5EQLA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
82
Chain Sequence
SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
molecule keywords SUMO-Affirmer-S2D5
molecule tags Protein binding
source organism Synthetic construct
total genus 13
structure length 82
sequence length 88
ec nomenclature
pdb deposition date 2015-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eqlA00
4N6V0 2KXGA 5ELJA 4N6MA 1EQKA 1A67A 3LH4A 3QRDA 1YVBI 3S67A 4ZM8A 3K9MC 3Q2PA 1LXEA 1G96A 4N6TA 4IT7A 4CCVA 1R4CA 1CYVA 5ELUA 5LC7A 3NX0A 4LZIA 1N5PA 2W9PA 5LC6A 4EYCA 1FUWA 1WNHA 3KSED 3L0RA 1KWIA 3PYJA 1MOLA 1PFPA 2OCTA 1N9JA 2W9QA 1NB5I 1ROAA 4N6UA 1DVDA 2BO9B 3GAXA 1IV9A 1TIJA 1CEWI 1NB3I 1MNLA 1DVCA 4TX4A 1STFI 1N5HA 2CH9A 3MWZA 1GD4A 2O9UX 1FA3A 1GD3A 3PS8A 3KFQC 3PXMA 1RN7A 5EQLA 4N6OB 1CYUA 3IMAB 3SVAA 4N6LA 1A90A 5A0OB 3UL6A 1IV7A 3UL5A 1M9GA 4N6NB
chains in the Genus database with same CATH superfamily
4FMAA 2GSPA 2KAAA 2WO0A 1KC84 1YIT3 4N6V0 1VQ73 4WYKB 4IPBA 1RN4A 1GMPA 1K28A 3WMDA 4EV5A 1MGWA 1E3RA 3EN8A 4I4KA 1UW1A 4RNZA 3HOHA 3VF1A 3J7Yd 2QEX3 1OHOA 2GBXB 3KE7A 2YFJB 1UCLA 1YVBI 3FSDA 4L8PA 3SOAA 1TTOA 4ZM8A 3K9MC 4EBGA 2H0GA 3Q3FA 1BUQA 1F8NA 1B2ZA 1HU9A 2I9WA 3E99A 3WA2X 4WWUC 3CCR3 4L7KA 1SIIA 4FMBA 3HI7A 4IT7A 6STDA 1FGTA 2XSHB 3GZRA 1BRHA 5I97A 3LMLA 1IT7A 5CK6A 1B20A 5G1KA 3RNTA 1ASKA 4HJLB 1OF5A 2XR8B 3PZWA 1Q40A 1NNVA 1BRGA 1DMMA 1JN5B 1RRLA 2JQ5A 1RGHA 4I5QA 4IIAA 4WHAA 1UGIA 5LC7A 2W56B 2B24B 1IT8A 3EBTA 3NX0A 5IEPA 3CCU3 1S723 1UGHI 3V99A 1VQO3 2E2VA 2GEYA 4HKVB 3T8NA 4BU4A 2KF3A 1T3BA 1FZUA 4HOHA 1FUWA 2KRTA 3KSED 3I553 3WR2A 4MMXB 1KWIA 4HAAA 4EC6A 1PFPA 4K90B 1N9JA 4AKZA 1K734 3F40A 3EX9A 3SX1A 4BTWA 1X1UA 4XM4A 4R80A 4DKIA 3F9SA 4N6UA 4XDWA 1AVKA 3VGNA 1DETA 3DGNA 1T5YA 2JDIH 1VQ53 1LOYA 1ZO2A 1O7GB 2BO9B 5G1LA 1UUVB 7GSPA 1RGEA 1QMAA 1TIJA 3GAXA 3PCRA 1W4NA 5CXOA 3ZFZA 1UCKA 3K0ZA 4AKYA 4HM3B 1GY7A 2P09A 6GSPA 1C7HA 2P05A 1Q7HA 1MNLA 1QALA 2KF6A 1RDSA 3VSYA 1A2PA 3JVCA 3I0YA 2BMQB 1DVCA 2HMNB 3NBBA 4H61A 1STFI 3SLUA 5CF1A 1DMNA 1W2B2 4GHOA 5BVBA 3AGNA 4KFEA 3MWZA 1GD4A 1HZ1A 3D3LA 1RNTA 5AYSC 3CC23 1IYYA 3URPA 1IU7A 3LTBA 4HM8B 1FA3A 2CG0A 3CNMA 1FGQA 3RGRA 2OQEC 3SOYA 3BIRA 5KP3A 3DGYA 2CWTA 1M1K4 1FGOA 4H3UA 5AEUB 1PYLA 5EQLA 1SQWA 4LYLB 4N6OB 4STDA 1CYUA 2D42A 1BSDA 2XSOB 5FGOA 3OWUA 1RCLA 3DGMA 2KF5A 4HM7B 3GSPA 4J9AA 2WGOA 4N6LA 5HOHA 1AR0A 5IEOA 3WDGB 1T2IA 2BT3A 2P0MA 4BIRA 1ISKA 3CU3A 3MYTA 3S28A 3SXXA 5D81A 1C54A 4MJDA 1RGCA 1M9GA 4N6NB 1VQL3 8CHOA 3CPW2 3CCV3 3FLJA 3CCS3 3H51A 3CD63 3G8ZA 3CCJ3 1YI23 5ELJA 1BVIA 4N6MA 4R4KA 1ZS7A 1BNGA 2UGIA 3LT9A 4O2HA 4NREA 3NBRA 1EQKA 4XBYA 3FG4A 1LQMB 1GY6A 1GY5A 1O7MB 1A67A 2L4VA 1JKGA 1UCJA 3PCSA 3KCHA 2W2CA 5AIFA 1BAOA 3ROBA 1W01A 1J2BA 4EXRA 3TDGA 2CFLA 3U1WA 1MWRA 1IVVA 1SPUA 1VQK3 3KIIA 3MG2A 2RFRA 3QK9A 1BSAA 1FGRA 2GU1A 4N6TA 5CLKA 1RGFA 3NXJA 1N8QA 4LSOA 1RGKA 1LOWA 2WOHA 3AMOA 3AHWA 4CCVA 1VQ43 1Q814 5AI1A 1M1XB 2HMLB 1B2XA 1CYVA 1Q9EA 4BL3A 3LTCA 2ZL8A 5D82A 1A2KA 2E2TA 3CXC2 1OHPA 2CX0A 2GXFA 3K63A 3KSPA 3MKIA 1OGZA 2F86B 3D5GA 4CJNA 4BTYA 5KP4A 1BRNL 1VQQA 1ULIB 4LZIA 1GMRA 4XBTA 3U97A 1RN1A 1NJI4 3NV0A 3Q90A 3JUNA 4EYCA 1IVWA 3LZAA 1GOYA 2CFWA 3IPTA 4FMDA 1X1XA 1KQS2 2OWPA 2XF3A 2ML5A 3V98A 5DRVA 1BU4A 2BIRA 3IJEB 3MG3A 2W9QA 2STDA 1BRJA 1NB5I 3MSOA 3FZWA 1GOUA 5GSPA 3O8YA 1IVXA 5IG5A 1YIJ3 1CH0A 1E97A 1QAFA 4OVMA 1O7NB 1S5AA 4R9KA 1DVDA 3F7XA 3FCSB 3X3YA 3JUOA 1YJ93 1SIHA 1Q42A 1BNIA 1V57A 3B7CA 3LXUX 4Q53A 2R41A 1B3SA 2OOVC 2K3DA 1RSNA 1Q7Y4 2MC8A 1QVG2 1GMQA 1NB3I 3RDEA 4X2OA 2IY2A 3Q1CA 2CG1A 3CC73 3EHCA 3HIGA 3DMCA 2MF7A 1HYFA 2Y74A 3LTDA 3N8BA 3WHOA 1LOVA 3GZYB 4EV2A 1VQ93 4MMYB 1SJWA 4K61A 1K41A 5IERA 3ALAA 5JPUA 1B2MA 3GWRA 4KFFA 3K7CA 4X2HA 4AEQA 2GU3A 1OACA 2D1WA 1K9M4 3KZTA 4NHFA 5FW5A 1LNIA 3B4PA 1TRQA 2XH9A 5IG4A 1QAKA 3X40A 1Q864 3KFQC 3PXMA 4WYKA 1RN7A 1TP6A 4J5KA 1JRQA 1EG9B 1LOXA 1BSCA 2ZDJA 3X42A 3ZG0A 2F4YA 1PY3A 2OTJ3 4GB5A 3KKGA 3EBYA 3X3XA 3RGAA 5AEWB 1BSBA 3SVAA 1YJN3 1OCVA 4TX4A 1TFKA 2BU4A 4U13A 2AADA 2QIYA 1G02A 4HM1B 1BANA 1UCIA 1AVLA 3DZLA 2C10A 1V74A 1FUTA 2P38A 4HZBB 3FKAA 4ORLA 2FXTA 2Z7AA 4MEIA 1TJDA 1WQLB 2XGNA 3CCL3 1W6CA 3CNXA 3LT8A 4HZ9B 1DMQA 3GZXB 2XGLA 2B1XB 2CFKA 4PEJA 3D79A 3DUKA 3S5CA 3NQYA 1I2GA 1JN5A 2W0QA 4QWTA 3T0UA 5BXQA 1DE3A 3F8XA 4J8TA 4ILFA 3LH4A 3QRDA 2W56A 1CQSA 1L5GB 5BU4A 1STDA 3G0KA 4FMCA 3CC43 3CCQ3 2W03A 3KN4A 1BNJA 4O3VA 5STDA 4WP5A 1NU3A 1KD14 2H0HA 3EQQB 4KT3B 1RRHA 1NO3A 2A15A 3FGYA 1G0TA 3B8LA 3NHXA 2IUJA 1R4CA 1IVUA 3JUQA 1IQXA 1HKXA 1UDII 1W5ZA 3LTAA 1JZOA 1OPYA 3MHEA 4HM0B 5EVHA 3UB1A 3DY5A 5ELUA 3S27A 4FCJA 3SEDA 3WODG 3MG1A 1BOXA 1I2EA 3SYUA 4EW5A 1FGMA 5JBSA 2HMKB 2WOFA 1OHSA 1QJGA 4JRFA 1RGAA 1VQ83 1EEJA 2H0IA 4K1VA 1WTHA 3FG3A 4RBNA 2F98A 4CPKA 1RTUA 3CMA3 1N8R4 3K5TA 1UI8A 4HM6B 2YFIB 5LC6A 2CX1A 1OUNA 4FR9A 1LNHA 1WNHA 4GSPA 1RNBA 4XB5A 2BNGA 1AY7A 5M19A 2XEPA 1IK3A 2INXA 4OK0A 1MOLA 1YJW3 2SARA 3CCM3 1U5OA 1X1WA 1VQN3 1I3FA 1OF5B 3H3HA 2RBIA 5AIHA 1RMSA 2CFGA 2C11A 4HM4B 5TGNA 1Q40B 3A5EA 1MWTA 1MWUA 3HK4A 3EE1A 3HZPA 1E3VA 1V58A 2Z76A 2AAEA 2HMMB 2XFSA 3WA3A 1M904 1IV9A 2QGUA 4R9LA 3A76A 1B27A 1CEWI 3OV4A 1BRIA 1D6YA 4KZ1A 2UUGC 3HIIA 2Z77A 3OWYA 4BL2A 4J5GA 3HX8A 2OQEA 3CME3 1LVNA 4K1UA 4G1MB 1BNFA 3PGBA 5IF6A 5RNTA 1N5HA 1RKYA 1ROVA 1AQZA 3JUMA 3GZBA 1I3IA 4HM5B 3BNBA 2RCDA 1RCKA 2BMOB 3NM7A 5HGRA 5IW9A 4O02B 1JB2A 1JB4A 7RNTA 3M8CA 1IQYA 1GYBA 1B21A 3DXOA 1BNEA 1D6UA 4MMZB 2QA43 2V1LA 1TUHA 1R4YA 1GS3A 1US1A 2E2UA 3BNCA 1BRKA 5AIGA 5IG0A 2CKFB 2M7OA 3F14A 3I563 1JV2B 3IMAB 2P0XA 2Z6BA 6RNTA 3G713 5A0OB 1VQP3 1YGWA 2KF4A 3UL6A 1IV7A 3UL5A 2YFLB 2SBLA 1ZX2A 1OGXA 5AIIA 1B2UA 2BMRB 4WFOA 1JZDA 2W04A 1W2ZA 5M18A 1K8A4 1YVSA 1W00A 2WGQA 3N9HA 3V92A 1W7CA 1UUWB 2KXGA 4L8OA 4LEHA 2CC3A 2UX0A 1FW7A 3OXAA 1LQGC 3FG1A 2YX9A 3D4AA 5AYRB 4LGQA 4KFDA 1TU5A 3X41A 3ER7A 3F8HA 1BSEA 2CIUA 1FUSA 5BIRA 3NUVA 1YHQ3 1W02A 4JF8A 3NBJA 1W6YA 1O7PB 3FF2A 5D83A 4GL6A 1I8VA 2O3OA 3BNEA 1X1YA 3DGOA 5CF2A 3S29A 3GRDA 1GOVA 1OH0A 3S67A 1BNRA 1JBRA 1I70A 4HBRA 1TFOA 2LQVA 3Q2PA 1LXEA 1MGRA 1G96A 3CPOA 3STDA 1EKMA 2ML6A 2Q07A 1I0VA 5KP1A 8RNTA 3OW22 3EJVA 1GSPA 3BNDA 3LOYA 3N54B 3G4S3 3D9RA 2GBWB 1N9EA 2IUKA 1W6GA 3DM8A 4FCMA 3B4OA 7STDA 2FGTA 1JB5A 1O7WB 2HOHA 2CWVA 2C4BA 3UNLA 1WMOA 1JKGB 2OTL3 4NPBA 1N5PA 2F5MA 2W9PA 5IG3A 3WOFB 2CK3H 1WMPA 2K54A 3EB8A 1Q824 1ZGXA 3NM2A 3WOEB 4XBXA 2R4IA 1T2HA 4O8SA 4BTXA 1EA2A 2J8XB 1DYUA 1JNQA 2CWUA 4XDVA 1VQM3 2OOVA 3DGLA 3L0RA 5G2GA 3JUPA 3PYJA 1I2FA 2PZVA 3AMOB 2OCTA 5M1AA 2CFDA 3BU4A 3NQZA 1PU4A 2BHMA 1ROAA 2RGQA 3BLZA 4RNTA 1JBSA 1BRSA 2RNTA 1BNSA 2W6JH 2Y73A 1A2VA 3FF0A 3OX9A 3OWSA 4HVNA 4LMIA 5IENA 1ULJB 2RSXA 3ZG5A 3NV0B 3MPHA 2IMJA 1Y4KA 2FNQA 1MWSA 3G16A 1BUJA 4RNYA 4CDLA 3T8UA 5DREA 2KCDA 1O7HB 1SARA 1TRPA 4RZMA 1D6ZA 3DH2A 1FYSA 1Z1SA 1RJOA 2LYXA 1BGSA 2XFTA 3F7SA 1NDOB 2CH9A 1UUGB 2GEXA 3AGOA 1LRAA 1U8CB 3EC9A 1VQ63 3BB9A 1YNVX 1NWWA 3UJMA 1QVF2 2O9UX 1JBTA 1UI7A 3ECFA 3EN1B 3G6E3 1YGEA 4N3VA 2ZHXB 1GD3A 4OUQA 1JJ22 2IA7A 3PS8A 9RNTA 1AV4A 1I0XA 2CW9A 3FH1A 4KVHA 1IQ8A 1IDPA 2PNCA 3EF8A 2HMJB 5JPPA 3D5IA 1WMNA 1RHLA 1KSIA 2F5WA 2F56A 5EEOA 4FCZA 3AHSA 3CCE3 2XRXB 1RGGA 2HMOB 1A90A 2F99A 3X3ZA 1BIRA 4R1KA 2CHCA 4HYZA 1VZZA 4HM2B 1B2SA 1EUIC 2IYJA 3LYGA 1RGLA 1RLSA 2ZA4A 2L1SA 2K0MA
chains in the Genus database with same CATH topology
4FMAA 2WO0A 1KC84 1YIT3 4N6V0 1VQ73 4WYKB 4IPBA 3WMDA 1K28A 4EV5A 1E3RA 3EN8A 4I4KA 1UW1A 4RNZA 3VF1A 3J7Yd 2QEX3 1OHOA 2GBXB 3KE7A 2YFJB 1YVBI 3FSDA 4L8PA 3SOAA 4ZM8A 3K9MC 4EBGA 1BUQA 1F8NA 1HU9A 3E99A 2I9WA 3WA2X 4WWUC 3CCR3 4L7KA 1SIIA 4FMBA 3HI7A 4IT7A 6STDA 1FGTA 2XSHB 3GZRA 5I97A 3LMLA 1IT7A 5CK6A 1ASKA 4HJLB 1OF5A 2XR8B 3PZWA 1Q40A 1RRLA 1DMMA 1JN5B 2JQ5A 4IIAA 4WHAA 5LC7A 2W56B 2B24B 1IT8A 3EBTA 3NX0A 5IEPA 3CCU3 1S723 3V99A 1VQO3 2E2VA 2GEYA 4HKVB 3T8NA 1FUWA 2KRTA 3KSED 3I553 4MMXB 1KWIA 4EC6A 1PFPA 4K90B 1N9JA 4AKZA 1K734 3F40A 3EX9A 3SX1A 4BTWA 4XM4A 4R80A 3F9SA 4N6UA 4XDWA 1AVKA 3VGNA 3DGNA 1T5YA 2JDIH 1VQ53 1ZO2A 1O7GB 2BO9B 1UUVB 3GAXA 1QMAA 1TIJA 3PCRA 1W4NA 5CXOA 3K0ZA 4AKYA 4HM3B 1GY7A 2P09A 1C7HA 2P05A 1QALA 1MNLA 3VSYA 3JVCA 3I0YA 2BMQB 1DVCA 2HMNB 3NBBA 4H61A 1STFI 3SLUA 5CF1A 1DMNA 1W2B2 5BVBA 4KFEA 3MWZA 1GD4A 3D3LA 5AYSC 3CC23 1IU7A 3LTBA 4HM8B 1FA3A 2CG0A 3CNMA 1FGQA 3RGRA 2OQEC 3SOYA 5KP3A 2CWTA 1M1K4 1FGOA 4H3UA 5AEUB 5EQLA 1SQWA 4N6OB 4STDA 1CYUA 2D42A 2XSOB 5FGOA 3OWUA 3DGMA 4HM7B 4J9AA 4N6LA 2WGOA 1AR0A 5IEOA 3WDGB 2BT3A 2P0MA 1ISKA 3CU3A 3MYTA 3S28A 3SXXA 5D81A 4MJDA 1M9GA 4N6NB 1VQL3 8CHOA 3CPW2 3CCV3 3FLJA 3CCS3 3H51A 3CD63 3G8ZA 3CCJ3 1YI23 5ELJA 4N6MA 4R4KA 4NREA 3LT9A 4O2HA 3NBRA 1EQKA 4XBYA 3FG4A 1A67A 1GY6A 1GY5A 1O7MB 2L4VA 1JKGA 3PCSA 2W2CA 5AIFA 3ROBA 1W01A 1J2BA 4EXRA 3TDGA 2CFLA 3U1WA 1VQK3 1IVVA 1SPUA 3KIIA 3MG2A 2RFRA 3QK9A 1FGRA 2GU1A 4N6TA 5CLKA 3NXJA 1N8QA 4LSOA 3AMOA 2WOHA 4CCVA 1VQ43 5AI1A 1M1XB 2HMLB 1CYVA 3LTCA 2ZL8A 5D82A 1A2KA 2E2TA 3CXC2 1OHPA 2GXFA 3KSPA 3K63A 3MKIA 1OGZA 2F86B 4BTYA 5KP4A 1ULIB 4LZIA 4XBTA 3U97A 1NJI4 3NV0A 3Q90A 3JUNA 4EYCA 1IVWA 3LZAA 2CFWA 3IPTA 4FMDA 1KQS2 2OWPA 2XF3A 2ML5A 3V98A 5DRVA 3IJEB 3MG3A 2W9QA 2STDA 1NB5I 3MSOA 3FZWA 3O8YA 1IVXA 5IG5A 1YIJ3 4OVMA 1E97A 1QAFA 1O7NB 1S5AA 4R9KA 1DVDA 3F7XA 3FCSB 3X3YA 3JUOA 1YJ93 1SIHA 1Q42A 3B7CA 4Q53A 3LXUX 2OOVC 1Q7Y4 2MC8A 1QVG2 1NB3I 3RDEA 4X2OA 3Q1CA 2CG1A 3CC73 3EHCA 3HIGA 3DMCA 2MF7A 2Y74A 3LTDA 3N8BA 3GZYB 4EV2A 1VQ93 4MMYB 1SJWA 4K61A 1K41A 5IERA 3ALAA 5JPUA 3GWRA 4KFFA 3K7CA 4X2HA 4AEQA 2GU3A 1OACA 2D1WA 1K9M4 3KZTA 4NHFA 5FW5A 3B4PA 5IG4A 2XH9A 1Q864 1QAKA 3X40A 3KFQC 3PXMA 4WYKA 1RN7A 1TP6A 1JRQA 1EG9B 1LOXA 2ZDJA 3X42A 2OTJ3 4GB5A 3KKGA 3EBYA 3X3XA 3RGAA 5AEWB 3SVAA 1YJN3 1OCVA 1TFKA 4U13A 2QIYA 4HM1B 1AVLA 3DZLA 2C10A 1V74A 2P38A 4HZBB 3FKAA 4ORLA 2FXTA 2Z7AA 4MEIA 1WQLB 2XGNA 3CCL3 1W6CA 3CNXA 3LT8A 4HZ9B 1DMQA 3GZXB 2XGLA 2B1XB 2CFKA 4PEJA 3DUKA 3S5CA 3NQYA 4QWTA 1JN5A 2W0QA 3T0UA 5BXQA 3F8XA 4J8TA 3LH4A 3QRDA 2W56A 1CQSA 1L5GB 1STDA 3G0KA 4FMCA 3CC43 3CCQ3 2W03A 3KN4A 4O3VA 5STDA 4WP5A 1NU3A 1KD14 3EQQB 1RRHA 1NO3A 2A15A 3FGYA 3B8LA 3NHXA 2IUJA 1R4CA 1IVUA 3JUQA 1IQXA 1HKXA 3LTAA 1W5ZA 3MHEA 4HM0B 1OPYA 5EVHA 3G4S3 3UB1A 3DY5A 5ELUA 3S27A 4FCJA 3SEDA 3WODG 3MG1A 1FGMA 5JBSA 2HMKB 2WOFA 1OHSA 1QJGA 4JRFA 1VQ83 4K1VA 1WTHA 3FG3A 4RBNA 2F98A 3CMA3 1N8R4 3K5TA 1UI8A 4HM6B 2YFIB 5LC6A 1OUNA 4FR9A 1LNHA 1WNHA 4XB5A 2BNGA 2XEPA 1IK3A 2INXA 4OK0A 1MOLA 1YJW3 3CCM3 1U5OA 1VQN3 1OF5B 3H3HA 5AIHA 5TGNA 2CFGA 2C11A 4HM4B 1Q40B 3HK4A 3EE1A 3HZPA 1E3VA 2Z76A 3WA3A 2HMMB 2XFSA 1M904 1IV9A 2QGUA 4R9LA 3A76A 1CEWI 3OV4A 1D6YA 4KZ1A 3HIIA 2Z77A 3OWYA 3CME3 3HX8A 2OQEA 1LVNA 4K1UA 4G1MB 3PGBA 5IF6A 1N5HA 1RKYA 1ROVA 3JUMA 3GZBA 4HM5B 3BNBA 2RCDA 2BMOB 3NM7A 5HGRA 5IW9A 4O02B 1JB2A 1JB4A 3M8CA 1IQYA 1GYBA 3DXOA 4MMZB 2QA43 1D6UA 2V1LA 1TUHA 1GS3A 1US1A 2E2UA 3BNCA 5AIGA 5IG0A 2CKFB 2M7OA 3F14A 3I563 1JV2B 3IMAB 2P0XA 2Z6BA 3G713 5A0OB 3UL6A 1IV7A 3UL5A 2YFLB 2SBLA 1ZX2A 1OGXA 5AIIA 2BMRB 4WFOA 2W04A 1W2ZA 1K8A4 1W00A 2WGQA 3N9HA 3V92A 1W7CA 1UUWB 2KXGA 4L8OA 4LEHA 2CC3A 2UX0A 3OXAA 3FG1A 1TU5A 2YX9A 5AYRB 1Q814 4LGQA 4KFDA 3X41A 3ER7A 3F8HA 2CIUA 3NUVA 1YHQ3 1W02A 4JF8A 3NBJA 1W6YA 1O7PB 3FF2A 5D83A 4GL6A 5CF2A 2O3OA 3BNEA 3DGOA 1VQP3 3S29A 3GRDA 1OH0A 3S67A 4HBRA 1TFOA 2LQVA 3Q2PA 1LXEA 1G96A 3CPOA 3STDA 1EKMA 2ML6A 2Q07A 5KP1A 3OW22 3EJVA 3BNDA 3LOYA 3N54B 3D9RA 2GBWB 1N9EA 2IUKA 1W6GA 3DM8A 4FCMA 3B4OA 7STDA 2FGTA 1JB5A 1O7WB 2CWVA 3UNLA 1WMOA 1JKGB 2OTL3 5IG3A 1N5PA 2W9PA 3WOFB 2CK3H 1WMPA 2K54A 3EB8A 1Q824 3NM2A 3WOEB 4XBXA 2R4IA 4O8SA 4BTXA 1EA2A 1VQM3 1DYUA 1JNQA 2CWUA 4XDVA 2OOVA 3DGLA 3L0RA 5G2GA 3JUPA 3PYJA 2PZVA 3AMOB 2OCTA 2CFDA 3NQZA 1PU4A 2BHMA 1ROAA 2RGQA 3BLZA 2W6JH 3FF0A 2Y73A 3OWSA 1A2VA 3OX9A 4HVNA 4LMIA 5IENA 1ULJB 2RSXA 3NV0B 3MPHA 2IMJA 1Y4KA 2FNQA 3G16A 4RNYA 4CDLA 3T8UA 5DREA 2KCDA 1O7HB 4RZMA 4TX4A 1D6ZA 2LYXA 1Z1SA 1RJOA 2XFTA 3F7SA 1NDOB 2CH9A 2GEXA 1U8CB 3EC9A 1VQ63 3BB9A 1NWWA 3UJMA 1QVF2 2O9UX 1UI7A 3ECFA 3EN1B 3G6E3 1YGEA 4N3VA 4OUQA 1GD3A 1JJ22 2IA7A 3PS8A 1AV4A 2CW9A 3FH1A 4KVHA 1IQ8A 1IDPA 2PNCA 3EF8A 2HMJB 5JPPA 1WMNA 1KSIA 5EEOA 4FCZA 3CCE3 2XRXB 2HMOB 1A90A 2F99A 3X3ZA 4R1KA 2CHCA 4HYZA 1VZZA 4HM2B 3LYGA 2K0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6V 0;  2KXG A;  5ELJ A;  4N6M A;  1EQK A;  1A67 A;  3LH4 A;  3QRD A;  1YVB I;  3S67 A;  4ZM8 A;  3K9M C;  3Q2P A;  1LXE A;  1G96 A;  4N6T A;  4IT7 A;  4CCV A;  1R4C A;  1CYV A;  5ELU A;  5LC7 A;  3NX0 A;  4LZI A;  1N5P A;  2W9P A;  5LC6 A;  4EYC A;  1FUW A;  1WNH A;  3KSE D;  3L0R A;  1KWI A;  3PYJ A;  1MOL A;  1PFP A;  2OCT A;  1N9J A;  2W9Q A;  1NB5 I;  1ROA A;  4N6U A;  1DVD A;  2BO9 B;  3GAX A;  1IV9 A;  1TIJ A;  1CEW I;  1NB3 I;  1MNL A;  1DVC A;  4TX4 A;  1STF I;  1N5H A;  2CH9 A;  3MWZ A;  1GD4 A;  2O9U X;  1FA3 A;  1GD3 A;  3PS8 A;  3KFQ C;  3PXM A;  1RN7 A;  5EQL A;  4N6O B;  1CYU A;  3IMA B;  3SVA A;  4N6L A;  1A90 A;  5A0O B;  3UL6 A;  1IV7 A;  3UL5 A;  1M9G A;  4N6N B; 
#chains in the Genus database with same CATH topology
 4FMA A;  2GSP A;  2KAA A;  2WO0 A;  1KC8 4;  1YIT 3;  4N6V 0;  1VQ7 3;  4WYK B;  4IPB A;  1RN4 A;  1GMP A;  1K28 A;  3WMD A;  4EV5 A;  1MGW A;  1E3R A;  3EN8 A;  4I4K A;  1UW1 A;  4RNZ A;  3HOH A;  3VF1 A;  3J7Y d;  2QEX 3;  1OHO A;  2GBX B;  3KE7 A;  2YFJ B;  1UCL A;  1YVB I;  3FSD A;  4L8P A;  3SOA A;  1TTO A;  4ZM8 A;  3K9M C;  4EBG A;  2H0G A;  3Q3F A;  1BUQ A;  1F8N A;  1B2Z A;  1HU9 A;  2I9W A;  3E99 A;  3WA2 X;  4WWU C;  3CCR 3;  4L7K A;  1SII A;  4FMB A;  3HI7 A;  4IT7 A;  6STD A;  1FGT A;  2XSH B;  3GZR A;  1BRH A;  5I97 A;  3LML A;  1IT7 A;  5CK6 A;  1B20 A;  5G1K A;  3RNT A;  1ASK A;  4HJL B;  1OF5 A;  2XR8 B;  3PZW A;  1Q40 A;  1NNV A;  1BRG A;  1DMM A;  1JN5 B;  1RRL A;  2JQ5 A;  1RGH A;  4I5Q A;  4IIA A;  4WHA A;  1UGI A;  5LC7 A;  2W56 B;  2B24 B;  1IT8 A;  3EBT A;  3NX0 A;  5IEP A;  3CCU 3;  1S72 3;  1UGH I;  3V99 A;  1VQO 3;  2E2V A;  2GEY A;  4HKV B;  3T8N A;  4BU4 A;  2KF3 A;  1T3B A;  1FZU A;  4HOH A;  1FUW A;  2KRT A;  3KSE D;  3I55 3;  3WR2 A;  4MMX B;  1KWI A;  4HAA A;  4EC6 A;  1PFP A;  4K90 B;  1N9J A;  4AKZ A;  1K73 4;  3F40 A;  3EX9 A;  3SX1 A;  4BTW A;  1X1U A;  4XM4 A;  4R80 A;  4DKI A;  3F9S A;  4N6U A;  4XDW A;  1AVK A;  3VGN A;  1DET A;  3DGN A;  1T5Y A;  2JDI H;  1VQ5 3;  1LOY A;  1ZO2 A;  1O7G B;  2BO9 B;  5G1L A;  1UUV B;  7GSP A;  1RGE A;  1QMA A;  1TIJ A;  3GAX A;  3PCR A;  1W4N A;  5CXO A;  3ZFZ A;  1UCK A;  3K0Z A;  4AKY A;  4HM3 B;  1GY7 A;  2P09 A;  6GSP A;  1C7H A;  2P05 A;  1Q7H A;  1MNL A;  1QAL A;  2KF6 A;  1RDS A;  3VSY A;  1A2P A;  3JVC A;  3I0Y A;  2BMQ B;  1DVC A;  2HMN B;  3NBB A;  4H61 A;  1STF I;  3SLU A;  5CF1 A;  1DMN A;  1W2B 2;  4GHO A;  5BVB A;  3AGN A;  4KFE A;  3MWZ A;  1GD4 A;  1HZ1 A;  3D3L A;  1RNT A;  5AYS C;  3CC2 3;  1IYY A;  3URP A;  1IU7 A;  3LTB A;  4HM8 B;  1FA3 A;  2CG0 A;  3CNM A;  1FGQ A;  3RGR A;  2OQE C;  3SOY A;  3BIR A;  5KP3 A;  3DGY A;  2CWT A;  1M1K 4;  1FGO A;  4H3U A;  5AEU B;  1PYL A;  5EQL A;  1SQW A;  4LYL B;  4N6O B;  4STD A;  1CYU A;  2D42 A;  1BSD A;  2XSO B;  5FGO A;  3OWU A;  1RCL A;  3DGM A;  2KF5 A;  4HM7 B;  3GSP A;  4J9A A;  2WGO A;  4N6L A;  5HOH A;  1AR0 A;  5IEO A;  3WDG B;  1T2I A;  2BT3 A;  2P0M A;  4BIR A;  1ISK A;  3CU3 A;  3MYT A;  3S28 A;  3SXX A;  5D81 A;  1C54 A;  4MJD A;  1RGC A;  1M9G A;  4N6N B;  1VQL 3;  8CHO A;  3CPW 2;  3CCV 3;  3FLJ A;  3CCS 3;  3H51 A;  3CD6 3;  3G8Z A;  3CCJ 3;  1YI2 3;  5ELJ A;  1BVI A;  4N6M A;  4R4K A;  1ZS7 A;  1BNG A;  2UGI A;  3LT9 A;  4O2H A;  4NRE A;  3NBR A;  1EQK A;  4XBY A;  3FG4 A;  1LQM B;  1GY6 A;  1GY5 A;  1O7M B;  1A67 A;  2L4V A;  1JKG A;  1UCJ A;  3PCS A;  3KCH A;  2W2C A;  5AIF A;  1BAO A;  3ROB A;  1W01 A;  1J2B A;  4EXR A;  3TDG A;  2CFL A;  3U1W A;  1MWR A;  1IVV A;  1SPU A;  1VQK 3;  3KII A;  3MG2 A;  2RFR A;  3QK9 A;  1BSA A;  1FGR A;  2GU1 A;  4N6T A;  5CLK A;  1RGF A;  3NXJ A;  1N8Q A;  4LSO A;  1RGK A;  1LOW A;  2WOH A;  3AMO A;  3AHW A;  4CCV A;  1VQ4 3;  1Q81 4;  5AI1 A;  1M1X B;  2HML B;  1B2X A;  1CYV A;  1Q9E A;  4BL3 A;  3LTC A;  2ZL8 A;  5D82 A;  1A2K A;  2E2T A;  3CXC 2;  1OHP A;  2CX0 A;  2GXF A;  3K63 A;  3KSP A;  3MKI A;  1OGZ A;  2F86 B;  3D5G A;  4CJN A;  4BTY A;  5KP4 A;  1BRN L;  1VQQ A;  1ULI B;  4LZI A;  1GMR A;  4XBT A;  3U97 A;  1RN1 A;  1NJI 4;  3NV0 A;  3Q90 A;  3JUN A;  4EYC A;  1IVW A;  3LZA A;  1GOY A;  2CFW A;  3IPT A;  4FMD A;  1X1X A;  1KQS 2;  2OWP A;  2XF3 A;  2ML5 A;  3V98 A;  5DRV A;  1BU4 A;  2BIR A;  3IJE B;  3MG3 A;  2W9Q A;  2STD A;  1BRJ A;  1NB5 I;  3MSO A;  3FZW A;  1GOU A;  5GSP A;  3O8Y A;  1IVX A;  5IG5 A;  1YIJ 3;  1CH0 A;  1E97 A;  1QAF A;  4OVM A;  1O7N B;  1S5A A;  4R9K A;  1DVD A;  3F7X A;  3FCS B;  3X3Y A;  3JUO A;  1YJ9 3;  1SIH A;  1Q42 A;  1BNI A;  1V57 A;  3B7C A;  3LXU X;  4Q53 A;  2R41 A;  1B3S A;  2OOV C;  2K3D A;  1RSN A;  1Q7Y 4;  2MC8 A;  1QVG 2;  1GMQ A;  1NB3 I;  3RDE A;  4X2O A;  2IY2 A;  3Q1C A;  2CG1 A;  3CC7 3;  3EHC A;  3HIG A;  3DMC A;  2MF7 A;  1HYF A;  2Y74 A;  3LTD A;  3N8B A;  3WHO A;  1LOV A;  3GZY B;  4EV2 A;  1VQ9 3;  4MMY B;  1SJW A;  4K61 A;  1K41 A;  5IER A;  3ALA A;  5JPU A;  1B2M A;  3GWR A;  4KFF A;  3K7C A;  4X2H A;  4AEQ A;  2GU3 A;  1OAC A;  2D1W A;  1K9M 4;  3KZT A;  4NHF A;  5FW5 A;  1LNI A;  3B4P A;  1TRQ A;  2XH9 A;  5IG4 A;  1QAK A;  3X40 A;  1Q86 4;  3KFQ C;  3PXM A;  4WYK A;  1RN7 A;  1TP6 A;  4J5K A;  1JRQ A;  1EG9 B;  1LOX A;  1BSC A;  2ZDJ A;  3X42 A;  3ZG0 A;  2F4Y A;  1PY3 A;  2OTJ 3;  4GB5 A;  3KKG A;  3EBY A;  3X3X A;  3RGA A;  5AEW B;  1BSB A;  3SVA A;  1YJN 3;  1OCV A;  4TX4 A;  1TFK A;  2BU4 A;  4U13 A;  2AAD A;  2QIY A;  1G02 A;  4HM1 B;  1BAN A;  1UCI A;  1AVL A;  3DZL A;  2C10 A;  1V74 A;  1FUT A;  2P38 A;  4HZB B;  3FKA A;  4ORL A;  2FXT A;  2Z7A A;  4MEI A;  1TJD A;  1WQL B;  2XGN A;  3CCL 3;  1W6C A;  3CNX A;  3LT8 A;  4HZ9 B;  1DMQ A;  3GZX B;  2XGL A;  2B1X B;  2CFK A;  4PEJ A;  3D79 A;  3DUK A;  3S5C A;  3NQY A;  1I2G A;  1JN5 A;  2W0Q A;  4QWT A;  3T0U A;  5BXQ A;  1DE3 A;  3F8X A;  4J8T A;  4ILF A;  3LH4 A;  3QRD A;  2W56 A;  1CQS A;  1L5G B;  5BU4 A;  1STD A;  3G0K A;  4FMC A;  3CC4 3;  3CCQ 3;  2W03 A;  3KN4 A;  1BNJ A;  4O3V A;  5STD A;  4WP5 A;  1NU3 A;  1KD1 4;  2H0H A;  3EQQ B;  4KT3 B;  1RRH A;  1NO3 A;  2A15 A;  3FGY A;  1G0T A;  3B8L A;  3NHX A;  2IUJ A;  1R4C A;  1IVU A;  3JUQ A;  1IQX A;  1HKX A;  1UDI I;  1W5Z A;  3LTA A;  1JZO A;  1OPY A;  3MHE A;  4HM0 B;  5EVH A;  3UB1 A;  3DY5 A;  5ELU A;  3S27 A;  4FCJ A;  3SED A;  3WOD G;  3MG1 A;  1BOX A;  1I2E A;  3SYU A;  4EW5 A;  1FGM A;  5JBS A;  2HMK B;  2WOF A;  1OHS A;  1QJG A;  4JRF A;  1RGA A;  1VQ8 3;  1EEJ A;  2H0I A;  4K1V A;  1WTH A;  3FG3 A;  4RBN A;  2F98 A;  4CPK A;  1RTU A;  3CMA 3;  1N8R 4;  3K5T A;  1UI8 A;  4HM6 B;  2YFI B;  5LC6 A;  2CX1 A;  1OUN A;  4FR9 A;  1LNH A;  1WNH A;  4GSP A;  1RNB A;  4XB5 A;  2BNG A;  1AY7 A;  5M19 A;  2XEP A;  1IK3 A;  2INX A;  4OK0 A;  1MOL A;  1YJW 3;  2SAR A;  3CCM 3;  1U5O A;  1X1W A;  1VQN 3;  1I3F A;  1OF5 B;  3H3H A;  2RBI A;  5AIH A;  1RMS A;  2CFG A;  2C11 A;  4HM4 B;  5TGN A;  1Q40 B;  3A5E A;  1MWT A;  1MWU A;  3HK4 A;  3EE1 A;  3HZP A;  1E3V A;  1V58 A;  2Z76 A;  2AAE A;  2HMM B;  2XFS A;  3WA3 A;  1M90 4;  1IV9 A;  2QGU A;  4R9L A;  3A76 A;  1B27 A;  1CEW I;  3OV4 A;  1BRI A;  1D6Y A;  4KZ1 A;  2UUG C;  3HII A;  2Z77 A;  3OWY A;  4BL2 A;  4J5G A;  3HX8 A;  2OQE A;  3CME 3;  1LVN A;  4K1U A;  4G1M B;  1BNF A;  3PGB A;  5IF6 A;  5RNT A;  1N5H A;  1RKY A;  1ROV A;  1AQZ A;  3JUM A;  3GZB A;  1I3I A;  4HM5 B;  3BNB A;  2RCD A;  1RCK A;  2BMO B;  3NM7 A;  5HGR A;  5IW9 A;  4O02 B;  1JB2 A;  1JB4 A;  7RNT A;  3M8C A;  1IQY A;  1GYB A;  1B21 A;  3DXO A;  1BNE A;  1D6U A;  4MMZ B;  2QA4 3;  2V1L A;  1TUH A;  1R4Y A;  1GS3 A;  1US1 A;  2E2U A;  3BNC A;  1BRK A;  5AIG A;  5IG0 A;  2CKF B;  2M7O A;  3F14 A;  3I56 3;  1JV2 B;  3IMA B;  2P0X A;  2Z6B A;  6RNT A;  3G71 3;  5A0O B;  1VQP 3;  1YGW A;  2KF4 A;  3UL6 A;  1IV7 A;  3UL5 A;  2YFL B;  2SBL A;  1ZX2 A;  1OGX A;  5AII A;  1B2U A;  2BMR B;  4WFO A;  1JZD A;  2W04 A;  1W2Z A;  5M18 A;  1K8A 4;  1YVS A;  1W00 A;  2WGQ A;  3N9H A;  3V92 A;  1W7C A;  1UUW B;  2KXG A;  4L8O A;  4LEH A;  2CC3 A;  2UX0 A;  1FW7 A;  3OXA A;  1LQG C;  3FG1 A;  2YX9 A;  3D4A A;  5AYR B;  4LGQ A;  4KFD A;  1TU5 A;  3X41 A;  3ER7 A;  3F8H A;  1BSE A;  2CIU A;  1FUS A;  5BIR A;  3NUV A;  1YHQ 3;  1W02 A;  4JF8 A;  3NBJ A;  1W6Y A;  1O7P B;  3FF2 A;  5D83 A;  4GL6 A;  1I8V A;  2O3O A;  3BNE A;  1X1Y A;  3DGO A;  5CF2 A;  3S29 A;  3GRD A;  1GOV A;  1OH0 A;  3S67 A;  1BNR A;  1JBR A;  1I70 A;  4HBR A;  1TFO A;  2LQV A;  3Q2P A;  1LXE A;  1MGR A;  1G96 A;  3CPO A;  3STD A;  1EKM A;  2ML6 A;  2Q07 A;  1I0V A;  5KP1 A;  8RNT A;  3OW2 2;  3EJV A;  1GSP A;  3BND A;  3LOY A;  3N54 B;  3G4S 3;  3D9R A;  2GBW B;  1N9E A;  2IUK A;  1W6G A;  3DM8 A;  4FCM A;  3B4O A;  7STD A;  2FGT A;  1JB5 A;  1O7W B;  2HOH A;  2CWV A;  2C4B A;  3UNL A;  1WMO A;  1JKG B;  2OTL 3;  4NPB A;  1N5P A;  2F5M A;  2W9P A;  5IG3 A;  3WOF B;  2CK3 H;  1WMP A;  2K54 A;  3EB8 A;  1Q82 4;  1ZGX A;  3NM2 A;  3WOE B;  4XBX A;  2R4I A;  1T2H A;  4O8S A;  4BTX A;  1EA2 A;  2J8X B;  1DYU A;  1JNQ A;  2CWU A;  4XDV A;  1VQM 3;  2OOV A;  3DGL A;  3L0R A;  5G2G A;  3JUP A;  3PYJ A;  1I2F A;  2PZV A;  3AMO B;  2OCT A;  5M1A A;  2CFD A;  3BU4 A;  3NQZ A;  1PU4 A;  2BHM A;  1ROA A;  2RGQ A;  3BLZ A;  4RNT A;  1JBS A;  1BRS A;  2RNT A;  1BNS A;  2W6J H;  2Y73 A;  1A2V A;  3FF0 A;  3OX9 A;  3OWS A;  4HVN A;  4LMI A;  5IEN A;  1ULJ B;  2RSX A;  3ZG5 A;  3NV0 B;  3MPH A;  2IMJ A;  1Y4K A;  2FNQ A;  1MWS A;  3G16 A;  1BUJ A;  4RNY A;  4CDL A;  3T8U A;  5DRE A;  2KCD A;  1O7H B;  1SAR A;  1TRP A;  4RZM A;  1D6Z A;  3DH2 A;  1FYS A;  1Z1S A;  1RJO A;  2LYX A;  1BGS A;  2XFT A;  3F7S A;  1NDO B;  2CH9 A;  1UUG B;  2GEX A;  3AGO A;  1LRA A;  1U8C B;  3EC9 A;  1VQ6 3;  3BB9 A;  1YNV X;  1NWW A;  3UJM A;  1QVF 2;  2O9U X;  1JBT A;  1UI7 A;  3ECF A;  3EN1 B;  3G6E 3;  1YGE A;  4N3V A;  2ZHX B;  1GD3 A;  4OUQ A;  1JJ2 2;  2IA7 A;  3PS8 A;  9RNT A;  1AV4 A;  1I0X A;  2CW9 A;  3FH1 A;  4KVH A;  1IQ8 A;  1IDP A;  2PNC A;  3EF8 A;  2HMJ B;  5JPP A;  3D5I A;  1WMN A;  1RHL A;  1KSI A;  2F5W A;  2F56 A;  5EEO A;  4FCZ A;  3AHS A;  3CCE 3;  2XRX B;  1RGG A;  2HMO B;  1A90 A;  2F99 A;  3X3Z A;  1BIR A;  4R1K A;  2CHC A;  4HYZ A;  1VZZ A;  4HM2 B;  1B2S A;  1EUI C;  2IYJ A;  3LYG A;  1RGL A;  1RLS A;  2ZA4 A;  2L1S A;  2K0M A; 
#chains in the Genus database with same CATH homology
 4FMA A;  2WO0 A;  1KC8 4;  1YIT 3;  4N6V 0;  1VQ7 3;  4WYK B;  4IPB A;  3WMD A;  1K28 A;  4EV5 A;  1E3R A;  3EN8 A;  4I4K A;  1UW1 A;  4RNZ A;  3VF1 A;  3J7Y d;  2QEX 3;  1OHO A;  2GBX B;  3KE7 A;  2YFJ B;  1YVB I;  3FSD A;  4L8P A;  3SOA A;  4ZM8 A;  3K9M C;  4EBG A;  1BUQ A;  1F8N A;  1HU9 A;  3E99 A;  2I9W A;  3WA2 X;  4WWU C;  3CCR 3;  4L7K A;  1SII A;  4FMB A;  3HI7 A;  4IT7 A;  6STD A;  1FGT A;  2XSH B;  3GZR A;  5I97 A;  3LML A;  1IT7 A;  5CK6 A;  1ASK A;  4HJL B;  1OF5 A;  2XR8 B;  3PZW A;  1Q40 A;  1RRL A;  1DMM A;  1JN5 B;  2JQ5 A;  4IIA A;  4WHA A;  5LC7 A;  2W56 B;  2B24 B;  1IT8 A;  3EBT A;  3NX0 A;  5IEP A;  3CCU 3;  1S72 3;  3V99 A;  1VQO 3;  2E2V A;  2GEY A;  4HKV B;  3T8N A;  1FUW A;  2KRT A;  3KSE D;  3I55 3;  4MMX B;  1KWI A;  4EC6 A;  1PFP A;  4K90 B;  1N9J A;  4AKZ A;  1K73 4;  3F40 A;  3EX9 A;  3SX1 A;  4BTW A;  4XM4 A;  4R80 A;  3F9S A;  4N6U A;  4XDW A;  1AVK A;  3VGN A;  3DGN A;  1T5Y A;  2JDI H;  1VQ5 3;  1ZO2 A;  1O7G B;  2BO9 B;  1UUV B;  3GAX A;  1QMA A;  1TIJ A;  3PCR A;  1W4N A;  5CXO A;  3K0Z A;  4AKY A;  4HM3 B;  1GY7 A;  2P09 A;  1C7H A;  2P05 A;  1QAL A;  1MNL A;  3VSY A;  3JVC A;  3I0Y A;  2BMQ B;  1DVC A;  2HMN B;  3NBB A;  4H61 A;  1STF I;  3SLU A;  5CF1 A;  1DMN A;  1W2B 2;  5BVB A;  4KFE A;  3MWZ A;  1GD4 A;  3D3L A;  5AYS C;  3CC2 3;  1IU7 A;  3LTB A;  4HM8 B;  1FA3 A;  2CG0 A;  3CNM A;  1FGQ A;  3RGR A;  2OQE C;  3SOY A;  5KP3 A;  2CWT A;  1M1K 4;  1FGO A;  4H3U A;  5AEU B;  5EQL A;  1SQW A;  4N6O B;  4STD A;  1CYU A;  2D42 A;  2XSO B;  5FGO A;  3OWU A;  3DGM A;  4HM7 B;  4J9A A;  4N6L A;  2WGO A;  1AR0 A;  5IEO A;  3WDG B;  2BT3 A;  2P0M A;  1ISK A;  3CU3 A;  3MYT A;  3S28 A;  3SXX A;  5D81 A;  4MJD A;  1M9G A;  4N6N B;  1VQL 3;  8CHO A;  3CPW 2;  3CCV 3;  3FLJ A;  3CCS 3;  3H51 A;  3CD6 3;  3G8Z A;  3CCJ 3;  1YI2 3;  5ELJ A;  4N6M A;  4R4K A;  4NRE A;  3LT9 A;  4O2H A;  3NBR A;  1EQK A;  4XBY A;  3FG4 A;  1A67 A;  1GY6 A;  1GY5 A;  1O7M B;  2L4V A;  1JKG A;  3PCS A;  2W2C A;  5AIF A;  3ROB A;  1W01 A;  1J2B A;  4EXR A;  3TDG A;  2CFL A;  3U1W A;  1VQK 3;  1IVV A;  1SPU A;  3KII A;  3MG2 A;  2RFR A;  3QK9 A;  1FGR A;  2GU1 A;  4N6T A;  5CLK A;  3NXJ A;  1N8Q A;  4LSO A;  3AMO A;  2WOH A;  4CCV A;  1VQ4 3;  5AI1 A;  1M1X B;  2HML B;  1CYV A;  3LTC A;  2ZL8 A;  5D82 A;  1A2K A;  2E2T A;  3CXC 2;  1OHP A;  2GXF A;  3KSP A;  3K63 A;  3MKI A;  1OGZ A;  2F86 B;  4BTY A;  5KP4 A;  1ULI B;  4LZI A;  4XBT A;  3U97 A;  1NJI 4;  3NV0 A;  3Q90 A;  3JUN A;  4EYC A;  1IVW A;  3LZA A;  2CFW A;  3IPT A;  4FMD A;  1KQS 2;  2OWP A;  2XF3 A;  2ML5 A;  3V98 A;  5DRV A;  3IJE B;  3MG3 A;  2W9Q A;  2STD A;  1NB5 I;  3MSO A;  3FZW A;  3O8Y A;  1IVX A;  5IG5 A;  1YIJ 3;  4OVM A;  1E97 A;  1QAF A;  1O7N B;  1S5A A;  4R9K A;  1DVD A;  3F7X A;  3FCS B;  3X3Y A;  3JUO A;  1YJ9 3;  1SIH A;  1Q42 A;  3B7C A;  4Q53 A;  3LXU X;  2OOV C;  1Q7Y 4;  2MC8 A;  1QVG 2;  1NB3 I;  3RDE A;  4X2O A;  3Q1C A;  2CG1 A;  3CC7 3;  3EHC A;  3HIG A;  3DMC A;  2MF7 A;  2Y74 A;  3LTD A;  3N8B A;  3GZY B;  4EV2 A;  1VQ9 3;  4MMY B;  1SJW A;  4K61 A;  1K41 A;  5IER A;  3ALA A;  5JPU A;  3GWR A;  4KFF A;  3K7C A;  4X2H A;  4AEQ A;  2GU3 A;  1OAC A;  2D1W A;  1K9M 4;  3KZT A;  4NHF A;  5FW5 A;  3B4P A;  5IG4 A;  2XH9 A;  1Q86 4;  1QAK A;  3X40 A;  3KFQ C;  3PXM A;  4WYK A;  1RN7 A;  1TP6 A;  1JRQ A;  1EG9 B;  1LOX A;  2ZDJ A;  3X42 A;  2OTJ 3;  4GB5 A;  3KKG A;  3EBY A;  3X3X A;  3RGA A;  5AEW B;  3SVA A;  1YJN 3;  1OCV A;  1TFK A;  4U13 A;  2QIY A;  4HM1 B;  1AVL A;  3DZL A;  2C10 A;  1V74 A;  2P38 A;  4HZB B;  3FKA A;  4ORL A;  2FXT A;  2Z7A A;  4MEI A;  1WQL B;  2XGN A;  3CCL 3;  1W6C A;  3CNX A;  3LT8 A;  4HZ9 B;  1DMQ A;  3GZX B;  2XGL A;  2B1X B;  2CFK A;  4PEJ A;  3DUK A;  3S5C A;  3NQY A;  4QWT A;  1JN5 A;  2W0Q A;  3T0U A;  5BXQ A;  3F8X A;  4J8T A;  3LH4 A;  3QRD A;  2W56 A;  1CQS A;  1L5G B;  1STD A;  3G0K A;  4FMC A;  3CC4 3;  3CCQ 3;  2W03 A;  3KN4 A;  4O3V A;  5STD A;  4WP5 A;  1NU3 A;  1KD1 4;  3EQQ B;  1RRH A;  1NO3 A;  2A15 A;  3FGY A;  3B8L A;  3NHX A;  2IUJ A;  1R4C A;  1IVU A;  3JUQ A;  1IQX A;  1HKX A;  3LTA A;  1W5Z A;  3MHE A;  4HM0 B;  1OPY A;  5EVH A;  3G4S 3;  3UB1 A;  3DY5 A;  5ELU A;  3S27 A;  4FCJ A;  3SED A;  3WOD G;  3MG1 A;  1FGM A;  5JBS A;  2HMK B;  2WOF A;  1OHS A;  1QJG A;  4JRF A;  1VQ8 3;  4K1V A;  1WTH A;  3FG3 A;  4RBN A;  2F98 A;  3CMA 3;  1N8R 4;  3K5T A;  1UI8 A;  4HM6 B;  2YFI B;  5LC6 A;  1OUN A;  4FR9 A;  1LNH A;  1WNH A;  4XB5 A;  2BNG A;  2XEP A;  1IK3 A;  2INX A;  4OK0 A;  1MOL A;  1YJW 3;  3CCM 3;  1U5O A;  1VQN 3;  1OF5 B;  3H3H A;  5AIH A;  5TGN A;  2CFG A;  2C11 A;  4HM4 B;  1Q40 B;  3HK4 A;  3EE1 A;  3HZP A;  1E3V A;  2Z76 A;  3WA3 A;  2HMM B;  2XFS A;  1M90 4;  1IV9 A;  2QGU A;  4R9L A;  3A76 A;  1CEW I;  3OV4 A;  1D6Y A;  4KZ1 A;  3HII A;  2Z77 A;  3OWY A;  3CME 3;  3HX8 A;  2OQE A;  1LVN A;  4K1U A;  4G1M B;  3PGB A;  5IF6 A;  1N5H A;  1RKY A;  1ROV A;  3JUM A;  3GZB A;  4HM5 B;  3BNB A;  2RCD A;  2BMO B;  3NM7 A;  5HGR A;  5IW9 A;  4O02 B;  1JB2 A;  1JB4 A;  3M8C A;  1IQY A;  1GYB A;  3DXO A;  4MMZ B;  2QA4 3;  1D6U A;  2V1L A;  1TUH A;  1GS3 A;  1US1 A;  2E2U A;  3BNC A;  5AIG A;  5IG0 A;  2CKF B;  2M7O A;  3F14 A;  3I56 3;  1JV2 B;  3IMA B;  2P0X A;  2Z6B A;  3G71 3;  5A0O B;  3UL6 A;  1IV7 A;  3UL5 A;  2YFL B;  2SBL A;  1ZX2 A;  1OGX A;  5AII A;  2BMR B;  4WFO A;  2W04 A;  1W2Z A;  1K8A 4;  1W00 A;  2WGQ A;  3N9H A;  3V92 A;  1W7C A;  1UUW B;  2KXG A;  4L8O A;  4LEH A;  2CC3 A;  2UX0 A;  3OXA A;  3FG1 A;  1TU5 A;  2YX9 A;  5AYR B;  1Q81 4;  4LGQ A;  4KFD A;  3X41 A;  3ER7 A;  3F8H A;  2CIU A;  3NUV A;  1YHQ 3;  1W02 A;  4JF8 A;  3NBJ A;  1W6Y A;  1O7P B;  3FF2 A;  5D83 A;  4GL6 A;  5CF2 A;  2O3O A;  3BNE A;  3DGO A;  1VQP 3;  3S29 A;  3GRD A;  1OH0 A;  3S67 A;  4HBR A;  1TFO A;  2LQV A;  3Q2P A;  1LXE A;  1G96 A;  3CPO A;  3STD A;  1EKM A;  2ML6 A;  2Q07 A;  5KP1 A;  3OW2 2;  3EJV A;  3BND A;  3LOY A;  3N54 B;  3D9R A;  2GBW B;  1N9E A;  2IUK A;  1W6G A;  3DM8 A;  4FCM A;  3B4O A;  7STD A;  2FGT A;  1JB5 A;  1O7W B;  2CWV A;  3UNL A;  1WMO A;  1JKG B;  2OTL 3;  5IG3 A;  1N5P A;  2W9P A;  3WOF B;  2CK3 H;  1WMP A;  2K54 A;  3EB8 A;  1Q82 4;  3NM2 A;  3WOE B;  4XBX A;  2R4I A;  4O8S A;  4BTX A;  1EA2 A;  1VQM 3;  1DYU A;  1JNQ A;  2CWU A;  4XDV A;  2OOV A;  3DGL A;  3L0R A;  5G2G A;  3JUP A;  3PYJ A;  2PZV A;  3AMO B;  2OCT A;  2CFD A;  3NQZ A;  1PU4 A;  2BHM A;  1ROA A;  2RGQ A;  3BLZ A;  2W6J H;  3FF0 A;  2Y73 A;  3OWS A;  1A2V A;  3OX9 A;  4HVN A;  4LMI A;  5IEN A;  1ULJ B;  2RSX A;  3NV0 B;  3MPH A;  2IMJ A;  1Y4K A;  2FNQ A;  3G16 A;  4RNY A;  4CDL A;  3T8U A;  5DRE A;  2KCD A;  1O7H B;  4RZM A;  4TX4 A;  1D6Z A;  2LYX A;  1Z1S A;  1RJO A;  2XFT A;  3F7S A;  1NDO B;  2CH9 A;  2GEX A;  1U8C B;  3EC9 A;  1VQ6 3;  3BB9 A;  1NWW A;  3UJM A;  1QVF 2;  2O9U X;  1UI7 A;  3ECF A;  3EN1 B;  3G6E 3;  1YGE A;  4N3V A;  4OUQ A;  1GD3 A;  1JJ2 2;  2IA7 A;  3PS8 A;  1AV4 A;  2CW9 A;  3FH1 A;  4KVH A;  1IQ8 A;  1IDP A;  2PNC A;  3EF8 A;  2HMJ B;  5JPP A;  1WMN A;  1KSI A;  5EEO A;  4FCZ A;  3CCE 3;  2XRX B;  2HMO B;  1A90 A;  2F99 A;  3X3Z A;  4R1K A;  2CHC A;  4HYZ A;  1VZZ A;  4HM2 B;  3LYG A;  2K0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...