1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
2BMRB 1C7HA 3OXAA 4GB5A 1SJWA 3FGYA 5AEWB 5CF2A 3Q90A 5JPPA 1JB5A 2QIYA 4HM8B 3EQQB 2F98A 5KP1A 3FH1A 4XB5A 2Z76A 1K41A 1A2KA 2GXFA 3NM2A 1DMMA 4KVHA 1Q40B 2JQ5A 3K0ZA 4CDLA 1IDPA 2K54A 3NHXA 1JKGA 2RCDA 1W01A 5TGNA 3OWYA 3UJMA 3T8UA 3F8HA 3DMCA 1OF5A 3NUVA 3EN1B 3F7XA 1HKXA 4LMIA 1GY5A 1O7HB 5JPUA 2YFLB 1W00A 4HZ9B 3OV4A 4R9KA 3RGAA 1S5AA 1GY7A 3GZBA 3EX9A 5AIHA 5AEUB 3IPTA 3JUPA 4J8TA 5IG3A 3SOAA 3G0KA 3GZYB 3OWSA 2OWPA 2F99A 5KP4A 1OGXA 4L8OA 3KSPA 3D9RA 4R9LA 4WYKB 1TP6A 1NU3A 3NV0A 2A15A 4U13A 5EVHA 5BXQA 3FSDA 1ASKA 1JN5A 4FCJA 3VSYA 1ZO2A 4STDA 5AIIA 2CHCA 4HJLB 4RZMA 1NWWA 3MG2A 5D83A 5AIGA 5IG5A 3MKIA 1ULIB 3LYGA 4J9AA 5IG4A 1JN5B 3CNMA 4HM7B 2XR8B 3BLZA 1NDOB 2XSOB 3JUOA 3STDA 2INXA 4WYKA 3WMDA 3DZLA 3E99A 5IENA 5CXOA 3MYTA 5CK6A 2HMNB 2GBXB 3NXJA 3NV0B 2HMLB 3HX8A 2RGQA 3H51A 2STDA 3F14A 4XBYA 4I4KA 4XDWA 5STDA 3SEDA 2PZVA 1CQSA 3S5CA 2W2CA 2B1XB 1VZZA 2CKFB 2XRXB 4HVNA 5IEPA 7STDA 2XSHB 3FZWA 4OUQA 1O7PB 3BB9A 4PEJA 1W6YA 5AI1A 2BMQB 4ORLA 1O7MB 3MHEA 3SOYA 3FKAA 5IERA 5IEOA 1TUHA 3EJVA 8CHOA 1UUWB 1OUNA 3DXOA 2I9WA 4HM2B 4HM5B 4HM6B 4XBXA 4XDVA 2F86B 3EN8A 1OF5B 3CPOA 1EG9B 3GRDA 1JKGB 3HZPA 3CNXA 2HMJB 3F8XA 3EHCA 3MG3A 3H3HA 5IF6A 1AR0A 1OHPA 1GY6A 2RFRA 3DUKA 3ER7A 1BUQA 3VGNA 5FW5A 3UNLA 1ZX2A 2Z7AA 3HK4A 1E97A 3M8CA 4Q53A 1QJGA 4XBTA 3B7CA 2HMOB 1OHSA 3B8LA 3ROBA 3EBYA 5G2GA 3T8NA 1GS3A 4HZBB 4K1UA 5D81A 1ISKA 4L7KA 4IIAA 2GEYA 4WWUC 4XM4A 4K1VA 3RGRA 2UX0A 4LEHA 3OX9A 2GEXA 1JB2A 3EC9A 3F40A 3FF2A 3LZAA 4OVMA 3F7SA 4WP5A 5HGRA 3EF8A 2R4IA 3CU3A 4HM4B 3OWUA 1ULJB 4R1KA 2HMMB 3DM8A 5AIFA 1OHOA 4HM1B 1E3VA 4X2HA 3GWRA 4LGQA 1OPYA 5BVBA 2YFJB 1WQLB 1E3RA 3KE7A 3GZXB 3B4OA 4FCMA 5DRVA 5DREA 4HM0B 1QMAA 3JUMA 1UUVB 1Z1SA 2IMJA 4HM3B 2HMKB 1OGZA 3NBRA 4HKVB 2BMOB 1Q40A 3JUNA 1O7WB 4N3VA 5CLKA 3MSOA 5KP3A 1OCVA 1U5OA 3A76A 3GZRA 5D82A 3F9SA 5IG0A 1OH0A 3I0YA 3FF0A 2Z77A 1Q42A 3G16A 5CF1A 6STDA 3B4PA 3FLJA 3KZTA 3JUQA 2GBWB 1O7NB 2BNGA 3ECFA 1EA2A 2QGUA 3K7CA 2YFIB 4X2OA 3EBTA 4L8PA 1DMQA 4MJDA 3G8ZA 4H3UA 1GYBA 1O7GB 1JB4A 1W02A 2B24B 1DMNA 3KKGA 3MG1A 1STDA
chains in the Genus database with same CATH superfamily
2BMRB 1C7HA 5AEWB 5JPPA 1D6YA 4HM8B 1JNQA 3ZG5A 2P09A 1K41A 1GD4A 1RGKA 2UGIA 4ILFA 1DMMA 1Q40B 3WA2X 1RGEA 2K54A 1W01A 5TGNA 3BNBA 1UW1A 2OTL3 3F8HA 1VQP3 3N9HA 1G0TA 3X3ZA 1AQZA 1QVF2 3NUVA 1N5HA 1HKXA 4LMIA 4N6TA 3G713 5JPUA 1YVSA 1W00A 2IA7A 3OV4A 4HZ9B 1BAOA 4OK0A 3RGAA 4N6OB 1KWIA 5AIHA 1BRNL 1RN7A 3JUPA 3EE1A 3SOAA 2LYXA 1I3FA 2XFSA 4R9LA 1TP6A 1NU3A 3FG4A 3NM7A 1QAFA 1V58A 1HZ1A 2K0MA 2CFWA 3PGBA 3VSYA 1B20A 4STDA 1IQXA 1RGLA 3MG2A 2KF6A 4RNYA 4HM7B 2XR8B 3BLZA 3PXMA 1NDOB 3WOEB 4N6MA 5ELJA 1X1YA 3DZLA 3AHWA 4HYZA 2CFLA 2HMNB 3HX8A 1LRAA 1CYVA 1T2HA 2HOHA 3H51A 2STDA 3F14A 4XDWA 2CG0A 3I563 3SEDA 1FGQA 1S723 2AAEA 2B1XB 2W56A 1BU4A 2E2UA 2ZL8A 3AHSA 1X1WA 2O9UX 1B2MA 3BB9A 1BRKA 3KN4A 2XGLA 1W6YA 4IT7A 2ML6A 2W0QA 1Q7HA 5IEOA 3S29A 8CHOA 1RNBA 2H0HA 4HM5B 1Q9EA 3U97A 3I553 4XDVA 3DGMA 1OF5B 1Q814 1RN1A 3X3XA 1BRHA 3CC43 2GSPA 3CNXA 3EHCA 1FUWA 3ER7A 1Q824 5FW5A 3PCSA 1ZX2A 4XBTA 1E97A 4FMAA 4Q53A 3UB1A 9RNTA 3ROBA 3T8NA 1BNRA 1RLSA 3EBYA 1PU4A 2WO0A 4K1UA 1ISKA 1TTOA 4IIAA 4K1VA 3CCR3 1IT7A 1OACA 1KC84 3OX9A 3PYJA 1I0XA 1JB2A 3EC9A 1KD14 2R4IA 3CU3A 2CX0A 1BANA 1ULJB 4HM4B 4R4KA 5AIFA 1OHOA 1RDSA 1RGAA 2XF3A 4N6LA 4N6NB 1J2BA 1OPYA 2WOFA 1E3RA 1DETA 1VQO3 3CD63 1ZS7A 1BRJA 1K28A 5EEOA 1UUVB 3BU4A 4AKZA 1I3IA 2F4YA 5M19A 1M9GA 1Q40A 5LC6A 2BIRA 1IVVA 1O7WB 2ZDJA 4H61A 3MSOA 5KP3A 4EV2A 1U5OA 1WMPA 3A76A 1OH0A 1EUIC 2OQEA 4JRFA 1HYFA 1Q42A 1U8CB 1M1K4 2CIUA 2P05A 1DE3A 1O7NB 3ECFA 3K7CA 1LNIA 2QGUA 4X2OA 2YFIB 3EBTA 4L8PA 1LOVA 4MJDA 4H3UA 1I8VA 3O8YA 1LOYA 3DH2A 1RKYA 1W02A 1T3BA 2RNTA 3KKGA 5IW9A 3OXAA 1IV7A 4GB5A 1BVIA 1LOWA 1SJWA 2V1LA 3Q90A 1JB5A 3A5EA 4EC6A 4I5QA 1YJN3 2F98A 3CPW2 1TJDA 3FH1A 3CCL3 4XB5A 4ZM8A 1YI23 1YVBI 1BNIA 1BRGA 4BTWA 4KT3B 3J7Yd 1GD3A 1W7CA 4CCVA 3UJMA 1VQ83 3T8UA 1X1UA 3V99A 1N5PA 1BNSA 3EN1B 1GY5A 2YFLB 3HIGA 4R9KA 3D79A 1FGMA 1W6GA 3LXUX 1S5AA 3OW22 1BNEA 3EX9A 3IPTA 4J8TA 3GZYB 1D6ZA 3OWSA 1BSDA 1GMRA 1MWSA 1OGXA 2FGTA 3SYUA 5KP4A 4WYKB 1TRPA 1UI8A 1L5GB 1TFOA 2GU1A 5EVHA 3AGOA 3BNDA 5BXQA 1G02A 1FUTA 3HOHA 1ASKA 4CJNA 3ALAA 4EBGA 2RBIA 1VQK3 1JZOA 4FCJA 4RZMA 1FZUA 1WTHA 1NWWA 1DYUA 4IPBA 1TFKA 1FW7A 5IG4A 3KSED 4J9AA 1YIT3 2CWVA 2ZA4A 3ZG0A 1RHLA 1RRLA 3JUOA 3STDA 1KQS2 2INXA 1RGGA 3E99A 2KF5A 3MYTA 1MWTA 2GBXB 3NXJA 4BU4A 1SIHA 1UUGB 2RSXA 5LC7A 3CXC2 1A2VA 1VQL3 1B2SA 2PZVA 1A90A 1TRQA 2W2CA 4HVNA 3S5CA 4AEQA 4BL2A 5IEPA 3DGLA 4KFDA 2CH9A 3FZWA 1O7PB 4PEJA 1T5YA 5AI1A 1BSCA 1JV2B 5IERA 5JBSA 2K3DA 4KZ1A 1EKMA 8RNTA 3HIIA 1A2PA 3DXOA 1MGWA 3FCSB 3AMOA 1QVG2 1VQ93 4HM6B 1FGTA 4NPBA 1D6UA 4DKIA 4RBNA 3CPOA 3GRDA 2CFDA 2HMJB 3F8XA 3PZWA 1RMSA 2RFRA 1GY6A 3HI7A 2CK3H 1BUQA 1W2B2 3M8CA 2HMOB 2QEX3 4N6V0 1GS3A 4HZBB 2XH9A 3NQYA 3LTBA 4L7KA 2P0XA 4WWUC 4XM4A 2KF4A 4TX4A 1NJI4 4LEHA 2GEXA 4WP5A 3LZAA 3Q3FA 2LQVA 3QRDA 4OVMA 3MPHA 3CC23 1YIJ3 2F5WA 3LT8A 2IUKA 4K90B 1WMOA 1E3VA 1PFPA 2E2TA 4HM1B 4X2HA 4BL3A 2ML5A 1TU5A 1WQLB 3KE7A 3GZXB 3LTDA 1UGIA 1NO3A 4J5KA 1ZGXA 4FMCA 3S27A 4HM3B 3U1WA 3LH4A 2HMKB 4RNTA 2BMOB 2WOHA 1LNHA 4N3VA 1SIIA 4GHOA 1AV4A 1CEWI 1FGRA 1US1A 2Y74A 1OCVA 4BIRA 3GZRA 1IQ8A 3F9SA 3KFQC 1UCLA 2QA43 3I0YA 5M18A 3CC73 3B4PA 3JUQA 2GBWB 3S67A 1EA2A 2WGOA 1RTUA 4O02B 4KFEA 1M1XB 1JB4A 3RDEA 3CCU3 1IV9A 1G96A 1K9M4 2QIYA 5BU4A 1FYSA 3BNEA 1ROAA 1GSPA 1V74A 1ROVA 3ZFZA 2JQ5A 3K0ZA 3NHXA 4MMYB 3JVCA 4EV5A 2KXGA 3LTCA 1EQKA 3DMCA 1AY7A 1FUSA 2MC8A 1W4NA 2H0GA 3FG1A 1BGSA 3SXXA 4J5GA 3D3LA 3G6E3 3CCJ3 1RGCA 1O7HB 5HOHA 1BUJA 3NBJA 4K61A 1B21A 1VQN3 3G4S3 5AEUB 3GZBA 1IYYA 1HU9A 1I2GA 5IG3A 4NHFA 1I70A 3G0KA 5FGOA 1RCLA 3KSPA 2W03A 1BOXA 3D5GA 1VQ53 4U13A 3KIIA 3FSDA 2OQEC 1Q7Y4 1JN5A 4RNZA 5AIIA 4HJLB 5D83A 4BTYA 2C10A 5AIGA 2BT3A 1GMQA 3UL5A 1ULIB 1JRQA 3DGOA 1V57A 3LYGA 1YNVX 2Y73A 1MGRA 2R41A 2BHMA 3S28A 4WYKA 5IENA 2L1SA 3URPA 5CXOA 1MNLA 1YGWA 2XFTA 1RGHA 2RGQA 2W56B 1RNTA 5STDA 3X41A 4I4KA 3N54B 1N8QA 4EW5A 1I2FA 2CKFB 1VZZA 2XRXB 3CCE3 1VQ63 7STDA 2XSHB 1DVDA 4OUQA 1YHQ3 2F5MA 2CFKA 3SOYA 1O7MB 5G1LA 3FKAA 3NX0A 3BNCA 1B27A 1UUWB 1OUNA 3CCS3 1UCJA 2OOVC 4XBXA 3X42A 2J8XB 1NB5I 2CW9A 3EN8A 1LQGC 1LQMB 1EG9B 2CX1A 1JKGB 3HZPA 1LOXA 3AMOB 3GSPA 3H3HA 3MG3A 5IF6A 1OHPA 1K734 3CMA3 1R4CA 3VGNA 1RRHA 3UNLA 2Z7AA 1DVCA 1IVXA 1QJGA 3IJEB 1OHSA 3B8LA 5G2GA 5EQLA 5D81A 3RGRA 1BNFA 2UX0A 3UL6A 3CCM3 1CYUA 5HGRA 1GOVA 1RJOA 3D4AA 3CCV3 3OWUA 3WOFB 1TIJA 1VQ73 2BO9B 4HOHA 1WMNA 3EB8A 3GWRA 4LGQA 7GSPA 2D42A 4FCMA 5DRVA 1N9EA 3B4OA 1AVLA 5A0OB 5DREA 1B2ZA 4LYLB 3V92A 2C11A 1IT8A 1Z1SA 2IMJA 1B2XA 2OOVA 1OGZA 3NBRA 1BSEA 3QK9A 4HKVB 3JUNA 1PYLA 3X3YA 1EEJA 1JBSA 3T0UA 4KFFA 1BSBA 5IG0A 4WHAA 1VQ43 1WNHA 2JDIH 3BIRA 2XEPA 4GSPA 6STDA 3KZTA 3FLJA 1BIRA 1N9JA 1KSIA 2BNGA 1GOUA 4FMDA 4MEIA 1BRSA 5I97A 1LXEA 3G8ZA 1GYBA 1UDII 3Q1CA 1O7GB 2B24B 3MG1A 1STDA 3WHOA 3FGYA 1RSNA 3WR2A 1I2EA 5CF2A 1SQWA 2BU4A 2KAAA 3NBBA 3PCRA 4HBRA 3SLUA 2CFGA 3EQQB 1VQM3 2L4VA 5KP1A 2Z76A 2KF3A 5RNTA 1A2KA 2GXFA 2FXTA 3NM2A 4KVHA 6GSPA 4EYCA 4CDLA 1AVKA 1IDPA 1JKGA 1W2ZA 2RCDA 4N6UA 3OWYA 3V98A 2OTJ3 3SVAA 1BRIA 4LSOA 1QALA 1OF5A 2SBLA 1MWUA 2FNQA 2CWTA 3F7XA 3FG3A 1MWRA 1NNVA 2GU3A 4FR9A 3DY5A 3SX1A 7RNTA 4HAAA 3LOYA 1W6CA 1BNJA 1GY7A 2IYJA 1YGEA 5AYSC 4FMBA 2OWPA 2F99A 3L0RA 4L8OA 3D9RA 2ZHXB 1N8R4 3NV0A 1A67A 2A15A 2W9QA 3K9MC 3VF1A 2Q07A 1UCKA 1SPUA 3N8BA 1ZO2A 5IG5A 2CHCA 1R4YA 2C4BA 1MOLA 1UCIA 4QWTA 4WFOA 4EXRA 3MKIA 3TDGA 2Z6BA 1JN5B 3GAXA 3CNMA 2P38A 1UI7A 2XSOB 4FCZA 1RN4A 1SARA 1IVWA 5BIRA 3WMDA 1X1XA 4GL6A 5ELUA 1BNGA 3PS8A 5CK6A 3NV0B 2HMLB 3RNTA 2F56A 4XBYA 1IU7A 4LZIA 1CQSA 2H0IA 2W04A 3KCHA 1CH0A 3K63A 1B3SA 1T2IA 1GMPA 5M1AA 1UGHI 4O8SA 3CME3 2BMQB 2CC3A 2M7OA 3MHEA 4ORLA 2UUGC 1TUHA 1B2UA 3EJVA 4HM2B 2I9WA 3WODG 3DGNA 4CPKA 3X40A 1YJW3 2P0MA 2AADA 2F86B 1LVNA 2PNCA 3D5IA 2OCTA 1JBTA 1JJ22 1IVUA 1STFI 1AR0A 2XGNA 3DUKA 4AKYA 5GSPA 3DGYA 1PY3A 1JZDA 2MF7A 2W6JH 3HK4A 1Q864 1IK3A 3B7CA 4R80A 4MMXB 1K8A4 2SARA 1C54A 3MWZA 2CG1A 1YJ93 3AGNA 2GEYA 1FGOA 6RNTA 1GOYA 3CCQ3 3K5TA 1FA3A 2IUJA 1BSAA 2IY2A 1RCKA 3F40A 3FF2A 3F7SA 1JBRA 3EF8A 3LT9A 5G1KA 4O3VA 4R1KA 2HMMB 2YX9A 3DM8A 1QAKA 5AYRB 3IMAB 1I0VA 5BVBA 2YFJB 1Y4KA 3NQZA 1F8NA 4BTXA 4HM0B 1QMAA 3JUMA 3LMLA 4NREA 4G1MB 3WA3A 1W5ZA 1IQYA 1NB3I 3Q2PA 4O2HA 1M904 5CLKA 4MMZB 3LTAA 1VQQA 5D82A 1RGFA 2KRTA 3FF0A 2Z77A 3G16A 5CF1A 2KCDA 3WDGB 4JF8A 2E2VA 2WGQA 1DMQA 2D1WA 2O3OA 2CWUA 1DMNA 2W9PA
chains in the Genus database with same CATH topology
2BMRB 1C7HA 5AEWB 5JPPA 1D6YA 4HM8B 1JNQA 2P09A 1K41A 1GD4A 1DMMA 1Q40B 3WA2X 2K54A 1W01A 5TGNA 3BNBA 1UW1A 2OTL3 3F8HA 1VQP3 3N9HA 3X3ZA 1QVF2 3NUVA 1N5HA 1HKXA 4LMIA 4N6TA 3G713 5JPUA 1W00A 2IA7A 3OV4A 4HZ9B 4OK0A 3RGAA 4N6OB 1KWIA 5AIHA 1RN7A 3JUPA 3EE1A 3SOAA 2LYXA 2XFSA 4R9LA 1TP6A 1NU3A 3FG4A 3NM7A 1QAFA 2K0MA 2CFWA 3PGBA 3VSYA 4STDA 1IQXA 3MG2A 4RNYA 4HM7B 2XR8B 3BLZA 3PXMA 1NDOB 3WOEB 4N6MA 5ELJA 4HYZA 3DZLA 2CFLA 2HMNB 3HX8A 1CYVA 3H51A 2STDA 3F14A 4XDWA 2CG0A 3I563 3SEDA 1FGQA 1S723 2B1XB 2W56A 2ZL8A 2E2UA 2O9UX 3BB9A 3KN4A 2XGLA 1W6YA 4IT7A 2ML6A 2W0QA 5IEOA 3S29A 8CHOA 4HM5B 3U97A 3I553 4XDVA 3DGMA 1OF5B 1Q814 3X3XA 3CNXA 3EHCA 1FUWA 3ER7A 1Q824 5FW5A 3PCSA 1ZX2A 4XBTA 1E97A 4FMAA 4Q53A 3UB1A 3ROBA 3T8NA 3EBYA 1PU4A 2WO0A 4K1UA 1ISKA 4IIAA 4K1VA 3CCR3 1IT7A 1OACA 1KC84 3OX9A 3PYJA 1JB2A 3EC9A 1KD14 2R4IA 3CU3A 4HM4B 1ULJB 4R4KA 5AIFA 1OHOA 2XF3A 4N6LA 4N6NB 1J2BA 1OPYA 2WOFA 1E3RA 1VQO3 3CD63 1K28A 5EEOA 1UUVB 4AKZA 1M9GA 1Q40A 5LC6A 1O7WB 2ZDJA 1IVVA 4H61A 3MSOA 5KP3A 4EV2A 1U5OA 1WMPA 3A76A 1OH0A 2OQEA 4JRFA 1Q42A 1M1K4 1U8CB 2CIUA 2P05A 3ECFA 1O7NB 3K7CA 2QGUA 4X2OA 2YFIB 3EBTA 4L8PA 4MJDA 4H3UA 3O8YA 1RKYA 1W02A 3KKGA 5IW9A 3OXAA 1IV7A 4GB5A 1SJWA 2V1LA 3Q90A 1JB5A 4EC6A 1YJN3 2F98A 3CPW2 1YI23 3FH1A 3CCL3 4XB5A 4ZM8A 1YVBI 4BTWA 3J7Yd 1GD3A 1W7CA 4CCVA 3UJMA 1VQ83 3T8UA 3V99A 1N5PA 3EN1B 1GY5A 2YFLB 3HIGA 4R9KA 1FGMA 1W6GA 3LXUX 1S5AA 3OW22 3EX9A 3IPTA 4J8TA 3GZYB 1D6ZA 3OWSA 5KP4A 1OGXA 2FGTA 4WYKB 1UI8A 1L5GB 1TFOA 2GU1A 5EVHA 3BNDA 3CC43 5BXQA 4EBGA 1ASKA 1VQK3 3ALAA 4FCJA 4RZMA 1WTHA 1NWWA 1DYUA 4IPBA 1TFKA 5IG4A 3KSED 4J9AA 1YIT3 2CWVA 1RRLA 3JUOA 3STDA 1KQS2 2INXA 3E99A 3MYTA 2GBXB 3NXJA 1SIHA 2RSXA 5LC7A 3CXC2 1A2VA 1VQL3 2PZVA 1A90A 3S5CA 2W2CA 4HVNA 4AEQA 5IEPA 3DGLA 4KFDA 2CH9A 3FZWA 1O7PB 4PEJA 1T5YA 5AI1A 5IERA 1JV2B 5JBSA 4KZ1A 1EKMA 3HIIA 3DXOA 3FCSB 3AMOA 1QVG2 1VQ93 4HM6B 1FGTA 1D6UA 4RBNA 3CPOA 3GRDA 2CFDA 2HMJB 3F8XA 3PZWA 2RFRA 1GY6A 3HI7A 2CK3H 1BUQA 1W2B2 3M8CA 2HMOB 2QEX3 4N6V0 1GS3A 4HZBB 2XH9A 3NQYA 3LTBA 4L7KA 2P0XA 4WWUC 4XM4A 4TX4A 1NJI4 4LEHA 2GEXA 4WP5A 3LZAA 3QRDA 2LQVA 4OVMA 3CC23 3MPHA 1YIJ3 3LT8A 2IUKA 4K90B 1WMOA 1E3VA 1PFPA 2E2TA 4HM1B 4X2HA 1TU5A 2ML5A 1WQLB 3KE7A 3GZXB 3LTDA 1NO3A 4FMCA 3S27A 4HM3B 3U1WA 3LH4A 2HMKB 2BMOB 2WOHA 1LNHA 4N3VA 1SIIA 1AV4A 1CEWI 1FGRA 1US1A 2Y74A 1OCVA 3GZRA 1IQ8A 3F9SA 3KFQC 2QA43 3I0YA 3CC73 3B4PA 3JUQA 2GBWB 3S67A 1EA2A 2WGOA 4O02B 4KFEA 1M1XB 1JB4A 3RDEA 3CCU3 1IV9A 1G96A 1K9M4 2QIYA 3BNEA 1ROAA 1V74A 1ROVA 2JQ5A 3K0ZA 3NHXA 4MMYB 3JVCA 4EV5A 2KXGA 3LTCA 1EQKA 3DMCA 2MC8A 1W4NA 3FG1A 3SXXA 3G6E3 3CCJ3 3D3LA 1O7HB 3NBJA 4K61A 1VQN3 3G4S3 5AEUB 3GZBA 1HU9A 5IG3A 4NHFA 3G0KA 5FGOA 3KSPA 2W03A 1VQ53 4U13A 3KIIA 3FSDA 2OQEC 1Q7Y4 1JN5A 4RNZA 5AIIA 4HJLB 5D83A 4BTYA 2C10A 5AIGA 2BT3A 3UL5A 1ULIB 1JRQA 3DGOA 3LYGA 2Y73A 2BHMA 3S28A 4WYKA 5IENA 5CXOA 1MNLA 2XFTA 2RGQA 2W56B 5STDA 3X41A 4I4KA 3N54B 1N8QA 2CKFB 1VZZA 2XRXB 3CCE3 1VQ63 7STDA 2XSHB 1DVDA 4OUQA 1YHQ3 2CFKA 3SOYA 1O7MB 3FKAA 3NX0A 3BNCA 1UUWB 1OUNA 3CCS3 2OOVC 4XBXA 3X42A 1NB5I 2CW9A 3EN8A 1EG9B 1JKGB 3HZPA 1LOXA 3AMOB 3MG3A 3H3HA 5IF6A 1OHPA 1K734 3CMA3 1R4CA 3VGNA 1RRHA 3UNLA 2Z7AA 1DVCA 1IVXA 1QJGA 3IJEB 1OHSA 3B8LA 5G2GA 5EQLA 5D81A 3RGRA 2UX0A 3UL6A 3CCM3 1CYUA 5HGRA 1RJOA 3CCV3 3OWUA 3WOFB 1TIJA 1VQ73 2BO9B 1WMNA 3EB8A 3GWRA 4LGQA 2D42A 4FCMA 5DRVA 1N9EA 3B4OA 1AVLA 5A0OB 5DREA 3V92A 2C11A 1IT8A 1Z1SA 2IMJA 2OOVA 1OGZA 3NBRA 4HKVB 3QK9A 3JUNA 3X3YA 3T0UA 4KFFA 5IG0A 4WHAA 1VQ43 1WNHA 2JDIH 2XEPA 6STDA 3KZTA 3FLJA 1N9JA 1KSIA 2BNGA 4FMDA 4MEIA 5I97A 1LXEA 3G8ZA 1GYBA 3Q1CA 1O7GB 2B24B 3MG1A 1STDA 3FGYA 5CF2A 1SQWA 3SLUA 3NBBA 3PCRA 4HBRA 2CFGA 3EQQB 1VQM3 2L4VA 5KP1A 2Z76A 1A2KA 2GXFA 2FXTA 3NM2A 4KVHA 4EYCA 4CDLA 1AVKA 1IDPA 1JKGA 1W2ZA 2RCDA 4N6UA 3OWYA 3V98A 2OTJ3 3SVAA 4LSOA 1QALA 1OF5A 2SBLA 2FNQA 2CWTA 3F7XA 3FG3A 4FR9A 3SX1A 2GU3A 3DY5A 3LOYA 1W6CA 1GY7A 1YGEA 5AYSC 4FMBA 2OWPA 2F99A 3L0RA 4L8OA 3D9RA 1N8R4 3NV0A 1A67A 2A15A 2W9QA 3K9MC 3VF1A 2Q07A 1SPUA 3N8BA 1ZO2A 5IG5A 2CHCA 1MOLA 4EXRA 4WFOA 4QWTA 3MKIA 3TDGA 2Z6BA 1JN5B 3GAXA 3CNMA 2P38A 1UI7A 2XSOB 4FCZA 1IVWA 3WMDA 4GL6A 5ELUA 3PS8A 5CK6A 3NV0B 2HMLB 4XBYA 1IU7A 4LZIA 1CQSA 2W04A 3K63A 4O8SA 3CME3 2BMQB 2CC3A 2M7OA 3MHEA 4ORLA 1TUHA 3EJVA 4HM2B 2I9WA 3WODG 3DGNA 3X40A 1YJW3 2P0MA 2F86B 2PNCA 1LVNA 2OCTA 1JJ22 1IVUA 1STFI 1AR0A 2XGNA 3DUKA 4AKYA 2MF7A 2W6JH 3HK4A 1Q864 1IK3A 3B7CA 4R80A 4MMXB 1K8A4 3MWZA 2CG1A 1YJ93 2GEYA 1FGOA 3CCQ3 3K5TA 1FA3A 2IUJA 3FF2A 3F40A 3F7SA 3EF8A 3LT9A 4O3VA 4R1KA 2HMMB 2YX9A 3DM8A 1QAKA 5AYRB 3IMAB 5BVBA 2YFJB 1Y4KA 3NQZA 1F8NA 4BTXA 4HM0B 1QMAA 3JUMA 3LMLA 4NREA 4G1MB 3WA3A 1W5ZA 1NB3I 1IQYA 3Q2PA 4O2HA 1M904 5CLKA 4MMZB 3LTAA 5D82A 2KRTA 3FF0A 2Z77A 3G16A 5CF1A 2KCDA 3WDGB 4JF8A 2E2VA 2WGQA 1DMQA 2D1WA 2O3OA 2CWUA 1DMNA 2W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMR B;  1C7H A;  3OXA A;  4GB5 A;  1SJW A;  3FGY A;  5AEW B;  5CF2 A;  3Q90 A;  5JPP A;  1JB5 A;  2QIY A;  4HM8 B;  3EQQ B;  2F98 A;  5KP1 A;  3FH1 A;  4XB5 A;  2Z76 A;  1K41 A;  1A2K A;  2GXF A;  3NM2 A;  1DMM A;  4KVH A;  1Q40 B;  2JQ5 A;  3K0Z A;  4CDL A;  1IDP A;  2K54 A;  3NHX A;  1JKG A;  2RCD A;  1W01 A;  5TGN A;  3OWY A;  3UJM A;  3T8U A;  3F8H A;  3DMC A;  1OF5 A;  3NUV A;  3EN1 B;  3F7X A;  1HKX A;  4LMI A;  1GY5 A;  1O7H B;  5JPU A;  2YFL B;  1W00 A;  4HZ9 B;  3OV4 A;  4R9K A;  3RGA A;  1S5A A;  1GY7 A;  3GZB A;  3EX9 A;  5AIH A;  5AEU B;  3IPT A;  3JUP A;  4J8T A;  5IG3 A;  3SOA A;  3G0K A;  3GZY B;  3OWS A;  2OWP A;  2F99 A;  5KP4 A;  1OGX A;  4L8O A;  3KSP A;  3D9R A;  4R9L A;  4WYK B;  1TP6 A;  1NU3 A;  3NV0 A;  2A15 A;  4U13 A;  5EVH A;  5BXQ A;  3FSD A;  1ASK A;  1JN5 A;  4FCJ A;  3VSY A;  1ZO2 A;  4STD A;  5AII A;  2CHC A;  4HJL B;  4RZM A;  1NWW A;  3MG2 A;  5D83 A;  5AIG A;  5IG5 A;  3MKI A;  1ULI B;  3LYG A;  4J9A A;  5IG4 A;  1JN5 B;  3CNM A;  4HM7 B;  2XR8 B;  3BLZ A;  1NDO B;  2XSO B;  3JUO A;  3STD A;  2INX A;  4WYK A;  3WMD A;  3DZL A;  3E99 A;  5IEN A;  5CXO A;  3MYT A;  5CK6 A;  2HMN B;  2GBX B;  3NXJ A;  3NV0 B;  2HML B;  3HX8 A;  2RGQ A;  3H51 A;  2STD A;  3F14 A;  4XBY A;  4I4K A;  4XDW A;  5STD A;  3SED A;  2PZV A;  1CQS A;  3S5C A;  2W2C A;  2B1X B;  1VZZ A;  2CKF B;  2XRX B;  4HVN A;  5IEP A;  7STD A;  2XSH B;  3FZW A;  4OUQ A;  1O7P B;  3BB9 A;  4PEJ A;  1W6Y A;  5AI1 A;  2BMQ B;  4ORL A;  1O7M B;  3MHE A;  3SOY A;  3FKA A;  5IER A;  5IEO A;  1TUH A;  3EJV A;  8CHO A;  1UUW B;  1OUN A;  3DXO A;  2I9W A;  4HM2 B;  4HM5 B;  4HM6 B;  4XBX A;  4XDV A;  2F86 B;  3EN8 A;  1OF5 B;  3CPO A;  1EG9 B;  3GRD A;  1JKG B;  3HZP A;  3CNX A;  2HMJ B;  3F8X A;  3EHC A;  3MG3 A;  3H3H A;  5IF6 A;  1AR0 A;  1OHP A;  1GY6 A;  2RFR A;  3DUK A;  3ER7 A;  1BUQ A;  3VGN A;  5FW5 A;  3UNL A;  1ZX2 A;  2Z7A A;  3HK4 A;  1E97 A;  3M8C A;  4Q53 A;  1QJG A;  4XBT A;  3B7C A;  2HMO B;  1OHS A;  3B8L A;  3ROB A;  3EBY A;  5G2G A;  3T8N A;  1GS3 A;  4HZB B;  4K1U A;  5D81 A;  1ISK A;  4L7K A;  4IIA A;  2GEY A;  4WWU C;  4XM4 A;  4K1V A;  3RGR A;  2UX0 A;  4LEH A;  3OX9 A;  2GEX A;  1JB2 A;  3EC9 A;  3F40 A;  3FF2 A;  3LZA A;  4OVM A;  3F7S A;  4WP5 A;  5HGR A;  3EF8 A;  2R4I A;  3CU3 A;  4HM4 B;  3OWU A;  1ULJ B;  4R1K A;  2HMM B;  3DM8 A;  5AIF A;  1OHO A;  4HM1 B;  1E3V A;  4X2H A;  3GWR A;  4LGQ A;  1OPY A;  5BVB A;  2YFJ B;  1WQL B;  1E3R A;  3KE7 A;  3GZX B;  3B4O A;  4FCM A;  5DRV A;  5DRE A;  4HM0 B;  1QMA A;  3JUM A;  1UUV B;  1Z1S A;  2IMJ A;  4HM3 B;  2HMK B;  1OGZ A;  3NBR A;  4HKV B;  2BMO B;  1Q40 A;  3JUN A;  1O7W B;  4N3V A;  5CLK A;  3MSO A;  5KP3 A;  1OCV A;  1U5O A;  3A76 A;  3GZR A;  5D82 A;  3F9S A;  5IG0 A;  1OH0 A;  3I0Y A;  3FF0 A;  2Z77 A;  1Q42 A;  3G16 A;  5CF1 A;  6STD A;  3B4P A;  3FLJ A;  3KZT A;  3JUQ A;  2GBW B;  1O7N B;  2BNG A;  3ECF A;  1EA2 A;  2QGU A;  3K7C A;  2YFI B;  4X2O A;  3EBT A;  4L8P A;  1DMQ A;  4MJD A;  3G8Z A;  4H3U A;  1GYB A;  1O7G B;  1JB4 A;  1W02 A;  2B24 B;  1DMN A;  3KKG A;  3MG1 A;  1STD A; 
#chains in the Genus database with same CATH topology
 2BMR B;  1C7H A;  5AEW B;  5JPP A;  1D6Y A;  4HM8 B;  1JNQ A;  3ZG5 A;  2P09 A;  1K41 A;  1GD4 A;  1RGK A;  2UGI A;  4ILF A;  1DMM A;  1Q40 B;  3WA2 X;  1RGE A;  2K54 A;  1W01 A;  5TGN A;  3BNB A;  1UW1 A;  2OTL 3;  3F8H A;  1VQP 3;  3N9H A;  1G0T A;  3X3Z A;  1AQZ A;  1QVF 2;  3NUV A;  1N5H A;  1HKX A;  4LMI A;  4N6T A;  3G71 3;  5JPU A;  1YVS A;  1W00 A;  2IA7 A;  3OV4 A;  4HZ9 B;  1BAO A;  4OK0 A;  3RGA A;  4N6O B;  1KWI A;  5AIH A;  1BRN L;  1RN7 A;  3JUP A;  3EE1 A;  3SOA A;  2LYX A;  1I3F A;  2XFS A;  4R9L A;  1TP6 A;  1NU3 A;  3FG4 A;  3NM7 A;  1QAF A;  1V58 A;  1HZ1 A;  2K0M A;  2CFW A;  3PGB A;  3VSY A;  1B20 A;  4STD A;  1IQX A;  1RGL A;  3MG2 A;  2KF6 A;  4RNY A;  4HM7 B;  2XR8 B;  3BLZ A;  3PXM A;  1NDO B;  3WOE B;  4N6M A;  5ELJ A;  1X1Y A;  3DZL A;  3AHW A;  4HYZ A;  2CFL A;  2HMN B;  3HX8 A;  1LRA A;  1CYV A;  1T2H A;  2HOH A;  3H51 A;  2STD A;  3F14 A;  4XDW A;  2CG0 A;  3I56 3;  3SED A;  1FGQ A;  1S72 3;  2AAE A;  2B1X B;  2W56 A;  1BU4 A;  2E2U A;  2ZL8 A;  3AHS A;  1X1W A;  2O9U X;  1B2M A;  3BB9 A;  1BRK A;  3KN4 A;  2XGL A;  1W6Y A;  4IT7 A;  2ML6 A;  2W0Q A;  1Q7H A;  5IEO A;  3S29 A;  8CHO A;  1RNB A;  2H0H A;  4HM5 B;  1Q9E A;  3U97 A;  3I55 3;  4XDV A;  3DGM A;  1OF5 B;  1Q81 4;  1RN1 A;  3X3X A;  1BRH A;  3CC4 3;  2GSP A;  3CNX A;  3EHC A;  1FUW A;  3ER7 A;  1Q82 4;  5FW5 A;  3PCS A;  1ZX2 A;  4XBT A;  1E97 A;  4FMA A;  4Q53 A;  3UB1 A;  9RNT A;  3ROB A;  3T8N A;  1BNR A;  1RLS A;  3EBY A;  1PU4 A;  2WO0 A;  4K1U A;  1ISK A;  1TTO A;  4IIA A;  4K1V A;  3CCR 3;  1IT7 A;  1OAC A;  1KC8 4;  3OX9 A;  3PYJ A;  1I0X A;  1JB2 A;  3EC9 A;  1KD1 4;  2R4I A;  3CU3 A;  2CX0 A;  1BAN A;  1ULJ B;  4HM4 B;  4R4K A;  5AIF A;  1OHO A;  1RDS A;  1RGA A;  2XF3 A;  4N6L A;  4N6N B;  1J2B A;  1OPY A;  2WOF A;  1E3R A;  1DET A;  1VQO 3;  3CD6 3;  1ZS7 A;  1BRJ A;  1K28 A;  5EEO A;  1UUV B;  3BU4 A;  4AKZ A;  1I3I A;  2F4Y A;  5M19 A;  1M9G A;  1Q40 A;  5LC6 A;  2BIR A;  1IVV A;  1O7W B;  2ZDJ A;  4H61 A;  3MSO A;  5KP3 A;  4EV2 A;  1U5O A;  1WMP A;  3A76 A;  1OH0 A;  1EUI C;  2OQE A;  4JRF A;  1HYF A;  1Q42 A;  1U8C B;  1M1K 4;  2CIU A;  2P05 A;  1DE3 A;  1O7N B;  3ECF A;  3K7C A;  1LNI A;  2QGU A;  4X2O A;  2YFI B;  3EBT A;  4L8P A;  1LOV A;  4MJD A;  4H3U A;  1I8V A;  3O8Y A;  1LOY A;  3DH2 A;  1RKY A;  1W02 A;  1T3B A;  2RNT A;  3KKG A;  5IW9 A;  3OXA A;  1IV7 A;  4GB5 A;  1BVI A;  1LOW A;  1SJW A;  2V1L A;  3Q90 A;  1JB5 A;  3A5E A;  4EC6 A;  4I5Q A;  1YJN 3;  2F98 A;  3CPW 2;  1TJD A;  3FH1 A;  3CCL 3;  4XB5 A;  4ZM8 A;  1YI2 3;  1YVB I;  1BNI A;  1BRG A;  4BTW A;  4KT3 B;  3J7Y d;  1GD3 A;  1W7C A;  4CCV A;  3UJM A;  1VQ8 3;  3T8U A;  1X1U A;  3V99 A;  1N5P A;  1BNS A;  3EN1 B;  1GY5 A;  2YFL B;  3HIG A;  4R9K A;  3D79 A;  1FGM A;  1W6G A;  3LXU X;  1S5A A;  3OW2 2;  1BNE A;  3EX9 A;  3IPT A;  4J8T A;  3GZY B;  1D6Z A;  3OWS A;  1BSD A;  1GMR A;  1MWS A;  1OGX A;  2FGT A;  3SYU A;  5KP4 A;  4WYK B;  1TRP A;  1UI8 A;  1L5G B;  1TFO A;  2GU1 A;  5EVH A;  3AGO A;  3BND A;  5BXQ A;  1G02 A;  1FUT A;  3HOH A;  1ASK A;  4CJN A;  3ALA A;  4EBG A;  2RBI A;  1VQK 3;  1JZO A;  4FCJ A;  4RZM A;  1FZU A;  1WTH A;  1NWW A;  1DYU A;  4IPB A;  1TFK A;  1FW7 A;  5IG4 A;  3KSE D;  4J9A A;  1YIT 3;  2CWV A;  2ZA4 A;  3ZG0 A;  1RHL A;  1RRL A;  3JUO A;  3STD A;  1KQS 2;  2INX A;  1RGG A;  3E99 A;  2KF5 A;  3MYT A;  1MWT A;  2GBX B;  3NXJ A;  4BU4 A;  1SIH A;  1UUG B;  2RSX A;  5LC7 A;  3CXC 2;  1A2V A;  1VQL 3;  1B2S A;  2PZV A;  1A90 A;  1TRQ A;  2W2C A;  4HVN A;  3S5C A;  4AEQ A;  4BL2 A;  5IEP A;  3DGL A;  4KFD A;  2CH9 A;  3FZW A;  1O7P B;  4PEJ A;  1T5Y A;  5AI1 A;  1BSC A;  1JV2 B;  5IER A;  5JBS A;  2K3D A;  4KZ1 A;  1EKM A;  8RNT A;  3HII A;  1A2P A;  3DXO A;  1MGW A;  3FCS B;  3AMO A;  1QVG 2;  1VQ9 3;  4HM6 B;  1FGT A;  4NPB A;  1D6U A;  4DKI A;  4RBN A;  3CPO A;  3GRD A;  2CFD A;  2HMJ B;  3F8X A;  3PZW A;  1RMS A;  2RFR A;  1GY6 A;  3HI7 A;  2CK3 H;  1BUQ A;  1W2B 2;  3M8C A;  2HMO B;  2QEX 3;  4N6V 0;  1GS3 A;  4HZB B;  2XH9 A;  3NQY A;  3LTB A;  4L7K A;  2P0X A;  4WWU C;  4XM4 A;  2KF4 A;  4TX4 A;  1NJI 4;  4LEH A;  2GEX A;  4WP5 A;  3LZA A;  3Q3F A;  2LQV A;  3QRD A;  4OVM A;  3MPH A;  3CC2 3;  1YIJ 3;  2F5W A;  3LT8 A;  2IUK A;  4K90 B;  1WMO A;  1E3V A;  1PFP A;  2E2T A;  4HM1 B;  4X2H A;  4BL3 A;  2ML5 A;  1TU5 A;  1WQL B;  3KE7 A;  3GZX B;  3LTD A;  1UGI A;  1NO3 A;  4J5K A;  1ZGX A;  4FMC A;  3S27 A;  4HM3 B;  3U1W A;  3LH4 A;  2HMK B;  4RNT A;  2BMO B;  2WOH A;  1LNH A;  4N3V A;  1SII A;  4GHO A;  1AV4 A;  1CEW I;  1FGR A;  1US1 A;  2Y74 A;  1OCV A;  4BIR A;  3GZR A;  1IQ8 A;  3F9S A;  3KFQ C;  1UCL A;  2QA4 3;  3I0Y A;  5M18 A;  3CC7 3;  3B4P A;  3JUQ A;  2GBW B;  3S67 A;  1EA2 A;  2WGO A;  1RTU A;  4O02 B;  4KFE A;  1M1X B;  1JB4 A;  3RDE A;  3CCU 3;  1IV9 A;  1G96 A;  1K9M 4;  2QIY A;  5BU4 A;  1FYS A;  3BNE A;  1ROA A;  1GSP A;  1V74 A;  1ROV A;  3ZFZ A;  2JQ5 A;  3K0Z A;  3NHX A;  4MMY B;  3JVC A;  4EV5 A;  2KXG A;  3LTC A;  1EQK A;  3DMC A;  1AY7 A;  1FUS A;  2MC8 A;  1W4N A;  2H0G A;  3FG1 A;  1BGS A;  3SXX A;  4J5G A;  3D3L A;  3G6E 3;  3CCJ 3;  1RGC A;  1O7H B;  5HOH A;  1BUJ A;  3NBJ A;  4K61 A;  1B21 A;  1VQN 3;  3G4S 3;  5AEU B;  3GZB A;  1IYY A;  1HU9 A;  1I2G A;  5IG3 A;  4NHF A;  1I70 A;  3G0K A;  5FGO A;  1RCL A;  3KSP A;  2W03 A;  1BOX A;  3D5G A;  1VQ5 3;  4U13 A;  3KII A;  3FSD A;  2OQE C;  1Q7Y 4;  1JN5 A;  4RNZ A;  5AII A;  4HJL B;  5D83 A;  4BTY A;  2C10 A;  5AIG A;  2BT3 A;  1GMQ A;  3UL5 A;  1ULI B;  1JRQ A;  3DGO A;  1V57 A;  3LYG A;  1YNV X;  2Y73 A;  1MGR A;  2R41 A;  2BHM A;  3S28 A;  4WYK A;  5IEN A;  2L1S A;  3URP A;  5CXO A;  1MNL A;  1YGW A;  2XFT A;  1RGH A;  2RGQ A;  2W56 B;  1RNT A;  5STD A;  3X41 A;  4I4K A;  3N54 B;  1N8Q A;  4EW5 A;  1I2F A;  2CKF B;  1VZZ A;  2XRX B;  3CCE 3;  1VQ6 3;  7STD A;  2XSH B;  1DVD A;  4OUQ A;  1YHQ 3;  2F5M A;  2CFK A;  3SOY A;  1O7M B;  5G1L A;  3FKA A;  3NX0 A;  3BNC A;  1B27 A;  1UUW B;  1OUN A;  3CCS 3;  1UCJ A;  2OOV C;  4XBX A;  3X42 A;  2J8X B;  1NB5 I;  2CW9 A;  3EN8 A;  1LQG C;  1LQM B;  1EG9 B;  2CX1 A;  1JKG B;  3HZP A;  1LOX A;  3AMO B;  3GSP A;  3H3H A;  3MG3 A;  5IF6 A;  1OHP A;  1K73 4;  3CMA 3;  1R4C A;  3VGN A;  1RRH A;  3UNL A;  2Z7A A;  1DVC A;  1IVX A;  1QJG A;  3IJE B;  1OHS A;  3B8L A;  5G2G A;  5EQL A;  5D81 A;  3RGR A;  1BNF A;  2UX0 A;  3UL6 A;  3CCM 3;  1CYU A;  5HGR A;  1GOV A;  1RJO A;  3D4A A;  3CCV 3;  3OWU A;  3WOF B;  1TIJ A;  1VQ7 3;  2BO9 B;  4HOH A;  1WMN A;  3EB8 A;  3GWR A;  4LGQ A;  7GSP A;  2D42 A;  4FCM A;  5DRV A;  1N9E A;  3B4O A;  1AVL A;  5A0O B;  5DRE A;  1B2Z A;  4LYL B;  3V92 A;  2C11 A;  1IT8 A;  1Z1S A;  2IMJ A;  1B2X A;  2OOV A;  1OGZ A;  3NBR A;  1BSE A;  3QK9 A;  4HKV B;  3JUN A;  1PYL A;  3X3Y A;  1EEJ A;  1JBS A;  3T0U A;  4KFF A;  1BSB A;  5IG0 A;  4WHA A;  1VQ4 3;  1WNH A;  2JDI H;  3BIR A;  2XEP A;  4GSP A;  6STD A;  3KZT A;  3FLJ A;  1BIR A;  1N9J A;  1KSI A;  2BNG A;  1GOU A;  4FMD A;  4MEI A;  1BRS A;  5I97 A;  1LXE A;  3G8Z A;  1GYB A;  1UDI I;  3Q1C A;  1O7G B;  2B24 B;  3MG1 A;  1STD A;  3WHO A;  3FGY A;  1RSN A;  3WR2 A;  1I2E A;  5CF2 A;  1SQW A;  2BU4 A;  2KAA A;  3NBB A;  3PCR A;  4HBR A;  3SLU A;  2CFG A;  3EQQ B;  1VQM 3;  2L4V A;  5KP1 A;  2Z76 A;  2KF3 A;  5RNT A;  1A2K A;  2GXF A;  2FXT A;  3NM2 A;  4KVH A;  6GSP A;  4EYC A;  4CDL A;  1AVK A;  1IDP A;  1JKG A;  1W2Z A;  2RCD A;  4N6U A;  3OWY A;  3V98 A;  2OTJ 3;  3SVA A;  1BRI A;  4LSO A;  1QAL A;  1OF5 A;  2SBL A;  1MWU A;  2FNQ A;  2CWT A;  3F7X A;  3FG3 A;  1MWR A;  1NNV A;  2GU3 A;  4FR9 A;  3DY5 A;  3SX1 A;  7RNT A;  4HAA A;  3LOY A;  1W6C A;  1BNJ A;  1GY7 A;  2IYJ A;  1YGE A;  5AYS C;  4FMB A;  2OWP A;  2F99 A;  3L0R A;  4L8O A;  3D9R A;  2ZHX B;  1N8R 4;  3NV0 A;  1A67 A;  2A15 A;  2W9Q A;  3K9M C;  3VF1 A;  2Q07 A;  1UCK A;  1SPU A;  3N8B A;  1ZO2 A;  5IG5 A;  2CHC A;  1R4Y A;  2C4B A;  1MOL A;  1UCI A;  4QWT A;  4WFO A;  4EXR A;  3MKI A;  3TDG A;  2Z6B A;  1JN5 B;  3GAX A;  3CNM A;  2P38 A;  1UI7 A;  2XSO B;  4FCZ A;  1RN4 A;  1SAR A;  1IVW A;  5BIR A;  3WMD A;  1X1X A;  4GL6 A;  5ELU A;  1BNG A;  3PS8 A;  5CK6 A;  3NV0 B;  2HML B;  3RNT A;  2F56 A;  4XBY A;  1IU7 A;  4LZI A;  1CQS A;  2H0I A;  2W04 A;  3KCH A;  1CH0 A;  3K63 A;  1B3S A;  1T2I A;  1GMP A;  5M1A A;  1UGH I;  4O8S A;  3CME 3;  2BMQ B;  2CC3 A;  2M7O A;  3MHE A;  4ORL A;  2UUG C;  1TUH A;  1B2U A;  3EJV A;  4HM2 B;  2I9W A;  3WOD G;  3DGN A;  4CPK A;  3X40 A;  1YJW 3;  2P0M A;  2AAD A;  2F86 B;  1LVN A;  2PNC A;  3D5I A;  2OCT A;  1JBT A;  1JJ2 2;  1IVU A;  1STF I;  1AR0 A;  2XGN A;  3DUK A;  4AKY A;  5GSP A;  3DGY A;  1PY3 A;  1JZD A;  2MF7 A;  2W6J H;  3HK4 A;  1Q86 4;  1IK3 A;  3B7C A;  4R80 A;  4MMX B;  1K8A 4;  2SAR A;  1C54 A;  3MWZ A;  2CG1 A;  1YJ9 3;  3AGN A;  2GEY A;  1FGO A;  6RNT A;  1GOY A;  3CCQ 3;  3K5T A;  1FA3 A;  2IUJ A;  1BSA A;  2IY2 A;  1RCK A;  3F40 A;  3FF2 A;  3F7S A;  1JBR A;  3EF8 A;  3LT9 A;  5G1K A;  4O3V A;  4R1K A;  2HMM B;  2YX9 A;  3DM8 A;  1QAK A;  5AYR B;  3IMA B;  1I0V A;  5BVB A;  2YFJ B;  1Y4K A;  3NQZ A;  1F8N A;  4BTX A;  4HM0 B;  1QMA A;  3JUM A;  3LML A;  4NRE A;  4G1M B;  3WA3 A;  1W5Z A;  1IQY A;  1NB3 I;  3Q2P A;  4O2H A;  1M90 4;  5CLK A;  4MMZ B;  3LTA A;  1VQQ A;  5D82 A;  1RGF A;  2KRT A;  3FF0 A;  2Z77 A;  3G16 A;  5CF1 A;  2KCD A;  3WDG B;  4JF8 A;  2E2V A;  2WGQ A;  1DMQ A;  2D1W A;  2O3O A;  2CWU A;  1DMN A;  2W9P A; 
#chains in the Genus database with same CATH homology
 2BMR B;  1C7H A;  5AEW B;  5JPP A;  1D6Y A;  4HM8 B;  1JNQ A;  2P09 A;  1K41 A;  1GD4 A;  1DMM A;  1Q40 B;  3WA2 X;  2K54 A;  1W01 A;  5TGN A;  3BNB A;  1UW1 A;  2OTL 3;  3F8H A;  1VQP 3;  3N9H A;  3X3Z A;  1QVF 2;  3NUV A;  1N5H A;  1HKX A;  4LMI A;  4N6T A;  3G71 3;  5JPU A;  1W00 A;  2IA7 A;  3OV4 A;  4HZ9 B;  4OK0 A;  3RGA A;  4N6O B;  1KWI A;  5AIH A;  1RN7 A;  3JUP A;  3EE1 A;  3SOA A;  2LYX A;  2XFS A;  4R9L A;  1TP6 A;  1NU3 A;  3FG4 A;  3NM7 A;  1QAF A;  2K0M A;  2CFW A;  3PGB A;  3VSY A;  4STD A;  1IQX A;  3MG2 A;  4RNY A;  4HM7 B;  2XR8 B;  3BLZ A;  3PXM A;  1NDO B;  3WOE B;  4N6M A;  5ELJ A;  4HYZ A;  3DZL A;  2CFL A;  2HMN B;  3HX8 A;  1CYV A;  3H51 A;  2STD A;  3F14 A;  4XDW A;  2CG0 A;  3I56 3;  3SED A;  1FGQ A;  1S72 3;  2B1X B;  2W56 A;  2ZL8 A;  2E2U A;  2O9U X;  3BB9 A;  3KN4 A;  2XGL A;  1W6Y A;  4IT7 A;  2ML6 A;  2W0Q A;  5IEO A;  3S29 A;  8CHO A;  4HM5 B;  3U97 A;  3I55 3;  4XDV A;  3DGM A;  1OF5 B;  1Q81 4;  3X3X A;  3CNX A;  3EHC A;  1FUW A;  3ER7 A;  1Q82 4;  5FW5 A;  3PCS A;  1ZX2 A;  4XBT A;  1E97 A;  4FMA A;  4Q53 A;  3UB1 A;  3ROB A;  3T8N A;  3EBY A;  1PU4 A;  2WO0 A;  4K1U A;  1ISK A;  4IIA A;  4K1V A;  3CCR 3;  1IT7 A;  1OAC A;  1KC8 4;  3OX9 A;  3PYJ A;  1JB2 A;  3EC9 A;  1KD1 4;  2R4I A;  3CU3 A;  4HM4 B;  1ULJ B;  4R4K A;  5AIF A;  1OHO A;  2XF3 A;  4N6L A;  4N6N B;  1J2B A;  1OPY A;  2WOF A;  1E3R A;  1VQO 3;  3CD6 3;  1K28 A;  5EEO A;  1UUV B;  4AKZ A;  1M9G A;  1Q40 A;  5LC6 A;  1O7W B;  2ZDJ A;  1IVV A;  4H61 A;  3MSO A;  5KP3 A;  4EV2 A;  1U5O A;  1WMP A;  3A76 A;  1OH0 A;  2OQE A;  4JRF A;  1Q42 A;  1M1K 4;  1U8C B;  2CIU A;  2P05 A;  3ECF A;  1O7N B;  3K7C A;  2QGU A;  4X2O A;  2YFI B;  3EBT A;  4L8P A;  4MJD A;  4H3U A;  3O8Y A;  1RKY A;  1W02 A;  3KKG A;  5IW9 A;  3OXA A;  1IV7 A;  4GB5 A;  1SJW A;  2V1L A;  3Q90 A;  1JB5 A;  4EC6 A;  1YJN 3;  2F98 A;  3CPW 2;  1YI2 3;  3FH1 A;  3CCL 3;  4XB5 A;  4ZM8 A;  1YVB I;  4BTW A;  3J7Y d;  1GD3 A;  1W7C A;  4CCV A;  3UJM A;  1VQ8 3;  3T8U A;  3V99 A;  1N5P A;  3EN1 B;  1GY5 A;  2YFL B;  3HIG A;  4R9K A;  1FGM A;  1W6G A;  3LXU X;  1S5A A;  3OW2 2;  3EX9 A;  3IPT A;  4J8T A;  3GZY B;  1D6Z A;  3OWS A;  5KP4 A;  1OGX A;  2FGT A;  4WYK B;  1UI8 A;  1L5G B;  1TFO A;  2GU1 A;  5EVH A;  3BND A;  3CC4 3;  5BXQ A;  4EBG A;  1ASK A;  1VQK 3;  3ALA A;  4FCJ A;  4RZM A;  1WTH A;  1NWW A;  1DYU A;  4IPB A;  1TFK A;  5IG4 A;  3KSE D;  4J9A A;  1YIT 3;  2CWV A;  1RRL A;  3JUO A;  3STD A;  1KQS 2;  2INX A;  3E99 A;  3MYT A;  2GBX B;  3NXJ A;  1SIH A;  2RSX A;  5LC7 A;  3CXC 2;  1A2V A;  1VQL 3;  2PZV A;  1A90 A;  3S5C A;  2W2C A;  4HVN A;  4AEQ A;  5IEP A;  3DGL A;  4KFD A;  2CH9 A;  3FZW A;  1O7P B;  4PEJ A;  1T5Y A;  5AI1 A;  5IER A;  1JV2 B;  5JBS A;  4KZ1 A;  1EKM A;  3HII A;  3DXO A;  3FCS B;  3AMO A;  1QVG 2;  1VQ9 3;  4HM6 B;  1FGT A;  1D6U A;  4RBN A;  3CPO A;  3GRD A;  2CFD A;  2HMJ B;  3F8X A;  3PZW A;  2RFR A;  1GY6 A;  3HI7 A;  2CK3 H;  1BUQ A;  1W2B 2;  3M8C A;  2HMO B;  2QEX 3;  4N6V 0;  1GS3 A;  4HZB B;  2XH9 A;  3NQY A;  3LTB A;  4L7K A;  2P0X A;  4WWU C;  4XM4 A;  4TX4 A;  1NJI 4;  4LEH A;  2GEX A;  4WP5 A;  3LZA A;  3QRD A;  2LQV A;  4OVM A;  3CC2 3;  3MPH A;  1YIJ 3;  3LT8 A;  2IUK A;  4K90 B;  1WMO A;  1E3V A;  1PFP A;  2E2T A;  4HM1 B;  4X2H A;  1TU5 A;  2ML5 A;  1WQL B;  3KE7 A;  3GZX B;  3LTD A;  1NO3 A;  4FMC A;  3S27 A;  4HM3 B;  3U1W A;  3LH4 A;  2HMK B;  2BMO B;  2WOH A;  1LNH A;  4N3V A;  1SII A;  1AV4 A;  1CEW I;  1FGR A;  1US1 A;  2Y74 A;  1OCV A;  3GZR A;  1IQ8 A;  3F9S A;  3KFQ C;  2QA4 3;  3I0Y A;  3CC7 3;  3B4P A;  3JUQ A;  2GBW B;  3S67 A;  1EA2 A;  2WGO A;  4O02 B;  4KFE A;  1M1X B;  1JB4 A;  3RDE A;  3CCU 3;  1IV9 A;  1G96 A;  1K9M 4;  2QIY A;  3BNE A;  1ROA A;  1V74 A;  1ROV A;  2JQ5 A;  3K0Z A;  3NHX A;  4MMY B;  3JVC A;  4EV5 A;  2KXG A;  3LTC A;  1EQK A;  3DMC A;  2MC8 A;  1W4N A;  3FG1 A;  3SXX A;  3G6E 3;  3CCJ 3;  3D3L A;  1O7H B;  3NBJ A;  4K61 A;  1VQN 3;  3G4S 3;  5AEU B;  3GZB A;  1HU9 A;  5IG3 A;  4NHF A;  3G0K A;  5FGO A;  3KSP A;  2W03 A;  1VQ5 3;  4U13 A;  3KII A;  3FSD A;  2OQE C;  1Q7Y 4;  1JN5 A;  4RNZ A;  5AII A;  4HJL B;  5D83 A;  4BTY A;  2C10 A;  5AIG A;  2BT3 A;  3UL5 A;  1ULI B;  1JRQ A;  3DGO A;  3LYG A;  2Y73 A;  2BHM A;  3S28 A;  4WYK A;  5IEN A;  5CXO A;  1MNL A;  2XFT A;  2RGQ A;  2W56 B;  5STD A;  3X41 A;  4I4K A;  3N54 B;  1N8Q A;  2CKF B;  1VZZ A;  2XRX B;  3CCE 3;  1VQ6 3;  7STD A;  2XSH B;  1DVD A;  4OUQ A;  1YHQ 3;  2CFK A;  3SOY A;  1O7M B;  3FKA A;  3NX0 A;  3BNC A;  1UUW B;  1OUN A;  3CCS 3;  2OOV C;  4XBX A;  3X42 A;  1NB5 I;  2CW9 A;  3EN8 A;  1EG9 B;  1JKG B;  3HZP A;  1LOX A;  3AMO B;  3MG3 A;  3H3H A;  5IF6 A;  1OHP A;  1K73 4;  3CMA 3;  1R4C A;  3VGN A;  1RRH A;  3UNL A;  2Z7A A;  1DVC A;  1IVX A;  1QJG A;  3IJE B;  1OHS A;  3B8L A;  5G2G A;  5EQL A;  5D81 A;  3RGR A;  2UX0 A;  3UL6 A;  3CCM 3;  1CYU A;  5HGR A;  1RJO A;  3CCV 3;  3OWU A;  3WOF B;  1TIJ A;  1VQ7 3;  2BO9 B;  1WMN A;  3EB8 A;  3GWR A;  4LGQ A;  2D42 A;  4FCM A;  5DRV A;  1N9E A;  3B4O A;  1AVL A;  5A0O B;  5DRE A;  3V92 A;  2C11 A;  1IT8 A;  1Z1S A;  2IMJ A;  2OOV A;  1OGZ A;  3NBR A;  4HKV B;  3QK9 A;  3JUN A;  3X3Y A;  3T0U A;  4KFF A;  5IG0 A;  4WHA A;  1VQ4 3;  1WNH A;  2JDI H;  2XEP A;  6STD A;  3KZT A;  3FLJ A;  1N9J A;  1KSI A;  2BNG A;  4FMD A;  4MEI A;  5I97 A;  1LXE A;  3G8Z A;  1GYB A;  3Q1C A;  1O7G B;  2B24 B;  3MG1 A;  1STD A;  3FGY A;  5CF2 A;  1SQW A;  3SLU A;  3NBB A;  3PCR A;  4HBR A;  2CFG A;  3EQQ B;  1VQM 3;  2L4V A;  5KP1 A;  2Z76 A;  1A2K A;  2GXF A;  2FXT A;  3NM2 A;  4KVH A;  4EYC A;  4CDL A;  1AVK A;  1IDP A;  1JKG A;  1W2Z A;  2RCD A;  4N6U A;  3OWY A;  3V98 A;  2OTJ 3;  3SVA A;  4LSO A;  1QAL A;  1OF5 A;  2SBL A;  2FNQ A;  2CWT A;  3F7X A;  3FG3 A;  4FR9 A;  3SX1 A;  2GU3 A;  3DY5 A;  3LOY A;  1W6C A;  1GY7 A;  1YGE A;  5AYS C;  4FMB A;  2OWP A;  2F99 A;  3L0R A;  4L8O A;  3D9R A;  1N8R 4;  3NV0 A;  1A67 A;  2A15 A;  2W9Q A;  3K9M C;  3VF1 A;  2Q07 A;  1SPU A;  3N8B A;  1ZO2 A;  5IG5 A;  2CHC A;  1MOL A;  4EXR A;  4WFO A;  4QWT A;  3MKI A;  3TDG A;  2Z6B A;  1JN5 B;  3GAX A;  3CNM A;  2P38 A;  1UI7 A;  2XSO B;  4FCZ A;  1IVW A;  3WMD A;  4GL6 A;  5ELU A;  3PS8 A;  5CK6 A;  3NV0 B;  2HML B;  4XBY A;  1IU7 A;  4LZI A;  1CQS A;  2W04 A;  3K63 A;  4O8S A;  3CME 3;  2BMQ B;  2CC3 A;  2M7O A;  3MHE A;  4ORL A;  1TUH A;  3EJV A;  4HM2 B;  2I9W A;  3WOD G;  3DGN A;  3X40 A;  1YJW 3;  2P0M A;  2F86 B;  2PNC A;  1LVN A;  2OCT A;  1JJ2 2;  1IVU A;  1STF I;  1AR0 A;  2XGN A;  3DUK A;  4AKY A;  2MF7 A;  2W6J H;  3HK4 A;  1Q86 4;  1IK3 A;  3B7C A;  4R80 A;  4MMX B;  1K8A 4;  3MWZ A;  2CG1 A;  1YJ9 3;  2GEY A;  1FGO A;  3CCQ 3;  3K5T A;  1FA3 A;  2IUJ A;  3FF2 A;  3F40 A;  3F7S A;  3EF8 A;  3LT9 A;  4O3V A;  4R1K A;  2HMM B;  2YX9 A;  3DM8 A;  1QAK A;  5AYR B;  3IMA B;  5BVB A;  2YFJ B;  1Y4K A;  3NQZ A;  1F8N A;  4BTX A;  4HM0 B;  1QMA A;  3JUM A;  3LML A;  4NRE A;  4G1M B;  3WA3 A;  1W5Z A;  1NB3 I;  1IQY A;  3Q2P A;  4O2H A;  1M90 4;  5CLK A;  4MMZ B;  3LTA A;  5D82 A;  2KRT A;  3FF0 A;  2Z77 A;  3G16 A;  5CF1 A;  2KCD A;  3WDG B;  4JF8 A;  2E2V A;  2WGQ A;  1DMQ A;  2D1W A;  2O3O A;  2CWU A;  1DMN A;  2W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...