5EQLA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
82
Chain Sequence
SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
molecule keywords SUMO-Affirmer-S2D5
total genus 13
structure length 82
sequence length 88
ec nomenclature
pdb deposition date 2015-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eqlA00
1N5HA 4LZIA 3L0RA 5LC7A 4CCVA 3GAXA 3PS8A 5ELJA 3LH4A 1CEWI 4N6LA 3K9MC 1N5PA 4IT7A 2CH9A 1NB3I 1CYUA 2W9PA 4N6OB 1FA3A 1A90A 1M9GA 2BO9B 1N9JA 4N6V0 1DVCA 3QRDA 1EQKA 3KSED 3NX0A 1G96A 4TX4A 1TIJA 3MWZA 5EQLA 3UL5A 4ZM8A 1A67A 1DVDA 4N6NB 1IV7A 1RN7A 1IV9A 2OCTA 4N6TA 5ELUA 1GD3A 5LC6A 3S67A 4EYCA 1LXEA 3KFQC 3IMAB 2O9UX 5A0OB 2KXGA 1MNLA 1MOLA 1CYVA 1YVBI 1STFI 1KWIA 2W9QA 3SVAA 3UL6A 1WNHA 4N6UA 1NB5I 1PFPA 3PYJA 3Q2PA 4N6MA 1FUWA 1ROAA 3PXMA 1R4CA 1GD4A
chains in the Genus database with same CATH superfamily
1N5HA 3G4S3 1BRSA 2W03A 3CU3A 1BSEA 2QEX3 1GY6A 3LOYA 1OF5B 4RNZA 3PCSA 1I3IA 2J8XB 3EX9A 1YJN3 5KP1A 4HM2B 5CK6A 1ZS7A 3X42A 1IQYA 3K63A 4EC6A 3FF2A 2OQEA 1VQ63 1A67A 3EQQB 1VQK3 3BU4A 1FW7A 4IIAA 1MGRA 4BTXA 4MMYB 2XFTA 2W2CA 3CC73 5IERA 2H0IA 1STDA 1MNLA 3B4OA 4FMAA 1OCVA 1UUVB 1B2UA 3ECFA 1KWIA 1KC84 4ORLA 2WOFA 3KN4A 1WNHA 1LOYA 4RNTA 3UL6A 5CF2A 1SIIA 3A76A 1Z1SA 4BL3A 4J5GA 1EEJA 3WOFB 3FGYA 1DE3A 2I9WA 4I5QA 1X1XA 3GAXA 3J7Yd 4G1MB 2AADA 2CX0A 1AR0A 1W5ZA 2SARA 1VQN3 1I70A 4J5KA 2BMOB 3DGNA 2IY2A 3JUPA 4K90B 2XSOB 5AIHA 1IT8A 3D4AA 1OHPA 1T2HA 3BLZA 2CKFB 2Q07A 3BNCA 1GY5A 1RGLA 1TFOA 1Q864 2QGUA 3DGOA 4XM4A 5HOHA 1GD3A 1BNRA 2BIRA 2STDA 1OACA 3D3LA 2CG0A 3LTBA 3D79A 1BNGA 3G6E3 1SARA 3MG2A 2CWVA 4BIRA 2GU3A 1RDSA 5JPPA 1NU3A 3K7CA 2W04A 3RGRA 3PYJA 1Q824 5KP3A 1TU5A 2H0GA 1VQ93 1TFKA 1ROAA 1T2IA 3CCE3 2F56A 2RBIA 3LH4A 3M8CA 2IA7A 4N6LA 1NDOB 2IYJA 1IT7A 1EKMA 2CC3A 2FGTA 1O7GB 3HIIA 4O3VA 3S27A 9RNTA 3CME3 2OTL3 1QVF2 1M9GA 2CW9A 3EBYA 2LQVA 1UI8A 1B2ZA 5M18A 4CJNA 2V1LA 1RGFA 2QIYA 3LT8A 2R4IA 1RSNA 1W01A 3I0YA 4HBRA 1UCIA 3V98A 3AGOA 1BNIA 3NBRA 4X2HA 1J2BA 1UCLA 1RTUA 1DVDA 1OHOA 4N6TA 1FUSA 4KFFA 1JKGB 1W2ZA 4IPBA 5IG0A 2D42A 2Y74A 2OOVC 3DXOA 1TRQA 1BRNL 3G0KA 3CC23 2GU1A 1X1WA 1RGHA 2W9QA 4OVMA 1BRIA 1TRPA 1NB5I 2SBLA 1N9EA 2ZDJA 1BSAA 1TJDA 2C10A 1YI23 2K54A 1RN1A 3L0RA 2CFWA 1A2KA 1JNQA 5RNTA 3EN1B 3FG1A 1WQLB 4HM7B 3KCHA 3N9HA 3NV0B 1RCLA 3WR2A 1WTHA 1NO3A 2KRTA 3HIGA 3HK4A 1V74A 4DKIA 1ASKA 3LT9A 3CMA3 3F8XA 1Y4KA 4ZM8A 3MWZA 4HM0B 4NHFA 1MGWA 2A15A 3FF0A 2BU4A 4JRFA 2WO0A 3SYUA 1IDPA 1SIHA 2KF3A 1LXEA 1TP6A 2CIUA 3B4PA 2OOVA 3DGLA 1BGSA 2KF5A 3CCU3 1CYVA 4FMCA 3F14A 2CHCA 3GSPA 5CXOA 1O7NB 1DETA 1VQQA 2CK3H 3JVCA 1JB5A 1AY7A 3GZYB 3Q2PA 1BSCA 1ROVA 1N8QA 3NQYA 2WGQA 1ISKA 1R4CA 1JB2A 3NM7A 2F86B 1VQ83 2IMJA 1LQMB 3WA2X 2O3OA 1JN5B 5IEPA 3GRDA 1MWUA 4L8OA 1RRHA 3GWRA 5KP4A 1RGCA 1S5AA 1BIRA 1X1UA 1YHQ3 1IYYA 4EW5A 3AGNA 4MMZB 4U13A 4Q53A 1FUWA 3MHEA 3JUNA 4R9LA 2F99A 2OCTA 3UNLA 4FMDA 4X2OA 3LXUX 2F98A 1HU9A 5DREA 2F5WA 2GBWB 1W6YA 2MF7A 2RFRA 3IMAB 1B2SA 5A0OB 1ZO2A 2CFLA 5BIRA 2CX1A 2JQ5A 2KCDA 3X3YA 5M1AA 5IW9A 3PZWA 2LYXA 2YFLB 5EVHA 2BMRB 2GEYA 8RNTA 1B2XA 3V92A 3EBTA 3QK9A 2XH9A 1GMQA 3ZG5A 4HM8B 1Q9EA 3WHOA 4LGQA 3OWSA 3SEDA 1UCJA 3N8BA 1LQGC 3CPOA 3KZTA 5BXQA 1AVLA 3CCL3 3ER7A 2L4VA 2XSHB 3EHCA 3DZLA 4J9AA 1GOYA 2H0HA 1JKGA 2OWPA 3S67A 2ZHXB 4EYCA 2W0QA 3K0ZA 4STDA 3F9SA 2HMNB 3G713 2E2VA 3X3XA 1RNTA 3U1WA 1EUIC 1IQ8A 1MWRA 1UGHI 1Q814 2BT3A 4WHAA 2UGIA 1FGMA 4WYKA 1GSPA 2Z6BA 1JBTA 1E97A 4LZIA 1PU4A 2RCDA 3MKIA 3CXC2 1JB4A 3GZXB 2ML5A 1B27A 2P0MA 3T8NA 3F7XA 2KF4A 1K28A 1IVUA 3DGMA 1LNIA 2KF6A 5G1KA 5G1LA 1AVKA 4HM5B 1HYFA 1JZDA 2CFDA 4MMXB 1FGOA 3KKGA 1GY7A 2BMQB 1JJ22 3HX8A 3SXXA 4NPBA 4FCZA 3NBBA 3CPW2 1RLSA 1VQM3 5AIFA 1R4YA 4HM4B 1I8VA 3EB8A 1LRAA 3LTDA 2ML6A 1FUTA 4GB5A 3WA3A 4HZ9B 1JRQA 4LMIA 3G16A 6RNTA 2QA43 1IVWA 4GHOA 1B20A 3HZPA 4H3UA 4EBGA 1C54A 1ZGXA 3PS8A 4FCJA 5G2GA 1LOXA 1U5OA 1SQWA 3DUKA 1FA3A 3MYTA 4O02B 3WMDA 2YFJB 1K41A 2IUJA 1OGZA 4FR9A 1W6CA 1PYLA 1KSIA 1BANA 1UCKA 1W6GA 1TIJA 2INXA 3OX9A 1UW1A 3NQZA 5FW5A 3I553 1DMMA 1BAOA 1W4NA 5ELUA 8CHOA 5M19A 1I2EA 3BIRA 2PZVA 3VGNA 3AMOB 3JUOA 1Q40B 2KXGA 3H51A 1MOLA 1UUGB 3K5TA 1I3FA 1STFI 1BRHA 2HMMB 2R41A 4N6UA 3CNMA 4CDLA 4HYZA 2RNTA 3EN8A 2W56A 3NBJA 3PXMA 1QAKA 1GD4A 1E3RA 3PCRA 4I4KA 4RZMA 3KE7A 4CCVA 3X41A 4R1KA 1YGEA 4BTYA 1M1XB 3EC9A 1IK3A 1US1A 1JV2B 4N6OB 1A90A 4OK0A 5CLKA 3HI7A 3STDA 1D6YA 2ZL8A 1YNVX 3CCR3 4K1VA 1EQKA 1X1YA 3LMLA 5D81A 1IV7A 3SOYA 5AEWB 1OUNA 4MEIA 1IU7A 3BNEA 1T3BA 3DH2A 4H61A 1BRGA 2M7OA 3LZAA 3CCM3 4AKZA 5AI1A 3CCS3 1I2FA 3FG4A 2CFKA 1JN5A 1EG9B 1SPUA 1VZZA 4N3VA 1I0XA 1L5GB 2W56B 3DY5A 3RDEA 3EF8A 3G8ZA 2B1XB 4HM1B 1BNEA 3T0UA 1YIJ3 1QVG2 1CH0A 3D5IA 3OWYA 4XDWA 1V57A 2ZA4A 2WGOA 3X40A 1IVVA 3SOAA 2UX0A 4K1UA 1G96A 4TX4A 4WYKB 5IF6A 1RN7A 1NWWA 5TGNA 1GOVA 1C7HA 4XBYA 1IVXA 1O7PB 1OF5A 5STDA 3OV4A 5IG4A 1UGIA 6GSPA 2XF3A 3FG3A 5AYRB 3FSDA 3Q3FA 4WFOA 3B8LA 3UJMA 2Z76A 1M904 1CEWI 2FXTA 3B7CA 2Z77A 3FCSB 1O7HB 3K9MC 4IT7A 4RBNA 1TTOA 1GOUA 2W6JH 6STDA 2W9PA 3D9RA 4KFDA 5AIGA 1S723 2RGQA 2BO9B 3V99A 3X3ZA 3MPHA 1BUJA 3IJEB 2E2UA 1BNJA 4QWTA 4L8PA 2RSXA 1YIT3 3NHXA 2B24B 3UL5A 2Y73A 3CCJ3 2HMKB 3KFQC 2XGNA 2CFGA 3OWUA 2GBXB 4XB5A 2O9UX 1FGQA 4JF8A 3CC43 1EA2A 5D82A 3URPA 1OHSA 1D6ZA 1OH0A 1PY3A 1WMPA 5AIIA 1W02A 4KZ1A 1RGAA 4HAAA 2P0XA 4R9KA 2XR8B 1Q42A 4KVHA 5IEOA 1RCKA 4XBXA 1ULJB 1B2MA 1DYUA 2UUGC 4LYLB 2CH9A 1NB3I 1CYUA 2F5MA 1YVSA 1LOVA 1RJOA 4FMBA 4L7KA 1FYSA 1ZX2A 1GMRA 4BTWA 1RRLA 1VQ43 3F7SA 3LTAA 4O8SA 1BSBA 3U97A 3NX0A 3ZG0A 4BU4A 5AEUB 4HVNA 2GSPA 1BRJA 4HM3B 3AHSA 1K8A4 1LOWA 1DMNA 2P38A 4HM6B 1BSDA 4HZBB 1LNHA 4HJLB 3F40A 4OUQA 5D83A 3SX1A 1Q40A 3BNDA 4BL2A 3CCQ3 1N8R4 1NJI4 3H3HA 3ZFZA 1A2VA 1OGXA 5BVBA 1ULIB 1VQO3 3N54B 1VQ53 1VQ73 1BUQA 2FNQA 3VSYA 4N6MA 4CPKA 3S28A 5DRVA 2CWUA 5HGRA 1AQZA 3NV0A 2CG1A 3ROBA 3D5GA 2HMJB 2YX9A 3KSPA 3I563 1YGWA 1BVIA 3VF1A 1GMPA 2E2TA 3MG1A 3RGAA 1LVNA 1O7MB 5CF1A 3NXJA 4FCMA 3GZRA 2K0MA 1IQXA 5IG3A 1V58A 3FKAA 4WWUC 3DMCA 1A2PA 3AHWA 5GSPA 1W2B2 1UI7A 2PNCA 3NUVA 4ILFA 2HMLB 3JUMA 4GSPA 3CD63 3T8UA 1RN4A 4KT3B 3TDGA 1U8CB 2BHMA 4PEJA 5LC7A 1M1K4 1MWTA 3HOHA 1QJGA 2YFIB 3RNTA 2C11A 3FLJA 1N5PA 2L1SA 3FH1A 1OPYA 2WOHA 5JPUA 3E99A 1K9M4 3MSOA 1BNSA 5JBSA 1DVCA 1QAFA 2OQEC 4AEQA 1AV4A 1HZ1A 2BNGA 4N6NB 2OTJ3 1QALA 1Q7Y4 7RNTA 3AMOA 3EE1A 4LEHA 4EXRA 3GZBA 1BOXA 3CCV3 1D6UA 1CQSA 3UB1A 1TUHA 2AAEA 2XGLA 3Q90A 1UUWB 1VQP3 1FGRA 4R4KA 1YJW3 1BU4A 3O8YA 1YJ93 3SVAA 1W00A 5BU4A 2JDIH 3JUQA 1JBRA 2HOHA 4O2HA 4RNYA 1N9JA 1WMNA 3MG3A 1RNBA 3BNBA 1BRKA 4K61A 1GYBA 1JZOA 7STDA 2C4BA 1HKXA 4NREA 1G02A 1K734 1JBSA 3SLUA 1I2GA 3A5EA 2Z7AA 3CNXA 1RKYA 1Q7HA 1NNVA 1RGEA 4N6V0 4AKYA 3FZWA 3LYGA 2GEXA 1G0TA 1WMOA 2XEPA 1O7WB 3KSED 4GL6A 1RGGA 3LTCA 3OW22 2MC8A 1E3VA 1RMSA 2CWTA 4EV2A 4R80A 5LC6A 3DGYA 3EJVA 1B21A 3WDGB 3PGBA 3Q1CA 1RHLA 1I0VA 5IG5A 2GXFA 5AYSC 4EV5A 2HMOB 1RGKA 3KIIA 4HOHA 2XRXB 1QMAA 4HKVB 1DMQA 3S29A 5IENA 3WOEB 1KD14 3OXAA 5ELJA 4MJDA 1BNFA 1B3SA 2K3DA 1UDII 3QRDA 4KFEA 3S5CA 5FGOA 1KQS2 7GSPA 3NM2A 1GS3A 5EQLA 3WODG 1FZUA 4LSOA 2F4YA 2P09A 2D1WA 1IV9A 1F8NA 1SJWA 3F8HA 5EEOA 1T5YA 2KAAA 4XDVA 4WP5A 2IUKA 1FGTA 1W7CA 1YVBI 3DM8A 4J8TA 1VQL3 1PFPA 2P05A 3ALAA 5I97A 3IPTA 3BB9A 1MWSA 4XBTA 2XFSA
chains in the Genus database with same CATH topology
1N5HA 3G4S3 2W03A 3CU3A 2QEX3 1GY6A 3LOYA 1OF5B 4RNZA 3PCSA 1YJN3 3EX9A 5KP1A 4HM2B 5CK6A 3X42A 1VQ63 1IQYA 3K63A 4EC6A 3FF2A 2OQEA 1A67A 3EQQB 1VQK3 4IIAA 4BTXA 4MMYB 2XFTA 2W2CA 3CC73 5IERA 1STDA 1MNLA 3B4OA 4FMAA 1OCVA 1UUVB 3ECFA 1KWIA 1KC84 4ORLA 2WOFA 3KN4A 1WNHA 3UL6A 5CF2A 1SIIA 3A76A 1Z1SA 3WOFB 3FGYA 2I9WA 3GAXA 3J7Yd 4G1MB 1AR0A 1W5ZA 1VQN3 2BMOB 3DGNA 3JUPA 4K90B 2XSOB 5AIHA 1IT8A 1OHPA 3BLZA 2CKFB 2Q07A 3BNCA 1GY5A 1TFOA 1Q864 2QGUA 3DGOA 4XM4A 1GD3A 2STDA 1OACA 3D3LA 2CG0A 3LTBA 3G6E3 3MG2A 2CWVA 2GU3A 5JPPA 1NU3A 3K7CA 2W04A 3RGRA 3PYJA 1Q824 5KP3A 1TU5A 1VQ93 1TFKA 1ROAA 3CCE3 3M8CA 3LH4A 4N6LA 2IA7A 1NDOB 1IT7A 1EKMA 2CC3A 2FGTA 1O7GB 3HIIA 4O3VA 3S27A 2OTL3 3CME3 1QVF2 1M9GA 2CW9A 3EBYA 2LQVA 1UI8A 2V1LA 2QIYA 3LT8A 2R4IA 3I0YA 1W01A 4HBRA 3V98A 1J2BA 1DVDA 3NBRA 4X2HA 1OHOA 4N6TA 4KFFA 1JKGB 1W2ZA 4IPBA 5IG0A 2D42A 2Y74A 2OOVC 3DXOA 3G0KA 3CC23 2GU1A 2W9QA 4OVMA 1NB5I 2SBLA 1N9EA 2ZDJA 2C10A 1YI23 2K54A 3L0RA 2CFWA 1A2KA 1JNQA 3EN1B 3FG1A 1WQLB 4HM7B 3N9HA 3NV0B 1WTHA 1NO3A 2KRTA 3HIGA 3HK4A 1V74A 1ASKA 3LT9A 3CMA3 3F8XA 1Y4KA 4ZM8A 3MWZA 4HM0B 4NHFA 2A15A 3FF0A 4JRFA 2WO0A 1IDPA 1SIHA 1LXEA 1TP6A 2CIUA 3B4PA 2OOVA 3DGLA 3CCU3 1CYVA 4FMCA 3F14A 2CHCA 5CXOA 1O7NB 3JVCA 2CK3H 1JB5A 3GZYB 3Q2PA 1ROVA 1N8QA 3NQYA 2WGQA 1ISKA 1R4CA 1JB2A 3NM7A 2F86B 1VQ83 2IMJA 3WA2X 2O3OA 1JN5B 5IEPA 3GRDA 4L8OA 1RRHA 3GWRA 5KP4A 1S5AA 1YHQ3 4MMZB 4U13A 4Q53A 1FUWA 3MHEA 3JUNA 4R9LA 2F99A 2OCTA 3UNLA 4FMDA 4X2OA 3LXUX 2F98A 1HU9A 5DREA 2MF7A 2GBWB 1W6YA 2RFRA 3IMAB 5A0OB 1ZO2A 2CFLA 2JQ5A 2KCDA 3X3YA 5IW9A 3PZWA 2LYXA 2YFLB 5EVHA 2BMRB 2GEYA 3V92A 3EBTA 3QK9A 2XH9A 4HM8B 4LGQA 3OWSA 3SEDA 3N8BA 5BXQA 3CPOA 3KZTA 3CCL3 1AVLA 3ER7A 2L4VA 2XSHB 3EHCA 3DZLA 4J9AA 1JKGA 2OWPA 3S67A 4EYCA 2W0QA 3K0ZA 4STDA 3F9SA 2HMNB 3G713 2E2VA 3X3XA 3U1WA 1IQ8A 1Q814 2BT3A 4WHAA 1FGMA 4WYKA 2Z6BA 1E97A 4LZIA 1PU4A 2RCDA 3MKIA 3CXC2 1JB4A 3GZXB 2ML5A 2P0MA 3T8NA 3F7XA 1K28A 1IVUA 3DGMA 1AVKA 4HM5B 2CFDA 4MMXB 1FGOA 3KKGA 1GY7A 2BMQB 1JJ22 3HX8A 3SXXA 4FCZA 3NBBA 3CPW2 1VQM3 5AIFA 4HM4B 3EB8A 3LTDA 2ML6A 4GB5A 3WA3A 4HZ9B 1JRQA 4LMIA 3G16A 2QA43 1IVWA 4H3UA 3HZPA 4EBGA 3PS8A 4FCJA 5G2GA 1LOXA 1U5OA 1SQWA 3DUKA 1FA3A 3MYTA 4O02B 3WMDA 2YFJB 1K41A 2IUJA 1OGZA 4FR9A 1W6CA 1KSIA 1W6GA 1TIJA 2INXA 3OX9A 1UW1A 3NQZA 5FW5A 3I553 1DMMA 5ELUA 1W4NA 8CHOA 2PZVA 3VGNA 3AMOB 3JUOA 1Q40B 2KXGA 3H51A 1MOLA 3K5TA 1STFI 2HMMB 4N6UA 3CNMA 4CDLA 4HYZA 3EN8A 2W56A 3NBJA 3PXMA 1QAKA 1E3RA 1GD4A 3PCRA 4I4KA 4RZMA 3KE7A 4CCVA 3X41A 4R1KA 1YGEA 4BTYA 1M1XB 3EC9A 1IK3A 1US1A 1JV2B 4N6OB 1A90A 4OK0A 5CLKA 3HI7A 3STDA 1D6YA 2ZL8A 3CCR3 4K1VA 1EQKA 3LMLA 5D81A 1IV7A 3SOYA 5AEWB 1OUNA 4MEIA 1IU7A 3BNEA 4H61A 3LZAA 2M7OA 3CCM3 4AKZA 5AI1A 3CCS3 3FG4A 2CFKA 1JN5A 1EG9B 1SPUA 1VZZA 4N3VA 1L5GB 2W56B 3DY5A 3RDEA 3EF8A 3G8ZA 2B1XB 4HM1B 3T0UA 1YIJ3 1QVG2 3OWYA 4XDWA 2WGOA 3X40A 1IVVA 3SOAA 2UX0A 4K1UA 1G96A 4TX4A 4WYKB 5IF6A 1RN7A 1NWWA 5TGNA 1C7HA 4XBYA 1IVXA 1O7PB 1OF5A 5STDA 3OV4A 5IG4A 2XF3A 3FG3A 5AYRB 3FSDA 4WFOA 3B8LA 3UJMA 2Z76A 1M904 1CEWI 2FXTA 3B7CA 2Z77A 3FCSB 1O7HB 3K9MC 4IT7A 4RBNA 2W6JH 6STDA 1S723 2W9PA 3D9RA 4KFDA 5AIGA 2RGQA 2BO9B 3V99A 3X3ZA 3MPHA 3IJEB 2E2UA 1YIT3 4QWTA 4L8PA 2RSXA 3NHXA 2B24B 3UL5A 2Y73A 3CCJ3 2HMKB 3KFQC 2XGNA 2CFGA 3OWUA 2GBXB 4XB5A 2O9UX 1FGQA 4JF8A 3CC43 1EA2A 5D82A 1OHSA 1D6ZA 1OH0A 1WMPA 5AIIA 1W02A 4KZ1A 4R9KA 2P0XA 2XR8B 1Q42A 4KVHA 5IEOA 4XBXA 1ULJB 1DYUA 2CH9A 1NB3I 1CYUA 1RJOA 4L7KA 4FMBA 1ZX2A 4BTWA 1RRLA 1VQ43 3F7SA 3LTAA 4O8SA 3U97A 3NX0A 5AEUB 4HVNA 4HM3B 1K8A4 1DMNA 2P38A 4HM6B 4HZBB 1LNHA 4HJLB 3F40A 4OUQA 5D83A 3SX1A 1Q40A 3BNDA 3CCQ3 1N8R4 1NJI4 3H3HA 1VQO3 1A2VA 1OGXA 5BVBA 1ULIB 1VQ53 3N54B 1BUQA 1VQ73 2FNQA 3VSYA 4N6MA 3S28A 5DRVA 2CWUA 5HGRA 2CG1A 3NV0A 3ROBA 3I563 2HMJB 2YX9A 3KSPA 3VF1A 2E2TA 3MG1A 3RGAA 1LVNA 1O7MB 5CF1A 3NXJA 4FCMA 3GZRA 2K0MA 1IQXA 5IG3A 3FKAA 4WWUC 3DMCA 1W2B2 1UI7A 2PNCA 3NUVA 3CD63 2HMLB 3JUMA 3T8UA 3TDGA 1U8CB 2BHMA 4PEJA 5LC7A 1M1K4 1QJGA 2YFIB 2C11A 3FLJA 1N5PA 3FH1A 1OPYA 2WOHA 5JPUA 3E99A 1K9M4 3MSOA 5JBSA 1DVCA 1QAFA 2OQEC 4AEQA 1AV4A 2BNGA 4N6NB 2OTJ3 1QALA 1Q7Y4 3AMOA 3EE1A 4LEHA 4EXRA 3GZBA 3CCV3 1D6UA 1CQSA 3UB1A 1TUHA 2XGLA 3Q90A 1VQP3 1UUWB 1FGRA 4R4KA 1YJW3 3O8YA 1YJ93 3SVAA 1W00A 2JDIH 3JUQA 4O2HA 4RNYA 1N9JA 1WMNA 3MG3A 3BNBA 4K61A 1GYBA 7STDA 1HKXA 4NREA 1K734 3SLUA 2Z7AA 3CNXA 1RKYA 4N6V0 4AKYA 3FZWA 3LYGA 2GEXA 1WMOA 2XEPA 3KSED 1O7WB 4GL6A 3LTCA 3OW22 2MC8A 1E3VA 2CWTA 4EV2A 4R80A 5LC6A 3EJVA 3WDGB 3PGBA 3Q1CA 5IG5A 2GXFA 5AYSC 4EV5A 2HMOB 3KIIA 2XRXB 1QMAA 4HKVB 1DMQA 3S29A 5IENA 3WOEB 1KD14 3OXAA 5ELJA 4MJDA 3QRDA 4KFEA 3S5CA 5FGOA 1KQS2 3NM2A 1GS3A 5EQLA 3WODG 4LSOA 2P09A 2D1WA 1IV9A 1F8NA 1SJWA 3F8HA 5EEOA 1T5YA 4XDVA 4WP5A 2IUKA 1FGTA 1W7CA 1YVBI 3DM8A 4J8TA 1VQL3 1PFPA 2P05A 3ALAA 5I97A 3IPTA 3BB9A 4XBTA 2XFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5H A;  4LZI A;  3L0R A;  5LC7 A;  4CCV A;  3GAX A;  3PS8 A;  5ELJ A;  3LH4 A;  1CEW I;  4N6L A;  3K9M C;  1N5P A;  4IT7 A;  2CH9 A;  1NB3 I;  1CYU A;  2W9P A;  4N6O B;  1FA3 A;  1A90 A;  1M9G A;  2BO9 B;  1N9J A;  4N6V 0;  1DVC A;  3QRD A;  1EQK A;  3KSE D;  3NX0 A;  1G96 A;  4TX4 A;  1TIJ A;  3MWZ A;  5EQL A;  3UL5 A;  4ZM8 A;  1A67 A;  1DVD A;  4N6N B;  1IV7 A;  1RN7 A;  1IV9 A;  2OCT A;  4N6T A;  5ELU A;  1GD3 A;  5LC6 A;  3S67 A;  4EYC A;  1LXE A;  3KFQ C;  3IMA B;  2O9U X;  5A0O B;  2KXG A;  1MNL A;  1MOL A;  1CYV A;  1YVB I;  1STF I;  1KWI A;  2W9Q A;  3SVA A;  3UL6 A;  1WNH A;  4N6U A;  1NB5 I;  1PFP A;  3PYJ A;  3Q2P A;  4N6M A;  1FUW A;  1ROA A;  3PXM A;  1R4C A;  1GD4 A; 
#chains in the Genus database with same CATH topology
 1N5H A;  3G4S 3;  1BRS A;  2W03 A;  3CU3 A;  1BSE A;  2QEX 3;  1GY6 A;  3LOY A;  1OF5 B;  4RNZ A;  3PCS A;  1I3I A;  2J8X B;  3EX9 A;  1YJN 3;  5KP1 A;  4HM2 B;  5CK6 A;  1ZS7 A;  3X42 A;  1IQY A;  3K63 A;  4EC6 A;  3FF2 A;  2OQE A;  1VQ6 3;  1A67 A;  3EQQ B;  1VQK 3;  3BU4 A;  1FW7 A;  4IIA A;  1MGR A;  4BTX A;  4MMY B;  2XFT A;  2W2C A;  3CC7 3;  5IER A;  2H0I A;  1STD A;  1MNL A;  3B4O A;  4FMA A;  1OCV A;  1UUV B;  1B2U A;  3ECF A;  1KWI A;  1KC8 4;  4ORL A;  2WOF A;  3KN4 A;  1WNH A;  1LOY A;  4RNT A;  3UL6 A;  5CF2 A;  1SII A;  3A76 A;  1Z1S A;  4BL3 A;  4J5G A;  1EEJ A;  3WOF B;  3FGY A;  1DE3 A;  2I9W A;  4I5Q A;  1X1X A;  3GAX A;  3J7Y d;  4G1M B;  2AAD A;  2CX0 A;  1AR0 A;  1W5Z A;  2SAR A;  1VQN 3;  1I70 A;  4J5K A;  2BMO B;  3DGN A;  2IY2 A;  3JUP A;  4K90 B;  2XSO B;  5AIH A;  1IT8 A;  3D4A A;  1OHP A;  1T2H A;  3BLZ A;  2CKF B;  2Q07 A;  3BNC A;  1GY5 A;  1RGL A;  1TFO A;  1Q86 4;  2QGU A;  3DGO A;  4XM4 A;  5HOH A;  1GD3 A;  1BNR A;  2BIR A;  2STD A;  1OAC A;  3D3L A;  2CG0 A;  3LTB A;  3D79 A;  1BNG A;  3G6E 3;  1SAR A;  3MG2 A;  2CWV A;  4BIR A;  2GU3 A;  1RDS A;  5JPP A;  1NU3 A;  3K7C A;  2W04 A;  3RGR A;  3PYJ A;  1Q82 4;  5KP3 A;  1TU5 A;  2H0G A;  1VQ9 3;  1TFK A;  1ROA A;  1T2I A;  3CCE 3;  2F56 A;  2RBI A;  3LH4 A;  3M8C A;  2IA7 A;  4N6L A;  1NDO B;  2IYJ A;  1IT7 A;  1EKM A;  2CC3 A;  2FGT A;  1O7G B;  3HII A;  4O3V A;  3S27 A;  9RNT A;  3CME 3;  2OTL 3;  1QVF 2;  1M9G A;  2CW9 A;  3EBY A;  2LQV A;  1UI8 A;  1B2Z A;  5M18 A;  4CJN A;  2V1L A;  1RGF A;  2QIY A;  3LT8 A;  2R4I A;  1RSN A;  1W01 A;  3I0Y A;  4HBR A;  1UCI A;  3V98 A;  3AGO A;  1BNI A;  3NBR A;  4X2H A;  1J2B A;  1UCL A;  1RTU A;  1DVD A;  1OHO A;  4N6T A;  1FUS A;  4KFF A;  1JKG B;  1W2Z A;  4IPB A;  5IG0 A;  2D42 A;  2Y74 A;  2OOV C;  3DXO A;  1TRQ A;  1BRN L;  3G0K A;  3CC2 3;  2GU1 A;  1X1W A;  1RGH A;  2W9Q A;  4OVM A;  1BRI A;  1TRP A;  1NB5 I;  2SBL A;  1N9E A;  2ZDJ A;  1BSA A;  1TJD A;  2C10 A;  1YI2 3;  2K54 A;  1RN1 A;  3L0R A;  2CFW A;  1A2K A;  1JNQ A;  5RNT A;  3EN1 B;  3FG1 A;  1WQL B;  4HM7 B;  3KCH A;  3N9H A;  3NV0 B;  1RCL A;  3WR2 A;  1WTH A;  1NO3 A;  2KRT A;  3HIG A;  3HK4 A;  1V74 A;  4DKI A;  1ASK A;  3LT9 A;  3CMA 3;  3F8X A;  1Y4K A;  4ZM8 A;  3MWZ A;  4HM0 B;  4NHF A;  1MGW A;  2A15 A;  3FF0 A;  2BU4 A;  4JRF A;  2WO0 A;  3SYU A;  1IDP A;  1SIH A;  2KF3 A;  1LXE A;  1TP6 A;  2CIU A;  3B4P A;  2OOV A;  3DGL A;  1BGS A;  2KF5 A;  3CCU 3;  1CYV A;  4FMC A;  3F14 A;  2CHC A;  3GSP A;  5CXO A;  1O7N B;  1DET A;  1VQQ A;  2CK3 H;  3JVC A;  1JB5 A;  1AY7 A;  3GZY B;  3Q2P A;  1BSC A;  1ROV A;  1N8Q A;  3NQY A;  2WGQ A;  1ISK A;  1R4C A;  1JB2 A;  3NM7 A;  2F86 B;  1VQ8 3;  2IMJ A;  1LQM B;  3WA2 X;  2O3O A;  1JN5 B;  5IEP A;  3GRD A;  1MWU A;  4L8O A;  1RRH A;  3GWR A;  5KP4 A;  1RGC A;  1S5A A;  1BIR A;  1X1U A;  1YHQ 3;  1IYY A;  4EW5 A;  3AGN A;  4MMZ B;  4U13 A;  4Q53 A;  1FUW A;  3MHE A;  3JUN A;  4R9L A;  2F99 A;  2OCT A;  3UNL A;  4FMD A;  4X2O A;  3LXU X;  2F98 A;  1HU9 A;  5DRE A;  2F5W A;  2GBW B;  1W6Y A;  2MF7 A;  2RFR A;  3IMA B;  1B2S A;  5A0O B;  1ZO2 A;  2CFL A;  5BIR A;  2CX1 A;  2JQ5 A;  2KCD A;  3X3Y A;  5M1A A;  5IW9 A;  3PZW A;  2LYX A;  2YFL B;  5EVH A;  2BMR B;  2GEY A;  8RNT A;  1B2X A;  3V92 A;  3EBT A;  3QK9 A;  2XH9 A;  1GMQ A;  3ZG5 A;  4HM8 B;  1Q9E A;  3WHO A;  4LGQ A;  3OWS A;  3SED A;  1UCJ A;  3N8B A;  1LQG C;  3CPO A;  3KZT A;  5BXQ A;  1AVL A;  3CCL 3;  3ER7 A;  2L4V A;  2XSH B;  3EHC A;  3DZL A;  4J9A A;  1GOY A;  2H0H A;  1JKG A;  2OWP A;  3S67 A;  2ZHX B;  4EYC A;  2W0Q A;  3K0Z A;  4STD A;  3F9S A;  2HMN B;  3G71 3;  2E2V A;  3X3X A;  1RNT A;  3U1W A;  1EUI C;  1IQ8 A;  1MWR A;  1UGH I;  1Q81 4;  2BT3 A;  4WHA A;  2UGI A;  1FGM A;  4WYK A;  1GSP A;  2Z6B A;  1JBT A;  1E97 A;  4LZI A;  1PU4 A;  2RCD A;  3MKI A;  3CXC 2;  1JB4 A;  3GZX B;  2ML5 A;  1B27 A;  2P0M A;  3T8N A;  3F7X A;  2KF4 A;  1K28 A;  1IVU A;  3DGM A;  1LNI A;  2KF6 A;  5G1K A;  5G1L A;  1AVK A;  4HM5 B;  1HYF A;  1JZD A;  2CFD A;  4MMX B;  1FGO A;  3KKG A;  1GY7 A;  2BMQ B;  1JJ2 2;  3HX8 A;  3SXX A;  4NPB A;  4FCZ A;  3NBB A;  3CPW 2;  1RLS A;  1VQM 3;  5AIF A;  1R4Y A;  4HM4 B;  1I8V A;  3EB8 A;  1LRA A;  3LTD A;  2ML6 A;  1FUT A;  4GB5 A;  3WA3 A;  4HZ9 B;  1JRQ A;  4LMI A;  3G16 A;  6RNT A;  2QA4 3;  1IVW A;  4GHO A;  1B20 A;  3HZP A;  4H3U A;  4EBG A;  1C54 A;  1ZGX A;  3PS8 A;  4FCJ A;  5G2G A;  1LOX A;  1U5O A;  1SQW A;  3DUK A;  1FA3 A;  3MYT A;  4O02 B;  3WMD A;  2YFJ B;  1K41 A;  2IUJ A;  1OGZ A;  4FR9 A;  1W6C A;  1PYL A;  1KSI A;  1BAN A;  1UCK A;  1W6G A;  1TIJ A;  2INX A;  3OX9 A;  1UW1 A;  3NQZ A;  5FW5 A;  3I55 3;  1DMM A;  1BAO A;  1W4N A;  5ELU A;  8CHO A;  5M19 A;  1I2E A;  3BIR A;  2PZV A;  3VGN A;  3AMO B;  3JUO A;  1Q40 B;  2KXG A;  3H51 A;  1MOL A;  1UUG B;  3K5T A;  1I3F A;  1STF I;  1BRH A;  2HMM B;  2R41 A;  4N6U A;  3CNM A;  4CDL A;  4HYZ A;  2RNT A;  3EN8 A;  2W56 A;  3NBJ A;  3PXM A;  1QAK A;  1GD4 A;  1E3R A;  3PCR A;  4I4K A;  4RZM A;  3KE7 A;  4CCV A;  3X41 A;  4R1K A;  1YGE A;  4BTY A;  1M1X B;  3EC9 A;  1IK3 A;  1US1 A;  1JV2 B;  4N6O B;  1A90 A;  4OK0 A;  5CLK A;  3HI7 A;  3STD A;  1D6Y A;  2ZL8 A;  1YNV X;  3CCR 3;  4K1V A;  1EQK A;  1X1Y A;  3LML A;  5D81 A;  1IV7 A;  3SOY A;  5AEW B;  1OUN A;  4MEI A;  1IU7 A;  3BNE A;  1T3B A;  3DH2 A;  4H61 A;  1BRG A;  2M7O A;  3LZA A;  3CCM 3;  4AKZ A;  5AI1 A;  3CCS 3;  1I2F A;  3FG4 A;  2CFK A;  1JN5 A;  1EG9 B;  1SPU A;  1VZZ A;  4N3V A;  1I0X A;  1L5G B;  2W56 B;  3DY5 A;  3RDE A;  3EF8 A;  3G8Z A;  2B1X B;  4HM1 B;  1BNE A;  3T0U A;  1YIJ 3;  1QVG 2;  1CH0 A;  3D5I A;  3OWY A;  4XDW A;  1V57 A;  2ZA4 A;  2WGO A;  3X40 A;  1IVV A;  3SOA A;  2UX0 A;  4K1U A;  1G96 A;  4TX4 A;  4WYK B;  5IF6 A;  1RN7 A;  1NWW A;  5TGN A;  1GOV A;  1C7H A;  4XBY A;  1IVX A;  1O7P B;  1OF5 A;  5STD A;  3OV4 A;  5IG4 A;  1UGI A;  6GSP A;  2XF3 A;  3FG3 A;  5AYR B;  3FSD A;  3Q3F A;  4WFO A;  3B8L A;  3UJM A;  2Z76 A;  1M90 4;  1CEW I;  2FXT A;  3B7C A;  2Z77 A;  3FCS B;  1O7H B;  3K9M C;  4IT7 A;  4RBN A;  1TTO A;  1GOU A;  2W6J H;  6STD A;  2W9P A;  3D9R A;  4KFD A;  5AIG A;  1S72 3;  2RGQ A;  2BO9 B;  3V99 A;  3X3Z A;  3MPH A;  1BUJ A;  3IJE B;  2E2U A;  1BNJ A;  4QWT A;  4L8P A;  2RSX A;  1YIT 3;  3NHX A;  2B24 B;  3UL5 A;  2Y73 A;  3CCJ 3;  2HMK B;  3KFQ C;  2XGN A;  2CFG A;  3OWU A;  2GBX B;  4XB5 A;  2O9U X;  1FGQ A;  4JF8 A;  3CC4 3;  1EA2 A;  5D82 A;  3URP A;  1OHS A;  1D6Z A;  1OH0 A;  1PY3 A;  1WMP A;  5AII A;  1W02 A;  4KZ1 A;  1RGA A;  4HAA A;  2P0X A;  4R9K A;  2XR8 B;  1Q42 A;  4KVH A;  5IEO A;  1RCK A;  4XBX A;  1ULJ B;  1B2M A;  1DYU A;  2UUG C;  4LYL B;  2CH9 A;  1NB3 I;  1CYU A;  2F5M A;  1YVS A;  1LOV A;  1RJO A;  4FMB A;  4L7K A;  1FYS A;  1ZX2 A;  1GMR A;  4BTW A;  1RRL A;  1VQ4 3;  3F7S A;  3LTA A;  4O8S A;  1BSB A;  3U97 A;  3NX0 A;  3ZG0 A;  4BU4 A;  5AEU B;  4HVN A;  2GSP A;  1BRJ A;  4HM3 B;  3AHS A;  1K8A 4;  1LOW A;  1DMN A;  2P38 A;  4HM6 B;  1BSD A;  4HZB B;  1LNH A;  4HJL B;  3F40 A;  4OUQ A;  5D83 A;  3SX1 A;  1Q40 A;  3BND A;  4BL2 A;  3CCQ 3;  1N8R 4;  1NJI 4;  3H3H A;  3ZFZ A;  1A2V A;  1OGX A;  5BVB A;  1ULI B;  1VQO 3;  3N54 B;  1VQ5 3;  1VQ7 3;  1BUQ A;  2FNQ A;  3VSY A;  4N6M A;  4CPK A;  3S28 A;  5DRV A;  2CWU A;  5HGR A;  1AQZ A;  3NV0 A;  2CG1 A;  3ROB A;  3D5G A;  2HMJ B;  2YX9 A;  3KSP A;  3I56 3;  1YGW A;  1BVI A;  3VF1 A;  1GMP A;  2E2T A;  3MG1 A;  3RGA A;  1LVN A;  1O7M B;  5CF1 A;  3NXJ A;  4FCM A;  3GZR A;  2K0M A;  1IQX A;  5IG3 A;  1V58 A;  3FKA A;  4WWU C;  3DMC A;  1A2P A;  3AHW A;  5GSP A;  1W2B 2;  1UI7 A;  2PNC A;  3NUV A;  4ILF A;  2HML B;  3JUM A;  4GSP A;  3CD6 3;  3T8U A;  1RN4 A;  4KT3 B;  3TDG A;  1U8C B;  2BHM A;  4PEJ A;  5LC7 A;  1M1K 4;  1MWT A;  3HOH A;  1QJG A;  2YFI B;  3RNT A;  2C11 A;  3FLJ A;  1N5P A;  2L1S A;  3FH1 A;  1OPY A;  2WOH A;  5JPU A;  3E99 A;  1K9M 4;  3MSO A;  1BNS A;  5JBS A;  1DVC A;  1QAF A;  2OQE C;  4AEQ A;  1AV4 A;  1HZ1 A;  2BNG A;  4N6N B;  2OTJ 3;  1QAL A;  1Q7Y 4;  7RNT A;  3AMO A;  3EE1 A;  4LEH A;  4EXR A;  3GZB A;  1BOX A;  3CCV 3;  1D6U A;  1CQS A;  3UB1 A;  1TUH A;  2AAE A;  2XGL A;  3Q90 A;  1UUW B;  1VQP 3;  1FGR A;  4R4K A;  1YJW 3;  1BU4 A;  3O8Y A;  1YJ9 3;  3SVA A;  1W00 A;  5BU4 A;  2JDI H;  3JUQ A;  1JBR A;  2HOH A;  4O2H A;  4RNY A;  1N9J A;  1WMN A;  3MG3 A;  1RNB A;  3BNB A;  1BRK A;  4K61 A;  1GYB A;  1JZO A;  7STD A;  2C4B A;  1HKX A;  4NRE A;  1G02 A;  1K73 4;  1JBS A;  3SLU A;  1I2G A;  3A5E A;  2Z7A A;  3CNX A;  1RKY A;  1Q7H A;  1NNV A;  1RGE A;  4N6V 0;  4AKY A;  3FZW A;  3LYG A;  2GEX A;  1G0T A;  1WMO A;  2XEP A;  1O7W B;  3KSE D;  4GL6 A;  1RGG A;  3LTC A;  3OW2 2;  2MC8 A;  1E3V A;  1RMS A;  2CWT A;  4EV2 A;  4R80 A;  5LC6 A;  3DGY A;  3EJV A;  1B21 A;  3WDG B;  3PGB A;  3Q1C A;  1RHL A;  1I0V A;  5IG5 A;  2GXF A;  5AYS C;  4EV5 A;  2HMO B;  1RGK A;  3KII A;  4HOH A;  2XRX B;  1QMA A;  4HKV B;  1DMQ A;  3S29 A;  5IEN A;  3WOE B;  1KD1 4;  3OXA A;  5ELJ A;  4MJD A;  1BNF A;  1B3S A;  2K3D A;  1UDI I;  3QRD A;  4KFE A;  3S5C A;  5FGO A;  1KQS 2;  7GSP A;  3NM2 A;  1GS3 A;  5EQL A;  3WOD G;  1FZU A;  4LSO A;  2F4Y A;  2P09 A;  2D1W A;  1IV9 A;  1F8N A;  1SJW A;  3F8H A;  5EEO A;  1T5Y A;  2KAA A;  4XDV A;  4WP5 A;  2IUK A;  1FGT A;  1W7C A;  1YVB I;  3DM8 A;  4J8T A;  1VQL 3;  1PFP A;  2P05 A;  3ALA A;  5I97 A;  3IPT A;  3BB9 A;  1MWS A;  4XBT A;  2XFS A; 
#chains in the Genus database with same CATH homology
 1N5H A;  3G4S 3;  2W03 A;  3CU3 A;  2QEX 3;  1GY6 A;  3LOY A;  1OF5 B;  4RNZ A;  3PCS A;  1YJN 3;  3EX9 A;  5KP1 A;  4HM2 B;  5CK6 A;  3X42 A;  1VQ6 3;  1IQY A;  3K63 A;  4EC6 A;  3FF2 A;  2OQE A;  1A67 A;  3EQQ B;  1VQK 3;  4IIA A;  4BTX A;  4MMY B;  2XFT A;  2W2C A;  3CC7 3;  5IER A;  1STD A;  1MNL A;  3B4O A;  4FMA A;  1OCV A;  1UUV B;  3ECF A;  1KWI A;  1KC8 4;  4ORL A;  2WOF A;  3KN4 A;  1WNH A;  3UL6 A;  5CF2 A;  1SII A;  3A76 A;  1Z1S A;  3WOF B;  3FGY A;  2I9W A;  3GAX A;  3J7Y d;  4G1M B;  1AR0 A;  1W5Z A;  1VQN 3;  2BMO B;  3DGN A;  3JUP A;  4K90 B;  2XSO B;  5AIH A;  1IT8 A;  1OHP A;  3BLZ A;  2CKF B;  2Q07 A;  3BNC A;  1GY5 A;  1TFO A;  1Q86 4;  2QGU A;  3DGO A;  4XM4 A;  1GD3 A;  2STD A;  1OAC A;  3D3L A;  2CG0 A;  3LTB A;  3G6E 3;  3MG2 A;  2CWV A;  2GU3 A;  5JPP A;  1NU3 A;  3K7C A;  2W04 A;  3RGR A;  3PYJ A;  1Q82 4;  5KP3 A;  1TU5 A;  1VQ9 3;  1TFK A;  1ROA A;  3CCE 3;  3M8C A;  3LH4 A;  4N6L A;  2IA7 A;  1NDO B;  1IT7 A;  1EKM A;  2CC3 A;  2FGT A;  1O7G B;  3HII A;  4O3V A;  3S27 A;  2OTL 3;  3CME 3;  1QVF 2;  1M9G A;  2CW9 A;  3EBY A;  2LQV A;  1UI8 A;  2V1L A;  2QIY A;  3LT8 A;  2R4I A;  3I0Y A;  1W01 A;  4HBR A;  3V98 A;  1J2B A;  1DVD A;  3NBR A;  4X2H A;  1OHO A;  4N6T A;  4KFF A;  1JKG B;  1W2Z A;  4IPB A;  5IG0 A;  2D42 A;  2Y74 A;  2OOV C;  3DXO A;  3G0K A;  3CC2 3;  2GU1 A;  2W9Q A;  4OVM A;  1NB5 I;  2SBL A;  1N9E A;  2ZDJ A;  2C10 A;  1YI2 3;  2K54 A;  3L0R A;  2CFW A;  1A2K A;  1JNQ A;  3EN1 B;  3FG1 A;  1WQL B;  4HM7 B;  3N9H A;  3NV0 B;  1WTH A;  1NO3 A;  2KRT A;  3HIG A;  3HK4 A;  1V74 A;  1ASK A;  3LT9 A;  3CMA 3;  3F8X A;  1Y4K A;  4ZM8 A;  3MWZ A;  4HM0 B;  4NHF A;  2A15 A;  3FF0 A;  4JRF A;  2WO0 A;  1IDP A;  1SIH A;  1LXE A;  1TP6 A;  2CIU A;  3B4P A;  2OOV A;  3DGL A;  3CCU 3;  1CYV A;  4FMC A;  3F14 A;  2CHC A;  5CXO A;  1O7N B;  3JVC A;  2CK3 H;  1JB5 A;  3GZY B;  3Q2P A;  1ROV A;  1N8Q A;  3NQY A;  2WGQ A;  1ISK A;  1R4C A;  1JB2 A;  3NM7 A;  2F86 B;  1VQ8 3;  2IMJ A;  3WA2 X;  2O3O A;  1JN5 B;  5IEP A;  3GRD A;  4L8O A;  1RRH A;  3GWR A;  5KP4 A;  1S5A A;  1YHQ 3;  4MMZ B;  4U13 A;  4Q53 A;  1FUW A;  3MHE A;  3JUN A;  4R9L A;  2F99 A;  2OCT A;  3UNL A;  4FMD A;  4X2O A;  3LXU X;  2F98 A;  1HU9 A;  5DRE A;  2MF7 A;  2GBW B;  1W6Y A;  2RFR A;  3IMA B;  5A0O B;  1ZO2 A;  2CFL A;  2JQ5 A;  2KCD A;  3X3Y A;  5IW9 A;  3PZW A;  2LYX A;  2YFL B;  5EVH A;  2BMR B;  2GEY A;  3V92 A;  3EBT A;  3QK9 A;  2XH9 A;  4HM8 B;  4LGQ A;  3OWS A;  3SED A;  3N8B A;  5BXQ A;  3CPO A;  3KZT A;  3CCL 3;  1AVL A;  3ER7 A;  2L4V A;  2XSH B;  3EHC A;  3DZL A;  4J9A A;  1JKG A;  2OWP A;  3S67 A;  4EYC A;  2W0Q A;  3K0Z A;  4STD A;  3F9S A;  2HMN B;  3G71 3;  2E2V A;  3X3X A;  3U1W A;  1IQ8 A;  1Q81 4;  2BT3 A;  4WHA A;  1FGM A;  4WYK A;  2Z6B A;  1E97 A;  4LZI A;  1PU4 A;  2RCD A;  3MKI A;  3CXC 2;  1JB4 A;  3GZX B;  2ML5 A;  2P0M A;  3T8N A;  3F7X A;  1K28 A;  1IVU A;  3DGM A;  1AVK A;  4HM5 B;  2CFD A;  4MMX B;  1FGO A;  3KKG A;  1GY7 A;  2BMQ B;  1JJ2 2;  3HX8 A;  3SXX A;  4FCZ A;  3NBB A;  3CPW 2;  1VQM 3;  5AIF A;  4HM4 B;  3EB8 A;  3LTD A;  2ML6 A;  4GB5 A;  3WA3 A;  4HZ9 B;  1JRQ A;  4LMI A;  3G16 A;  2QA4 3;  1IVW A;  4H3U A;  3HZP A;  4EBG A;  3PS8 A;  4FCJ A;  5G2G A;  1LOX A;  1U5O A;  1SQW A;  3DUK A;  1FA3 A;  3MYT A;  4O02 B;  3WMD A;  2YFJ B;  1K41 A;  2IUJ A;  1OGZ A;  4FR9 A;  1W6C A;  1KSI A;  1W6G A;  1TIJ A;  2INX A;  3OX9 A;  1UW1 A;  3NQZ A;  5FW5 A;  3I55 3;  1DMM A;  5ELU A;  1W4N A;  8CHO A;  2PZV A;  3VGN A;  3AMO B;  3JUO A;  1Q40 B;  2KXG A;  3H51 A;  1MOL A;  3K5T A;  1STF I;  2HMM B;  4N6U A;  3CNM A;  4CDL A;  4HYZ A;  3EN8 A;  2W56 A;  3NBJ A;  3PXM A;  1QAK A;  1E3R A;  1GD4 A;  3PCR A;  4I4K A;  4RZM A;  3KE7 A;  4CCV A;  3X41 A;  4R1K A;  1YGE A;  4BTY A;  1M1X B;  3EC9 A;  1IK3 A;  1US1 A;  1JV2 B;  4N6O B;  1A90 A;  4OK0 A;  5CLK A;  3HI7 A;  3STD A;  1D6Y A;  2ZL8 A;  3CCR 3;  4K1V A;  1EQK A;  3LML A;  5D81 A;  1IV7 A;  3SOY A;  5AEW B;  1OUN A;  4MEI A;  1IU7 A;  3BNE A;  4H61 A;  3LZA A;  2M7O A;  3CCM 3;  4AKZ A;  5AI1 A;  3CCS 3;  3FG4 A;  2CFK A;  1JN5 A;  1EG9 B;  1SPU A;  1VZZ A;  4N3V A;  1L5G B;  2W56 B;  3DY5 A;  3RDE A;  3EF8 A;  3G8Z A;  2B1X B;  4HM1 B;  3T0U A;  1YIJ 3;  1QVG 2;  3OWY A;  4XDW A;  2WGO A;  3X40 A;  1IVV A;  3SOA A;  2UX0 A;  4K1U A;  1G96 A;  4TX4 A;  4WYK B;  5IF6 A;  1RN7 A;  1NWW A;  5TGN A;  1C7H A;  4XBY A;  1IVX A;  1O7P B;  1OF5 A;  5STD A;  3OV4 A;  5IG4 A;  2XF3 A;  3FG3 A;  5AYR B;  3FSD A;  4WFO A;  3B8L A;  3UJM A;  2Z76 A;  1M90 4;  1CEW I;  2FXT A;  3B7C A;  2Z77 A;  3FCS B;  1O7H B;  3K9M C;  4IT7 A;  4RBN A;  2W6J H;  6STD A;  1S72 3;  2W9P A;  3D9R A;  4KFD A;  5AIG A;  2RGQ A;  2BO9 B;  3V99 A;  3X3Z A;  3MPH A;  3IJE B;  2E2U A;  1YIT 3;  4QWT A;  4L8P A;  2RSX A;  3NHX A;  2B24 B;  3UL5 A;  2Y73 A;  3CCJ 3;  2HMK B;  3KFQ C;  2XGN A;  2CFG A;  3OWU A;  2GBX B;  4XB5 A;  2O9U X;  1FGQ A;  4JF8 A;  3CC4 3;  1EA2 A;  5D82 A;  1OHS A;  1D6Z A;  1OH0 A;  1WMP A;  5AII A;  1W02 A;  4KZ1 A;  4R9K A;  2P0X A;  2XR8 B;  1Q42 A;  4KVH A;  5IEO A;  4XBX A;  1ULJ B;  1DYU A;  2CH9 A;  1NB3 I;  1CYU A;  1RJO A;  4L7K A;  4FMB A;  1ZX2 A;  4BTW A;  1RRL A;  1VQ4 3;  3F7S A;  3LTA A;  4O8S A;  3U97 A;  3NX0 A;  5AEU B;  4HVN A;  4HM3 B;  1K8A 4;  1DMN A;  2P38 A;  4HM6 B;  4HZB B;  1LNH A;  4HJL B;  3F40 A;  4OUQ A;  5D83 A;  3SX1 A;  1Q40 A;  3BND A;  3CCQ 3;  1N8R 4;  1NJI 4;  3H3H A;  1VQO 3;  1A2V A;  1OGX A;  5BVB A;  1ULI B;  1VQ5 3;  3N54 B;  1BUQ A;  1VQ7 3;  2FNQ A;  3VSY A;  4N6M A;  3S28 A;  5DRV A;  2CWU A;  5HGR A;  2CG1 A;  3NV0 A;  3ROB A;  3I56 3;  2HMJ B;  2YX9 A;  3KSP A;  3VF1 A;  2E2T A;  3MG1 A;  3RGA A;  1LVN A;  1O7M B;  5CF1 A;  3NXJ A;  4FCM A;  3GZR A;  2K0M A;  1IQX A;  5IG3 A;  3FKA A;  4WWU C;  3DMC A;  1W2B 2;  1UI7 A;  2PNC A;  3NUV A;  3CD6 3;  2HML B;  3JUM A;  3T8U A;  3TDG A;  1U8C B;  2BHM A;  4PEJ A;  5LC7 A;  1M1K 4;  1QJG A;  2YFI B;  2C11 A;  3FLJ A;  1N5P A;  3FH1 A;  1OPY A;  2WOH A;  5JPU A;  3E99 A;  1K9M 4;  3MSO A;  5JBS A;  1DVC A;  1QAF A;  2OQE C;  4AEQ A;  1AV4 A;  2BNG A;  4N6N B;  2OTJ 3;  1QAL A;  1Q7Y 4;  3AMO A;  3EE1 A;  4LEH A;  4EXR A;  3GZB A;  3CCV 3;  1D6U A;  1CQS A;  3UB1 A;  1TUH A;  2XGL A;  3Q90 A;  1VQP 3;  1UUW B;  1FGR A;  4R4K A;  1YJW 3;  3O8Y A;  1YJ9 3;  3SVA A;  1W00 A;  2JDI H;  3JUQ A;  4O2H A;  4RNY A;  1N9J A;  1WMN A;  3MG3 A;  3BNB A;  4K61 A;  1GYB A;  7STD A;  1HKX A;  4NRE A;  1K73 4;  3SLU A;  2Z7A A;  3CNX A;  1RKY A;  4N6V 0;  4AKY A;  3FZW A;  3LYG A;  2GEX A;  1WMO A;  2XEP A;  3KSE D;  1O7W B;  4GL6 A;  3LTC A;  3OW2 2;  2MC8 A;  1E3V A;  2CWT A;  4EV2 A;  4R80 A;  5LC6 A;  3EJV A;  3WDG B;  3PGB A;  3Q1C A;  5IG5 A;  2GXF A;  5AYS C;  4EV5 A;  2HMO B;  3KII A;  2XRX B;  1QMA A;  4HKV B;  1DMQ A;  3S29 A;  5IEN A;  3WOE B;  1KD1 4;  3OXA A;  5ELJ A;  4MJD A;  3QRD A;  4KFE A;  3S5C A;  5FGO A;  1KQS 2;  3NM2 A;  1GS3 A;  5EQL A;  3WOD G;  4LSO A;  2P09 A;  2D1W A;  1IV9 A;  1F8N A;  1SJW A;  3F8H A;  5EEO A;  1T5Y A;  4XDV A;  4WP5 A;  2IUK A;  1FGT A;  1W7C A;  1YVB I;  3DM8 A;  4J8T A;  1VQL 3;  1PFP A;  2P05 A;  3ALA A;  5I97 A;  3IPT A;  3BB9 A;  4XBT A;  2XFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...