5EQLA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
82
Chain Sequence
SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-Affirmer-S2D5
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 13
structure length 82
sequence length 88
ec nomenclature
pdb deposition date 2015-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eqlA00
3LH4A 4ZM8A 1R4CA 1A67A 2W9PA 5EQLA 1MOLA 3S67A 1NB5I 1NB3I 1ROAA 5ELJA 3UL6A 3IMAB 1N5HA 1WNHA 1YVBI 2KXGA 4N6UA 3UL5A 3MWZA 1STFI 4TX4A 1PFPA 4CCVA 1FUWA 4N6LA 2OCTA 3K9MC 2BO9B 1M9GA 1CYUA 4N6V0 1CEWI 3PYJA 5LC6A 5A0OB 4EYCA 2W9QA 3SVAA 3PXMA 1CYVA 1EQKA 1LXEA 1DVCA 1TIJA 4N6TA 2CH9A 3GAXA 4N6OB 4N6MA 3QRDA 3KFQC 5LC7A 4IT7A 1A90A 1N5PA 3KSED 2O9UX 1GD4A 1N9JA 4N6NB 1FA3A 4LZIA 1DVDA 1IV7A 1GD3A 1MNLA 3PS8A 3L0RA 1IV9A 1RN7A 1G96A 3Q2PA 3NX0A 5ELUA 1KWIA
chains in the Genus database with same CATH superfamily
3LH4A 1Q7Y4 1JN5B 2W9PA 3KE7A 4J8TA 2Z76A 3AGOA 1K9M4 1EG9B 1ULIB 1ROAA 4O8SA 3WHOA 3X3YA 3I553 1NJI4 2KCDA 3CC73 2P09A 3M8CA 3SLUA 1N5HA 4QWTA 1Q40B 3Q90A 1GOUA 2CFGA 3ECFA 1QAFA 4FR9A 3URPA 4EW5A 3V92A 5CF1A 1JZDA 1RRLA 4XBXA 3NQZA 1M1XB 1FW7A 1YJ93 3LTAA 4HM3B 1SJWA 1SPUA 5AYSC 2CFDA 4ORLA 3U1WA 3DMCA 3T8NA 3CCE3 3ALAA 1JB4A 3S5CA 1TTOA 1ROVA 3JUQA 3NHXA 2KF3A 2ML5A 3DY5A 4KVHA 4O2HA 1IK3A 4FCMA 1RJOA 3PCRA 3F40A 1BUJA 1GY7A 5BU4A 6GSPA 1DE3A 1BSBA 4N6LA 4CJNA 3HIIA 2OCTA 2IUJA 3HZPA 3CXC2 2Q07A 3T0UA 2R4IA 1LOXA 3LOYA 4J5GA 1I2FA 1RGGA 2R41A 4IIAA 3B8LA 1VZZA 3DH2A 1JN5A 3PYJA 4MJDA 5LC6A 1QVF2 1VQ83 7RNTA 2ZA4A 1YIT3 2KF4A 3KN4A 1RN4A 2F99A 1IVWA 4OVMA 3CPOA 5AI1A 1PY3A 4Q53A 4WWUC 1YGEA 3F7XA 3LZAA 3FCSB 3OWSA 1VQ73 5AEUB 1RMSA 1Q40A 1QJGA 1S723 1TIJA 2L1SA 2LYXA 4N6TA 3V99A 5FW5A 3GAXA 4HM7B 1EKMA 2GSPA 2B1XB 3SEDA 1VQP3 1W4NA 4N6MA 4KZ1A 1BSCA 1IVUA 1T3BA 3BB9A 3LTCA 5EEOA 1BVIA 4RNYA 1ZX2A 3K7CA 1K734 3DXOA 2F5WA 2CG1A 1OPYA 5IEPA 1NO3A 4FCJA 1RKYA 2L4VA 4DKIA 2O9UX 4RZMA 1GD4A 1I3IA 3CNXA 1C7HA 2CX1A 1PU4A 2JDIH 5M18A 2ZL8A 2UX0A 3CU3A 3GRDA 3OW22 3D9RA 1FGQA 4G1MB 3O8YA 1DMNA 4LZIA 4GHOA 3K5TA 4HYZA 1D6ZA 1IV7A 2W6JH 1GD3A 1QAKA 3X42A 1RGCA 2OTL3 3ROBA 1UGHI 4HKVB 4KFFA 1NNVA 3AGNA 3L0RA 4MEIA 3SXXA 1QMAA 1BRJA 1I0XA 3GWRA 5KP4A 3CCR3 1RN7A 1R4YA 3AHSA 2ZHXB 5AYRB 4K1VA 1BNEA 4HM4B 2UGIA 3I563 1EA2A 3A76A 4XDWA 5JPPA 3CCQ3 1BNIA 1JV2B 3NX0A 5ELUA 1VQ53 3LXUX 1OGXA 1V74A 4K90B 1SARA 4ZM8A 2A15A 4FCZA 2GEYA 3K63A 3WMDA 3EN8A 1DETA 4J9AA 1IQXA 1K41A 3G6E3 1OH0A 4LEHA 1JB2A 2BHMA 4K61A 5STDA 3S67A 1O7PB 3ZG5A 1C54A 2IA7A 1GSPA 2E2UA 3UL6A 4XBTA 2P05A 3I0YA 3CPW2 2LQVA 3FLJA 1O7WB 3FG4A 4L8PA 3WDGB 3NUVA 5IG3A 5IW9A 2XGLA 3FZWA 3MG2A 2XGNA 5AIGA 1BAOA 2GU3A 3DGOA 3VSYA 1N8R4 5JBSA 5CXOA 2CWUA 1O7NB 1W5ZA 1YVSA 3LT8A 4R4KA 3RGRA 1T5YA 1MWSA 2IUKA 3HOHA 3UL5A 4O02B 1LVNA 1X1UA 4WYKB 2J8XB 1FGRA 2CW9A 3X3ZA 1FUTA 2RNTA 1VQQA 2XEPA 3F7SA 4TX4A 5IENA 1Q42A 3U97A 1Q864 1OCVA 3N9HA 1PYLA 3GZXB 2D42A 1GYBA 3CCV3 3FG1A 4BL2A 3UNLA 1FUWA 1I3FA 3K9MC 5IG5A 5CLKA 3CD63 2AADA 1F8NA 3EF8A 4EV5A 3EC9A 2CIUA 1OHSA 4WP5A 2HMOB 3PGBA 3SYUA 3S27A 1D6UA 3EJVA 1ISKA 1JRQA 1VQL3 2CWTA 1O7GB 4J5KA 1MGWA 4EYCA 1RCKA 1TUHA 1IYYA 2H0HA 1W2B2 3PXMA 1CYVA 1EQKA 4U13A 2BNGA 1LXEA 2CFLA 4BL3A 1B2SA 2IMJA 5D81A 3LTDA 3RGAA 4X2HA 4HM5B 2GBXB 1FUSA 4MMYB 3F14A 1KSIA 1ASKA 1JZOA 2QEX3 1YJN3 1QVG2 1LQGC 1UI8A 4N6OB 1JBRA 1HZ1A 2UUGC 2HMKB 2BMRB 5KP3A 1UUGB 1MWRA 6STDA 3AHWA 2O3OA 3MG1A 1UUWB 3KIIA 3KFQC 4R80A 1STDA 2OQEA 5LC7A 4WYKA 3X3XA 1Q814 1N5PA 1WTHA 3BNCA 1B2MA 1WMPA 4WHAA 4HM8B 2D1WA 3KSED 3J7Yd 2YFIB 4MMZB 3BIRA 4HM6B 1K8A4 3H3HA 1TP6A 3LTBA 3F8XA 3G4S3 1HU9A 1UCJA 1RHLA 3FF2A 4CDLA 3JUNA 2FNQA 2GXFA 1YIJ3 1GOYA 3GSPA 1RNTA 1RGKA 4R9KA 1Q9EA 3IJEB 3OWUA 1B2XA 2CX0A 4H3UA 4ILFA 1UW1A 5KP1A 3D5GA 1G02A 5AIIA 1O7MB 2BT3A 2KAAA 3EBTA 4OUQA 3CMA3 1E3RA 1BRHA 4BU4A 2WGOA 1BNRA 4FMCA 1IV9A 4MMXB 1KC84 2W2CA 3G8ZA 4HJLB 1B2UA 2HMJB 3BNEA 1RGFA 1BU4A 1W6GA 3CCJ3 3WA3A 1TFOA 3NBRA 1U8CB 1U5OA 1YNVX 2ML6A 4WFOA 3Q1CA 1B20A 4HM1B 1GS3A 3LT9A 3ER7A 3AMOB 2STDA 1A67A 5EQLA 4KFDA 4HAAA 4KT3B 3WOFB 2CFWA 1X1WA 5IG0A 1NB5I 1NB3I 2KF6A 3NM7A 2C4BA 1IQYA 4JRFA 1MWTA 4GSPA 1VQ63 4R9LA 2HMMB 1CH0A 4I5QA 3IMAB 4PEJA 4BIRA 5IERA 1WNHA 1OACA 1G0TA 1YJW3 2ZDJA 4EC6A 2SARA 4RNTA 3DUKA 2Z7AA 3VF1A 1B3SA 1N9EA 1I70A 5I97A 3CCL3 1A2KA 1FYSA 1RLSA 2JQ5A 1BOXA 3JUPA 3CCS3 3OXAA 1BRIA 2WO0A 3MWZA 2RGQA 3HI7A 1JB5A 2F56A 2P38A 4R1KA 5DRVA 4I4KA 1DMMA 5G1LA 3SOAA 4FMAA 8CHOA 4LGQA 1HYFA 1Q7HA 2B24B 1GMRA 5GSPA 2E2VA 2QA43 1FGTA 1US1A 1YHQ3 3TDGA 2GBWB 1MGRA 3JUMA 1YGWA 1I0VA 3KKGA 1SQWA 3OX9A 2F86B 3LYGA 4CCVA 5AEWB 1BNSA 2CG0A 2F5MA 1BUQA 1AY7A 1M9GA 4HZBB 1CYUA 4RNZA 3HK4A 3SX1A 1IVVA 1TRQA 1JBSA 1QALA 1ULJB 1X1YA 3AMOA 1RCLA 3RDEA 4H61A 5A0OB 1BRGA 1W7CA 1ZO2A 2XR8B 7GSPA 1LQMB 1WMNA 3OWYA 2AAEA 2W9QA 1EUIC 4LYLB 3EE1A 3DZLA 4AEQA 2CFKA 4OK0A 3HX8A 3FG3A 4AKZA 1NDOB 4LSOA 1BGSA 1NU3A 2SBLA 2W04A 5G1KA 3UJMA 5BVBA 1LOVA 1VQ93 1E97A 3MKIA 1BANA 2OOVA 3NXJA 1Z1SA 1RGHA 5HOHA 3CCU3 1NWWA 1V58A 1WQLB 1UDII 2IY2A 1ZS7A 2WOFA 3E99A 1X1XA 2PZVA 3G16A 3OV4A 3JVCA 3X40A 1A90A 1A2VA 1IDPA 1EEJA 1UUVB 2RFRA 1WMOA 1GMQA 2Y74A 3G713 4HM0B 4XDVA 1W6YA 5BXQA 1N9JA 1I2GA 1UI7A 2W56B 1IT8A 3DGMA 1D6YA 2Z77A 1M1K4 1TFKA 2INXA 3ZG0A 1FA3A 2C10A 4AKYA 2I9WA 2RBIA 3S29A 1DVDA 2F98A 1BSDA 1UCIA 5EVHA 5CF2A 3STDA 1M904 1AV4A 2HOHA 1FGOA 2RCDA 2H0GA 2YFLB 3CNMA 3MSOA 2FGTA 3MG3A 4STDA 3WA2X 5RNTA 2QGUA 1K28A 3D5IA 5G2GA 4L7KA 3D79A 3EQQB 3KSPA 3PS8A 4GB5A 5AIHA 1L5GB 1FZUA 1AVLA 2OQEC 3NBBA 5IG4A 1T2IA 1VQO3 1RNBA 2BMQB 4XM4A 3DGYA 3GZBA 3PZWA 2QIYA 1BIRA 2XFSA 2YX9A 1BSEA 5D82A 2MC8A 3K0ZA 7STDA 4HM2B 1LNHA 1DMQA 1BRNL 4O3VA 3FGYA 1RDSA 1RGLA 2V1LA 1I8VA 1IU7A 2E2TA 2H0IA 3EBYA 1KD14 1KWIA 1AVKA 3NQYA 1B21A 1R4CA 4KFEA 1CQSA 1A2PA 2XH9A 3WODG 1O7HB 1TU5A 3FH1A 5IF6A 1MOLA 1GY6A 3CC23 4N3VA 3BLZA 1YI23 3EB8A 4NPBA 4HVNA 4IPBA 5ELJA 1FGMA 1UGIA 1AR0A 1RSNA 1IQ8A 1J2BA 2K3DA 3BU4A 2W56A 5JPUA 3N54B 9RNTA 1VQN3 1YVBI 2KXGA 2XRXB 2GEXA 1BNGA 1BSAA 4N6UA 2W0QA 3B4PA 4EBGA 1OHPA 2FXTA 1OF5B 1OGZA 1RN1A 3BNBA 2HMNB 2YFJB 4XBYA 3FKAA 3WR2A 2CK3H 4LMIA 2M7OA 1UCLA 3A5EA 1BNJA 1TJDA 4BTXA 1VQK3 1STFI 1HKXA 1PFPA 3B4OA 3F8HA 5TGNA 1JNQA 3V98A 1Y4KA 3X41A 2P0MA 1UCKA 2RSXA 1W6CA 1TRPA 4HZ9B 2K0MA 4EXRA 4CPKA 4JF8A 3DGLA 3FF0A 3VGNA 2IYJA 2BMOB 4RBNA 1LOWA 5BIRA 1Q824 3SOYA 2CKFB 2BO9B 2GU1A 3GZRA 5AIFA 1JKGB 2CWVA 3LMLA 3DGNA 4EV2A 2WOHA 4N6V0 1DYUA 1CEWI 1GY5A 3S28A 8RNTA 2K54A 1B2ZA 4HOHA 5HGRA 3G0KA 1BRSA 3JUOA 4GL6A 3CCM3 1KQS2 3NBJA 3SVAA 2KF5A 1LNIA 1ZGXA 2HMLB 3CME3 1VQM3 1JJ22 2CHCA 1V57A 3H51A 1DVCA 3IPTA 3NV0B 1IT7A 3EX9A 1OHOA 1W01A 3D4AA 2CH9A 1AQZA 2XF3A 2PNCA 3DM8A 1OF5A 4K1UA 5DREA 2P0XA 3QRDA 3EN1B 2OTJ3 1RRHA 3MPHA 3N8BA 3Q3FA 3ZFZA 3EHCA 1LRAA 3WOEB 5M1AA 4BTWA 4IT7A 2W03A 2WGQA 3D3LA 1BRKA 3KCHA 1I2EA 1VQ43 1S5AA 2KRTA 1T2HA 4X2OA 3HIGA 2XFTA 3MYTA 3KZTA 3T8UA 2MF7A 2BIRA 1MWUA 1W02A 4N6NB 4NREA 1B27A 1RGAA 2OWPA 2CC3A 3GZYB 2XSHB 5D83A 4BTYA 1IVXA 2BU4A 5CK6A 2Z6BA 4XB5A 3CC43 4HBRA 1N8QA 5M19A 2F4YA 1JKGA 3RNTA 1RTUA 2XSOB 3UB1A 3F9SA 1OUNA 1RGEA 2OOVC 1MNLA 3QK9A 1SIHA 4FMDA 3FSDA 3B7CA 5FGOA 4L8OA 2Y73A 1E3VA 1G96A 2C11A 6RNTA 1GOVA 3NV0A 4NHFA 4FMBA 1SIIA 1W2ZA 3MHEA 3PCSA 3Q2PA 1BNFA 1JBTA 1W00A 3NM2A 1LOYA 1GMPA 5IEOA 3BNDA
chains in the Genus database with same CATH topology
3LH4A 1Q7Y4 1JN5B 2W9PA 3KE7A 4J8TA 2Z76A 1K9M4 1EG9B 1ULIB 1ROAA 4O8SA 3X3YA 3I553 1NJI4 2KCDA 3CC73 2P09A 3M8CA 3SLUA 1N5HA 4QWTA 1Q40B 3Q90A 2CFGA 3ECFA 1QAFA 4FR9A 3V92A 5CF1A 1RRLA 4XBXA 3NQZA 1M1XB 1YJ93 3LTAA 4HM3B 1SJWA 1SPUA 5AYSC 2CFDA 4ORLA 3U1WA 3DMCA 3T8NA 3CCE3 3ALAA 1JB4A 3S5CA 3NHXA 1ROVA 3JUQA 2ML5A 3DY5A 4KVHA 4O2HA 1IK3A 4FCMA 1RJOA 3PCRA 3F40A 1GY7A 4N6LA 3HIIA 2OCTA 2IUJA 3HZPA 3CXC2 2Q07A 3T0UA 2R4IA 1LOXA 3LOYA 4IIAA 3B8LA 1VZZA 4MJDA 1JN5A 3PYJA 1QVF2 5LC6A 1VQ83 1YIT3 3KN4A 2F99A 1IVWA 4OVMA 3CPOA 5AI1A 4Q53A 4WWUC 1YGEA 3F7XA 3LZAA 3FCSB 3OWSA 1VQ73 5AEUB 1Q40A 1QJGA 1S723 1TIJA 2LYXA 3V99A 4N6TA 5FW5A 3GAXA 4HM7B 1EKMA 2B1XB 3SEDA 1VQP3 1W4NA 4N6MA 4KZ1A 1IVUA 3BB9A 3LTCA 5EEOA 4RNYA 1ZX2A 3K7CA 1K734 3DXOA 2CG1A 1OPYA 5IEPA 1NO3A 4FCJA 1RKYA 2L4VA 2O9UX 4RZMA 1GD4A 3CNXA 1C7HA 1PU4A 2JDIH 2ZL8A 2UX0A 3CU3A 3GRDA 3OW22 3D9RA 1FGQA 4G1MB 3O8YA 1DMNA 4LZIA 3K5TA 4HYZA 1D6ZA 1IV7A 2W6JH 1GD3A 1QAKA 3X42A 2OTL3 3ROBA 4HKVB 4KFFA 3L0RA 4MEIA 3SXXA 1QMAA 3GWRA 5KP4A 3CCR3 1RN7A 5AYRB 4K1VA 4HM4B 3I563 1EA2A 3A76A 4XDWA 5JPPA 3CCQ3 1JV2B 3NX0A 5ELUA 1VQ53 3LXUX 1OGXA 1V74A 4K90B 4ZM8A 2A15A 4FCZA 2GEYA 3K63A 3WMDA 3EN8A 4J9AA 3G6E3 1IQXA 1K41A 1OH0A 4LEHA 1JB2A 2BHMA 4K61A 5STDA 3S67A 1O7PB 2IA7A 2E2UA 3UL6A 4XBTA 2P05A 3I0YA 3CPW2 2LQVA 3FLJA 1O7WB 3FG4A 4L8PA 3WDGB 3NUVA 5IG3A 5IW9A 2XGLA 3FZWA 3MG2A 2XGNA 5AIGA 2GU3A 3DGOA 3VSYA 1N8R4 5JBSA 5CXOA 2CWUA 1O7NB 1W5ZA 3LT8A 4R4KA 3RGRA 1T5YA 2IUKA 3UL5A 4O02B 1LVNA 4WYKB 1FGRA 2CW9A 3X3ZA 2XEPA 5IENA 3F7SA 4TX4A 1Q42A 3U97A 1Q864 1OCVA 3N9HA 3GZXB 2D42A 1GYBA 3CCV3 3FG1A 1FUWA 3UNLA 3K9MC 5IG5A 5CLKA 3CD63 1F8NA 3EF8A 4EV5A 3EC9A 2CIUA 1OHSA 4WP5A 2HMOB 3PGBA 1ISKA 3S27A 1D6UA 3EJVA 1JRQA 1VQL3 2CWTA 1O7GB 4EYCA 1TUHA 1W2B2 3PXMA 1CYVA 1EQKA 4U13A 2BNGA 1LXEA 2CFLA 2IMJA 5D81A 3LTDA 3RGAA 4X2HA 4HM5B 2GBXB 4MMYB 3F14A 1KSIA 1ASKA 2QEX3 1YJN3 1QVG2 1UI8A 4N6OB 2HMKB 2BMRB 5KP3A 6STDA 3MG1A 2O3OA 1UUWB 3KIIA 3KFQC 4R80A 1STDA 2OQEA 5LC7A 4WYKA 3X3XA 1Q814 1N5PA 1WTHA 3BNCA 1WMPA 4WHAA 4HM8B 2D1WA 3KSED 3J7Yd 2YFIB 4MMZB 4HM6B 1K8A4 3H3HA 1TP6A 3LTBA 3F8XA 3G4S3 1HU9A 3FF2A 4CDLA 3JUNA 2FNQA 2GXFA 1YIJ3 4R9KA 3IJEB 3OWUA 4H3UA 1UW1A 5KP1A 5AIIA 1O7MB 2BT3A 3EBTA 4OUQA 3CMA3 1E3RA 2WGOA 4FMCA 1IV9A 4MMXB 1KC84 2W2CA 3G8ZA 4HJLB 2HMJB 3BNEA 1W6GA 3CCJ3 3WA3A 1TFOA 3NBRA 1U8CB 1U5OA 2ML6A 4WFOA 3Q1CA 4HM1B 1GS3A 3LT9A 3ER7A 3AMOB 2STDA 1A67A 5EQLA 4KFDA 3WOFB 2CFWA 5IG0A 1NB5I 1NB3I 3NM7A 4JRFA 1IQYA 1VQ63 4R9LA 2HMMB 3IMAB 4PEJA 5IERA 1WNHA 1OACA 1YJW3 2ZDJA 4EC6A 3DUKA 2Z7AA 3VF1A 1N9EA 3CCL3 5I97A 1A2KA 2JQ5A 3JUPA 3CCS3 3OXAA 2WO0A 3MWZA 2RGQA 3HI7A 1JB5A 4R1KA 2P38A 5DRVA 3SOAA 4I4KA 1DMMA 8CHOA 4FMAA 4LGQA 2B24B 1YHQ3 2QA43 2E2VA 1FGTA 1US1A 3TDGA 2GBWB 3JUMA 3KKGA 1SQWA 3OX9A 2F86B 3LYGA 4CCVA 5AEWB 2CG0A 1BUQA 1M9GA 4HZBB 1CYUA 4RNZA 3HK4A 3SX1A 1IVVA 1QALA 1ULJB 3AMOA 3RDEA 4H61A 5A0OB 1W7CA 1ZO2A 2XR8B 1WMNA 3OWYA 2W9QA 3EE1A 3DZLA 4AEQA 2CFKA 4OK0A 3HX8A 3FG3A 4AKZA 1NDOB 4LSOA 1NU3A 2SBLA 2W04A 3UJMA 5BVBA 1VQ93 1E97A 3MKIA 2OOVA 3NXJA 1Z1SA 3CCU3 1NWWA 1WQLB 3E99A 2WOFA 2PZVA 3G16A 3OV4A 3JVCA 3X40A 1A90A 1A2VA 1IDPA 1UUVB 2RFRA 1WMOA 2Y74A 3G713 4HM0B 4XDVA 1W6YA 5BXQA 1N9JA 1UI7A 2W56B 1IT8A 3DGMA 1D6YA 2Z77A 1M1K4 1TFKA 2INXA 1FA3A 2C10A 4AKYA 2I9WA 3S29A 1DVDA 2F98A 5EVHA 5CF2A 3STDA 1M904 1AV4A 2YFLB 1FGOA 2RCDA 3MSOA 3CNMA 2FGTA 3MG3A 4STDA 3WA2X 2QGUA 1K28A 5G2GA 4L7KA 3EQQB 3KSPA 3PS8A 4GB5A 5AIHA 1L5GB 1AVLA 2OQEC 3NBBA 5IG4A 1VQO3 2BMQB 4XM4A 3GZBA 3PZWA 2QIYA 2XFSA 2YX9A 5D82A 2MC8A 3K0ZA 7STDA 4HM2B 1LNHA 1DMQA 4O3VA 3FGYA 2V1LA 1IU7A 2E2TA 3EBYA 1KD14 1KWIA 1AVKA 3NQYA 1R4CA 4KFEA 1CQSA 2XH9A 3WODG 1O7HB 1TU5A 3FH1A 5IF6A 1MOLA 1GY6A 3CC23 4N3VA 3BLZA 1YI23 3EB8A 4HVNA 4IPBA 5ELJA 1FGMA 1AR0A 1IQ8A 1J2BA 2W56A 5JPUA 3N54B 1VQN3 1YVBI 2KXGA 2XRXB 2GEXA 4N6UA 2W0QA 3B4PA 4EBGA 1OHPA 2FXTA 1OF5B 1OGZA 3BNBA 2HMNB 2YFJB 4XBYA 3FKAA 2CK3H 4LMIA 2M7OA 4BTXA 1VQK3 1STFI 1HKXA 1PFPA 3B4OA 3F8HA 5TGNA 1JNQA 3V98A 1Y4KA 3X41A 2P0MA 2RSXA 4HZ9B 1W6CA 2K0MA 4EXRA 4JF8A 3DGLA 3FF0A 3VGNA 1Q824 2BMOB 4RBNA 3SOYA 2CKFB 2BO9B 2GU1A 3GZRA 5AIFA 1JKGB 2CWVA 3LMLA 3DGNA 4EV2A 2WOHA 4N6V0 1DYUA 1CEWI 1GY5A 3S28A 2K54A 5HGRA 3G0KA 3JUOA 4GL6A 1KQS2 3CCM3 3NBJA 3SVAA 2HMLB 3CME3 1VQM3 1JJ22 2CHCA 3H51A 1DVCA 3IPTA 3NV0B 1IT7A 3EX9A 1OHOA 1W01A 2CH9A 2XF3A 2PNCA 3DM8A 1OF5A 4K1UA 5DREA 2P0XA 3QRDA 3EN1B 2OTJ3 1RRHA 3MPHA 3N8BA 3EHCA 3WOEB 4BTWA 4IT7A 2W03A 2WGQA 3D3LA 1VQ43 1S5AA 2KRTA 4X2OA 3HIGA 2XFTA 3MYTA 3KZTA 3T8UA 2MF7A 1W02A 4N6NB 4NREA 2OWPA 2CC3A 3GZYB 2XSHB 5D83A 4BTYA 1IVXA 5CK6A 2Z6BA 4XB5A 3CC43 4HBRA 1N8QA 1JKGA 2XSOB 3UB1A 3F9SA 1OUNA 2OOVC 1MNLA 3QK9A 1SIHA 4FMDA 3FSDA 3B7CA 5FGOA 4L8OA 2Y73A 1E3VA 1G96A 2C11A 3NV0A 4NHFA 4FMBA 1SIIA 1W2ZA 3MHEA 3PCSA 3Q2PA 1W00A 3NM2A 5IEOA 3BNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH4 A;  4ZM8 A;  1R4C A;  1A67 A;  2W9P A;  5EQL A;  1MOL A;  3S67 A;  1NB5 I;  1NB3 I;  1ROA A;  5ELJ A;  3UL6 A;  3IMA B;  1N5H A;  1WNH A;  1YVB I;  2KXG A;  4N6U A;  3UL5 A;  3MWZ A;  1STF I;  4TX4 A;  1PFP A;  4CCV A;  1FUW A;  4N6L A;  2OCT A;  3K9M C;  2BO9 B;  1M9G A;  1CYU A;  4N6V 0;  1CEW I;  3PYJ A;  5LC6 A;  5A0O B;  4EYC A;  2W9Q A;  3SVA A;  3PXM A;  1CYV A;  1EQK A;  1LXE A;  1DVC A;  1TIJ A;  4N6T A;  2CH9 A;  3GAX A;  4N6O B;  4N6M A;  3QRD A;  3KFQ C;  5LC7 A;  4IT7 A;  1A90 A;  1N5P A;  3KSE D;  2O9U X;  1GD4 A;  1N9J A;  4N6N B;  1FA3 A;  4LZI A;  1DVD A;  1IV7 A;  1GD3 A;  1MNL A;  3PS8 A;  3L0R A;  1IV9 A;  1RN7 A;  1G96 A;  3Q2P A;  3NX0 A;  5ELU A;  1KWI A; 
#chains in the Genus database with same CATH topology
 3LH4 A;  1Q7Y 4;  1JN5 B;  2W9P A;  3KE7 A;  4J8T A;  2Z76 A;  3AGO A;  1K9M 4;  1EG9 B;  1ULI B;  1ROA A;  4O8S A;  3WHO A;  3X3Y A;  3I55 3;  1NJI 4;  2KCD A;  3CC7 3;  2P09 A;  3M8C A;  3SLU A;  1N5H A;  4QWT A;  1Q40 B;  3Q90 A;  1GOU A;  2CFG A;  3ECF A;  1QAF A;  4FR9 A;  3URP A;  4EW5 A;  3V92 A;  5CF1 A;  1JZD A;  1RRL A;  4XBX A;  3NQZ A;  1M1X B;  1FW7 A;  1YJ9 3;  3LTA A;  4HM3 B;  1SJW A;  1SPU A;  5AYS C;  2CFD A;  4ORL A;  3U1W A;  3DMC A;  3T8N A;  3CCE 3;  3ALA A;  1JB4 A;  3S5C A;  1TTO A;  1ROV A;  3JUQ A;  3NHX A;  2KF3 A;  2ML5 A;  3DY5 A;  4KVH A;  4O2H A;  1IK3 A;  4FCM A;  1RJO A;  3PCR A;  3F40 A;  1BUJ A;  1GY7 A;  5BU4 A;  6GSP A;  1DE3 A;  1BSB A;  4N6L A;  4CJN A;  3HII A;  2OCT A;  2IUJ A;  3HZP A;  3CXC 2;  2Q07 A;  3T0U A;  2R4I A;  1LOX A;  3LOY A;  4J5G A;  1I2F A;  1RGG A;  2R41 A;  4IIA A;  3B8L A;  1VZZ A;  3DH2 A;  1JN5 A;  3PYJ A;  4MJD A;  5LC6 A;  1QVF 2;  1VQ8 3;  7RNT A;  2ZA4 A;  1YIT 3;  2KF4 A;  3KN4 A;  1RN4 A;  2F99 A;  1IVW A;  4OVM A;  3CPO A;  5AI1 A;  1PY3 A;  4Q53 A;  4WWU C;  1YGE A;  3F7X A;  3LZA A;  3FCS B;  3OWS A;  1VQ7 3;  5AEU B;  1RMS A;  1Q40 A;  1QJG A;  1S72 3;  1TIJ A;  2L1S A;  2LYX A;  4N6T A;  3V99 A;  5FW5 A;  3GAX A;  4HM7 B;  1EKM A;  2GSP A;  2B1X B;  3SED A;  1VQP 3;  1W4N A;  4N6M A;  4KZ1 A;  1BSC A;  1IVU A;  1T3B A;  3BB9 A;  3LTC A;  5EEO A;  1BVI A;  4RNY A;  1ZX2 A;  3K7C A;  1K73 4;  3DXO A;  2F5W A;  2CG1 A;  1OPY A;  5IEP A;  1NO3 A;  4FCJ A;  1RKY A;  2L4V A;  4DKI A;  2O9U X;  4RZM A;  1GD4 A;  1I3I A;  3CNX A;  1C7H A;  2CX1 A;  1PU4 A;  2JDI H;  5M18 A;  2ZL8 A;  2UX0 A;  3CU3 A;  3GRD A;  3OW2 2;  3D9R A;  1FGQ A;  4G1M B;  3O8Y A;  1DMN A;  4LZI A;  4GHO A;  3K5T A;  4HYZ A;  1D6Z A;  1IV7 A;  2W6J H;  1GD3 A;  1QAK A;  3X42 A;  1RGC A;  2OTL 3;  3ROB A;  1UGH I;  4HKV B;  4KFF A;  1NNV A;  3AGN A;  3L0R A;  4MEI A;  3SXX A;  1QMA A;  1BRJ A;  1I0X A;  3GWR A;  5KP4 A;  3CCR 3;  1RN7 A;  1R4Y A;  3AHS A;  2ZHX B;  5AYR B;  4K1V A;  1BNE A;  4HM4 B;  2UGI A;  3I56 3;  1EA2 A;  3A76 A;  4XDW A;  5JPP A;  3CCQ 3;  1BNI A;  1JV2 B;  3NX0 A;  5ELU A;  1VQ5 3;  3LXU X;  1OGX A;  1V74 A;  4K90 B;  1SAR A;  4ZM8 A;  2A15 A;  4FCZ A;  2GEY A;  3K63 A;  3WMD A;  3EN8 A;  1DET A;  4J9A A;  1IQX A;  1K41 A;  3G6E 3;  1OH0 A;  4LEH A;  1JB2 A;  2BHM A;  4K61 A;  5STD A;  3S67 A;  1O7P B;  3ZG5 A;  1C54 A;  2IA7 A;  1GSP A;  2E2U A;  3UL6 A;  4XBT A;  2P05 A;  3I0Y A;  3CPW 2;  2LQV A;  3FLJ A;  1O7W B;  3FG4 A;  4L8P A;  3WDG B;  3NUV A;  5IG3 A;  5IW9 A;  2XGL A;  3FZW A;  3MG2 A;  2XGN A;  5AIG A;  1BAO A;  2GU3 A;  3DGO A;  3VSY A;  1N8R 4;  5JBS A;  5CXO A;  2CWU A;  1O7N B;  1W5Z A;  1YVS A;  3LT8 A;  4R4K A;  3RGR A;  1T5Y A;  1MWS A;  2IUK A;  3HOH A;  3UL5 A;  4O02 B;  1LVN A;  1X1U A;  4WYK B;  2J8X B;  1FGR A;  2CW9 A;  3X3Z A;  1FUT A;  2RNT A;  1VQQ A;  2XEP A;  3F7S A;  4TX4 A;  5IEN A;  1Q42 A;  3U97 A;  1Q86 4;  1OCV A;  3N9H A;  1PYL A;  3GZX B;  2D42 A;  1GYB A;  3CCV 3;  3FG1 A;  4BL2 A;  3UNL A;  1FUW A;  1I3F A;  3K9M C;  5IG5 A;  5CLK A;  3CD6 3;  2AAD A;  1F8N A;  3EF8 A;  4EV5 A;  3EC9 A;  2CIU A;  1OHS A;  4WP5 A;  2HMO B;  3PGB A;  3SYU A;  3S27 A;  1D6U A;  3EJV A;  1ISK A;  1JRQ A;  1VQL 3;  2CWT A;  1O7G B;  4J5K A;  1MGW A;  4EYC A;  1RCK A;  1TUH A;  1IYY A;  2H0H A;  1W2B 2;  3PXM A;  1CYV A;  1EQK A;  4U13 A;  2BNG A;  1LXE A;  2CFL A;  4BL3 A;  1B2S A;  2IMJ A;  5D81 A;  3LTD A;  3RGA A;  4X2H A;  4HM5 B;  2GBX B;  1FUS A;  4MMY B;  3F14 A;  1KSI A;  1ASK A;  1JZO A;  2QEX 3;  1YJN 3;  1QVG 2;  1LQG C;  1UI8 A;  4N6O B;  1JBR A;  1HZ1 A;  2UUG C;  2HMK B;  2BMR B;  5KP3 A;  1UUG B;  1MWR A;  6STD A;  3AHW A;  2O3O A;  3MG1 A;  1UUW B;  3KII A;  3KFQ C;  4R80 A;  1STD A;  2OQE A;  5LC7 A;  4WYK A;  3X3X A;  1Q81 4;  1N5P A;  1WTH A;  3BNC A;  1B2M A;  1WMP A;  4WHA A;  4HM8 B;  2D1W A;  3KSE D;  3J7Y d;  2YFI B;  4MMZ B;  3BIR A;  4HM6 B;  1K8A 4;  3H3H A;  1TP6 A;  3LTB A;  3F8X A;  3G4S 3;  1HU9 A;  1UCJ A;  1RHL A;  3FF2 A;  4CDL A;  3JUN A;  2FNQ A;  2GXF A;  1YIJ 3;  1GOY A;  3GSP A;  1RNT A;  1RGK A;  4R9K A;  1Q9E A;  3IJE B;  3OWU A;  1B2X A;  2CX0 A;  4H3U A;  4ILF A;  1UW1 A;  5KP1 A;  3D5G A;  1G02 A;  5AII A;  1O7M B;  2BT3 A;  2KAA A;  3EBT A;  4OUQ A;  3CMA 3;  1E3R A;  1BRH A;  4BU4 A;  2WGO A;  1BNR A;  4FMC A;  1IV9 A;  4MMX B;  1KC8 4;  2W2C A;  3G8Z A;  4HJL B;  1B2U A;  2HMJ B;  3BNE A;  1RGF A;  1BU4 A;  1W6G A;  3CCJ 3;  3WA3 A;  1TFO A;  3NBR A;  1U8C B;  1U5O A;  1YNV X;  2ML6 A;  4WFO A;  3Q1C A;  1B20 A;  4HM1 B;  1GS3 A;  3LT9 A;  3ER7 A;  3AMO B;  2STD A;  1A67 A;  5EQL A;  4KFD A;  4HAA A;  4KT3 B;  3WOF B;  2CFW A;  1X1W A;  5IG0 A;  1NB5 I;  1NB3 I;  2KF6 A;  3NM7 A;  2C4B A;  1IQY A;  4JRF A;  1MWT A;  4GSP A;  1VQ6 3;  4R9L A;  2HMM B;  1CH0 A;  4I5Q A;  3IMA B;  4PEJ A;  4BIR A;  5IER A;  1WNH A;  1OAC A;  1G0T A;  1YJW 3;  2ZDJ A;  4EC6 A;  2SAR A;  4RNT A;  3DUK A;  2Z7A A;  3VF1 A;  1B3S A;  1N9E A;  1I70 A;  5I97 A;  3CCL 3;  1A2K A;  1FYS A;  1RLS A;  2JQ5 A;  1BOX A;  3JUP A;  3CCS 3;  3OXA A;  1BRI A;  2WO0 A;  3MWZ A;  2RGQ A;  3HI7 A;  1JB5 A;  2F56 A;  2P38 A;  4R1K A;  5DRV A;  4I4K A;  1DMM A;  5G1L A;  3SOA A;  4FMA A;  8CHO A;  4LGQ A;  1HYF A;  1Q7H A;  2B24 B;  1GMR A;  5GSP A;  2E2V A;  2QA4 3;  1FGT A;  1US1 A;  1YHQ 3;  3TDG A;  2GBW B;  1MGR A;  3JUM A;  1YGW A;  1I0V A;  3KKG A;  1SQW A;  3OX9 A;  2F86 B;  3LYG A;  4CCV A;  5AEW B;  1BNS A;  2CG0 A;  2F5M A;  1BUQ A;  1AY7 A;  1M9G A;  4HZB B;  1CYU A;  4RNZ A;  3HK4 A;  3SX1 A;  1IVV A;  1TRQ A;  1JBS A;  1QAL A;  1ULJ B;  1X1Y A;  3AMO A;  1RCL A;  3RDE A;  4H61 A;  5A0O B;  1BRG A;  1W7C A;  1ZO2 A;  2XR8 B;  7GSP A;  1LQM B;  1WMN A;  3OWY A;  2AAE A;  2W9Q A;  1EUI C;  4LYL B;  3EE1 A;  3DZL A;  4AEQ A;  2CFK A;  4OK0 A;  3HX8 A;  3FG3 A;  4AKZ A;  1NDO B;  4LSO A;  1BGS A;  1NU3 A;  2SBL A;  2W04 A;  5G1K A;  3UJM A;  5BVB A;  1LOV A;  1VQ9 3;  1E97 A;  3MKI A;  1BAN A;  2OOV A;  3NXJ A;  1Z1S A;  1RGH A;  5HOH A;  3CCU 3;  1NWW A;  1V58 A;  1WQL B;  1UDI I;  2IY2 A;  1ZS7 A;  2WOF A;  3E99 A;  1X1X A;  2PZV A;  3G16 A;  3OV4 A;  3JVC A;  3X40 A;  1A90 A;  1A2V A;  1IDP A;  1EEJ A;  1UUV B;  2RFR A;  1WMO A;  1GMQ A;  2Y74 A;  3G71 3;  4HM0 B;  4XDV A;  1W6Y A;  5BXQ A;  1N9J A;  1I2G A;  1UI7 A;  2W56 B;  1IT8 A;  3DGM A;  1D6Y A;  2Z77 A;  1M1K 4;  1TFK A;  2INX A;  3ZG0 A;  1FA3 A;  2C10 A;  4AKY A;  2I9W A;  2RBI A;  3S29 A;  1DVD A;  2F98 A;  1BSD A;  1UCI A;  5EVH A;  5CF2 A;  3STD A;  1M90 4;  1AV4 A;  2HOH A;  1FGO A;  2RCD A;  2H0G A;  2YFL B;  3CNM A;  3MSO A;  2FGT A;  3MG3 A;  4STD A;  3WA2 X;  5RNT A;  2QGU A;  1K28 A;  3D5I A;  5G2G A;  4L7K A;  3D79 A;  3EQQ B;  3KSP A;  3PS8 A;  4GB5 A;  5AIH A;  1L5G B;  1FZU A;  1AVL A;  2OQE C;  3NBB A;  5IG4 A;  1T2I A;  1VQO 3;  1RNB A;  2BMQ B;  4XM4 A;  3DGY A;  3GZB A;  3PZW A;  2QIY A;  1BIR A;  2XFS A;  2YX9 A;  1BSE A;  5D82 A;  2MC8 A;  3K0Z A;  7STD A;  4HM2 B;  1LNH A;  1DMQ A;  1BRN L;  4O3V A;  3FGY A;  1RDS A;  1RGL A;  2V1L A;  1I8V A;  1IU7 A;  2E2T A;  2H0I A;  3EBY A;  1KD1 4;  1KWI A;  1AVK A;  3NQY A;  1B21 A;  1R4C A;  4KFE A;  1CQS A;  1A2P A;  2XH9 A;  3WOD G;  1O7H B;  1TU5 A;  3FH1 A;  5IF6 A;  1MOL A;  1GY6 A;  3CC2 3;  4N3V A;  3BLZ A;  1YI2 3;  3EB8 A;  4NPB A;  4HVN A;  4IPB A;  5ELJ A;  1FGM A;  1UGI A;  1AR0 A;  1RSN A;  1IQ8 A;  1J2B A;  2K3D A;  3BU4 A;  2W56 A;  5JPU A;  3N54 B;  9RNT A;  1VQN 3;  1YVB I;  2KXG A;  2XRX B;  2GEX A;  1BNG A;  1BSA A;  4N6U A;  2W0Q A;  3B4P A;  4EBG A;  1OHP A;  2FXT A;  1OF5 B;  1OGZ A;  1RN1 A;  3BNB A;  2HMN B;  2YFJ B;  4XBY A;  3FKA A;  3WR2 A;  2CK3 H;  4LMI A;  2M7O A;  1UCL A;  3A5E A;  1BNJ A;  1TJD A;  4BTX A;  1VQK 3;  1STF I;  1HKX A;  1PFP A;  3B4O A;  3F8H A;  5TGN A;  1JNQ A;  3V98 A;  1Y4K A;  3X41 A;  2P0M A;  1UCK A;  2RSX A;  1W6C A;  1TRP A;  4HZ9 B;  2K0M A;  4EXR A;  4CPK A;  4JF8 A;  3DGL A;  3FF0 A;  3VGN A;  2IYJ A;  2BMO B;  4RBN A;  1LOW A;  5BIR A;  1Q82 4;  3SOY A;  2CKF B;  2BO9 B;  2GU1 A;  3GZR A;  5AIF A;  1JKG B;  2CWV A;  3LML A;  3DGN A;  4EV2 A;  2WOH A;  4N6V 0;  1DYU A;  1CEW I;  1GY5 A;  3S28 A;  8RNT A;  2K54 A;  1B2Z A;  4HOH A;  5HGR A;  3G0K A;  1BRS A;  3JUO A;  4GL6 A;  3CCM 3;  1KQS 2;  3NBJ A;  3SVA A;  2KF5 A;  1LNI A;  1ZGX A;  2HML B;  3CME 3;  1VQM 3;  1JJ2 2;  2CHC A;  1V57 A;  3H51 A;  1DVC A;  3IPT A;  3NV0 B;  1IT7 A;  3EX9 A;  1OHO A;  1W01 A;  3D4A A;  2CH9 A;  1AQZ A;  2XF3 A;  2PNC A;  3DM8 A;  1OF5 A;  4K1U A;  5DRE A;  2P0X A;  3QRD A;  3EN1 B;  2OTJ 3;  1RRH A;  3MPH A;  3N8B A;  3Q3F A;  3ZFZ A;  3EHC A;  1LRA A;  3WOE B;  5M1A A;  4BTW A;  4IT7 A;  2W03 A;  2WGQ A;  3D3L A;  1BRK A;  3KCH A;  1I2E A;  1VQ4 3;  1S5A A;  2KRT A;  1T2H A;  4X2O A;  3HIG A;  2XFT A;  3MYT A;  3KZT A;  3T8U A;  2MF7 A;  2BIR A;  1MWU A;  1W02 A;  4N6N B;  4NRE A;  1B27 A;  1RGA A;  2OWP A;  2CC3 A;  3GZY B;  2XSH B;  5D83 A;  4BTY A;  1IVX A;  2BU4 A;  5CK6 A;  2Z6B A;  4XB5 A;  3CC4 3;  4HBR A;  1N8Q A;  5M19 A;  2F4Y A;  1JKG A;  3RNT A;  1RTU A;  2XSO B;  3UB1 A;  3F9S A;  1OUN A;  1RGE A;  2OOV C;  1MNL A;  3QK9 A;  1SIH A;  4FMD A;  3FSD A;  3B7C A;  5FGO A;  4L8O A;  2Y73 A;  1E3V A;  1G96 A;  2C11 A;  6RNT A;  1GOV A;  3NV0 A;  4NHF A;  4FMB A;  1SII A;  1W2Z A;  3MHE A;  3PCS A;  3Q2P A;  1BNF A;  1JBT A;  1W00 A;  3NM2 A;  1LOY A;  1GMP A;  5IEO A;  3BND A; 
#chains in the Genus database with same CATH homology
 3LH4 A;  1Q7Y 4;  1JN5 B;  2W9P A;  3KE7 A;  4J8T A;  2Z76 A;  1K9M 4;  1EG9 B;  1ULI B;  1ROA A;  4O8S A;  3X3Y A;  3I55 3;  1NJI 4;  2KCD A;  3CC7 3;  2P09 A;  3M8C A;  3SLU A;  1N5H A;  4QWT A;  1Q40 B;  3Q90 A;  2CFG A;  3ECF A;  1QAF A;  4FR9 A;  3V92 A;  5CF1 A;  1RRL A;  4XBX A;  3NQZ A;  1M1X B;  1YJ9 3;  3LTA A;  4HM3 B;  1SJW A;  1SPU A;  5AYS C;  2CFD A;  4ORL A;  3U1W A;  3DMC A;  3T8N A;  3CCE 3;  3ALA A;  1JB4 A;  3S5C A;  3NHX A;  1ROV A;  3JUQ A;  2ML5 A;  3DY5 A;  4KVH A;  4O2H A;  1IK3 A;  4FCM A;  1RJO A;  3PCR A;  3F40 A;  1GY7 A;  4N6L A;  3HII A;  2OCT A;  2IUJ A;  3HZP A;  3CXC 2;  2Q07 A;  3T0U A;  2R4I A;  1LOX A;  3LOY A;  4IIA A;  3B8L A;  1VZZ A;  4MJD A;  1JN5 A;  3PYJ A;  1QVF 2;  5LC6 A;  1VQ8 3;  1YIT 3;  3KN4 A;  2F99 A;  1IVW A;  4OVM A;  3CPO A;  5AI1 A;  4Q53 A;  4WWU C;  1YGE A;  3F7X A;  3LZA A;  3FCS B;  3OWS A;  1VQ7 3;  5AEU B;  1Q40 A;  1QJG A;  1S72 3;  1TIJ A;  2LYX A;  3V99 A;  4N6T A;  5FW5 A;  3GAX A;  4HM7 B;  1EKM A;  2B1X B;  3SED A;  1VQP 3;  1W4N A;  4N6M A;  4KZ1 A;  1IVU A;  3BB9 A;  3LTC A;  5EEO A;  4RNY A;  1ZX2 A;  3K7C A;  1K73 4;  3DXO A;  2CG1 A;  1OPY A;  5IEP A;  1NO3 A;  4FCJ A;  1RKY A;  2L4V A;  2O9U X;  4RZM A;  1GD4 A;  3CNX A;  1C7H A;  1PU4 A;  2JDI H;  2ZL8 A;  2UX0 A;  3CU3 A;  3GRD A;  3OW2 2;  3D9R A;  1FGQ A;  4G1M B;  3O8Y A;  1DMN A;  4LZI A;  3K5T A;  4HYZ A;  1D6Z A;  1IV7 A;  2W6J H;  1GD3 A;  1QAK A;  3X42 A;  2OTL 3;  3ROB A;  4HKV B;  4KFF A;  3L0R A;  4MEI A;  3SXX A;  1QMA A;  3GWR A;  5KP4 A;  3CCR 3;  1RN7 A;  5AYR B;  4K1V A;  4HM4 B;  3I56 3;  1EA2 A;  3A76 A;  4XDW A;  5JPP A;  3CCQ 3;  1JV2 B;  3NX0 A;  5ELU A;  1VQ5 3;  3LXU X;  1OGX A;  1V74 A;  4K90 B;  4ZM8 A;  2A15 A;  4FCZ A;  2GEY A;  3K63 A;  3WMD A;  3EN8 A;  4J9A A;  3G6E 3;  1IQX A;  1K41 A;  1OH0 A;  4LEH A;  1JB2 A;  2BHM A;  4K61 A;  5STD A;  3S67 A;  1O7P B;  2IA7 A;  2E2U A;  3UL6 A;  4XBT A;  2P05 A;  3I0Y A;  3CPW 2;  2LQV A;  3FLJ A;  1O7W B;  3FG4 A;  4L8P A;  3WDG B;  3NUV A;  5IG3 A;  5IW9 A;  2XGL A;  3FZW A;  3MG2 A;  2XGN A;  5AIG A;  2GU3 A;  3DGO A;  3VSY A;  1N8R 4;  5JBS A;  5CXO A;  2CWU A;  1O7N B;  1W5Z A;  3LT8 A;  4R4K A;  3RGR A;  1T5Y A;  2IUK A;  3UL5 A;  4O02 B;  1LVN A;  4WYK B;  1FGR A;  2CW9 A;  3X3Z A;  2XEP A;  5IEN A;  3F7S A;  4TX4 A;  1Q42 A;  3U97 A;  1Q86 4;  1OCV A;  3N9H A;  3GZX B;  2D42 A;  1GYB A;  3CCV 3;  3FG1 A;  1FUW A;  3UNL A;  3K9M C;  5IG5 A;  5CLK A;  3CD6 3;  1F8N A;  3EF8 A;  4EV5 A;  3EC9 A;  2CIU A;  1OHS A;  4WP5 A;  2HMO B;  3PGB A;  1ISK A;  3S27 A;  1D6U A;  3EJV A;  1JRQ A;  1VQL 3;  2CWT A;  1O7G B;  4EYC A;  1TUH A;  1W2B 2;  3PXM A;  1CYV A;  1EQK A;  4U13 A;  2BNG A;  1LXE A;  2CFL A;  2IMJ A;  5D81 A;  3LTD A;  3RGA A;  4X2H A;  4HM5 B;  2GBX B;  4MMY B;  3F14 A;  1KSI A;  1ASK A;  2QEX 3;  1YJN 3;  1QVG 2;  1UI8 A;  4N6O B;  2HMK B;  2BMR B;  5KP3 A;  6STD A;  3MG1 A;  2O3O A;  1UUW B;  3KII A;  3KFQ C;  4R80 A;  1STD A;  2OQE A;  5LC7 A;  4WYK A;  3X3X A;  1Q81 4;  1N5P A;  1WTH A;  3BNC A;  1WMP A;  4WHA A;  4HM8 B;  2D1W A;  3KSE D;  3J7Y d;  2YFI B;  4MMZ B;  4HM6 B;  1K8A 4;  3H3H A;  1TP6 A;  3LTB A;  3F8X A;  3G4S 3;  1HU9 A;  3FF2 A;  4CDL A;  3JUN A;  2FNQ A;  2GXF A;  1YIJ 3;  4R9K A;  3IJE B;  3OWU A;  4H3U A;  1UW1 A;  5KP1 A;  5AII A;  1O7M B;  2BT3 A;  3EBT A;  4OUQ A;  3CMA 3;  1E3R A;  2WGO A;  4FMC A;  1IV9 A;  4MMX B;  1KC8 4;  2W2C A;  3G8Z A;  4HJL B;  2HMJ B;  3BNE A;  1W6G A;  3CCJ 3;  3WA3 A;  1TFO A;  3NBR A;  1U8C B;  1U5O A;  2ML6 A;  4WFO A;  3Q1C A;  4HM1 B;  1GS3 A;  3LT9 A;  3ER7 A;  3AMO B;  2STD A;  1A67 A;  5EQL A;  4KFD A;  3WOF B;  2CFW A;  5IG0 A;  1NB5 I;  1NB3 I;  3NM7 A;  4JRF A;  1IQY A;  1VQ6 3;  4R9L A;  2HMM B;  3IMA B;  4PEJ A;  5IER A;  1WNH A;  1OAC A;  1YJW 3;  2ZDJ A;  4EC6 A;  3DUK A;  2Z7A A;  3VF1 A;  1N9E A;  3CCL 3;  5I97 A;  1A2K A;  2JQ5 A;  3JUP A;  3CCS 3;  3OXA A;  2WO0 A;  3MWZ A;  2RGQ A;  3HI7 A;  1JB5 A;  4R1K A;  2P38 A;  5DRV A;  3SOA A;  4I4K A;  1DMM A;  8CHO A;  4FMA A;  4LGQ A;  2B24 B;  1YHQ 3;  2QA4 3;  2E2V A;  1FGT A;  1US1 A;  3TDG A;  2GBW B;  3JUM A;  3KKG A;  1SQW A;  3OX9 A;  2F86 B;  3LYG A;  4CCV A;  5AEW B;  2CG0 A;  1BUQ A;  1M9G A;  4HZB B;  1CYU A;  4RNZ A;  3HK4 A;  3SX1 A;  1IVV A;  1QAL A;  1ULJ B;  3AMO A;  3RDE A;  4H61 A;  5A0O B;  1W7C A;  1ZO2 A;  2XR8 B;  1WMN A;  3OWY A;  2W9Q A;  3EE1 A;  3DZL A;  4AEQ A;  2CFK A;  4OK0 A;  3HX8 A;  3FG3 A;  4AKZ A;  1NDO B;  4LSO A;  1NU3 A;  2SBL A;  2W04 A;  3UJM A;  5BVB A;  1VQ9 3;  1E97 A;  3MKI A;  2OOV A;  3NXJ A;  1Z1S A;  3CCU 3;  1NWW A;  1WQL B;  3E99 A;  2WOF A;  2PZV A;  3G16 A;  3OV4 A;  3JVC A;  3X40 A;  1A90 A;  1A2V A;  1IDP A;  1UUV B;  2RFR A;  1WMO A;  2Y74 A;  3G71 3;  4HM0 B;  4XDV A;  1W6Y A;  5BXQ A;  1N9J A;  1UI7 A;  2W56 B;  1IT8 A;  3DGM A;  1D6Y A;  2Z77 A;  1M1K 4;  1TFK A;  2INX A;  1FA3 A;  2C10 A;  4AKY A;  2I9W A;  3S29 A;  1DVD A;  2F98 A;  5EVH A;  5CF2 A;  3STD A;  1M90 4;  1AV4 A;  2YFL B;  1FGO A;  2RCD A;  3MSO A;  3CNM A;  2FGT A;  3MG3 A;  4STD A;  3WA2 X;  2QGU A;  1K28 A;  5G2G A;  4L7K A;  3EQQ B;  3KSP A;  3PS8 A;  4GB5 A;  5AIH A;  1L5G B;  1AVL A;  2OQE C;  3NBB A;  5IG4 A;  1VQO 3;  2BMQ B;  4XM4 A;  3GZB A;  3PZW A;  2QIY A;  2XFS A;  2YX9 A;  5D82 A;  2MC8 A;  3K0Z A;  7STD A;  4HM2 B;  1LNH A;  1DMQ A;  4O3V A;  3FGY A;  2V1L A;  1IU7 A;  2E2T A;  3EBY A;  1KD1 4;  1KWI A;  1AVK A;  3NQY A;  1R4C A;  4KFE A;  1CQS A;  2XH9 A;  3WOD G;  1O7H B;  1TU5 A;  3FH1 A;  5IF6 A;  1MOL A;  1GY6 A;  3CC2 3;  4N3V A;  3BLZ A;  1YI2 3;  3EB8 A;  4HVN A;  4IPB A;  5ELJ A;  1FGM A;  1AR0 A;  1IQ8 A;  1J2B A;  2W56 A;  5JPU A;  3N54 B;  1VQN 3;  1YVB I;  2KXG A;  2XRX B;  2GEX A;  4N6U A;  2W0Q A;  3B4P A;  4EBG A;  1OHP A;  2FXT A;  1OF5 B;  1OGZ A;  3BNB A;  2HMN B;  2YFJ B;  4XBY A;  3FKA A;  2CK3 H;  4LMI A;  2M7O A;  4BTX A;  1VQK 3;  1STF I;  1HKX A;  1PFP A;  3B4O A;  3F8H A;  5TGN A;  1JNQ A;  3V98 A;  1Y4K A;  3X41 A;  2P0M A;  2RSX A;  4HZ9 B;  1W6C A;  2K0M A;  4EXR A;  4JF8 A;  3DGL A;  3FF0 A;  3VGN A;  1Q82 4;  2BMO B;  4RBN A;  3SOY A;  2CKF B;  2BO9 B;  2GU1 A;  3GZR A;  5AIF A;  1JKG B;  2CWV A;  3LML A;  3DGN A;  4EV2 A;  2WOH A;  4N6V 0;  1DYU A;  1CEW I;  1GY5 A;  3S28 A;  2K54 A;  5HGR A;  3G0K A;  3JUO A;  4GL6 A;  1KQS 2;  3CCM 3;  3NBJ A;  3SVA A;  2HML B;  3CME 3;  1VQM 3;  1JJ2 2;  2CHC A;  3H51 A;  1DVC A;  3IPT A;  3NV0 B;  1IT7 A;  3EX9 A;  1OHO A;  1W01 A;  2CH9 A;  2XF3 A;  2PNC A;  3DM8 A;  1OF5 A;  4K1U A;  5DRE A;  2P0X A;  3QRD A;  3EN1 B;  2OTJ 3;  1RRH A;  3MPH A;  3N8B A;  3EHC A;  3WOE B;  4BTW A;  4IT7 A;  2W03 A;  2WGQ A;  3D3L A;  1VQ4 3;  1S5A A;  2KRT A;  4X2O A;  3HIG A;  2XFT A;  3MYT A;  3KZT A;  3T8U A;  2MF7 A;  1W02 A;  4N6N B;  4NRE A;  2OWP A;  2CC3 A;  3GZY B;  2XSH B;  5D83 A;  4BTY A;  1IVX A;  5CK6 A;  2Z6B A;  4XB5 A;  3CC4 3;  4HBR A;  1N8Q A;  1JKG A;  2XSO B;  3UB1 A;  3F9S A;  1OUN A;  2OOV C;  1MNL A;  3QK9 A;  1SIH A;  4FMD A;  3FSD A;  3B7C A;  5FGO A;  4L8O A;  2Y73 A;  1E3V A;  1G96 A;  2C11 A;  3NV0 A;  4NHF A;  4FMB A;  1SII A;  1W2Z A;  3MHE A;  3PCS A;  3Q2P A;  1W00 A;  3NM2 A;  5IEO A;  3BND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...