1UUVB

Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
193
structure length
193
Chain Sequence
MINIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title No Binding to Naphthalene Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords NAPHTHALENE 1,2-DIOXYGENASE ALPHA SUBUNIT
total genus 51
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uuvB00
4HM7B 5IG0A 3EJVA 4PEJA 5AEUB 3M8CA 5KP3A 1JN5B 3CPOA 3KKGA 5G2GA 2F99A 4KVHA 3EQQB 3KE7A 3SOYA 4L8OA 2Z76A 3K7CA 4OUQA 7STDA 4FCMA 1OHOA 3F7XA 1ULIB 2CHCA 1HKXA 1Q40B 2QIYA 3FF2A 3FGYA 3KZTA 5BXQA 3FLJA 4WP5A 5KP1A 3S5CA 3WMDA 2BMRB 3GWRA 4K1VA 2Z77A 4HM8B 4XB5A 4HJLB 5AIGA 5AIIA 2GEXA 3GZYB 4OVMA 1VZZA 3BB9A 4STDA 5IEOA 3T8NA 2Z7AA 4L8PA 1EA2A 5HGRA 3EN1B 3ER7A 2XR8B 3E99A 4HZBB 3GZXB 3MG2A 2IMJA 4HZ9B 5CXOA 3SOAA 5IERA 1E3VA 1IDPA 3OWUA 3DMCA 4FCJA 4HM5B 3F8XA 4LMIA 4XDVA 1NDOB 1O7NB 5KP4A 1GYBA 4R9KA 3MG1A 1EG9B 1CQSA 2BNGA 5IEPA 1O7MB 3B8LA 4HM4B 3OX9A 3BLZA 4WYKB 5CLKA 5STDA 5IG5A 4GB5A 4J9AA 3EN8A 1GY6A 1DMMA 3GRDA 3DM8A 3ROBA 3HK4A 2HMMB 3VGNA 8CHOA 1ISKA 5IG3A 1ASKA 1SJWA 3EC9A 2R4IA 4HM1B 5CF1A 5CK6A 3KSPA 3MG3A 3FH1A 5IENA 3I0YA 4LGQA 3CU3A 3NBRA 3ECFA 1QMAA 3MSOA 4U13A 1OPYA 1OCVA 3F14A 3NXJA 4XBYA 1K41A 2I9WA 3D9RA 3FZWA 3JUQA 2F98A 1OGXA 3NV0A 3HZPA 2B1XB 5AI1A 3FSDA 3B7CA 3STDA 3NUVA 3OWYA 1DMNA 2GXFA 1OGZA 3EF8A 3LZAA 1DMQA 5AEWB 2W2CA 3DXOA 3FF0A 4H3UA 4IIAA 1O7GB 4X2OA 5BVBA 4XBTA 5CF2A 3F7SA 4R1KA 5JPPA 3HX8A 3VSYA 1TP6A 1WQLB 4I4KA 1OF5A 2HMJB 3B4OA 3IPTA 3JUNA 4WWUC 3NV0B 1OHSA 3LYGA 3H3HA 1UUVB 4HM2B 4ORLA 5D81A 4WYKA 2F86B 5AIHA 3UJMA 3UNLA 3DUKA 1C7HA 4R9LA 2XRXB 1QJGA 3G0KA 3Q90A 5DREA 1W6YA 3MHEA 2A15A 2OWPA 3GZBA 5D82A 1STDA 1S5AA 3F40A 2XSHB 4CDLA 1W01A 2PZVA 2INXA 4K1UA 1JKGB 4X2HA 1OF5B 3RGAA 4MJDA 2YFJB 1ULJB 1ZO2A 1OH0A 3F8HA 3NHXA 3OV4A 1Z1SA 3SEDA 1E97A 1NWWA 2JQ5A 2QGUA 1JKGA 5JPUA 3JUOA 1U5OA 4HM0B 3H51A 3EBTA 3DZLA 3MYTA 4HVNA 3MKIA 2B24B 4HKVB 1W02A 5FW5A 2CKFB 3EBYA 4XDWA 3JUMA 3T8UA 1O7WB 4XM4A 4J8TA 1A2KA 3GZRA 3B4PA 5EVHA 2GBXB 1JB4A 3A76A 3EHCA 3EX9A 3NM2A 2UX0A 4RZMA 5IG4A 4Q53A 4L7KA 1GY7A 4XBXA 1AR0A 2BMOB 3F9SA 1OHPA 1Q42A 1W00A 2BMQB 2HMNB 2HMOB 2HMKB 3G8ZA 1E3RA 2YFLB 3OWSA 4HM3B 4N3VA 5DRVA 2K54A 1JN5A 5TGNA 1O7HB 3G16A 1O7PB 5D83A 2YFIB 6STDA 5IF6A 1JB2A 3CNMA 3JUPA 3RGRA 2HMLB 1OUNA 2RGQA 1JB5A 1GY5A 3OXAA 3CNXA 1ZX2A 1Q40A 5AIFA 1TUHA 2GEYA 2RFRA 3FKAA 2STDA 3K0ZA 4HM6B 1BUQA 1UUWB 1GS3A 2GBWB 4LEHA 2RCDA 2XSOB 1NU3A
chains in the Genus database with same CATH superfamily
3I563 1B27A 3EJVA 1BAOA 3KKGA 3N54B 3EQQB 1ZS7A 1BNRA 1L5GB 1MGWA 1IVWA 1WTHA 1YJW3 1A67A 2GU3A 1NNVA 3BU4A 4KZ1A 1RGGA 1RGHA 1N8QA 1Y4KA 3FF2A 3NX0A 2HOHA 3JVCA 1UGHI 4WP5A 3AHSA 3LTBA 1B2MA 4K1VA 1GMPA 2Z77A 3EB8A 4AKZA 1BRKA 1LNIA 2F5WA 1B20A 3T8NA 3BB9A 3RNTA 1I0XA 4L8PA 2WGOA 1EA2A 1TRQA 3QK9A 1YIT3 3GZXB 3MG2A 2IMJA 1GOUA 1PY3A 1KSIA 4FMAA 3F8XA 3D4AA 1O7NB 2KF3A 4MMYB 3DGYA 1UW1A 2CC3A 2D42A 2K3DA 1Q824 1BNGA 1V74A 1M9GA 3WHOA 3EN8A 2E2TA 1VQ53 3HK4A 1KWIA 1UGIA 3VGNA 1ASKA 4MMZB 1D6ZA 1I0VA 1TRPA 1EKMA 2E2VA 3FH1A 3I0YA 5ELJA 3TDGA 4N6MA 1QMAA 7RNTA 3WA3A 1N8R4 1RDSA 4U13A 2SARA 2BO9B 3F14A 1HYFA 1R4CA 1K41A 3JUQA 4XBYA 3IMAB 5M1AA 3S29A 2MC8A 1QVF2 3HZPA 4IT7A 2GXFA 2C10A 1M904 1EUIC 2L1SA 2GU1A 1WMNA 4GHOA 7GSPA 3G6E3 2C11A 3IJEB 2KF5A 1AY7A 3NM7A 1TP6A 3AHWA 1HZ1A 1OF5A 2HMJB 3B4OA 1MGRA 4J5KA 1RN1A 4QWTA 4WYKA 4GSPA 3UJMA 3UNLA 1J2BA 1C7HA 3NQZA 2R41A 4R9LA 3G0KA 2BU4A 1CH0A 2BHMA 3N9HA 4K61A 3KSED 5D82A 3WR2A 1VQ43 1STDA 3UB1A 2CK3H 2INXA 4K1UA 1JKGB 1OF5B 4EXRA 2K0MA 1VQ63 4CPKA 4BL2A 1ZO2A 1OH0A 3OV4A 2W04A 1UCLA 1N5HA 1C54A 2QA43 3H51A 3Q2PA 2OOVA 3K63A 3WOEB 2B24B 3U1WA 1BANA 3LMLA 3EBYA 4CCVA 1O7WB 3HIGA 3GZRA 4J8TA 1RGKA 3A76A 3SLUA 3NM2A 3SX1A 1GMRA 2P09A 1Q42A 1W00A 3DGLA 1E3RA 2D1WA 5DRVA 2K54A 1JN5A 1Q814 1K9M4 1X1UA 1O7PB 4TX4A 1BUJA 3CNMA 3JUPA 3RGRA 2OQEA 3CMA3 1JB5A 1W7CA 1ZX2A 2ZDJA 1RGLA 4I4KA 3CCR3 2PNCA 2AADA 1NU3A 2XSOB 2ZHXB 1BNJA 2H0GA 4IPBA 5AEUB 1DVCA 2Y73A 1JN5B 3CPOA 1B21A 1SIHA 1UUGB 1N9JA 2F99A 4KVHA 2KF6A 5I97A 1LVNA 4FCMA 3LXUX 2P0XA 4NREA 2CW9A 2CHCA 4LYLB 2XFSA 2XEPA 4BU4A 3QRDA 3S5CA 1YJN3 1WMOA 1I2GA 4KFFA 4RNZA 5RNTA 2BMRB 1WNHA 1RGEA 4HM8B 3CD63 4HJLB 5AIIA 3CXC2 1YJ93 1RGCA 3GZYB 3DGMA 1MWUA 4STDA 3CCJ3 2W9QA 2W56A 2XGLA 5LC7A 1DYUA 2CWUA 1DVDA 3OWUA 4FCJA 4XDVA 3DMCA 4HM5B 4LMIA 4WHAA 1JBSA 4O2HA 5ELUA 3BNDA 1GYBA 3KCHA 1I3IA 4R9KA 5A0OB 5IW9A 2P38A 2Z6BA 3MG1A 1FW7A 1ROAA 2BNGA 3V92A 3CCS3 5IEPA 1M1K4 3DY5A 1JNQA 3B8LA 2CX1A 3OX9A 4HM4B 5IG5A 1IQYA 3D3LA 3CC73 3WA2X 2C4BA 1MWRA 3GRDA 4LZIA 2FGTA 2WGQA 8CHOA 1TFOA 2OOVC 1V57A 2R4IA 1IQXA 1IT7A 5CF1A 3KSPA 2WOFA 1GD4A 1FZUA 5BIRA 3S67A 1MWSA 4RNTA 3ECFA 5IENA 1IK3A 4O3VA 2SBLA 1FA3A 1EEJA 1IV9A 1OCVA 3WODG 3FZWA 3NV0A 3ROBA 2F98A 1OGXA 2B1XB 1RLSA 3GSPA 2CIUA 1UI7A 1OGZA 3EF8A 1JJ22 1DMQA 4FCZA 4H3UA 5BVBA 3X40A 4GL6A 3SXXA 1FUSA 2CWTA 1RN4A 4XBTA 3F7SA 1BIRA 2OQEC 4FMDA 2O9UX 1WQLB 2W6JH 3IPTA 1TJDA 3ALAA 4R4KA 1UUVB 1JBRA 3KFQC 1BRSA 1Q7HA 1X1WA 2F86B 5AIHA 4EC6A 3WOFB 1NJI4 3DUKA 3Q90A 5DREA 3DH2A 1JZOA 1IU7A 2P05A 3EE1A 2F56A 1T5YA 2CFDA 1GOVA 2O3OA 1W01A 2PZVA 2XSHB 4R80A 4X2HA 3T0UA 1CYUA 1MNLA 3J7Yd 1BSDA 2YFJB 4N6TA 5HOHA 5AYRB 1UDII 3SEDA 4RBNA 3BIRA 1NWWA 2CH9A 2QGUA 1JKGA 4KFDA 5JPUA 2CFWA 1K8A4 1KQS2 1A90A 1A2VA 4BL3A 3DZLA 3MYTA 4HVNA 3MKIA 4HKVB 4J5GA 4N6NB 2CG1A 3UL6A 4CJNA 4XDWA 2XH9A 3B4PA 5EVHA 4RZMA 3EHCA 1JZDA 4N6LA 4Q53A 3BNCA 4XBXA 1CYVA 1GY7A 2KRTA 4N6UA 2BMOB 1QALA 3F9SA 1OHPA 1S723 2BMQB 2HMOB 3HIIA 1RNBA 1BSAA 1G0TA 2LYXA 1RRLA 3LH4A 3HI7A 5G1KA 3LT8A 1JB2A 2UGIA 1PYLA 2Q07A 2MF7A 2ML6A 3CNXA 3CPW2 1Q40A 1NB3I 4FMBA 1TFKA 2GEYA 3FKAA 2CG0A 4BIRA 1BNEA 4HM6B 1D6UA 2QEX3 3FLJA 2JDIH 1RSNA 1IQ8A 1TIJA 1WMPA 4HM7B 4PEJA 3FCSB 3M8CA 5IG0A 1SARA 3G4S3 5G2GA 3KE7A 2Z76A 7STDA 1RRHA 1BGSA 1RCLA 5JBSA 1B2ZA 1ULIB 1VQ93 3OW22 1Q40B 1Q9EA 1QAKA 4DKIA 1VQK3 1N5PA 4BTWA 5BXQA 5KP1A 1A2PA 3Q1CA 3WMDA 3GWRA 3U97A 4AEQA 1BOXA 4WFOA 1TU5A 1BNIA 1RTUA 4HAAA 2GEXA 2IA7A 3FG1A 4OVMA 1VZZA 5IEOA 1FUTA 3ZG5A 1NB5I 2Z7AA 3S28A 1B2UA 3ER7A 4HZBB 1I2EA 1UCKA 4HZ9B 5CXOA 3SOAA 3URPA 2H0HA 2RBIA 1IDPA 4EBGA 1T3BA 5KP4A 3L0RA 1NDOB 5BU4A 4JRFA 3BNBA 4K90B 1CQSA 2AAEA 1YGEA 3ZG0A 5STDA 5CLKA 2F5MA 3Q3FA 4BTXA 3FG3A 3PXMA 4J9AA 1DMMA 4H61A 3DM8A 4KT3B 2BIRA 2CX0A 1ISKA 4RNYA 2IUKA 5IG3A 1MWTA 1SJWA 1QAFA 2F4YA 4EV2A 1BSEA 2OTJ3 3DGNA 2L4VA 3NBRA 2GSPA 3X3ZA 3LTAA 2OCTA 1W6CA 2XGNA 1OPYA 2J8XB 1LQGC 2I9WA 1AV4A 3PGBA 3VF1A 3FSDA 3STDA 3SVAA 3OWYA 1VQP3 1RHLA 2XFTA 3CCL3 5AEWB 1DETA 2W2CA 3DXOA 3K9MC 4FR9A 4X2OA 3SYUA 5CF2A 1I70A 1DE3A 3PZWA 3VSYA 1FGRA 1BSBA 1EQKA 3JUNA 4WWUC 3NV0B 1OHSA 3X42A 3H3HA 1T2IA 2CFLA 4HM2B 4OK0A 3PYJA 5D81A 2P0MA 3D5GA 2IUJA 1B2SA 2XRXB 1QJGA 1W5ZA 3CCU3 1W6YA 2CWVA 3MHEA 2A15A 2KF4A 3FG4A 2XF3A 3GZBA 3K5TA 4MMXB 4CDLA 3RGAA 4MJDA 1K734 1IVXA 2UUGC 1CEWI 3F8HA 1I8VA 1Z1SA 1G02A 4KFEA 1IYYA 2JQ5A 1GD3A 3JUOA 1X1XA 2W03A 3EBTA 1SIIA 5FW5A 2E2UA 3LTCA 1UCIA 4XM4A 3KN4A 3GAXA 2GBXB 3HOHA 1IVVA 2UX0A 1OACA 1UI8A 4FMCA 2CFGA 2W56B 2V1LA 4N3VA 1LXEA 2BT3A 2HMKB 3G8ZA 2FXTA 2YFLB 2IYJA 1JBTA 1Q864 5TGNA 1B2XA 3V98A 1FGMA 4ILFA 3AGNA 5IF6A 1NO3A 1BRHA 3V99A 1OUNA 1GY5A 1N9EA 1IV7A 1BVIA 5AIFA 1TUHA 2RFRA 3O8YA 1D6YA 3MWZA 2YX9A 1YIJ3 1BRJA 1BUQA 1YNVX 4BTYA 2RCDA 2ML5A 3UL5A 5KP3A 5M18A 1VQN3 2FNQA 1Q7Y4 1LOWA 3AGOA 3SOYA 4L8OA 3AMOB 2KCDA 3K7CA 4OUQA 1IVUA 3WDGB 1LQMB 4G1MB 1OHOA 3F7XA 1QVG2 1JV2B 1HKXA 1YVBI 2QIYA 3CC23 1AVKA 1UCJA 3FGYA 1US1A 3KZTA 3KIIA 1B3SA 1RNTA 3BNEA 3ZFZA 9RNTA 1LOXA 2ZA4A 5AYSC 4XB5A 1BNSA 3PS8A 1FGQA 1SPUA 5AIGA 1PU4A 1U8CB 3NQYA 3X3YA 5HGRA 2M7OA 3EN1B 2XR8B 3E99A 3A5EA 5IERA 3LT9A 1E3VA 1ZGXA 6RNTA 3CCM3 1VQL3 1FUWA 3G713 2CFKA 1EG9B 4AKYA 3CCQ3 4JF8A 1BRNL 1GSPA 1O7MB 4I5QA 3BLZA 1ROVA 2KXGA 4WYKB 1SQWA 4GB5A 1YHQ3 5LC6A 4HYZA 1RGFA 3PCSA 4LSOA 1GY6A 1BU4A 3CCV3 1KD14 2HMMB 3RDEA 2Y74A 3EC9A 4O02B 1I2FA 4HM1B 1HU9A 3LOYA 2ZL8A 2KAAA 5CK6A 1BNFA 3MG3A 3X41A 1YI23 3CC43 4LGQA 3CU3A 1YVSA 3MSOA 4NHFA 3NXJA 1VQO3 3D79A 3D9RA 1FGTA 3PCRA 5AI1A 4HBRA 3NBBA 3B7CA 3LTDA 3NUVA 1DMNA 1TTOA 3LZAA 1VQQA 1W4NA 3FF0A 4EV5A 4IIAA 8RNTA 1O7GB 1JRQA 2W9PA 3AMOA 4R1KA 5FGOA 3HX8A 2W0QA 1VQM3 1AVLA 3N8BA 1RN7A 1MOLA 3LYGA 1RGAA 4ORLA 1X1YA 5EEOA 1RCKA 3CME3 1YGWA 1KC84 1VQ83 1LNHA 4O8SA 4ZM8A 4N6V0 2IY2A 1F8NA 1RMSA 2OWPA 1BRGA 1S5AA 3F40A 4NPBA 1GMQA 1I3FA 3NBJA 4HOHA 5M19A 3I553 2RNTA 3X3XA 1VQ73 3CCE3 1W6GA 1ULJB 1FGOA 2WOHA 3NHXA 1G96A 1K28A 3DGOA 1E97A 1V58A 2H0IA 1U5OA 4HM0B 5GSPA 1STFI 2OTL3 1M1XB 1R4YA 5EQLA 2RSXA 1W02A 4N6OB 2CKFB 3T8UA 1GOYA 1LOVA 1LRAA 3JUMA 5JPPA 1A2KA 1W2B2 1IT8A 1FYSA 3EX9A 1JB4A 3S27A 5IG4A 1RKYA 2WO0A 4L7KA 1LOYA 1RJOA 1AR0A 3OWSA 2HMNB 5G1LA 4HM3B 4MEIA 1O7HB 3G16A 1AQZA 5D83A 4EYCA 2LQVA 2YFIB 6STDA 2HMLB 2RGQA 1PFPA 3MPHA 1T2HA 3OXAA 1BSCA 1BRIA 1W2ZA 3K0ZA 2STDA 3D5IA 1UUWB 1GS3A 2GBWB 6GSPA 4EW5A 4LEHA
chains in the Genus database with same CATH topology
3I563 3EJVA 3KKGA 3N54B 3EQQB 1L5GB 1IVWA 1WTHA 1YJW3 1A67A 2GU3A 4KZ1A 1N8QA 1Y4KA 3FF2A 3NX0A 3JVCA 4WP5A 3LTBA 4K1VA 2Z77A 3EB8A 4AKZA 3T8NA 3BB9A 4L8PA 2WGOA 1EA2A 3QK9A 1YIT3 3GZXB 3MG2A 2IMJA 1KSIA 4FMAA 3F8XA 1O7NB 4MMYB 1UW1A 2CC3A 2D42A 1V74A 1M9GA 3EN8A 2E2TA 1VQ53 3HK4A 1KWIA 3VGNA 1ASKA 4MMZB 1D6ZA 3FH1A 1EKMA 2E2VA 3I0YA 5ELJA 3TDGA 3WA3A 4N6MA 1QMAA 1Q824 1N8R4 4U13A 2BO9B 3F14A 1R4CA 4XBYA 1K41A 3JUQA 3S29A 3IMAB 1QVF2 2MC8A 3HZPA 4IT7A 2GXFA 2C10A 1M904 2GU1A 1WMNA 3G6E3 2C11A 3IJEB 3NM7A 1TP6A 1OF5A 2HMJB 3B4OA 4QWTA 4WYKA 3UJMA 3UNLA 1J2BA 1C7HA 3NQZA 4R9LA 3G0KA 2BHMA 3N9HA 4K61A 3KSED 5D82A 1VQ43 1STDA 3UB1A 2CK3H 2INXA 4K1UA 1JKGB 1OF5B 4EXRA 2K0MA 1VQ63 1ZO2A 1OH0A 3OV4A 2W04A 1N5HA 2QA43 3H51A 3Q2PA 2OOVA 3K63A 3WOEB 2B24B 3U1WA 3LMLA 3EBYA 4CCVA 1O7WB 3HIGA 3GZRA 4J8TA 3A76A 3SLUA 3NM2A 3SX1A 2P09A 1Q42A 3DGLA 1W00A 1E3RA 2D1WA 5DRVA 2K54A 1JN5A 1Q814 1K9M4 1O7PB 4TX4A 3CNMA 3JUPA 3RGRA 2OQEA 3CMA3 1JB5A 1W7CA 2ZDJA 1ZX2A 4I4KA 3CCR3 2PNCA 2XSOB 1NU3A 4IPBA 5AEUB 1DVCA 2Y73A 1JN5B 3CPOA 1SIHA 2F99A 1N9JA 4KVHA 5I97A 1LVNA 4FCMA 3LXUX 2P0XA 4NREA 2CW9A 2CHCA 2XFSA 2XEPA 3QRDA 3S5CA 1YJN3 1WMOA 4KFFA 4RNZA 2BMRB 1WNHA 4HM8B 3CD63 4HJLB 5AIIA 3CXC2 1YJ93 3GZYB 3DGMA 4STDA 3CCJ3 2W9QA 2W56A 2XGLA 5LC7A 1DYUA 2CWUA 1DVDA 3OWUA 4FCJA 4XDVA 3DMCA 4HM5B 4LMIA 4WHAA 4O2HA 5ELUA 3BNDA 1GYBA 4R9KA 5A0OB 5IW9A 2P38A 2Z6BA 3MG1A 1ROAA 2BNGA 3V92A 3CCS3 5IEPA 1M1K4 3DY5A 1JNQA 3B8LA 4HM4B 3OX9A 5IG5A 1IQYA 3D3LA 3WA2X 4LZIA 3GRDA 2FGTA 2WGQA 8CHOA 1TFOA 2OOVC 2R4IA 1IQXA 1IT7A 5CF1A 3KSPA 2WOFA 1GD4A 5IENA 3CC73 3S67A 3ECFA 1IK3A 4O3VA 2SBLA 1FA3A 1IV9A 1OCVA 3WODG 3FZWA 3NV0A 3ROBA 2F98A 1OGXA 2B1XB 2CIUA 1UI7A 1OGZA 3EF8A 1JJ22 1DMQA 4FCZA 4H3UA 5BVBA 3X40A 4GL6A 3SXXA 2CWTA 4XBTA 3F7SA 4FMDA 2OQEC 2O9UX 1WQLB 2W6JH 3IPTA 3ALAA 4R4KA 1UUVB 3KFQC 2F86B 5AIHA 4EC6A 3WOFB 1NJI4 3DUKA 3Q90A 5DREA 1IU7A 3EE1A 2P05A 2O3OA 1T5YA 2CFDA 2XSHB 1W01A 2PZVA 4R80A 4X2HA 3T0UA 1CYUA 1MNLA 3J7Yd 2YFJB 4N6TA 5AYRB 3SEDA 4RBNA 1NWWA 2CH9A 2QGUA 1JKGA 4KFDA 5JPUA 2CFWA 1K8A4 1KQS2 1A90A 1A2VA 3DZLA 3MYTA 4HVNA 3MKIA 4HKVB 4N6NB 2CG1A 3UL6A 4XDWA 2XH9A 3B4PA 5EVHA 4RZMA 3EHCA 4N6LA 4Q53A 3BNCA 4XBXA 1CYVA 1GY7A 2KRTA 4N6UA 2BMOB 1QALA 3F9SA 1OHPA 1S723 2BMQB 2HMOB 3HIIA 2LYXA 1RRLA 3LH4A 3HI7A 3LT8A 1JB2A 2Q07A 2MF7A 2ML6A 3CNXA 3CPW2 1Q40A 1NB3I 4FMBA 1TFKA 2GEYA 3FKAA 2CG0A 2QEX3 3CME3 4HM6B 1D6UA 3FLJA 2JDIH 1IQ8A 1TIJA 1WMPA 4HM7B 4PEJA 3FCSB 3M8CA 5IG0A 3G4S3 5G2GA 3KE7A 2Z76A 7STDA 1RRHA 5JBSA 1ULIB 1VQ93 3OW22 1Q40B 1QAKA 1VQK3 1N5PA 4BTWA 5BXQA 5KP1A 3Q1CA 3WMDA 3GWRA 3U97A 4AEQA 4WFOA 1TU5A 2GEXA 2IA7A 3FG1A 4OVMA 1VZZA 5IEOA 1NB5I 2Z7AA 3S28A 3ER7A 4HZBB 4HZ9B 5CXOA 3SOAA 4EBGA 1IDPA 5KP4A 3L0RA 1NDOB 4JRFA 3BNBA 4K90B 1CQSA 1YGEA 5STDA 5CLKA 4BTXA 3FG3A 3PXMA 4J9AA 1DMMA 4H61A 3DM8A 1ISKA 4RNYA 2IUKA 5IG3A 1SJWA 1QAFA 4EV2A 2OTJ3 3DGNA 2L4VA 3NBRA 3X3ZA 3LTAA 2OCTA 1W6CA 2XGNA 1OPYA 2I9WA 1AV4A 3PGBA 3VF1A 3FSDA 3STDA 3SVAA 3OWYA 1VQP3 2XFTA 3CCL3 5AEWB 2W2CA 3DXOA 3K9MC 4FR9A 4X2OA 5CF2A 3PZWA 3VSYA 1FGRA 1EQKA 3JUNA 4WWUC 3NV0B 1OHSA 3X42A 3H3HA 2CFLA 4HM2B 4OK0A 3PYJA 5D81A 2P0MA 2IUJA 2XRXB 1QJGA 1W5ZA 3CCU3 1W6YA 2CWVA 3MHEA 2A15A 3FG4A 3GZBA 2XF3A 4MMXB 3K5TA 4CDLA 3RGAA 4MJDA 1K734 1IVXA 1CEWI 3F8HA 1Z1SA 4KFEA 2JQ5A 1GD3A 3JUOA 2W03A 3EBTA 1SIIA 5FW5A 2E2UA 3LTCA 4XM4A 3KN4A 3GAXA 2GBXB 1IVVA 2UX0A 1OACA 1UI8A 4FMCA 2CFGA 2W56B 2V1LA 4N3VA 1LXEA 2BT3A 2HMKB 3G8ZA 2FXTA 2YFLB 1Q864 5TGNA 3V98A 1FGMA 5IF6A 1NO3A 3V99A 1OUNA 1GY5A 1N9EA 1IV7A 5AIFA 1TUHA 2RFRA 3O8YA 1D6YA 3MWZA 2YX9A 1YIJ3 1BUQA 4BTYA 2RCDA 2ML5A 3UL5A 5KP3A 1VQN3 2FNQA 1Q7Y4 3SOYA 4L8OA 3AMOB 2KCDA 3K7CA 4OUQA 1IVUA 3WDGB 1QVG2 4G1MB 1OHOA 3F7XA 1JV2B 1HKXA 1YVBI 2QIYA 3CC23 1AVKA 3FGYA 1US1A 3KZTA 3KIIA 3BNEA 1LOXA 5AYSC 4XB5A 5AIGA 3PS8A 1FGQA 1SPUA 1PU4A 1U8CB 3NQYA 3X3YA 5HGRA 2M7OA 3EN1B 2XR8B 3E99A 5IERA 3LT9A 1E3VA 1VQL3 3CCM3 1FUWA 3G713 2CFKA 1EG9B 4AKYA 3CCQ3 4JF8A 1O7MB 4WYKB 3BLZA 1ROVA 2KXGA 1SQWA 4GB5A 1YHQ3 5LC6A 4HYZA 3PCSA 4LSOA 1GY6A 3CCV3 1KD14 2HMMB 3RDEA 2Y74A 3EC9A 4O02B 4HM1B 1HU9A 3LOYA 2ZL8A 5CK6A 3X41A 3MG3A 1YI23 3CC43 4LGQA 3CU3A 3MSOA 4NHFA 3NXJA 1VQO3 3D9RA 1FGTA 3PCRA 5AI1A 4HBRA 3NBBA 3B7CA 3LTDA 3NUVA 1DMNA 3LZAA 1W4NA 3FF0A 4EV5A 4IIAA 1O7GB 1JRQA 2W9PA 3AMOA 4R1KA 5FGOA 3HX8A 2W0QA 1VQM3 1AVLA 3N8BA 1RN7A 1MOLA 3LYGA 4ORLA 5EEOA 1KC84 1VQ83 1LNHA 4O8SA 4ZM8A 4N6V0 1F8NA 2OWPA 1S5AA 3F40A 3I553 3NBJA 3X3XA 1VQ73 3CCE3 1W6GA 2WOHA 1ULJB 1FGOA 3NHXA 1G96A 1K28A 3DGOA 1E97A 1U5OA 4HM0B 2OTL3 1STFI 1M1XB 5EQLA 2RSXA 1W02A 4N6OB 2CKFB 3T8UA 3JUMA 5JPPA 1A2KA 1W2B2 1IT8A 3EX9A 1JB4A 3S27A 5IG4A 1RKYA 2WO0A 4L7KA 1RJOA 1AR0A 3OWSA 2HMNB 4HM3B 4MEIA 1O7HB 3G16A 5D83A 4EYCA 2LQVA 2YFIB 6STDA 2HMLB 2RGQA 1PFPA 3MPHA 3OXAA 1W2ZA 3K0ZA 2STDA 1UUWB 1GS3A 2GBWB 4LEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM7 B;  5IG0 A;  3EJV A;  4PEJ A;  5AEU B;  3M8C A;  5KP3 A;  1JN5 B;  3CPO A;  3KKG A;  5G2G A;  2F99 A;  4KVH A;  3EQQ B;  3KE7 A;  3SOY A;  4L8O A;  2Z76 A;  3K7C A;  4OUQ A;  7STD A;  4FCM A;  1OHO A;  3F7X A;  1ULI B;  2CHC A;  1HKX A;  1Q40 B;  2QIY A;  3FF2 A;  3FGY A;  3KZT A;  5BXQ A;  3FLJ A;  4WP5 A;  5KP1 A;  3S5C A;  3WMD A;  2BMR B;  3GWR A;  4K1V A;  2Z77 A;  4HM8 B;  4XB5 A;  4HJL B;  5AIG A;  5AII A;  2GEX A;  3GZY B;  4OVM A;  1VZZ A;  3BB9 A;  4STD A;  5IEO A;  3T8N A;  2Z7A A;  4L8P A;  1EA2 A;  5HGR A;  3EN1 B;  3ER7 A;  2XR8 B;  3E99 A;  4HZB B;  3GZX B;  3MG2 A;  2IMJ A;  4HZ9 B;  5CXO A;  3SOA A;  5IER A;  1E3V A;  1IDP A;  3OWU A;  3DMC A;  4FCJ A;  4HM5 B;  3F8X A;  4LMI A;  4XDV A;  1NDO B;  1O7N B;  5KP4 A;  1GYB A;  4R9K A;  3MG1 A;  1EG9 B;  1CQS A;  2BNG A;  5IEP A;  1O7M B;  3B8L A;  4HM4 B;  3OX9 A;  3BLZ A;  4WYK B;  5CLK A;  5STD A;  5IG5 A;  4GB5 A;  4J9A A;  3EN8 A;  1GY6 A;  1DMM A;  3GRD A;  3DM8 A;  3ROB A;  3HK4 A;  2HMM B;  3VGN A;  8CHO A;  1ISK A;  5IG3 A;  1ASK A;  1SJW A;  3EC9 A;  2R4I A;  4HM1 B;  5CF1 A;  5CK6 A;  3KSP A;  3MG3 A;  3FH1 A;  5IEN A;  3I0Y A;  4LGQ A;  3CU3 A;  3NBR A;  3ECF A;  1QMA A;  3MSO A;  4U13 A;  1OPY A;  1OCV A;  3F14 A;  3NXJ A;  4XBY A;  1K41 A;  2I9W A;  3D9R A;  3FZW A;  3JUQ A;  2F98 A;  1OGX A;  3NV0 A;  3HZP A;  2B1X B;  5AI1 A;  3FSD A;  3B7C A;  3STD A;  3NUV A;  3OWY A;  1DMN A;  2GXF A;  1OGZ A;  3EF8 A;  3LZA A;  1DMQ A;  5AEW B;  2W2C A;  3DXO A;  3FF0 A;  4H3U A;  4IIA A;  1O7G B;  4X2O A;  5BVB A;  4XBT A;  5CF2 A;  3F7S A;  4R1K A;  5JPP A;  3HX8 A;  3VSY A;  1TP6 A;  1WQL B;  4I4K A;  1OF5 A;  2HMJ B;  3B4O A;  3IPT A;  3JUN A;  4WWU C;  3NV0 B;  1OHS A;  3LYG A;  3H3H A;  1UUV B;  4HM2 B;  4ORL A;  5D81 A;  4WYK A;  2F86 B;  5AIH A;  3UJM A;  3UNL A;  3DUK A;  1C7H A;  4R9L A;  2XRX B;  1QJG A;  3G0K A;  3Q90 A;  5DRE A;  1W6Y A;  3MHE A;  2A15 A;  2OWP A;  3GZB A;  5D82 A;  1STD A;  1S5A A;  3F40 A;  2XSH B;  4CDL A;  1W01 A;  2PZV A;  2INX A;  4K1U A;  1JKG B;  4X2H A;  1OF5 B;  3RGA A;  4MJD A;  2YFJ B;  1ULJ B;  1ZO2 A;  1OH0 A;  3F8H A;  3NHX A;  3OV4 A;  1Z1S A;  3SED A;  1E97 A;  1NWW A;  2JQ5 A;  2QGU A;  1JKG A;  5JPU A;  3JUO A;  1U5O A;  4HM0 B;  3H51 A;  3EBT A;  3DZL A;  3MYT A;  4HVN A;  3MKI A;  2B24 B;  4HKV B;  1W02 A;  5FW5 A;  2CKF B;  3EBY A;  4XDW A;  3JUM A;  3T8U A;  1O7W B;  4XM4 A;  4J8T A;  1A2K A;  3GZR A;  3B4P A;  5EVH A;  2GBX B;  1JB4 A;  3A76 A;  3EHC A;  3EX9 A;  3NM2 A;  2UX0 A;  4RZM A;  5IG4 A;  4Q53 A;  4L7K A;  1GY7 A;  4XBX A;  1AR0 A;  2BMO B;  3F9S A;  1OHP A;  1Q42 A;  1W00 A;  2BMQ B;  2HMN B;  2HMO B;  2HMK B;  3G8Z A;  1E3R A;  2YFL B;  3OWS A;  4HM3 B;  4N3V A;  5DRV A;  2K54 A;  1JN5 A;  5TGN A;  1O7H B;  3G16 A;  1O7P B;  5D83 A;  2YFI B;  6STD A;  5IF6 A;  1JB2 A;  3CNM A;  3JUP A;  3RGR A;  2HML B;  1OUN A;  2RGQ A;  1JB5 A;  1GY5 A;  3OXA A;  3CNX A;  1ZX2 A;  1Q40 A;  5AIF A;  1TUH A;  2GEY A;  2RFR A;  3FKA A;  2STD A;  3K0Z A;  4HM6 B;  1BUQ A;  1UUW B;  1GS3 A;  2GBW B;  4LEH A;  2RCD A;  2XSO B;  1NU3 A; 
#chains in the Genus database with same CATH topology
 3I56 3;  1B27 A;  3EJV A;  1BAO A;  3KKG A;  3N54 B;  3EQQ B;  1ZS7 A;  1BNR A;  1L5G B;  1MGW A;  1IVW A;  1WTH A;  1YJW 3;  1A67 A;  2GU3 A;  1NNV A;  3BU4 A;  4KZ1 A;  1RGG A;  1RGH A;  1N8Q A;  1Y4K A;  3FF2 A;  3NX0 A;  2HOH A;  3JVC A;  1UGH I;  4WP5 A;  3AHS A;  3LTB A;  1B2M A;  4K1V A;  1GMP A;  2Z77 A;  3EB8 A;  4AKZ A;  1BRK A;  1LNI A;  2F5W A;  1B20 A;  3T8N A;  3BB9 A;  3RNT A;  1I0X A;  4L8P A;  2WGO A;  1EA2 A;  1TRQ A;  3QK9 A;  1YIT 3;  3GZX B;  3MG2 A;  2IMJ A;  1GOU A;  1PY3 A;  1KSI A;  4FMA A;  3F8X A;  3D4A A;  1O7N B;  2KF3 A;  4MMY B;  3DGY A;  1UW1 A;  2CC3 A;  2D42 A;  2K3D A;  1Q82 4;  1BNG A;  1V74 A;  1M9G A;  3WHO A;  3EN8 A;  2E2T A;  1VQ5 3;  3HK4 A;  1KWI A;  1UGI A;  3VGN A;  1ASK A;  4MMZ B;  1D6Z A;  1I0V A;  1TRP A;  1EKM A;  2E2V A;  3FH1 A;  3I0Y A;  5ELJ A;  3TDG A;  4N6M A;  1QMA A;  7RNT A;  3WA3 A;  1N8R 4;  1RDS A;  4U13 A;  2SAR A;  2BO9 B;  3F14 A;  1HYF A;  1R4C A;  1K41 A;  3JUQ A;  4XBY A;  3IMA B;  5M1A A;  3S29 A;  2MC8 A;  1QVF 2;  3HZP A;  4IT7 A;  2GXF A;  2C10 A;  1M90 4;  1EUI C;  2L1S A;  2GU1 A;  1WMN A;  4GHO A;  7GSP A;  3G6E 3;  2C11 A;  3IJE B;  2KF5 A;  1AY7 A;  3NM7 A;  1TP6 A;  3AHW A;  1HZ1 A;  1OF5 A;  2HMJ B;  3B4O A;  1MGR A;  4J5K A;  1RN1 A;  4QWT A;  4WYK A;  4GSP A;  3UJM A;  3UNL A;  1J2B A;  1C7H A;  3NQZ A;  2R41 A;  4R9L A;  3G0K A;  2BU4 A;  1CH0 A;  2BHM A;  3N9H A;  4K61 A;  3KSE D;  5D82 A;  3WR2 A;  1VQ4 3;  1STD A;  3UB1 A;  2CK3 H;  2INX A;  4K1U A;  1JKG B;  1OF5 B;  4EXR A;  2K0M A;  1VQ6 3;  4CPK A;  4BL2 A;  1ZO2 A;  1OH0 A;  3OV4 A;  2W04 A;  1UCL A;  1N5H A;  1C54 A;  2QA4 3;  3H51 A;  3Q2P A;  2OOV A;  3K63 A;  3WOE B;  2B24 B;  3U1W A;  1BAN A;  3LML A;  3EBY A;  4CCV A;  1O7W B;  3HIG A;  3GZR A;  4J8T A;  1RGK A;  3A76 A;  3SLU A;  3NM2 A;  3SX1 A;  1GMR A;  2P09 A;  1Q42 A;  1W00 A;  3DGL A;  1E3R A;  2D1W A;  5DRV A;  2K54 A;  1JN5 A;  1Q81 4;  1K9M 4;  1X1U A;  1O7P B;  4TX4 A;  1BUJ A;  3CNM A;  3JUP A;  3RGR A;  2OQE A;  3CMA 3;  1JB5 A;  1W7C A;  1ZX2 A;  2ZDJ A;  1RGL A;  4I4K A;  3CCR 3;  2PNC A;  2AAD A;  1NU3 A;  2XSO B;  2ZHX B;  1BNJ A;  2H0G A;  4IPB A;  5AEU B;  1DVC A;  2Y73 A;  1JN5 B;  3CPO A;  1B21 A;  1SIH A;  1UUG B;  1N9J A;  2F99 A;  4KVH A;  2KF6 A;  5I97 A;  1LVN A;  4FCM A;  3LXU X;  2P0X A;  4NRE A;  2CW9 A;  2CHC A;  4LYL B;  2XFS A;  2XEP A;  4BU4 A;  3QRD A;  3S5C A;  1YJN 3;  1WMO A;  1I2G A;  4KFF A;  4RNZ A;  5RNT A;  2BMR B;  1WNH A;  1RGE A;  4HM8 B;  3CD6 3;  4HJL B;  5AII A;  3CXC 2;  1YJ9 3;  1RGC A;  3GZY B;  3DGM A;  1MWU A;  4STD A;  3CCJ 3;  2W9Q A;  2W56 A;  2XGL A;  5LC7 A;  1DYU A;  2CWU A;  1DVD A;  3OWU A;  4FCJ A;  4XDV A;  3DMC A;  4HM5 B;  4LMI A;  4WHA A;  1JBS A;  4O2H A;  5ELU A;  3BND A;  1GYB A;  3KCH A;  1I3I A;  4R9K A;  5A0O B;  5IW9 A;  2P38 A;  2Z6B A;  3MG1 A;  1FW7 A;  1ROA A;  2BNG A;  3V92 A;  3CCS 3;  5IEP A;  1M1K 4;  3DY5 A;  1JNQ A;  3B8L A;  2CX1 A;  3OX9 A;  4HM4 B;  5IG5 A;  1IQY A;  3D3L A;  3CC7 3;  3WA2 X;  2C4B A;  1MWR A;  3GRD A;  4LZI A;  2FGT A;  2WGQ A;  8CHO A;  1TFO A;  2OOV C;  1V57 A;  2R4I A;  1IQX A;  1IT7 A;  5CF1 A;  3KSP A;  2WOF A;  1GD4 A;  1FZU A;  5BIR A;  3S67 A;  1MWS A;  4RNT A;  3ECF A;  5IEN A;  1IK3 A;  4O3V A;  2SBL A;  1FA3 A;  1EEJ A;  1IV9 A;  1OCV A;  3WOD G;  3FZW A;  3NV0 A;  3ROB A;  2F98 A;  1OGX A;  2B1X B;  1RLS A;  3GSP A;  2CIU A;  1UI7 A;  1OGZ A;  3EF8 A;  1JJ2 2;  1DMQ A;  4FCZ A;  4H3U A;  5BVB A;  3X40 A;  4GL6 A;  3SXX A;  1FUS A;  2CWT A;  1RN4 A;  4XBT A;  3F7S A;  1BIR A;  2OQE C;  4FMD A;  2O9U X;  1WQL B;  2W6J H;  3IPT A;  1TJD A;  3ALA A;  4R4K A;  1UUV B;  1JBR A;  3KFQ C;  1BRS A;  1Q7H A;  1X1W A;  2F86 B;  5AIH A;  4EC6 A;  3WOF B;  1NJI 4;  3DUK A;  3Q90 A;  5DRE A;  3DH2 A;  1JZO A;  1IU7 A;  2P05 A;  3EE1 A;  2F56 A;  1T5Y A;  2CFD A;  1GOV A;  2O3O A;  1W01 A;  2PZV A;  2XSH B;  4R80 A;  4X2H A;  3T0U A;  1CYU A;  1MNL A;  3J7Y d;  1BSD A;  2YFJ B;  4N6T A;  5HOH A;  5AYR B;  1UDI I;  3SED A;  4RBN A;  3BIR A;  1NWW A;  2CH9 A;  2QGU A;  1JKG A;  4KFD A;  5JPU A;  2CFW A;  1K8A 4;  1KQS 2;  1A90 A;  1A2V A;  4BL3 A;  3DZL A;  3MYT A;  4HVN A;  3MKI A;  4HKV B;  4J5G A;  4N6N B;  2CG1 A;  3UL6 A;  4CJN A;  4XDW A;  2XH9 A;  3B4P A;  5EVH A;  4RZM A;  3EHC A;  1JZD A;  4N6L A;  4Q53 A;  3BNC A;  4XBX A;  1CYV A;  1GY7 A;  2KRT A;  4N6U A;  2BMO B;  1QAL A;  3F9S A;  1OHP A;  1S72 3;  2BMQ B;  2HMO B;  3HII A;  1RNB A;  1BSA A;  1G0T A;  2LYX A;  1RRL A;  3LH4 A;  3HI7 A;  5G1K A;  3LT8 A;  1JB2 A;  2UGI A;  1PYL A;  2Q07 A;  2MF7 A;  2ML6 A;  3CNX A;  3CPW 2;  1Q40 A;  1NB3 I;  4FMB A;  1TFK A;  2GEY A;  3FKA A;  2CG0 A;  4BIR A;  1BNE A;  4HM6 B;  1D6U A;  2QEX 3;  3FLJ A;  2JDI H;  1RSN A;  1IQ8 A;  1TIJ A;  1WMP A;  4HM7 B;  4PEJ A;  3FCS B;  3M8C A;  5IG0 A;  1SAR A;  3G4S 3;  5G2G A;  3KE7 A;  2Z76 A;  7STD A;  1RRH A;  1BGS A;  1RCL A;  5JBS A;  1B2Z A;  1ULI B;  1VQ9 3;  3OW2 2;  1Q40 B;  1Q9E A;  1QAK A;  4DKI A;  1VQK 3;  1N5P A;  4BTW A;  5BXQ A;  5KP1 A;  1A2P A;  3Q1C A;  3WMD A;  3GWR A;  3U97 A;  4AEQ A;  1BOX A;  4WFO A;  1TU5 A;  1BNI A;  1RTU A;  4HAA A;  2GEX A;  2IA7 A;  3FG1 A;  4OVM A;  1VZZ A;  5IEO A;  1FUT A;  3ZG5 A;  1NB5 I;  2Z7A A;  3S28 A;  1B2U A;  3ER7 A;  4HZB B;  1I2E A;  1UCK A;  4HZ9 B;  5CXO A;  3SOA A;  3URP A;  2H0H A;  2RBI A;  1IDP A;  4EBG A;  1T3B A;  5KP4 A;  3L0R A;  1NDO B;  5BU4 A;  4JRF A;  3BNB A;  4K90 B;  1CQS A;  2AAE A;  1YGE A;  3ZG0 A;  5STD A;  5CLK A;  2F5M A;  3Q3F A;  4BTX A;  3FG3 A;  3PXM A;  4J9A A;  1DMM A;  4H61 A;  3DM8 A;  4KT3 B;  2BIR A;  2CX0 A;  1ISK A;  4RNY A;  2IUK A;  5IG3 A;  1MWT A;  1SJW A;  1QAF A;  2F4Y A;  4EV2 A;  1BSE A;  2OTJ 3;  3DGN A;  2L4V A;  3NBR A;  2GSP A;  3X3Z A;  3LTA A;  2OCT A;  1W6C A;  2XGN A;  1OPY A;  2J8X B;  1LQG C;  2I9W A;  1AV4 A;  3PGB A;  3VF1 A;  3FSD A;  3STD A;  3SVA A;  3OWY A;  1VQP 3;  1RHL A;  2XFT A;  3CCL 3;  5AEW B;  1DET A;  2W2C A;  3DXO A;  3K9M C;  4FR9 A;  4X2O A;  3SYU A;  5CF2 A;  1I70 A;  1DE3 A;  3PZW A;  3VSY A;  1FGR A;  1BSB A;  1EQK A;  3JUN A;  4WWU C;  3NV0 B;  1OHS A;  3X42 A;  3H3H A;  1T2I A;  2CFL A;  4HM2 B;  4OK0 A;  3PYJ A;  5D81 A;  2P0M A;  3D5G A;  2IUJ A;  1B2S A;  2XRX B;  1QJG A;  1W5Z A;  3CCU 3;  1W6Y A;  2CWV A;  3MHE A;  2A15 A;  2KF4 A;  3FG4 A;  2XF3 A;  3GZB A;  3K5T A;  4MMX B;  4CDL A;  3RGA A;  4MJD A;  1K73 4;  1IVX A;  2UUG C;  1CEW I;  3F8H A;  1I8V A;  1Z1S A;  1G02 A;  4KFE A;  1IYY A;  2JQ5 A;  1GD3 A;  3JUO A;  1X1X A;  2W03 A;  3EBT A;  1SII A;  5FW5 A;  2E2U A;  3LTC A;  1UCI A;  4XM4 A;  3KN4 A;  3GAX A;  2GBX B;  3HOH A;  1IVV A;  2UX0 A;  1OAC A;  1UI8 A;  4FMC A;  2CFG A;  2W56 B;  2V1L A;  4N3V A;  1LXE A;  2BT3 A;  2HMK B;  3G8Z A;  2FXT A;  2YFL B;  2IYJ A;  1JBT A;  1Q86 4;  5TGN A;  1B2X A;  3V98 A;  1FGM A;  4ILF A;  3AGN A;  5IF6 A;  1NO3 A;  1BRH A;  3V99 A;  1OUN A;  1GY5 A;  1N9E A;  1IV7 A;  1BVI A;  5AIF A;  1TUH A;  2RFR A;  3O8Y A;  1D6Y A;  3MWZ A;  2YX9 A;  1YIJ 3;  1BRJ A;  1BUQ A;  1YNV X;  4BTY A;  2RCD A;  2ML5 A;  3UL5 A;  5KP3 A;  5M18 A;  1VQN 3;  2FNQ A;  1Q7Y 4;  1LOW A;  3AGO A;  3SOY A;  4L8O A;  3AMO B;  2KCD A;  3K7C A;  4OUQ A;  1IVU A;  3WDG B;  1LQM B;  4G1M B;  1OHO A;  3F7X A;  1QVG 2;  1JV2 B;  1HKX A;  1YVB I;  2QIY A;  3CC2 3;  1AVK A;  1UCJ A;  3FGY A;  1US1 A;  3KZT A;  3KII A;  1B3S A;  1RNT A;  3BNE A;  3ZFZ A;  9RNT A;  1LOX A;  2ZA4 A;  5AYS C;  4XB5 A;  1BNS A;  3PS8 A;  1FGQ A;  1SPU A;  5AIG A;  1PU4 A;  1U8C B;  3NQY A;  3X3Y A;  5HGR A;  2M7O A;  3EN1 B;  2XR8 B;  3E99 A;  3A5E A;  5IER A;  3LT9 A;  1E3V A;  1ZGX A;  6RNT A;  3CCM 3;  1VQL 3;  1FUW A;  3G71 3;  2CFK A;  1EG9 B;  4AKY A;  3CCQ 3;  4JF8 A;  1BRN L;  1GSP A;  1O7M B;  4I5Q A;  3BLZ A;  1ROV A;  2KXG A;  4WYK B;  1SQW A;  4GB5 A;  1YHQ 3;  5LC6 A;  4HYZ A;  1RGF A;  3PCS A;  4LSO A;  1GY6 A;  1BU4 A;  3CCV 3;  1KD1 4;  2HMM B;  3RDE A;  2Y74 A;  3EC9 A;  4O02 B;  1I2F A;  4HM1 B;  1HU9 A;  3LOY A;  2ZL8 A;  2KAA A;  5CK6 A;  1BNF A;  3MG3 A;  3X41 A;  1YI2 3;  3CC4 3;  4LGQ A;  3CU3 A;  1YVS A;  3MSO A;  4NHF A;  3NXJ A;  1VQO 3;  3D79 A;  3D9R A;  1FGT A;  3PCR A;  5AI1 A;  4HBR A;  3NBB A;  3B7C A;  3LTD A;  3NUV A;  1DMN A;  1TTO A;  3LZA A;  1VQQ A;  1W4N A;  3FF0 A;  4EV5 A;  4IIA A;  8RNT A;  1O7G B;  1JRQ A;  2W9P A;  3AMO A;  4R1K A;  5FGO A;  3HX8 A;  2W0Q A;  1VQM 3;  1AVL A;  3N8B A;  1RN7 A;  1MOL A;  3LYG A;  1RGA A;  4ORL A;  1X1Y A;  5EEO A;  1RCK A;  3CME 3;  1YGW A;  1KC8 4;  1VQ8 3;  1LNH A;  4O8S A;  4ZM8 A;  4N6V 0;  2IY2 A;  1F8N A;  1RMS A;  2OWP A;  1BRG A;  1S5A A;  3F40 A;  4NPB A;  1GMQ A;  1I3F A;  3NBJ A;  4HOH A;  5M19 A;  3I55 3;  2RNT A;  3X3X A;  1VQ7 3;  3CCE 3;  1W6G A;  1ULJ B;  1FGO A;  2WOH A;  3NHX A;  1G96 A;  1K28 A;  3DGO A;  1E97 A;  1V58 A;  2H0I A;  1U5O A;  4HM0 B;  5GSP A;  1STF I;  2OTL 3;  1M1X B;  1R4Y A;  5EQL A;  2RSX A;  1W02 A;  4N6O B;  2CKF B;  3T8U A;  1GOY A;  1LOV A;  1LRA A;  3JUM A;  5JPP A;  1A2K A;  1W2B 2;  1IT8 A;  1FYS A;  3EX9 A;  1JB4 A;  3S27 A;  5IG4 A;  1RKY A;  2WO0 A;  4L7K A;  1LOY A;  1RJO A;  1AR0 A;  3OWS A;  2HMN B;  5G1L A;  4HM3 B;  4MEI A;  1O7H B;  3G16 A;  1AQZ A;  5D83 A;  4EYC A;  2LQV A;  2YFI B;  6STD A;  2HML B;  2RGQ A;  1PFP A;  3MPH A;  1T2H A;  3OXA A;  1BSC A;  1BRI A;  1W2Z A;  3K0Z A;  2STD A;  3D5I A;  1UUW B;  1GS3 A;  2GBW B;  6GSP A;  4EW5 A;  4LEH A; 
#chains in the Genus database with same CATH homology
 3I56 3;  3EJV A;  3KKG A;  3N54 B;  3EQQ B;  1L5G B;  1IVW A;  1WTH A;  1YJW 3;  1A67 A;  2GU3 A;  4KZ1 A;  1N8Q A;  1Y4K A;  3FF2 A;  3NX0 A;  3JVC A;  4WP5 A;  3LTB A;  4K1V A;  2Z77 A;  3EB8 A;  4AKZ A;  3T8N A;  3BB9 A;  4L8P A;  2WGO A;  1EA2 A;  3QK9 A;  1YIT 3;  3GZX B;  3MG2 A;  2IMJ A;  1KSI A;  4FMA A;  3F8X A;  1O7N B;  4MMY B;  1UW1 A;  2CC3 A;  2D42 A;  1V74 A;  1M9G A;  3EN8 A;  2E2T A;  1VQ5 3;  3HK4 A;  1KWI A;  3VGN A;  1ASK A;  4MMZ B;  1D6Z A;  3FH1 A;  1EKM A;  2E2V A;  3I0Y A;  5ELJ A;  3TDG A;  3WA3 A;  4N6M A;  1QMA A;  1Q82 4;  1N8R 4;  4U13 A;  2BO9 B;  3F14 A;  1R4C A;  4XBY A;  1K41 A;  3JUQ A;  3S29 A;  3IMA B;  1QVF 2;  2MC8 A;  3HZP A;  4IT7 A;  2GXF A;  2C10 A;  1M90 4;  2GU1 A;  1WMN A;  3G6E 3;  2C11 A;  3IJE B;  3NM7 A;  1TP6 A;  1OF5 A;  2HMJ B;  3B4O A;  4QWT A;  4WYK A;  3UJM A;  3UNL A;  1J2B A;  1C7H A;  3NQZ A;  4R9L A;  3G0K A;  2BHM A;  3N9H A;  4K61 A;  3KSE D;  5D82 A;  1VQ4 3;  1STD A;  3UB1 A;  2CK3 H;  2INX A;  4K1U A;  1JKG B;  1OF5 B;  4EXR A;  2K0M A;  1VQ6 3;  1ZO2 A;  1OH0 A;  3OV4 A;  2W04 A;  1N5H A;  2QA4 3;  3H51 A;  3Q2P A;  2OOV A;  3K63 A;  3WOE B;  2B24 B;  3U1W A;  3LML A;  3EBY A;  4CCV A;  1O7W B;  3HIG A;  3GZR A;  4J8T A;  3A76 A;  3SLU A;  3NM2 A;  3SX1 A;  2P09 A;  1Q42 A;  3DGL A;  1W00 A;  1E3R A;  2D1W A;  5DRV A;  2K54 A;  1JN5 A;  1Q81 4;  1K9M 4;  1O7P B;  4TX4 A;  3CNM A;  3JUP A;  3RGR A;  2OQE A;  3CMA 3;  1JB5 A;  1W7C A;  2ZDJ A;  1ZX2 A;  4I4K A;  3CCR 3;  2PNC A;  2XSO B;  1NU3 A;  4IPB A;  5AEU B;  1DVC A;  2Y73 A;  1JN5 B;  3CPO A;  1SIH A;  2F99 A;  1N9J A;  4KVH A;  5I97 A;  1LVN A;  4FCM A;  3LXU X;  2P0X A;  4NRE A;  2CW9 A;  2CHC A;  2XFS A;  2XEP A;  3QRD A;  3S5C A;  1YJN 3;  1WMO A;  4KFF A;  4RNZ A;  2BMR B;  1WNH A;  4HM8 B;  3CD6 3;  4HJL B;  5AII A;  3CXC 2;  1YJ9 3;  3GZY B;  3DGM A;  4STD A;  3CCJ 3;  2W9Q A;  2W56 A;  2XGL A;  5LC7 A;  1DYU A;  2CWU A;  1DVD A;  3OWU A;  4FCJ A;  4XDV A;  3DMC A;  4HM5 B;  4LMI A;  4WHA A;  4O2H A;  5ELU A;  3BND A;  1GYB A;  4R9K A;  5A0O B;  5IW9 A;  2P38 A;  2Z6B A;  3MG1 A;  1ROA A;  2BNG A;  3V92 A;  3CCS 3;  5IEP A;  1M1K 4;  3DY5 A;  1JNQ A;  3B8L A;  4HM4 B;  3OX9 A;  5IG5 A;  1IQY A;  3D3L A;  3WA2 X;  4LZI A;  3GRD A;  2FGT A;  2WGQ A;  8CHO A;  1TFO A;  2OOV C;  2R4I A;  1IQX A;  1IT7 A;  5CF1 A;  3KSP A;  2WOF A;  1GD4 A;  5IEN A;  3CC7 3;  3S67 A;  3ECF A;  1IK3 A;  4O3V A;  2SBL A;  1FA3 A;  1IV9 A;  1OCV A;  3WOD G;  3FZW A;  3NV0 A;  3ROB A;  2F98 A;  1OGX A;  2B1X B;  2CIU A;  1UI7 A;  1OGZ A;  3EF8 A;  1JJ2 2;  1DMQ A;  4FCZ A;  4H3U A;  5BVB A;  3X40 A;  4GL6 A;  3SXX A;  2CWT A;  4XBT A;  3F7S A;  4FMD A;  2OQE C;  2O9U X;  1WQL B;  2W6J H;  3IPT A;  3ALA A;  4R4K A;  1UUV B;  3KFQ C;  2F86 B;  5AIH A;  4EC6 A;  3WOF B;  1NJI 4;  3DUK A;  3Q90 A;  5DRE A;  1IU7 A;  3EE1 A;  2P05 A;  2O3O A;  1T5Y A;  2CFD A;  2XSH B;  1W01 A;  2PZV A;  4R80 A;  4X2H A;  3T0U A;  1CYU A;  1MNL A;  3J7Y d;  2YFJ B;  4N6T A;  5AYR B;  3SED A;  4RBN A;  1NWW A;  2CH9 A;  2QGU A;  1JKG A;  4KFD A;  5JPU A;  2CFW A;  1K8A 4;  1KQS 2;  1A90 A;  1A2V A;  3DZL A;  3MYT A;  4HVN A;  3MKI A;  4HKV B;  4N6N B;  2CG1 A;  3UL6 A;  4XDW A;  2XH9 A;  3B4P A;  5EVH A;  4RZM A;  3EHC A;  4N6L A;  4Q53 A;  3BNC A;  4XBX A;  1CYV A;  1GY7 A;  2KRT A;  4N6U A;  2BMO B;  1QAL A;  3F9S A;  1OHP A;  1S72 3;  2BMQ B;  2HMO B;  3HII A;  2LYX A;  1RRL A;  3LH4 A;  3HI7 A;  3LT8 A;  1JB2 A;  2Q07 A;  2MF7 A;  2ML6 A;  3CNX A;  3CPW 2;  1Q40 A;  1NB3 I;  4FMB A;  1TFK A;  2GEY A;  3FKA A;  2CG0 A;  2QEX 3;  3CME 3;  4HM6 B;  1D6U A;  3FLJ A;  2JDI H;  1IQ8 A;  1TIJ A;  1WMP A;  4HM7 B;  4PEJ A;  3FCS B;  3M8C A;  5IG0 A;  3G4S 3;  5G2G A;  3KE7 A;  2Z76 A;  7STD A;  1RRH A;  5JBS A;  1ULI B;  1VQ9 3;  3OW2 2;  1Q40 B;  1QAK A;  1VQK 3;  1N5P A;  4BTW A;  5BXQ A;  5KP1 A;  3Q1C A;  3WMD A;  3GWR A;  3U97 A;  4AEQ A;  4WFO A;  1TU5 A;  2GEX A;  2IA7 A;  3FG1 A;  4OVM A;  1VZZ A;  5IEO A;  1NB5 I;  2Z7A A;  3S28 A;  3ER7 A;  4HZB B;  4HZ9 B;  5CXO A;  3SOA A;  4EBG A;  1IDP A;  5KP4 A;  3L0R A;  1NDO B;  4JRF A;  3BNB A;  4K90 B;  1CQS A;  1YGE A;  5STD A;  5CLK A;  4BTX A;  3FG3 A;  3PXM A;  4J9A A;  1DMM A;  4H61 A;  3DM8 A;  1ISK A;  4RNY A;  2IUK A;  5IG3 A;  1SJW A;  1QAF A;  4EV2 A;  2OTJ 3;  3DGN A;  2L4V A;  3NBR A;  3X3Z A;  3LTA A;  2OCT A;  1W6C A;  2XGN A;  1OPY A;  2I9W A;  1AV4 A;  3PGB A;  3VF1 A;  3FSD A;  3STD A;  3SVA A;  3OWY A;  1VQP 3;  2XFT A;  3CCL 3;  5AEW B;  2W2C A;  3DXO A;  3K9M C;  4FR9 A;  4X2O A;  5CF2 A;  3PZW A;  3VSY A;  1FGR A;  1EQK A;  3JUN A;  4WWU C;  3NV0 B;  1OHS A;  3X42 A;  3H3H A;  2CFL A;  4HM2 B;  4OK0 A;  3PYJ A;  5D81 A;  2P0M A;  2IUJ A;  2XRX B;  1QJG A;  1W5Z A;  3CCU 3;  1W6Y A;  2CWV A;  3MHE A;  2A15 A;  3FG4 A;  3GZB A;  2XF3 A;  4MMX B;  3K5T A;  4CDL A;  3RGA A;  4MJD A;  1K73 4;  1IVX A;  1CEW I;  3F8H A;  1Z1S A;  4KFE A;  2JQ5 A;  1GD3 A;  3JUO A;  2W03 A;  3EBT A;  1SII A;  5FW5 A;  2E2U A;  3LTC A;  4XM4 A;  3KN4 A;  3GAX A;  2GBX B;  1IVV A;  2UX0 A;  1OAC A;  1UI8 A;  4FMC A;  2CFG A;  2W56 B;  2V1L A;  4N3V A;  1LXE A;  2BT3 A;  2HMK B;  3G8Z A;  2FXT A;  2YFL B;  1Q86 4;  5TGN A;  3V98 A;  1FGM A;  5IF6 A;  1NO3 A;  3V99 A;  1OUN A;  1GY5 A;  1N9E A;  1IV7 A;  5AIF A;  1TUH A;  2RFR A;  3O8Y A;  1D6Y A;  3MWZ A;  2YX9 A;  1YIJ 3;  1BUQ A;  4BTY A;  2RCD A;  2ML5 A;  3UL5 A;  5KP3 A;  1VQN 3;  2FNQ A;  1Q7Y 4;  3SOY A;  4L8O A;  3AMO B;  2KCD A;  3K7C A;  4OUQ A;  1IVU A;  3WDG B;  1QVG 2;  4G1M B;  1OHO A;  3F7X A;  1JV2 B;  1HKX A;  1YVB I;  2QIY A;  3CC2 3;  1AVK A;  3FGY A;  1US1 A;  3KZT A;  3KII A;  3BNE A;  1LOX A;  5AYS C;  4XB5 A;  5AIG A;  3PS8 A;  1FGQ A;  1SPU A;  1PU4 A;  1U8C B;  3NQY A;  3X3Y A;  5HGR A;  2M7O A;  3EN1 B;  2XR8 B;  3E99 A;  5IER A;  3LT9 A;  1E3V A;  1VQL 3;  3CCM 3;  1FUW A;  3G71 3;  2CFK A;  1EG9 B;  4AKY A;  3CCQ 3;  4JF8 A;  1O7M B;  4WYK B;  3BLZ A;  1ROV A;  2KXG A;  1SQW A;  4GB5 A;  1YHQ 3;  5LC6 A;  4HYZ A;  3PCS A;  4LSO A;  1GY6 A;  3CCV 3;  1KD1 4;  2HMM B;  3RDE A;  2Y74 A;  3EC9 A;  4O02 B;  4HM1 B;  1HU9 A;  3LOY A;  2ZL8 A;  5CK6 A;  3X41 A;  3MG3 A;  1YI2 3;  3CC4 3;  4LGQ A;  3CU3 A;  3MSO A;  4NHF A;  3NXJ A;  1VQO 3;  3D9R A;  1FGT A;  3PCR A;  5AI1 A;  4HBR A;  3NBB A;  3B7C A;  3LTD A;  3NUV A;  1DMN A;  3LZA A;  1W4N A;  3FF0 A;  4EV5 A;  4IIA A;  1O7G B;  1JRQ A;  2W9P A;  3AMO A;  4R1K A;  5FGO A;  3HX8 A;  2W0Q A;  1VQM 3;  1AVL A;  3N8B A;  1RN7 A;  1MOL A;  3LYG A;  4ORL A;  5EEO A;  1KC8 4;  1VQ8 3;  1LNH A;  4O8S A;  4ZM8 A;  4N6V 0;  1F8N A;  2OWP A;  1S5A A;  3F40 A;  3I55 3;  3NBJ A;  3X3X A;  1VQ7 3;  3CCE 3;  1W6G A;  2WOH A;  1ULJ B;  1FGO A;  3NHX A;  1G96 A;  1K28 A;  3DGO A;  1E97 A;  1U5O A;  4HM0 B;  2OTL 3;  1STF I;  1M1X B;  5EQL A;  2RSX A;  1W02 A;  4N6O B;  2CKF B;  3T8U A;  3JUM A;  5JPP A;  1A2K A;  1W2B 2;  1IT8 A;  3EX9 A;  1JB4 A;  3S27 A;  5IG4 A;  1RKY A;  2WO0 A;  4L7K A;  1RJO A;  1AR0 A;  3OWS A;  2HMN B;  4HM3 B;  4MEI A;  1O7H B;  3G16 A;  5D83 A;  4EYC A;  2LQV A;  2YFI B;  6STD A;  2HML B;  2RGQ A;  1PFP A;  3MPH A;  3OXA A;  1W2Z A;  3K0Z A;  2STD A;  1UUW B;  1GS3 A;  2GBW B;  4LEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...