 3CCE3 4EBGA 3EBTA 1SIIA 5CK6A 1EG9B 3DMCA 4HM0B 3MSOA 5IEOA 1K734 5AEUB 1VQ83 4BTYA 2QA43 4HKVB 5BXQA 3CCJ3 5KP4A 4N6V0 1TU5A 3X3XA 3BNCA 1FGTA 2XSHB 5TGNA 1O7PB 1C7HA 2W04A 1UUWB 1YI23 1Z1SA 5A0OB 3JUOA 3G16A 1W6CA 3UL6A 2XFSA 3VF1A 3CXC2 1OF5B 2Z76A 3CU3A 2IUJA 3NX0A 3RGRA 4EV2A 2RFRA 2Y74A 1YIT3 3MKIA 3DY5A 2I9WA 1YVBI 3IJEB 3U1WA 2CW9A 2KRTA 4R9KA 2XSOB 1KD14 2ML6A 2YFJB 1RN7A 1S5AA 4AKYA 1IT8A 4NREA 1W02A 3MG3A 1JB5A 1TFOA 1NWWA 3K5TA 1CYVA 2CWVA 3FF2A 3V99A 3BNEA 1Q40B 3UJMA 1YJN3 4LEHA 2E2TA 4N6OB 3WA2X 4O3VA 3JUQA 5IW9A 3CC43 1LXEA 3I0YA 1KC84 1M904 1M1XB 4HJLB 2JDIH 5IG3A 4HM8B 1O7NB 3GRDA 4LSOA 3X41A 1OHSA 1EKMA 1FGOA 3EX9A 4WYKB 5IG5A 3LTDA 4FMAA 1N8QA 4XB5A 2CFLA 2XR8B 5IEPA 3SOAA 1N5HA 2YFLB 4GL6A 2XGLA 1V74A 4CDLA 5ELUA 5AI1A 4O8SA 1VQ43 2E2UA 1JKGA 1JV2B 3PCRA 1QMAA 1DVDA 3FKAA 3FGYA 4HM7B 1E3VA 3GZXB 1KQS2 3F7SA 3B4OA 3L0RA 5AIFA 4PEJA 3LH4A 3EN8A 3SEDA 2CWUA 2HMLB 3DUKA 1VQK3 4FCJA 3PYJA 3BLZA 1O7HB 3X40A 1W7CA 4HBRA 2O9UX 4XDVA 5G2GA 3STDA 1TFKA 3F40A 2B24B 5CXOA 2CWTA 1US1A 3NBJA 5EEOA 2P0XA 5KP3A 3FSDA 4XBXA 1QVG2 1RKYA 1GY6A 3CCS3 4N6TA 2RCDA 3U97A 1RRLA 4H3UA 2RSXA 3X3ZA 1HKXA 4J8TA 2CIUA 1G96A 2MC8A 3UB1A 2OWPA 2XH9A 3BNDA 1W6GA 1WMOA 1RJOA 4KFDA 3KE7A 1Q824 2BMOB 4RZMA 1DMQA 3SXXA 1K9M4 3JVCA 5FGOA 1IQYA 1FGRA 1NO3A 1YGEA 4N6MA 1IVVA 2WOHA 6STDA 1OACA 5IENA 1FGMA 4WHAA 3LTCA 2A15A 1OPYA 3GZRA 5CF1A 3FZWA 3QK9A 2BNGA 4LZIA 1OF5A 5FW5A 1PU4A 1JB4A 3DGMA 3ECFA 1IQXA 1OCVA 3A76A 4R1KA 3CPOA 3DXOA 5AIHA 3WODG 3CMA3 4MEIA 3BB9A 3NQZA 2YFIB 4JF8A 4STDA 4HZ9B 3EJVA 3NV0B 2CKFB 1EA2A 3KIIA 3G6E3 3H3HA 4KFFA 3MG1A 3AMOB 1Q40A 3MYTA 3WOFB 3LZAA 3DM8A 2HMOB 2B1XB 3CCM3 1TP6A 1Y4KA 1UI8A 4IPBA 1ROAA 4Q53A 3WA3A 2C10A 3B4PA 1VQ73 3NBRA 2Q07A 2D42A 3KFQC 4X2OA 1IU7A 5HGRA 5EQLA 4O2HA 3N9HA 1TUHA 3T0UA 4WYKA 1VQ53 3IMAB 3PGBA 3WDGB 1VQ93 4MMYB 2INXA 4FCZA 5D83A 4U13A 4N6LA 3EBYA 2QGUA 2CK3H 5D81A 3SX1A 1JRQA 1LOXA 1W00A 3UNLA 2RGQA 3CCQ3 3JUNA 1YIJ3 1IT7A 1TIJA 5CF2A 1NJI4 3NXJA 4HM2B 3LYGA 1IVUA 3OWSA 3SVAA 4CCVA 3RGAA 3KZTA 2CH9A 1U5OA 3K63A 1F8NA 1O7WB 4L8PA 3I563 2HMKB 4WFOA 1AV4A 2CFGA 1LNHA 3NQYA 5ELJA 1GD3A 4HM3B 4ORLA 3FG3A 4I4KA 2UX0A 2FXTA 4KFEA 3CNXA 1OHPA 1DMNA 1SJWA 1QALA 1L5GB 4L8OA 1DYUA 7STDA 1W6YA 3EHCA 1K28A 2C11A 4H61A 4TX4A 3GZYB 3GAXA 4MJDA 1A90A 4IIAA 1UW1A 2GBXB 4HM1B 3F7XA 3I553 4FCMA 2F99A 1DVCA 3H51A 2OCTA 3FG1A 1O7MB 5LC6A 1JN5B 3PCSA 3EF8A 2LYXA 4XM4A 3NHXA 1W4NA 3EN1B 3FH1A 1GY7A 3MPHA 5AEWB 1N8R4 3VGNA 3HK4A 3SOYA 1VQN3 3J7Yd 3OX9A 3CME3 1N9JA 1M9GA 4HZBB 1NU3A 2XEPA 2BHMA 3Q1CA 4KZ1A 5AYSC 4BTWA 2OQEC 8CHOA 2BMRB 2GEXA 1A67A 4EYCA 1ULIB 2K0MA 4N6NB 4OUQA 3LTBA 4N3VA 1QAFA 5D82A 1OUNA 2WO0A 3LOYA 3JUPA 1STDA 5JPUA 4K61A 1D6UA 3EE1A 5IG4A 4G1MB 3V92A 1E3RA 1NB3I 1W2ZA 4MMXB 3NV0A 4IT7A 1KSIA 3FF0A 2YX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1V A;  3FLJ A;  2QIY A;  3VSY A;  3G0K A;  3KSP A;  1GY5 A;  3MG2 A;  3OWY A;  1E97 A;  2W2C A;  4OVM A;  3M8C A;  2XRX B;  3HX8 A;  3ROB A;  1CQS A;  3NM2 A;  2GXF A;  4XBT A;  2CHC A;  4HVN A;  1O7G B;  1JB2 A;  3B8L A;  4KVH A;  2R4I A;  3EQQ B;  3F9S A;  5DRE A;  5EVH A;  3G8Z A;  2BMQ B;  3CNM A;  1OGX A;  4L7K A;  4K1U A;  4LGQ A;  3OWU A;  2GBW B;  5STD A;  5IF6 A;  1ASK A;  4GB5 A;  3F8X A;  3EC9 A;  3K7C A;  3T8N A;  1UUV B;  3DZL A;  1DMM A;  2GEY A;  3ER7 A;  4XBY A;  2Z77 A;  5AII A;  3S5C A;  1JN5 A;  5IER A;  1ZO2 A;  4WWU C;  3F8H A;  3NUV A;  1W01 A;  2HMM B;  1A2K A;  3GZB A;  1AR0 A;  3OV4 A;  3GWR A;  3D9R A;  3B7C A;  3F14 A;  3JUM A;  3E99 A;  1IDP A;  4X2H A;  2F98 A;  2STD A;  3MHE A;  4LMI A;  1GS3 A;  5AIG A;  4R9L A;  3KKG A;  2PZV A;  3Q90 A;  4WP5 A;  1ISK A;  5KP1 A;  5JPP A;  3OXA A;  3WMD A;  3K0Z A;  2JQ5 A;  3T8U A;  1JKG B;  1WQL B;  2IMJ A;  4J9A A;  3IPT A;  5IG0 A;  2HMN B;  4HM5 B;  1ULJ B;  4HM4 B;  1K41 A;  1OHO A;  1NDO B;  4HM6 B;  4XDW A;  1QJG A;  5BVB A;  1OGZ A;  1OH0 A;  2F86 B;  1Q42 A;  2K54 A;  3HZP A;  1BUQ A;  2Z7A A;  1GYB A;  5CLK A;  2HMJ B;  1VZZ A;  5DRV A;  1ZX2 A;  3EBT A;  5CK6 A;  1EG9 B;  5IEO A;  3DMC A;  3MSO A;  4HM0 B;  5AEU B;  4HKV B;  5BXQ A;  5KP4 A;  5TGN A;  2XSH B;  1O7P B;  1C7H A;  1UUW B;  1Z1S A;  3JUO A;  3G16 A;  1OF5 B;  2Z76 A;  3CU3 A;  3RGR A;  2RFR A;  3MKI A;  2I9W A;  4R9K A;  2XSO B;  2YFJ B;  1S5A A;  1W02 A;  3MG3 A;  1JB5 A;  1NWW A;  3FF2 A;  1Q40 B;  3UJM A;  4LEH A;  3JUQ A;  3I0Y A;  4HJL B;  5IG3 A;  4HM8 B;  1O7N B;  3GRD A;  1OHS A;  3EX9 A;  4WYK B;  5IG5 A;  4XB5 A;  2XR8 B;  5IEP A;  3SOA A;  2YFL B;  4CDL A;  5AI1 A;  1JKG A;  1QMA A;  3FKA A;  3FGY A;  4HM7 B;  1E3V A;  3GZX B;  3F7S A;  3B4O A;  5AIF A;  4PEJ A;  3EN8 A;  3SED A;  2HML B;  3DUK A;  4FCJ A;  3BLZ A;  1O7H B;  4XDV A;  5G2G A;  3STD A;  3F40 A;  2B24 B;  5CXO A;  5KP3 A;  3FSD A;  4XBX A;  1GY6 A;  2RCD A;  4H3U A;  1HKX A;  4J8T A;  2OWP A;  3KE7 A;  2BMO B;  4RZM A;  1DMQ A;  6STD A;  5IEN A;  2A15 A;  1OPY A;  3GZR A;  5CF1 A;  3FZW A;  2BNG A;  1OF5 A;  5FW5 A;  1JB4 A;  3ECF A;  1OCV A;  3A76 A;  4R1K A;  3CPO A;  3DXO A;  5AIH A;  3BB9 A;  2YFI B;  4STD A;  4HZ9 B;  3EJV A;  3NV0 B;  2CKF B;  1EA2 A;  3H3H A;  3MG1 A;  1Q40 A;  3MYT A;  3LZA A;  3DM8 A;  2HMO B;  2B1X B;  1TP6 A;  4Q53 A;  3B4P A;  3NBR A;  5HGR A;  4X2O A;  1TUH A;  4WYK A;  2INX A;  5D83 A;  4U13 A;  3EBY A;  2QGU A;  5D81 A;  1W00 A;  3UNL A;  2RGQ A;  3JUN A;  5CF2 A;  3NXJ A;  4HM2 B;  3LYG A;  3OWS A;  3RGA A;  3KZT A;  1U5O A;  1O7W B;  4L8P A;  2HMK B;  4HM3 B;  4ORL A;  4I4K A;  2UX0 A;  3CNX A;  1OHP A;  1DMN A;  1SJW A;  4L8O A;  7STD A;  1W6Y A;  3EHC A;  3GZY B;  4MJD A;  4IIA A;  2GBX B;  4HM1 B;  3F7X A;  4FCM A;  2F99 A;  3H51 A;  1O7M B;  1JN5 B;  3EF8 A;  4XM4 A;  3NHX A;  3EN1 B;  3FH1 A;  1GY7 A;  5AEW B;  3VGN A;  3HK4 A;  3SOY A;  3OX9 A;  4HZB B;  1NU3 A;  8CHO A;  2BMR B;  2GEX A;  1ULI B;  4OUQ A;  4N3V A;  5D82 A;  1OUN A;  3JUP A;  1STD A;  5JPU A;  5IG4 A;  1E3R A;  3NV0 A;  3FF0 A; 
#chains in the Genus database with same CATH topology
 4K1V A;  3CCR 3;  4O02 B;  2MF7 A;  3FLJ A;  2QIY A;  3URP A;  3VSY A;  2P05 A;  3V98 A;  4BU4 A;  3AMO A;  3G0K A;  6GSP A;  3KSP A;  1GY5 A;  1R4Y A;  3MG2 A;  2Z6B A;  1I3I A;  1B2U A;  3OWY A;  4EV5 A;  4BTX A;  2ML5 A;  1E97 A;  2W2C A;  4OVM A;  1DET A;  3M8C A;  2XRX B;  3KN4 A;  5M18 A;  1IVW A;  2C4B A;  3HX8 A;  1LRA A;  3BNB A;  3K9M C;  1ROV A;  4R4K A;  3ROB A;  2XGN A;  3Q2P A;  2Y73 A;  5AYR B;  1CQS A;  2BO9 B;  5M19 A;  1W2B 2;  2CX0 A;  1YHQ 3;  3NM2 A;  2GXF A;  1AQZ A;  8RNT A;  1BOX A;  1R4C A;  2KF5 A;  2CHC A;  4HVN A;  4XBT A;  1O7G B;  1JB2 A;  3X42 A;  5JBS A;  3D3L A;  1GSP A;  3B8L A;  1BNS A;  3AHS A;  4KVH A;  1RCL A;  3CCU 3;  2RBI A;  2W9P A;  1JNQ A;  2R4I A;  3EQQ B;  4RNZ A;  3FCS B;  3NM7 A;  4FR9 A;  1YJ9 3;  1VQL 3;  1BNR A;  1KWI A;  3HI7 A;  3N54 B;  1IV9 A;  2KF4 A;  1RTU A;  4N6U A;  3F9S A;  1IV7 A;  1B20 A;  1BNI A;  3HII A;  1VQ6 3;  5DRE A;  5EVH A;  3G8Z A;  2BMQ B;  3SLU A;  3CNM A;  2OOV A;  1X1U A;  3TDG A;  3CCV 3;  1LOY A;  2ZL8 A;  1OGX A;  2F56 A;  2OOV C;  1RNB A;  4L7K A;  4QWT A;  1GMQ A;  4K1U A;  1RHL A;  2F4Y A;  3OWU A;  3LXU X;  4LGQ A;  1FA3 A;  2GBW B;  3S28 A;  1IK3 A;  2W56 B;  2WOF A;  5STD A;  2RNT A;  1RGC A;  5IF6 A;  1IQ8 A;  1ASK A;  3OW2 2;  3KCH A;  2D1W A;  1VQQ A;  3F8X A;  3EC9 A;  4GB5 A;  3K7C A;  2P38 A;  1G0T A;  1GMP A;  3T8N A;  5LC7 A;  2WGQ A;  4AKZ A;  3MWZ A;  4CJN A;  1TRQ A;  3QRD A;  3ZG5 A;  3LML A;  1UUV B;  3CPW 2;  3WHO A;  3LT8 A;  3DZL A;  1DMM A;  3CCL 3;  2GSP A;  2GU3 A;  1RGK A;  2GEY A;  3ER7 A;  4XBY A;  1JZO A;  1BVI A;  2Z77 A;  5AII A;  1RGG A;  1CEW I;  1JN5 A;  4FMC A;  3S5C A;  2BU4 A;  4RNY A;  2V1L A;  3CC2 3;  5IER A;  2CC3 A;  1MGR A;  1ZO2 A;  1EUI C;  1UGI A;  2SBL A;  3FG4 A;  3S29 A;  1BRI A;  2P0M A;  1Q81 4;  4WWU C;  3DGL A;  1RCK A;  3F8H A;  1VQO 3;  1W5Z A;  3NUV A;  4EXR A;  4NHF A;  4R80 A;  1Q7Y 4;  1W01 A;  1GOV A;  2FGT A;  2P09 A;  1FGQ A;  2HMM B;  1NB5 I;  1SIH A;  2W9Q A;  1PY3 A;  1GD4 A;  1HU9 A;  1A2K A;  2CG0 A;  4EC6 A;  3D5I A;  2KCD A;  4RBN A;  3KSE D;  3CC7 3;  1EQK A;  3GZB A;  1GOY A;  1FUW A;  1PFP A;  1J2B A;  1WMP A;  2CFW A;  3HIG A;  3S27 A;  1AR0 A;  1U8C B;  1T3B A;  3OV4 A;  3RDE A;  5M1A A;  1UCL A;  3GWR A;  3CD6 3;  4HOH A;  3D9R A;  2XFT A;  3PXM A;  1IVX A;  4FMB A;  1HYF A;  2O3O A;  1D6Y A;  2PNC A;  2E2V A;  2LQV A;  1AVL A;  4GHO A;  1MOL A;  3B7C A;  3F14 A;  1N9E A;  2CFK A;  1AVK A;  2FNQ A;  3LTA A;  2OQE A;  1MNL A;  3JUM A;  1A2V A;  3E99 A;  3O8Y A;  1TRP A;  5RNT A;  1IDP A;  3NBB A;  4X2H A;  3G71 3;  2F98 A;  3N8B A;  1WNH A;  2STD A;  3MHE A;  4CPK A;  4LMI A;  2L1S A;  2ZDJ A;  1BRN L;  4FMD A;  1GS3 A;  3DH2 A;  5AIG A;  1UI7 A;  3KKG A;  2PZV A;  2XF3 A;  4R9L A;  1I3F A;  3Q90 A;  1LVN A;  1WMN A;  4WP5 A;  1RGE A;  2AAE A;  4AEQ A;  1BRG A;  1JZD A;  1M1K 4;  1ISK A;  2IUK A;  2R41 A;  2KXG A;  5KP1 A;  1STF I;  4DKI A;  5JPP A;  1JBR A;  3OXA A;  3WMD A;  3K0Z A;  2JQ5 A;  3T8U A;  1JKG B;  1WQL B;  1WTH A;  1ZGX A;  3DGO A;  4LYL B;  1Q86 4;  2IMJ A;  2BT3 A;  2KAA A;  2QEX 3;  4J9A A;  3IPT A;  2OTJ 3;  5IG0 A;  2CG1 A;  3SYU A;  2HMN B;  4HYZ A;  1S72 3;  4HM5 B;  1JJ2 2;  1ULJ B;  1YJW 3;  3S67 A;  4HM4 B;  3X3Y A;  2M7O A;  2ZA4 A;  4ZM8 A;  3RNT A;  2OTL 3;  1K41 A;  1OHO A;  2W6J H;  1I8V A;  1NDO B;  1Q7H A;  4MMZ B;  5G1L A;  2L4V A;  4HM6 B;  5I97 A;  2CFD A;  2CX1 A;  1X1Y A;  3PZW A;  3LT9 A;  1CYU A;  2W56 A;  1QJG A;  1RDS A;  2IA7 A;  4XDW A;  5BVB A;  1N5P A;  4K90 B;  1SPU A;  3WOE B;  1VQP 3;  1OGZ A;  1BRH A;  1OH0 A;  2GU1 A;  1I0X A;  1RGF A;  4OK0 A;  3UL5 A;  1QAK A;  4RNT A;  1SQW A;  2F86 B;  1BSC A;  1RRH A;  2W0Q A;  3DGN A;  1BSE A;  1T5Y A;  3ALA A;  1Q42 A;  2K54 A;  4JRF A;  3HZP A;  1QVF 2;  3DGY A;  1BUQ A;  2W03 A;  2WGO A;  1K8A 4;  3EB8 A;  2Z7A A;  1BSB A;  1GYB A;  5CLK A;  2HMJ B;  1VZZ A;  3G4S 3;  3PS8 A;  1D6Z A;  5DRV A;  1ZX2 A;  1VQM 3;  3CCE 3;  4EBG A;  3EBT A;  1SII A;  5CK6 A;  1EG9 B;  3DMC A;  4HM0 B;  3MSO A;  5IEO A;  1K73 4;  5AEU B;  1TTO A;  3ZG0 A;  1VQ8 3;  4BTY A;  2QA4 3;  4HKV B;  5BXQ A;  3CCJ 3;  5KP4 A;  1BSA A;  4N6V 0;  1TU5 A;  3X3X A;  1A2P A;  1BRK A;  3BNC A;  2KF6 A;  4NPB A;  1FGT A;  2XSH B;  5TGN A;  1O7P B;  1C7H A;  2W04 A;  1UUW B;  1G02 A;  1I2E A;  1YI2 3;  1Z1S A;  5A0O B;  3JUO A;  3G16 A;  1W6C A;  3UL6 A;  1UDI I;  2AAD A;  1B2M A;  2XFS A;  3VF1 A;  3CXC 2;  1OF5 B;  2Z76 A;  3CU3 A;  2IUJ A;  3NX0 A;  3RGR A;  4EV2 A;  1JBS A;  4I5Q A;  2RFR A;  2Y74 A;  1YIT 3;  3MKI A;  3DY5 A;  2I9W A;  1C54 A;  1YVB I;  3IJE B;  3U1W A;  2CW9 A;  2KRT A;  4R9K A;  2XSO B;  1KD1 4;  2ML6 A;  2H0H A;  2YFJ B;  1RN7 A;  1S5A A;  5G1K A;  4AKY A;  1IT8 A;  4NRE A;  1W02 A;  3MG3 A;  1JB5 A;  1TFO A;  1NWW A;  3K5T A;  4BIR A;  1CYV A;  2CWV A;  3FF2 A;  3V99 A;  3BNE A;  3AHW A;  1Q40 B;  3UJM A;  1YJN 3;  1UUG B;  1ZS7 A;  4LEH A;  2E2T A;  4N6O B;  3ZFZ A;  3WA2 X;  4O3V A;  3JUQ A;  5IW9 A;  3CC4 3;  1LXE A;  3I0Y A;  1KC8 4;  1UCJ A;  1M90 4;  1M1X B;  1B3S A;  4HJL B;  1MWT A;  2JDI H;  5IG3 A;  4HM8 B;  1FYS A;  1O7N B;  3GRD A;  1RGH A;  4LSO A;  2K3D A;  1MWU A;  3X41 A;  1OHS A;  1EKM A;  2IY2 A;  2J8X B;  1FGO A;  1NNV A;  3EX9 A;  4WYK B;  5IG5 A;  4KT3 B;  3LTD A;  4FMA A;  1N8Q A;  4XB5 A;  2CFL A;  2XR8 B;  5IEP A;  3SOA A;  9RNT A;  1N5H A;  1CH0 A;  2YFL B;  4GL6 A;  2H0I A;  2XGL A;  1V74 A;  1BSD A;  5ELU A;  5AI1 A;  4J5K A;  4CDL A;  2HOH A;  4O8S A;  3D5G A;  1VQ4 3;  2E2U A;  1B27 A;  1JKG A;  1JV2 B;  3PCR A;  3Q3F A;  1QMA A;  1YGW A;  1DE3 A;  1MWS A;  1DVD A;  1T2H A;  3FKA A;  3FGY A;  4HM7 B;  1E3V A;  3GZX B;  1KQS 2;  3F7S A;  3B4O A;  3L0R A;  5AIF A;  4PEJ A;  3HOH A;  1X1W A;  6RNT A;  3LH4 A;  3EN8 A;  3SED A;  1RMS A;  1YNV X;  1LOW A;  2CWU A;  2HML B;  3DUK A;  1VQK 3;  4FCJ A;  3AGN A;  3PYJ A;  1GMR A;  5BU4 A;  1BNJ A;  2SAR A;  3BLZ A;  4HAA A;  4BL3 A;  3BU4 A;  1O7H B;  3X40 A;  1W7C A;  4HBR A;  1BNG A;  2O9U X;  4XDV A;  5G2G A;  3STD A;  1I70 A;  1TFK A;  3F40 A;  2B24 B;  5CXO A;  2CWT A;  1US1 A;  1GOU A;  3NBJ A;  5EEO A;  2P0X A;  5KP3 A;  3FSD A;  4XBX A;  1QVG 2;  1RKY A;  1GY6 A;  3CCS 3;  4N6T A;  2RCD A;  3U97 A;  1RRL A;  2BIR A;  4H3U A;  2RSX A;  3X3Z A;  1IYY A;  1HKX A;  1UCI A;  4J8T A;  2CIU A;  1I2F A;  1G96 A;  2MC8 A;  3UB1 A;  2OWP A;  1B21 A;  2XH9 A;  3BND A;  1W6G A;  1WMO A;  1RJO A;  4KFD A;  3KE7 A;  1RLS A;  1BU4 A;  1Q82 4;  2BMO B;  4RZM A;  1BGS A;  1DMQ A;  3SXX A;  1K9M 4;  2ZHX B;  3JVC A;  1B2S A;  1IQY A;  1FGR A;  5FGO A;  1FW7 A;  1NO3 A;  1YGE A;  4N6M A;  1IVV A;  1B2Z A;  2WOH A;  1OAC A;  6STD A;  5IEN A;  1BRJ A;  1FGM A;  4WHA A;  3LTC A;  1BNF A;  2A15 A;  1I2G A;  1BRS A;  1OPY A;  3GZR A;  5CF1 A;  1FUT A;  1FZU A;  3FZW A;  2H0G A;  2BNG A;  3QK9 A;  4LZI A;  1OF5 A;  2IYJ A;  1X1X A;  5FW5 A;  1JB4 A;  4GSP A;  1PU4 A;  3DGM A;  4EW5 A;  3ECF A;  5BIR A;  1IQX A;  1OCV A;  3A76 A;  4R1K A;  3CPO A;  3DXO A;  5AIH A;  2F5W A;  3WOD G;  3CMA 3;  3D4A A;  1Q9E A;  3AGO A;  1PYL A;  3BB9 A;  3NQZ A;  4MEI A;  2YFI B;  4JF8 A;  4STD A;  4HZ9 B;  3EJV A;  3NV0 B;  3D79 A;  3FF0 A;  2CKF B;  1EA2 A;  3KII A;  3G6E 3;  3H3H A;  4KFF A;  1RN4 A;  3MG1 A;  3AMO B;  1Q40 A;  3MYT A;  3WOF B;  3LZA A;  1TJD A;  3DM8 A;  2HMO B;  2B1X B;  3CCM 3;  1TP6 A;  1Y4K A;  1UI8 A;  4IPB A;  1ROA A;  4Q53 A;  3WA3 A;  2C10 A;  3B4P A;  1VQ7 3;  3NBR A;  2Q07 A;  2D42 A;  3KFQ C;  2UUG C;  1IU7 A;  4X2O A;  5HGR A;  4J5G A;  1V58 A;  1AY7 A;  1RNT A;  5EQL A;  4O2H A;  3N9H A;  1TUH A;  3T0U A;  7RNT A;  2UGI A;  4WYK A;  1FUS A;  1VQ5 3;  3IMA B;  3PGB A;  2KF3 A;  3WDG B;  1VQ9 3;  4MMY B;  2INX A;  4FCZ A;  5HOH A;  5D83 A;  4U13 A;  4N6L A;  3EBY A;  2QGU A;  2CK3 H;  1JBT A;  5D81 A;  3SX1 A;  1JRQ A;  1LOX A;  1W00 A;  3UNL A;  2RGQ A;  3CCQ 3;  3JUN A;  1BIR A;  1YIJ 3;  1IT7 A;  1TIJ A;  5CF2 A;  1MGW A;  1NJI 4;  3NXJ A;  4HM2 B;  3LYG A;  1IVU A;  3OWS A;  3SVA A;  4CCV A;  3RGA A;  3KZT A;  2CH9 A;  1LQM B;  1B2X A;  1U5O A;  3K63 A;  3WR2 A;  1F8N A;  1O7W B;  1LNI A;  4L8P A;  3I56 3;  2HMK B;  4WFO A;  1AV4 A;  2CFG A;  1LNH A;  3NQY A;  5ELJ A;  1GD3 A;  4HM3 B;  4ORL A;  3FG3 A;  1BUJ A;  4I4K A;  2UX0 A;  2FXT A;  4KFE A;  3CNX A;  1OHP A;  1DMN A;  1SJW A;  1QAL A;  1L5G B;  4L8O A;  1DYU A;  7STD A;  1HZ1 A;  1W6Y A;  3EHC A;  2F5M A;  1K28 A;  1RSN A;  2C11 A;  4H61 A;  1MWR A;  4TX4 A;  5GSP A;  3GZY B;  3GAX A;  4MJD A;  1A90 A;  4IIA A;  1UW1 A;  1YVS A;  2GBX B;  4HM1 B;  3F7X A;  3I55 3;  1I0V A;  4FCM A;  1RGA A;  2F99 A;  1DVC A;  3H51 A;  2OCT A;  3FG1 A;  1O7M B;  1BAO A;  1JN5 B;  3PCS A;  5LC6 A;  3EF8 A;  2LYX A;  4XM4 A;  1LOV A;  1LQG C;  3NHX A;  1W4N A;  3EN1 B;  3FH1 A;  1RN1 A;  1GY7 A;  3MPH A;  5AEW B;  1N8R 4;  1SAR A;  3VGN A;  3HK4 A;  1UCK A;  3SOY A;  1VQN 3;  3J7Y d;  3OX9 A;  3CME 3;  1N9J A;  1M9G A;  4HZB B;  7GSP A;  1NU3 A;  2XEP A;  2BHM A;  1T2I A;  3GSP A;  3Q1C A;  4KZ1 A;  5AYS C;  4BTW A;  2OQE C;  8CHO A;  2BMR B;  2GEX A;  1A67 A;  4EYC A;  1ULI B;  4ILF A;  1EEJ A;  2K0M A;  1BAN A;  4N6N B;  1RGL A;  4BL2 A;  4OUQ A;  3LTB A;  4N3V A;  1QAF A;  5D82 A;  1OUN A;  2WO0 A;  3LOY A;  3BIR A;  1BNE A;  3JUP A;  1STD A;  1UGH I;  5JPU A;  4K61 A;  1D6U A;  3EE1 A;  5IG4 A;  4G1M B;  3V92 A;  3A5E A;  1E3R A;  1NB3 I;  1W2Z A;  4MMX B;  3NV0 A;  4IT7 A;  1KSI A;  1V57 A;  2YX9 A; 
#chains in the Genus database with same CATH homology
 4K1V A;  3CCR 3;  4O02 B;  2MF7 A;  3FLJ A;  2QIY A;  3VSY A;  2P05 A;  3V98 A;  3AMO A;  3G0K A;  3KSP A;  1GY5 A;  3MG2 A;  2Z6B A;  4EV5 A;  3OWY A;  4BTX A;  2ML5 A;  1E97 A;  2W2C A;  4OVM A;  3M8C A;  2XRX B;  3KN4 A;  1IVW A;  3HX8 A;  3BNB A;  3K9M C;  3ROB A;  1ROV A;  4R4K A;  2XGN A;  3Q2P A;  2Y73 A;  5AYR B;  1CQS A;  2BO9 B;  1W2B 2;  1YHQ 3;  3NM2 A;  2GXF A;  1R4C A;  4XBT A;  2CHC A;  4HVN A;  1O7G B;  1JB2 A;  3X42 A;  5JBS A;  3D3L A;  3CCU 3;  3B8L A;  4KVH A;  2W9P A;  1JNQ A;  2R4I A;  3EQQ B;  4RNZ A;  3FCS B;  3NM7 A;  4FR9 A;  1YJ9 3;  1VQL 3;  1KWI A;  3HI7 A;  3N54 B;  1IV9 A;  4N6U A;  3F9S A;  1IV7 A;  3HII A;  1VQ6 3;  5DRE A;  5EVH A;  3G8Z A;  2BMQ B;  3SLU A;  3CNM A;  2OOV A;  3TDG A;  3CCV 3;  2ZL8 A;  1OGX A;  2OOV C;  4L7K A;  4QWT A;  4K1U A;  4LGQ A;  3OWU A;  3LXU X;  1FA3 A;  2GBW B;  3S28 A;  1IK3 A;  2W56 B;  2WOF A;  5STD A;  5IF6 A;  1IQ8 A;  1ASK A;  3OW2 2;  2D1W A;  4GB5 A;  3F8X A;  3EC9 A;  3K7C A;  2P38 A;  3T8N A;  4AKZ A;  5LC7 A;  2WGQ A;  3MWZ A;  3QRD A;  3LML A;  1UUV B;  3CPW 2;  3LT8 A;  3DZL A;  1DMM A;  3CCL 3;  2GU3 A;  2GEY A;  3ER7 A;  4XBY A;  2Z77 A;  5AII A;  4FMC A;  1CEW I;  1JN5 A;  3S5C A;  3CC2 3;  4RNY A;  2V1L A;  5IER A;  2CC3 A;  2SBL A;  1ZO2 A;  3S29 A;  3FG4 A;  2P0M A;  1Q81 4;  4WWU C;  3DGL A;  3F8H A;  1VQO 3;  1W5Z A;  3NUV A;  4EXR A;  4NHF A;  4R80 A;  1Q7Y 4;  1W01 A;  2FGT A;  2P09 A;  1FGQ A;  2HMM B;  1NB5 I;  1SIH A;  2W9Q A;  1GD4 A;  1HU9 A;  1A2K A;  2CG0 A;  4EC6 A;  2KCD A;  4RBN A;  3KSE D;  3CC7 3;  1EQK A;  3GZB A;  1FUW A;  1PFP A;  1J2B A;  1WMP A;  2CFW A;  3HIG A;  3S27 A;  1AR0 A;  1U8C B;  3OV4 A;  3RDE A;  3GWR A;  3CD6 3;  3D9R A;  2XFT A;  3PXM A;  1IVX A;  4FMB A;  2O3O A;  1D6Y A;  2PNC A;  2E2V A;  2LQV A;  1AVL A;  1MOL A;  3B7C A;  3F14 A;  1N9E A;  2CFK A;  1AVK A;  2FNQ A;  3LTA A;  2OQE A;  1MNL A;  3JUM A;  1A2V A;  3E99 A;  3O8Y A;  1IDP A;  3NBB A;  4X2H A;  3G71 3;  2F98 A;  3N8B A;  1WNH A;  2STD A;  3MHE A;  4LMI A;  2ZDJ A;  4FMD A;  1GS3 A;  5AIG A;  1UI7 A;  3KKG A;  2PZV A;  2XF3 A;  4R9L A;  3Q90 A;  1LVN A;  1WMN A;  4WP5 A;  4AEQ A;  1M1K 4;  1ISK A;  2IUK A;  2KXG A;  5KP1 A;  1STF I;  5JPP A;  3OXA A;  3WMD A;  3K0Z A;  2JQ5 A;  3T8U A;  1JKG B;  1WQL B;  1WTH A;  3DGO A;  1Q86 4;  2IMJ A;  2BT3 A;  2QEX 3;  4J9A A;  3IPT A;  2OTJ 3;  5IG0 A;  2CG1 A;  2HMN B;  4HYZ A;  1S72 3;  4HM5 B;  1JJ2 2;  1ULJ B;  1YJW 3;  3S67 A;  4HM4 B;  3X3Y A;  2M7O A;  4ZM8 A;  2OTL 3;  1K41 A;  1OHO A;  2W6J H;  1NDO B;  4MMZ B;  2L4V A;  4HM6 B;  5I97 A;  2CFD A;  3PZW A;  1CYU A;  3LT9 A;  2W56 A;  1QJG A;  4XDW A;  2IA7 A;  5BVB A;  1N5P A;  4K90 B;  1SPU A;  3WOE B;  1VQP 3;  1OGZ A;  1OH0 A;  2GU1 A;  4OK0 A;  3UL5 A;  1QAK A;  1SQW A;  2F86 B;  1RRH A;  2W0Q A;  3DGN A;  1T5Y A;  3ALA A;  1Q42 A;  2K54 A;  4JRF A;  3HZP A;  1QVF 2;  1BUQ A;  2W03 A;  2WGO A;  1K8A 4;  3EB8 A;  2Z7A A;  1GYB A;  5CLK A;  2HMJ B;  1VZZ A;  3G4S 3;  3PS8 A;  1D6Z A;  5DRV A;  1ZX2 A;  1VQM 3;  3CCE 3;  4EBG A;  3EBT A;  1SII A;  5CK6 A;  1EG9 B;  3DMC A;  4HM0 B;  3MSO A;  5IEO A;  1K73 4;  5AEU B;  1VQ8 3;  4BTY A;  2QA4 3;  4HKV B;  5BXQ A;  3CCJ 3;  5KP4 A;  4N6V 0;  1TU5 A;  3X3X A;  3BNC A;  1FGT A;  2XSH B;  5TGN A;  1O7P B;  1C7H A;  2W04 A;  1UUW B;  1YI2 3;  1Z1S A;  5A0O B;  3JUO A;  3G16 A;  1W6C A;  3UL6 A;  2XFS A;  3VF1 A;  3CXC 2;  1OF5 B;  2Z76 A;  3CU3 A;  2IUJ A;  3NX0 A;  3RGR A;  4EV2 A;  2RFR A;  2Y74 A;  1YIT 3;  3MKI A;  3DY5 A;  2I9W A;  1YVB I;  3IJE B;  3U1W A;  2CW9 A;  2KRT A;  4R9K A;  2XSO B;  1KD1 4;  2ML6 A;  2YFJ B;  1RN7 A;  1S5A A;  4AKY A;  1IT8 A;  4NRE A;  1W02 A;  3MG3 A;  1JB5 A;  1TFO A;  1NWW A;  3K5T A;  1CYV A;  2CWV A;  3FF2 A;  3V99 A;  3BNE A;  1Q40 B;  3UJM A;  1YJN 3;  4LEH A;  2E2T A;  4N6O B;  3WA2 X;  4O3V A;  3JUQ A;  5IW9 A;  3CC4 3;  1LXE A;  3I0Y A;  1KC8 4;  1M90 4;  1M1X B;  4HJL B;  2JDI H;  5IG3 A;  4HM8 B;  1O7N B;  3GRD A;  4LSO A;  3X41 A;  1OHS A;  1EKM A;  1FGO A;  3EX9 A;  4WYK B;  5IG5 A;  3LTD A;  4FMA A;  1N8Q A;  4XB5 A;  2CFL A;  2XR8 B;  5IEP A;  3SOA A;  1N5H A;  2YFL B;  4GL6 A;  2XGL A;  1V74 A;  4CDL A;  5ELU A;  5AI1 A;  4O8S A;  1VQ4 3;  2E2U A;  1JKG A;  1JV2 B;  3PCR A;  1QMA A;  1DVD A;  3FKA A;  3FGY A;  4HM7 B;  1E3V A;  3GZX B;  1KQS 2;  3F7S A;  3B4O A;  3L0R A;  5AIF A;  4PEJ A;  3LH4 A;  3EN8 A;  3SED A;  2CWU A;  2HML B;  3DUK A;  1VQK 3;  4FCJ A;  3PYJ A;  3BLZ A;  1O7H B;  3X40 A;  1W7C A;  4HBR A;  2O9U X;  4XDV A;  5G2G A;  3STD A;  1TFK A;  3F40 A;  2B24 B;  5CXO A;  2CWT A;  1US1 A;  3NBJ A;  5EEO A;  2P0X A;  5KP3 A;  3FSD A;  4XBX A;  1QVG 2;  1RKY A;  1GY6 A;  3CCS 3;  4N6T A;  2RCD A;  3U97 A;  1RRL A;  4H3U A;  2RSX A;  3X3Z A;  1HKX A;  4J8T A;  2CIU A;  1G96 A;  2MC8 A;  3UB1 A;  2OWP A;  2XH9 A;  3BND A;  1W6G A;  1WMO A;  1RJO A;  4KFD A;  3KE7 A;  1Q82 4;  2BMO B;  4RZM A;  1DMQ A;  3SXX A;  1K9M 4;  3JVC A;  5FGO A;  1IQY A;  1FGR A;  1NO3 A;  1YGE A;  4N6M A;  1IVV A;  2WOH A;  6STD A;  1OAC A;  5IEN A;  1FGM A;  4WHA A;  3LTC A;  2A15 A;  1OPY A;  3GZR A;  5CF1 A;  3FZW A;  3QK9 A;  2BNG A;  4LZI A;  1OF5 A;  5FW5 A;  1PU4 A;  1JB4 A;  3DGM A;  3ECF A;  1IQX A;  1OCV A;  3A76 A;  4R1K A;  3CPO A;  3DXO A;  5AIH A;  3WOD G;  3CMA 3;  4MEI A;  3BB9 A;  3NQZ A;  2YFI B;  4JF8 A;  4STD A;  4HZ9 B;  3EJV A;  3NV0 B;  2CKF B;  1EA2 A;  3KII A;  3G6E 3;  3H3H A;  4KFF A;  3MG1 A;  3AMO B;  1Q40 A;  3MYT A;  3WOF B;  3LZA A;  3DM8 A;  2HMO B;  2B1X B;  3CCM 3;  1TP6 A;  1Y4K A;  1UI8 A;  4IPB A;  1ROA A;  4Q53 A;  3WA3 A;  2C10 A;  3B4P A;  1VQ7 3;  3NBR A;  2Q07 A;  2D42 A;  3KFQ C;  4X2O A;  1IU7 A;  5HGR A;  5EQL A;  4O2H A;  3N9H A;  1TUH A;  3T0U A;  4WYK A;  1VQ5 3;  3IMA B;  3PGB A;  3WDG B;  1VQ9 3;  4MMY B;  2INX A;  4FCZ A;  5D83 A;  4U13 A;  4N6L A;  3EBY A;  2QGU A;  2CK3 H;  5D81 A;  3SX1 A;  1JRQ A;  1LOX A;  1W00 A;  3UNL A;  2RGQ A;  3CCQ 3;  3JUN A;  1YIJ 3;  1IT7 A;  1TIJ A;  5CF2 A;  1NJI 4;  3NXJ A;  4HM2 B;  3LYG A;  1IVU A;  3OWS A;  3SVA A;  4CCV A;  3RGA A;  3KZT A;  2CH9 A;  1U5O A;  3K63 A;  1F8N A;  1O7W B;  4L8P A;  3I56 3;  2HMK B;  4WFO A;  1AV4 A;  2CFG A;  1LNH A;  3NQY A;  5ELJ A;  1GD3 A;  4HM3 B;  4ORL A;  3FG3 A;  4I4K A;  2UX0 A;  2FXT A;  4KFE A;  3CNX A;  1OHP A;  1DMN A;  1SJW A;  1QAL A;  1L5G B;  4L8O A;  1DYU A;  7STD A;  1W6Y A;  3EHC A;  1K28 A;  2C11 A;  4H61 A;  4TX4 A;  3GZY B;  3GAX A;  4MJD A;  1A90 A;  4IIA A;  1UW1 A;  2GBX B;  4HM1 B;  3F7X A;  3I55 3;  4FCM A;  2F99 A;  1DVC A;  3H51 A;  2OCT A;  3FG1 A;  1O7M B;  5LC6 A;  1JN5 B;  3PCS A;  3EF8 A;  2LYX A;  4XM4 A;  3NHX A;  1W4N A;  3EN1 B;  3FH1 A;  1GY7 A;  3MPH A;  5AEW B;  1N8R 4;  3VGN A;  3HK4 A;  3SOY A;  1VQN 3;  3J7Y d;  3OX9 A;  3CME 3;  1N9J A;  1M9G A;  4HZB B;  1NU3 A;  2XEP A;  2BHM A;  3Q1C A;  4KZ1 A;  5AYS C;  4BTW A;  2OQE C;  8CHO A;  2BMR B;  2GEX A;  1A67 A;  4EYC A;  1ULI B;  2K0M A;  4N6N B;  4OUQ A;  3LTB A;  4N3V A;  1QAF A;  5D82 A;  1OUN A;  2WO0 A;  3LOY A;  3JUP A;  1STD A;  5JPU A;  4K61 A;  1D6U A;  3EE1 A;  5IG4 A;  4G1M B;  3V92 A;  1E3R A;  1NB3 I;  1W2Z A;  4MMX B;  3NV0 A;  4IT7 A;  1KSI A;  3FF0 A;  2YX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...