5EQLA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
82
Chain Sequence
SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQEWVFTMYYLTLEAKDGGKKKLYEAKVWVKGLTNWKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-Affirmer-S2D5
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Protein binding
total genus 13
structure length 82
sequence length 88
ec nomenclature
pdb deposition date 2015-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eqlA00
4IT7A 5ELJA 1FA3A 1FUWA 1MOLA 2OCTA 1CYUA 1A90A 3KSED 3GAXA 1STFI 5EQLA 2O9UX 2W9QA 4LZIA 4N6MA 1TIJA 1PFPA 1RN7A 3PXMA 3Q2PA 3PYJA 1CEWI 5LC7A 1N5PA 1LXEA 2KXGA 3IMAB 4N6OB 3UL6A 4EYCA 5A0OB 3QRDA 1DVDA 1M9GA 1CYVA 3L0RA 4ZM8A 4N6NB 1IV9A 4N6V0 4N6TA 1KWIA 1YVBI 1DVCA 4N6UA 1GD3A 1NB5I 1G96A 1EQKA 1A67A 2BO9B 3MWZA 3KFQC 1N5HA 1N9JA 1MNLA 3S67A 4N6LA 3UL5A 1WNHA 3K9MC 2CH9A 1IV7A 1GD4A 2W9PA 5ELUA 5LC6A 1R4CA 1ROAA 4CCVA 1NB3I 4TX4A 3SVAA 3PS8A 3LH4A 3NX0A
chains in the Genus database with same CATH superfamily
3DM8A 3RGAA 4IT7A 2M7OA 3EE1A 2C11A 4BTYA 1UCIA 3LTDA 4FCZA 8RNTA 3KN4A 1MGRA 1B21A 3NM2A 1BUJA 1MOLA 1ZGXA 2CWUA 1V74A 2KRTA 2HMNB 1O7MB 2WO0A 1BNJA 1GOVA 5EVHA 1CYUA 2CX0A 3JUQA 1D6UA 5AIFA 4OUQA 1STFI 1RGAA 1OF5A 2OOVC 1LOWA 3PCSA 5HOHA 1NJI4 1RNBA 3EN8A 1TTOA 1M1XB 5FW5A 1VZZA 4XDWA 2D1WA 3U1WA 2W9QA 3AHWA 1SJWA 2K54A 3NHXA 4N6MA 1FGMA 1K28A 1BOXA 1GYBA 2K3DA 3CPOA 3X40A 1TP6A 1PFPA 1UI8A 1GY7A 2GSPA 3I0YA 7GSPA 3A5EA 1UUVB 3NQZA 1B2ZA 1SIHA 4FR9A 4BTXA 2HMOB 1I3FA 1BSBA 1IVWA 4X2OA 3FG1A 2HMLB 1YJN3 2CIUA 1JV2B 3GZYB 5G1KA 2AAEA 3PGBA 3IMAB 2KXGA 1GMQA 3OX9A 2L4VA 1VQP3 4K1UA 5GSPA 1BSDA 3K63A 1BUQA 1FGOA 3SOYA 1T2IA 1I2EA 1UGHI 2F5WA 2ML5A 3URPA 1UUGB 1X1XA 1DMMA 1YIT3 2RFRA 1TJDA 6STDA 1OGXA 4MMZB 4JF8A 2UX0A 3UNLA 1IV9A 4AKZA 2Y73A 1YJW3 3D9RA 1W2ZA 3SLUA 1L5GB 2Z77A 1X1WA 4EXRA 5CF2A 3GWRA 4ORLA 5AEUB 2IY2A 2INXA 1Y4KA 4N6V0 1E3VA 2GEXA 1VQK3 4N6TA 2O3OA 1FGQA 5AYSC 3GZBA 1JJ22 1Q864 1DE3A 1IU7A 1BVIA 1KWIA 1BRSA 4MEIA 1I70A 3ZFZA 1BRJA 4HM7B 1X1UA 1FGRA 1GD3A 1VQN3 1G96A 1UDII 5RNTA 4HM1B 4LMIA 3GZRA 1G0TA 3DXOA 4K1VA 3CC43 1A67A 1MWTA 3FZWA 1YI23 3G6E3 4HKVB 1TRQA 1U8CB 3N54B 1RGKA 5DREA 3KFQC 3CMA3 2GU1A 3OV4A 4BTWA 2OTL3 1G02A 4WP5A 2CFDA 3S67A 4HZ9B 5M1AA 4BL2A 3KCHA 3WR2A 1BU4A 1QAKA 2STDA 1RN1A 3V98A 5JPPA 3LT8A 1IQYA 3UL5A 3CCE3 2JDIH 3K9MC 1K9M4 3G16A 2W03A 4N3VA 1TU5A 3FG4A 3EHCA 4NREA 1Q7Y4 1ROAA 4J5GA 1MGWA 3FCSB 4CCVA 2F86B 2CW9A 3EX9A 4EW5A 2F56A 1BNEA 1W02A 1S5AA 4TX4A 5HGRA 3WOFB 5KP3A 3JUOA 3LTCA 1FW7A 3B4PA 2GXFA 1KSIA 1YJ93 3ZG5A 3DUKA 2PNCA 3EBYA 5IERA 4LGQA 3HIIA 3MSOA 3D79A 3B8LA 3FKAA 4MMYB 7STDA 1BRIA 1BSEA 2ML6A 3F8XA 4XDVA 1JBRA 1BGSA 1KC84 2OCTA 3NM7A 3CCJ3 1GMRA 1O7HB 5D83A 3LXUX 4EV2A 1TFKA 2XF3A 2YFJB 3F40A 4HVNA 1BIRA 1K41A 1RSNA 1TRPA 3FF0A 3FGYA 2R4IA 1RGGA 5G2GA 4O8SA 3X42A 1OCVA 3TDGA 1EKMA 5DRVA 5IEPA 1LRAA 3N9HA 3WODG 5AEWB 4GL6A 4O02B 1A2VA 1FZUA 1LOXA 4MJDA 3NQYA 3MG2A 1EA2A 3BNCA 3PXMA 5AIGA 3HOHA 3K7CA 3Q2PA 4J8TA 1CEWI 3X41A 1IQXA 5LC7A 1BSAA 1A2PA 4CJNA 5CLKA 2OOVA 4N6OB 2C10A 3AMOB 4EYCA 3BB9A 3F14A 3F8HA 4HZBB 5A0OB 1GY5A 2BNGA 3LTBA 4HOHA 2BIRA 3EB8A 4R1KA 3IJEB 1W6CA 4RNYA 3X3XA 2ZDJA 1RKYA 1B2MA 3G8ZA 1W00A 2W2CA 4QWTA 3LZAA 1FYSA 1N9EA 3ECFA 1Q824 2WGOA 3ALAA 3FG3A 1LQGC 1JB5A 2L1SA 2RNTA 4O2HA 5M19A 1VQ63 3WA2X 3L0RA 5D81A 4ZM8A 1VQ43 4N6NB 1MWSA 2XRXB 3AMOA 1JKGB 4K61A 4NHFA 3BNBA 3GRDA 4H61A 4IPBA 1YGWA 1W2B2 1ULIB 5STDA 4Q53A 2P38A 3K5TA 3U97A 2KAAA 9RNTA 5KP1A 4HM0B 3H51A 1FUSA 4MMXB 5BIRA 3WDGB 3IPTA 4WYKB 2WGQA 1AV4A 4EV5A 4ILFA 3DGOA 2A15A 3MG1A 3ROBA 2CG0A 2W0QA 3KKGA 4RBNA 1I8VA 1JKGA 1RMSA 4N6UA 4XM4A 1NB5I 1ROVA 3D5IA 3O8YA 2R41A 1OPYA 4HM8B 3LMLA 3DH2A 3EJVA 1RGEA 5I97A 3S27A 4WYKA 4BIRA 3G4S3 2BO9B 3KIIA 1V58A 1VQL3 1QALA 2PZVA 3CD63 1N5HA 3FSDA 1N9JA 2P0MA 2V1LA 1WMPA 4FMCA 4N6LA 8CHOA 1Q40A 1W7CA 3DZLA 3CCR3 1GY6A 4KFEA 1BNRA 1NNVA 1AQZA 1JRQA 4HM3B 1VQ53 3STDA 4EBGA 4G1MB 1IV7A 1GD4A 3T8UA 3B4OA 5ELUA 3CCL3 3AGOA 2KF4A 1FUTA 5IG3A 1IVXA 1VQ73 5AYRB 1JB2A 1LOYA 1GMPA 1IDPA 1TFOA 5CF1A 1VQ83 1V57A 1A2KA 1RN4A 3MHEA 5EEOA 1PYLA 1HKXA 2H0GA 3SVAA 1N8R4 3PS8A 2Z6BA 4HM2B 2OQEC 1YGEA 4FMDA 1S723 3NX0A 4GB5A 2E2TA 1B2XA 2KF6A 5KP4A 2KF5A 1O7WB 2FGTA 5ELJA 4R9LA 1FUWA 2F4YA 3F7XA 2B1XB 3LT9A 3T0UA 3S28A 3M8CA 1BSCA 2F99A 1W01A 1T2HA 3DGYA 7RNTA 1A90A 3CPW2 1SPUA 2YX9A 1JB4A 1NU3A 2WOHA 5TGNA 3S5CA 1RGCA 3T8NA 4GSPA 1SQWA 2GBWB 2P0XA 5EQLA 3GSPA 1AVLA 4KFDA 3NV0B 2MC8A 1Q7HA 1RJOA 2LQVA 4AKYA 4LZIA 3RNTA 4HBRA 1F8NA 4K90B 4AEQA 4FCMA 1I3IA 1RDSA 1US1A 1QJGA 3HI7A 4L7KA 3EN1B 1Q814 1WMNA 5IEOA 5CK6A 2XGNA 3PYJA 3CCU3 3HK4A 1LOVA 4KVHA 2OTJ3 2FNQA 4LYLB 1SARA 4RNZA 3BNDA 3NV0A 4X2HA 2IUKA 1BRNL 1D6YA 3NUVA 3SYUA 3WOEB 3X3ZA 2ZL8A 3OWYA 3QK9A 3X3YA 1GSPA 3ZG0A 2KCDA 1DVDA 3JUPA 3BU4A 3CC73 3VF1A 1EUIC 1VQQA 4JRFA 2W6JH 1CYVA 2IA7A 2Z76A 3J7Yd 5JBSA 2RCDA 2XEPA 2MF7A 3DMCA 3LYGA 1KQS2 1M904 1J2BA 4HAAA 2CC3A 3UB1A 3FF2A 1BNSA 1DETA 1DMQA 2CWVA 3PZWA 3MKIA 4EC6A 1HU9A 2GEYA 1O7GB 3EQQB 3B7CA 4IIAA 2ZHXB 1QVF2 2YFIB 1YHQ3 1E3RA 3VGNA 3GZXB 4FMBA 3N8BA 2HMJB 4R4KA 5IF6A 4J9AA 1GOYA 1YVSA 1ASKA 1DMNA 3G713 1I0XA 3DGNA 4HM5B 3WA3A 2HOHA 2JQ5A 2K0MA 1OGZA 1VQM3 3SX1A 1B27A 1WMOA 1OHSA 1LQMB 2CX1A 3G0KA 1MWRA 1HZ1A 2HMKB 3AHSA 3MWZA 4FCJA 3DGMA 2XR8B 3KE7A 2XSOB 1QMAA 1UGIA 2QA43 1RHLA 3I553 3OXAA 1YNVX 3H3HA 1RRHA 1JZOA 1W4NA 4RNTA 3F7SA 1BRHA 2CKFB 3Q90A 1PU4A 2CH9A 2RGQA 3NBJA 3WHOA 3CCS3 1KD14 1WTHA 2W9PA 3KZTA 1SIIA 1ZX2A 4HM4B 2CG1A 2CFKA 2XFTA 2ZA4A 5LC6A 2P09A 3JUMA 1R4CA 2WOFA 3D3LA 3ER7A 3HZPA 2F5MA 3CC23 3DGLA 1Q40B 1DYUA 5IENA 4NPBA 1B3SA 1BRGA 2SBLA 2Y74A 3CXC2 1B2UA 1ISKA 3PCRA 1I0VA 1OHOA 2FXTA 4STDA 2GBXB 1VQO3 1RRLA 1PY3A 4PEJA 3WMDA 1FA3A 4LEHA 3SOAA 3A76A 1AY7A 4OK0A 3OW22 3CCQ3 2SARA 3LOYA 4R80A 5IG5A 3KSED 2BU4A 3GAXA 2LYXA 4WHAA 2XH9A 1BAOA 3MPHA 5IG0A 1N8QA 1OH0A 1IQ8A 3I563 5FGOA 2O9UX 2BHMA 3EBTA 1IK3A 1LNIA 2OQEA 5G1LA 1NDOB 1FGTA 1TIJA 2CFWA 2QGUA 2P05A 3DY5A 3HX8A 1EG9B 1IVUA 1ZO2A 4L8OA 3KSPA 2W56B 1BNIA 4BL3A 3K0ZA 2QEX3 1AVKA 1RN7A 2Q07A 1RGHA 3Q3FA 3RDEA 2CWTA 4XB5A 1STDA 2XSHB 4GHOA 2B24B 5AIHA 1YIJ3 2E2VA 4CDLA 5BXQA 4J5KA 2QIYA 1RLSA 3D5GA 1N5PA 1LXEA 1K734 3NXJA 3UL6A 3AGNA 3CNXA 1UCKA 2CFLA 1CQSA 4DKIA 2I9WA 2XGLA 1OACA 2F98A 3QRDA 2UUGC 2OWPA 2AADA 2W56A 4KZ1A 1Q42A 1M9GA 1M1K4 1JN5B 1BNGA 3OWUA 2IUJA 1QVG2 1IT7A 6RNTA 3LTAA 3JUNA 3MG3A 1WQLB 1R4YA 1ULJB 2BT3A 1K8A4 1C7HA 1GS3A 3HIGA 4FMAA 4OVMA 1IT8A 1E97A 1JZDA 3CNMA 1LVNA 2RBIA 3E99A 1VQ93 1RGFA 1UI7A 1W6YA 2BMOB 4L8PA 1C54A 3CU3A 3OWSA 1JN5A 3NBRA 2J8XB 1JBTA 2GU3A 1YVBI 1BNFA 1Q9EA 1RGLA 2BMQB 4KFFA 1Z1SA 1DVCA 2Z7AA 1UCLA 4XBXA 1RCKA 1O7PB 2D42A 5JPUA 3D4AA 3SXXA 1T3BA 1OUNA 2IYJA 2KF3A 3EC9A 5M18A 5IG4A 1I2GA 1UCJA 4U13A 4R9KA 1OHPA 1W6GA 1EQKA 4KT3B 2H0IA 4XBTA 5BVBA 4LSOA 3UJMA 3F9SA 1JNQA 1GOUA 4BU4A 3V99A 1X1YA 3NBBA 5AIIA 6GSPA 1U5OA 4I4KA 4O3VA 4WFOA 1EEJA 5BU4A 1NWWA 4HYZA 5D82A 4RZMA 1JBSA 3JVCA 1D6ZA 1MNLA 1NO3A 1CH0A 1IVVA 2CHCA 3BIRA 2UGIA 2RSXA 3EF8A 2YFLB 4H3UA 5CXOA 2HMMB 1WNHA 5AI1A 1TUHA 3VSYA 2CK3H 4I5QA 1RTUA 1ZS7A 4HM6B 1T5YA 3Q1CA 1UUWB 2BMRB 1B20A 1BANA 1AR0A 1B2SA 3RGRA 3SEDA 4CPKA 3FH1A 2CFGA 4WWUC 4HJLB 1RCLA 3CME3 1BRKA 1MWUA 3FLJA 1O7NB 2XFSA 1NB3I 1IYYA 2W04A 4XBYA 2IMJA 3V92A 1RNTA 2E2UA 5IW9A 3CCM3 2C4BA 3CCV3 1QAFA 1W5ZA 3MYTA 2H0HA 3S29A 1OF5B 1UW1A 3BLZA 1LNHA 1HYFA 3LH4A 3BNEA 1I2FA
chains in the Genus database with same CATH topology
3DM8A 3RGAA 4IT7A 2M7OA 3EE1A 2C11A 4BTYA 3LTDA 4FCZA 3KN4A 3NM2A 1MOLA 2CWUA 2KRTA 1V74A 2HMNB 1O7MB 2WO0A 5EVHA 1CYUA 3JUQA 1D6UA 5AIFA 4OUQA 1STFI 3PCSA 1OF5A 2OOVC 1NJI4 3EN8A 1M1XB 5FW5A 1VZZA 4XDWA 2D1WA 3U1WA 2W9QA 1SJWA 2K54A 3NHXA 4N6MA 1FGMA 1K28A 1GYBA 3CPOA 3X40A 1TP6A 1PFPA 1UI8A 1GY7A 3I0YA 1UUVB 3NQZA 1SIHA 4FR9A 4BTXA 2HMOB 1IVWA 4X2OA 3FG1A 2HMLB 1YJN3 2CIUA 1JV2B 3GZYB 3PGBA 3IMAB 2KXGA 3OX9A 2L4VA 1VQP3 4K1UA 3K63A 1BUQA 1FGOA 3SOYA 2ML5A 1DMMA 1YIT3 2RFRA 6STDA 1OGXA 4MMZB 4JF8A 2UX0A 3UNLA 1IV9A 4AKZA 2Y73A 1YJW3 3D9RA 1W2ZA 3SLUA 1L5GB 2Z77A 4EXRA 5CF2A 3GWRA 4ORLA 5AEUB 2INXA 1Y4KA 4N6V0 1E3VA 2GEXA 1VQK3 1LNHA 2O3OA 1FGQA 4N6TA 5AYSC 3GZBA 1JJ22 1Q864 1IU7A 1KWIA 4MEIA 4HM7B 1FGRA 1GD3A 1VQN3 1G96A 4HM1B 4LMIA 3GZRA 3DXOA 4K1VA 3CC43 1A67A 3FZWA 1YI23 3G6E3 4HKVB 1U8CB 3N54B 5DREA 3KFQC 3CMA3 2GU1A 3OV4A 4BTWA 2OTL3 4WP5A 2CFDA 3S67A 4HZ9B 5JPPA 1QAKA 2STDA 3V98A 3LT8A 1IQYA 3UL5A 3CCE3 2JDIH 3K9MC 1K9M4 3G16A 2W03A 4N3VA 1TU5A 3FG4A 3EHCA 4NREA 1Q7Y4 1ROAA 4CCVA 3FCSB 2F86B 2CW9A 3EX9A 1W02A 1S5AA 4TX4A 5HGRA 3WOFB 5KP3A 3JUOA 3LTCA 3B4PA 2GXFA 1KSIA 1YJ93 3DUKA 2PNCA 3EBYA 5IERA 4LGQA 3HIIA 3MSOA 3B8LA 3FKAA 4MMYB 7STDA 2ML6A 3F8XA 4XDVA 1KC84 2OCTA 3NM7A 3CCJ3 5D83A 1O7HB 3LXUX 4EV2A 1TFKA 2XF3A 2YFJB 3F40A 4HVNA 1K41A 3FGYA 3FF0A 2R4IA 5G2GA 4O8SA 3X42A 1OCVA 3TDGA 1EKMA 5DRVA 5IEPA 3N9HA 3WODG 5AEWB 4GL6A 4O02B 1A2VA 1LOXA 4MJDA 3NQYA 3MG2A 1EA2A 3BNCA 3PXMA 5AIGA 3K7CA 3Q2PA 4J8TA 1CEWI 3X41A 1IQXA 5LC7A 5CLKA 2OOVA 4N6OB 2C10A 3AMOB 4EYCA 3BB9A 3F14A 3F8HA 4HZBB 5A0OB 1GY5A 2BNGA 3LTBA 4RNYA 3EB8A 4R1KA 3IJEB 1W6CA 3X3XA 2ZDJA 1RKYA 3G8ZA 1W00A 2W2CA 4QWTA 3LZAA 1N9EA 3ECFA 1Q824 2WGOA 3ALAA 3FG3A 1JB5A 4O2HA 1VQ63 3WA2X 3L0RA 5D81A 4ZM8A 1VQ43 4N6NB 3AMOA 2XRXB 1JKGB 4K61A 4NHFA 3BNBA 3GRDA 4H61A 4IPBA 1W2B2 1ULIB 5STDA 4Q53A 2P38A 3K5TA 3U97A 5KP1A 4HM0B 3H51A 4MMXB 3WDGB 3IPTA 4WYKB 2WGQA 1AV4A 4EV5A 3DGOA 2A15A 3MG1A 3ROBA 2CG0A 2W0QA 3KKGA 4RBNA 4N6UA 1JKGA 4XM4A 1NB5I 1ROVA 3O8YA 1OPYA 4HM8B 3LMLA 3EJVA 5I97A 3S27A 4WYKA 3G4S3 2BO9B 3KIIA 1VQL3 1QALA 2PZVA 3CD63 1N5HA 3FSDA 1N9JA 2P0MA 2V1LA 1WMPA 4FMCA 4N6LA 8CHOA 1Q40A 1W7CA 3DZLA 1GY6A 4KFEA 4HM3B 1JRQA 1VQ53 3STDA 4EBGA 4G1MB 1IV7A 1GD4A 3T8UA 3B4OA 5ELUA 3CCL3 5IG3A 1IVXA 1VQ73 5AYRB 1JB2A 1IDPA 1TFOA 5CF1A 1VQ83 1A2KA 3MHEA 5EEOA 1HKXA 3SVAA 1N8R4 3PS8A 2Z6BA 4HM2B 2OQEC 1YGEA 4FMDA 1S723 3NX0A 4GB5A 2E2TA 5KP4A 1O7WB 2FGTA 5ELJA 4R9LA 1FUWA 3F7XA 2B1XB 3LT9A 3T0UA 3S28A 3M8CA 2F99A 1W01A 1A90A 3CPW2 1SPUA 2YX9A 1JB4A 1NU3A 2WOHA 5TGNA 3S5CA 3T8NA 1SQWA 2GBWB 2P0XA 5EQLA 1AVLA 4KFDA 3NV0B 2MC8A 1RJOA 2LQVA 4AKYA 4LZIA 4AEQA 4HBRA 1F8NA 4K90B 4FCMA 1QJGA 1US1A 3HI7A 4L7KA 3EN1B 1Q814 1WMNA 5IEOA 5CK6A 2XGNA 3PYJA 3CCU3 3HK4A 4KVHA 2OTJ3 2FNQA 4RNZA 3BNDA 3NV0A 4X2HA 2IUKA 1D6YA 3NUVA 3X3ZA 3WOEB 2ZL8A 3OWYA 3QK9A 3X3YA 2KCDA 1DVDA 3JUPA 3CC73 3VF1A 4JRFA 2W6JH 1CYVA 2IA7A 2Z76A 3J7Yd 5JBSA 2RCDA 2XEPA 2MF7A 3DMCA 3LYGA 1KQS2 1M904 1J2BA 2CC3A 3UB1A 3FF2A 1DMQA 2CWVA 3PZWA 3MKIA 4EC6A 1HU9A 2GEYA 1O7GB 3EQQB 3B7CA 4IIAA 1QVF2 2YFIB 1YHQ3 1E3RA 3VGNA 3GZXB 4FMBA 3N8BA 2HMJB 4R4KA 5IF6A 4J9AA 1ASKA 1DMNA 3G713 3DGNA 4HM5B 3WA3A 2JQ5A 2K0MA 1OGZA 1VQM3 3SX1A 1WMOA 1OHSA 3G0KA 2HMKB 4FCJA 3MWZA 3DGMA 2XR8B 3KE7A 2XSOB 1QMAA 2QA43 3I553 3OXAA 3H3HA 1RRHA 1W4NA 3F7SA 2CKFB 1PU4A 3Q90A 2CH9A 2RGQA 3NBJA 3CCS3 1KD14 1WTHA 2W9PA 3KZTA 1SIIA 1ZX2A 4HM4B 2CG1A 2CFKA 2XFTA 5LC6A 2P09A 3JUMA 1R4CA 2WOFA 3D3LA 3ER7A 3HZPA 3CC23 3DGLA 1Q40B 1DYUA 5IENA 1ISKA 2SBLA 2Y74A 3CXC2 3PCRA 1OHOA 2FXTA 4STDA 2GBXB 1VQO3 1RRLA 3WMDA 4PEJA 1FA3A 4LEHA 3SOAA 3A76A 4OK0A 3OW22 3CCQ3 3LOYA 4R80A 5IG5A 3KSED 3GAXA 2LYXA 4WHAA 2XH9A 3MPHA 5IG0A 1N8QA 1OH0A 1IQ8A 3I563 5FGOA 2O9UX 2BHMA 3EBTA 1IK3A 2OQEA 1NDOB 1FGTA 1TIJA 2CFWA 2QGUA 2P05A 3DY5A 3HX8A 1EG9B 1IVUA 1ZO2A 4L8OA 3KSPA 2W56B 2QEX3 3CCR3 3K0ZA 1AVKA 1RN7A 2Q07A 3RDEA 2CWTA 4XB5A 1STDA 2XSHB 5AIHA 2B24B 1YIJ3 2E2VA 4CDLA 5BXQA 2QIYA 1N5PA 1LXEA 1K734 3NXJA 3UL6A 3CNXA 2CFLA 1CQSA 2I9WA 2XGLA 1OACA 2F98A 3QRDA 2W56A 2OWPA 4KZ1A 1Q42A 1M9GA 1M1K4 1JN5B 3OWUA 2IUJA 1QVG2 1IT7A 3LTAA 3JUNA 3MG3A 1WQLB 1ULJB 1K8A4 2BT3A 1C7HA 1GS3A 3HIGA 4FMAA 4OVMA 1IT8A 1E97A 3CNMA 1LVNA 3E99A 1VQ93 2BMOB 1UI7A 1W6YA 4L8PA 3CU3A 3OWSA 1JN5A 3NBRA 2GU3A 1YVBI 2BMQB 4KFFA 1Z1SA 1DVCA 2Z7AA 4XBXA 1O7PB 2D42A 5JPUA 3SXXA 1OUNA 3EC9A 5IG4A 4U13A 4R9KA 1OHPA 1W6GA 1EQKA 4XBTA 5BVBA 4LSOA 3UJMA 3F9SA 1JNQA 3V99A 3NBBA 5AIIA 1U5OA 4I4KA 4O3VA 4WFOA 1NWWA 4HYZA 5D82A 4RZMA 3JVCA 1D6ZA 1MNLA 1NO3A 1IVVA 2CHCA 2RSXA 3EF8A 2YFLB 4H3UA 5CXOA 2HMMB 1WNHA 5AI1A 1TUHA 3VSYA 2CK3H 4HM6B 1T5YA 3Q1CA 1UUWB 2BMRB 1AR0A 3RGRA 3SEDA 3FH1A 2CFGA 4WWUC 4HJLB 3CME3 3FLJA 1O7NB 1NB3I 2W04A 4XBYA 2IMJA 3V92A 2E2UA 5IW9A 3CCM3 3CCV3 1QAFA 1W5ZA 3MYTA 3S29A 1OF5B 1UW1A 3BLZA 2XFSA 3LH4A 3BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT7 A;  5ELJ A;  1FA3 A;  1FUW A;  1MOL A;  2OCT A;  1CYU A;  1A90 A;  3KSE D;  3GAX A;  1STF I;  5EQL A;  2O9U X;  2W9Q A;  4LZI A;  4N6M A;  1TIJ A;  1PFP A;  1RN7 A;  3PXM A;  3Q2P A;  3PYJ A;  1CEW I;  5LC7 A;  1N5P A;  1LXE A;  2KXG A;  3IMA B;  4N6O B;  3UL6 A;  4EYC A;  5A0O B;  3QRD A;  1DVD A;  1M9G A;  1CYV A;  3L0R A;  4ZM8 A;  4N6N B;  1IV9 A;  4N6V 0;  4N6T A;  1KWI A;  1YVB I;  1DVC A;  4N6U A;  1GD3 A;  1NB5 I;  1G96 A;  1EQK A;  1A67 A;  2BO9 B;  3MWZ A;  3KFQ C;  1N5H A;  1N9J A;  1MNL A;  3S67 A;  4N6L A;  3UL5 A;  1WNH A;  3K9M C;  2CH9 A;  1IV7 A;  1GD4 A;  2W9P A;  5ELU A;  5LC6 A;  1R4C A;  1ROA A;  4CCV A;  1NB3 I;  4TX4 A;  3SVA A;  3PS8 A;  3LH4 A;  3NX0 A; 
#chains in the Genus database with same CATH topology
 3DM8 A;  3RGA A;  4IT7 A;  2M7O A;  3EE1 A;  2C11 A;  4BTY A;  1UCI A;  3LTD A;  4FCZ A;  8RNT A;  3KN4 A;  1MGR A;  1B21 A;  3NM2 A;  1BUJ A;  1MOL A;  1ZGX A;  2CWU A;  1V74 A;  2KRT A;  2HMN B;  1O7M B;  2WO0 A;  1BNJ A;  1GOV A;  5EVH A;  1CYU A;  2CX0 A;  3JUQ A;  1D6U A;  5AIF A;  4OUQ A;  1STF I;  1RGA A;  1OF5 A;  2OOV C;  1LOW A;  3PCS A;  5HOH A;  1NJI 4;  1RNB A;  3EN8 A;  1TTO A;  1M1X B;  5FW5 A;  1VZZ A;  4XDW A;  2D1W A;  3U1W A;  2W9Q A;  3AHW A;  1SJW A;  2K54 A;  3NHX A;  4N6M A;  1FGM A;  1K28 A;  1BOX A;  1GYB A;  2K3D A;  3CPO A;  3X40 A;  1TP6 A;  1PFP A;  1UI8 A;  1GY7 A;  2GSP A;  3I0Y A;  7GSP A;  3A5E A;  1UUV B;  3NQZ A;  1B2Z A;  1SIH A;  4FR9 A;  4BTX A;  2HMO B;  1I3F A;  1BSB A;  1IVW A;  4X2O A;  3FG1 A;  2HML B;  1YJN 3;  2CIU A;  1JV2 B;  3GZY B;  5G1K A;  2AAE A;  3PGB A;  3IMA B;  2KXG A;  1GMQ A;  3OX9 A;  2L4V A;  1VQP 3;  4K1U A;  5GSP A;  1BSD A;  3K63 A;  1BUQ A;  1FGO A;  3SOY A;  1T2I A;  1I2E A;  1UGH I;  2F5W A;  2ML5 A;  3URP A;  1UUG B;  1X1X A;  1DMM A;  1YIT 3;  2RFR A;  1TJD A;  6STD A;  1OGX A;  4MMZ B;  4JF8 A;  2UX0 A;  3UNL A;  1IV9 A;  4AKZ A;  2Y73 A;  1YJW 3;  3D9R A;  1W2Z A;  3SLU A;  1L5G B;  2Z77 A;  1X1W A;  4EXR A;  5CF2 A;  3GWR A;  4ORL A;  5AEU B;  2IY2 A;  2INX A;  1Y4K A;  4N6V 0;  1E3V A;  2GEX A;  1VQK 3;  4N6T A;  2O3O A;  1FGQ A;  5AYS C;  3GZB A;  1JJ2 2;  1Q86 4;  1DE3 A;  1IU7 A;  1BVI A;  1KWI A;  1BRS A;  4MEI A;  1I70 A;  3ZFZ A;  1BRJ A;  4HM7 B;  1X1U A;  1FGR A;  1GD3 A;  1VQN 3;  1G96 A;  1UDI I;  5RNT A;  4HM1 B;  4LMI A;  3GZR A;  1G0T A;  3DXO A;  4K1V A;  3CC4 3;  1A67 A;  1MWT A;  3FZW A;  1YI2 3;  3G6E 3;  4HKV B;  1TRQ A;  1U8C B;  3N54 B;  1RGK A;  5DRE A;  3KFQ C;  3CMA 3;  2GU1 A;  3OV4 A;  4BTW A;  2OTL 3;  1G02 A;  4WP5 A;  2CFD A;  3S67 A;  4HZ9 B;  5M1A A;  4BL2 A;  3KCH A;  3WR2 A;  1BU4 A;  1QAK A;  2STD A;  1RN1 A;  3V98 A;  5JPP A;  3LT8 A;  1IQY A;  3UL5 A;  3CCE 3;  2JDI H;  3K9M C;  1K9M 4;  3G16 A;  2W03 A;  4N3V A;  1TU5 A;  3FG4 A;  3EHC A;  4NRE A;  1Q7Y 4;  1ROA A;  4J5G A;  1MGW A;  3FCS B;  4CCV A;  2F86 B;  2CW9 A;  3EX9 A;  4EW5 A;  2F56 A;  1BNE A;  1W02 A;  1S5A A;  4TX4 A;  5HGR A;  3WOF B;  5KP3 A;  3JUO A;  3LTC A;  1FW7 A;  3B4P A;  2GXF A;  1KSI A;  1YJ9 3;  3ZG5 A;  3DUK A;  2PNC A;  3EBY A;  5IER A;  4LGQ A;  3HII A;  3MSO A;  3D79 A;  3B8L A;  3FKA A;  4MMY B;  7STD A;  1BRI A;  1BSE A;  2ML6 A;  3F8X A;  4XDV A;  1JBR A;  1BGS A;  1KC8 4;  2OCT A;  3NM7 A;  3CCJ 3;  1GMR A;  1O7H B;  5D83 A;  3LXU X;  4EV2 A;  1TFK A;  2XF3 A;  2YFJ B;  3F40 A;  4HVN A;  1BIR A;  1K41 A;  1RSN A;  1TRP A;  3FF0 A;  3FGY A;  2R4I A;  1RGG A;  5G2G A;  4O8S A;  3X42 A;  1OCV A;  3TDG A;  1EKM A;  5DRV A;  5IEP A;  1LRA A;  3N9H A;  3WOD G;  5AEW B;  4GL6 A;  4O02 B;  1A2V A;  1FZU A;  1LOX A;  4MJD A;  3NQY A;  3MG2 A;  1EA2 A;  3BNC A;  3PXM A;  5AIG A;  3HOH A;  3K7C A;  3Q2P A;  4J8T A;  1CEW I;  3X41 A;  1IQX A;  5LC7 A;  1BSA A;  1A2P A;  4CJN A;  5CLK A;  2OOV A;  4N6O B;  2C10 A;  3AMO B;  4EYC A;  3BB9 A;  3F14 A;  3F8H A;  4HZB B;  5A0O B;  1GY5 A;  2BNG A;  3LTB A;  4HOH A;  2BIR A;  3EB8 A;  4R1K A;  3IJE B;  1W6C A;  4RNY A;  3X3X A;  2ZDJ A;  1RKY A;  1B2M A;  3G8Z A;  1W00 A;  2W2C A;  4QWT A;  3LZA A;  1FYS A;  1N9E A;  3ECF A;  1Q82 4;  2WGO A;  3ALA A;  3FG3 A;  1LQG C;  1JB5 A;  2L1S A;  2RNT A;  4O2H A;  5M19 A;  1VQ6 3;  3WA2 X;  3L0R A;  5D81 A;  4ZM8 A;  1VQ4 3;  4N6N B;  1MWS A;  2XRX B;  3AMO A;  1JKG B;  4K61 A;  4NHF A;  3BNB A;  3GRD A;  4H61 A;  4IPB A;  1YGW A;  1W2B 2;  1ULI B;  5STD A;  4Q53 A;  2P38 A;  3K5T A;  3U97 A;  2KAA A;  9RNT A;  5KP1 A;  4HM0 B;  3H51 A;  1FUS A;  4MMX B;  5BIR A;  3WDG B;  3IPT A;  4WYK B;  2WGQ A;  1AV4 A;  4EV5 A;  4ILF A;  3DGO A;  2A15 A;  3MG1 A;  3ROB A;  2CG0 A;  2W0Q A;  3KKG A;  4RBN A;  1I8V A;  1JKG A;  1RMS A;  4N6U A;  4XM4 A;  1NB5 I;  1ROV A;  3D5I A;  3O8Y A;  2R41 A;  1OPY A;  4HM8 B;  3LML A;  3DH2 A;  3EJV A;  1RGE A;  5I97 A;  3S27 A;  4WYK A;  4BIR A;  3G4S 3;  2BO9 B;  3KII A;  1V58 A;  1VQL 3;  1QAL A;  2PZV A;  3CD6 3;  1N5H A;  3FSD A;  1N9J A;  2P0M A;  2V1L A;  1WMP A;  4FMC A;  4N6L A;  8CHO A;  1Q40 A;  1W7C A;  3DZL A;  3CCR 3;  1GY6 A;  4KFE A;  1BNR A;  1NNV A;  1AQZ A;  1JRQ A;  4HM3 B;  1VQ5 3;  3STD A;  4EBG A;  4G1M B;  1IV7 A;  1GD4 A;  3T8U A;  3B4O A;  5ELU A;  3CCL 3;  3AGO A;  2KF4 A;  1FUT A;  5IG3 A;  1IVX A;  1VQ7 3;  5AYR B;  1JB2 A;  1LOY A;  1GMP A;  1IDP A;  1TFO A;  5CF1 A;  1VQ8 3;  1V57 A;  1A2K A;  1RN4 A;  3MHE A;  5EEO A;  1PYL A;  1HKX A;  2H0G A;  3SVA A;  1N8R 4;  3PS8 A;  2Z6B A;  4HM2 B;  2OQE C;  1YGE A;  4FMD A;  1S72 3;  3NX0 A;  4GB5 A;  2E2T A;  1B2X A;  2KF6 A;  5KP4 A;  2KF5 A;  1O7W B;  2FGT A;  5ELJ A;  4R9L A;  1FUW A;  2F4Y A;  3F7X A;  2B1X B;  3LT9 A;  3T0U A;  3S28 A;  3M8C A;  1BSC A;  2F99 A;  1W01 A;  1T2H A;  3DGY A;  7RNT A;  1A90 A;  3CPW 2;  1SPU A;  2YX9 A;  1JB4 A;  1NU3 A;  2WOH A;  5TGN A;  3S5C A;  1RGC A;  3T8N A;  4GSP A;  1SQW A;  2GBW B;  2P0X A;  5EQL A;  3GSP A;  1AVL A;  4KFD A;  3NV0 B;  2MC8 A;  1Q7H A;  1RJO A;  2LQV A;  4AKY A;  4LZI A;  3RNT A;  4HBR A;  1F8N A;  4K90 B;  4AEQ A;  4FCM A;  1I3I A;  1RDS A;  1US1 A;  1QJG A;  3HI7 A;  4L7K A;  3EN1 B;  1Q81 4;  1WMN A;  5IEO A;  5CK6 A;  2XGN A;  3PYJ A;  3CCU 3;  3HK4 A;  1LOV A;  4KVH A;  2OTJ 3;  2FNQ A;  4LYL B;  1SAR A;  4RNZ A;  3BND A;  3NV0 A;  4X2H A;  2IUK A;  1BRN L;  1D6Y A;  3NUV A;  3SYU A;  3WOE B;  3X3Z A;  2ZL8 A;  3OWY A;  3QK9 A;  3X3Y A;  1GSP A;  3ZG0 A;  2KCD A;  1DVD A;  3JUP A;  3BU4 A;  3CC7 3;  3VF1 A;  1EUI C;  1VQQ A;  4JRF A;  2W6J H;  1CYV A;  2IA7 A;  2Z76 A;  3J7Y d;  5JBS A;  2RCD A;  2XEP A;  2MF7 A;  3DMC A;  3LYG A;  1KQS 2;  1M90 4;  1J2B A;  4HAA A;  2CC3 A;  3UB1 A;  3FF2 A;  1BNS A;  1DET A;  1DMQ A;  2CWV A;  3PZW A;  3MKI A;  4EC6 A;  1HU9 A;  2GEY A;  1O7G B;  3EQQ B;  3B7C A;  4IIA A;  2ZHX B;  1QVF 2;  2YFI B;  1YHQ 3;  1E3R A;  3VGN A;  3GZX B;  4FMB A;  3N8B A;  2HMJ B;  4R4K A;  5IF6 A;  4J9A A;  1GOY A;  1YVS A;  1ASK A;  1DMN A;  3G71 3;  1I0X A;  3DGN A;  4HM5 B;  3WA3 A;  2HOH A;  2JQ5 A;  2K0M A;  1OGZ A;  1VQM 3;  3SX1 A;  1B27 A;  1WMO A;  1OHS A;  1LQM B;  2CX1 A;  3G0K A;  1MWR A;  1HZ1 A;  2HMK B;  3AHS A;  3MWZ A;  4FCJ A;  3DGM A;  2XR8 B;  3KE7 A;  2XSO B;  1QMA A;  1UGI A;  2QA4 3;  1RHL A;  3I55 3;  3OXA A;  1YNV X;  3H3H A;  1RRH A;  1JZO A;  1W4N A;  4RNT A;  3F7S A;  1BRH A;  2CKF B;  3Q90 A;  1PU4 A;  2CH9 A;  2RGQ A;  3NBJ A;  3WHO A;  3CCS 3;  1KD1 4;  1WTH A;  2W9P A;  3KZT A;  1SII A;  1ZX2 A;  4HM4 B;  2CG1 A;  2CFK A;  2XFT A;  2ZA4 A;  5LC6 A;  2P09 A;  3JUM A;  1R4C A;  2WOF A;  3D3L A;  3ER7 A;  3HZP A;  2F5M A;  3CC2 3;  3DGL A;  1Q40 B;  1DYU A;  5IEN A;  4NPB A;  1B3S A;  1BRG A;  2SBL A;  2Y74 A;  3CXC 2;  1B2U A;  1ISK A;  3PCR A;  1I0V A;  1OHO A;  2FXT A;  4STD A;  2GBX B;  1VQO 3;  1RRL A;  1PY3 A;  4PEJ A;  3WMD A;  1FA3 A;  4LEH A;  3SOA A;  3A76 A;  1AY7 A;  4OK0 A;  3OW2 2;  3CCQ 3;  2SAR A;  3LOY A;  4R80 A;  5IG5 A;  3KSE D;  2BU4 A;  3GAX A;  2LYX A;  4WHA A;  2XH9 A;  1BAO A;  3MPH A;  5IG0 A;  1N8Q A;  1OH0 A;  1IQ8 A;  3I56 3;  5FGO A;  2O9U X;  2BHM A;  3EBT A;  1IK3 A;  1LNI A;  2OQE A;  5G1L A;  1NDO B;  1FGT A;  1TIJ A;  2CFW A;  2QGU A;  2P05 A;  3DY5 A;  3HX8 A;  1EG9 B;  1IVU A;  1ZO2 A;  4L8O A;  3KSP A;  2W56 B;  1BNI A;  4BL3 A;  3K0Z A;  2QEX 3;  1AVK A;  1RN7 A;  2Q07 A;  1RGH A;  3Q3F A;  3RDE A;  2CWT A;  4XB5 A;  1STD A;  2XSH B;  4GHO A;  2B24 B;  5AIH A;  1YIJ 3;  2E2V A;  4CDL A;  5BXQ A;  4J5K A;  2QIY A;  1RLS A;  3D5G A;  1N5P A;  1LXE A;  1K73 4;  3NXJ A;  3UL6 A;  3AGN A;  3CNX A;  1UCK A;  2CFL A;  1CQS A;  4DKI A;  2I9W A;  2XGL A;  1OAC A;  2F98 A;  3QRD A;  2UUG C;  2OWP A;  2AAD A;  2W56 A;  4KZ1 A;  1Q42 A;  1M9G A;  1M1K 4;  1JN5 B;  1BNG A;  3OWU A;  2IUJ A;  1QVG 2;  1IT7 A;  6RNT A;  3LTA A;  3JUN A;  3MG3 A;  1WQL B;  1R4Y A;  1ULJ B;  2BT3 A;  1K8A 4;  1C7H A;  1GS3 A;  3HIG A;  4FMA A;  4OVM A;  1IT8 A;  1E97 A;  1JZD A;  3CNM A;  1LVN A;  2RBI A;  3E99 A;  1VQ9 3;  1RGF A;  1UI7 A;  1W6Y A;  2BMO B;  4L8P A;  1C54 A;  3CU3 A;  3OWS A;  1JN5 A;  3NBR A;  2J8X B;  1JBT A;  2GU3 A;  1YVB I;  1BNF A;  1Q9E A;  1RGL A;  2BMQ B;  4KFF A;  1Z1S A;  1DVC A;  2Z7A A;  1UCL A;  4XBX A;  1RCK A;  1O7P B;  2D42 A;  5JPU A;  3D4A A;  3SXX A;  1T3B A;  1OUN A;  2IYJ A;  2KF3 A;  3EC9 A;  5M18 A;  5IG4 A;  1I2G A;  1UCJ A;  4U13 A;  4R9K A;  1OHP A;  1W6G A;  1EQK A;  4KT3 B;  2H0I A;  4XBT A;  5BVB A;  4LSO A;  3UJM A;  3F9S A;  1JNQ A;  1GOU A;  4BU4 A;  3V99 A;  1X1Y A;  3NBB A;  5AII A;  6GSP A;  1U5O A;  4I4K A;  4O3V A;  4WFO A;  1EEJ A;  5BU4 A;  1NWW A;  4HYZ A;  5D82 A;  4RZM A;  1JBS A;  3JVC A;  1D6Z A;  1MNL A;  1NO3 A;  1CH0 A;  1IVV A;  2CHC A;  3BIR A;  2UGI A;  2RSX A;  3EF8 A;  2YFL B;  4H3U A;  5CXO A;  2HMM B;  1WNH A;  5AI1 A;  1TUH A;  3VSY A;  2CK3 H;  4I5Q A;  1RTU A;  1ZS7 A;  4HM6 B;  1T5Y A;  3Q1C A;  1UUW B;  2BMR B;  1B20 A;  1BAN A;  1AR0 A;  1B2S A;  3RGR A;  3SED A;  4CPK A;  3FH1 A;  2CFG A;  4WWU C;  4HJL B;  1RCL A;  3CME 3;  1BRK A;  1MWU A;  3FLJ A;  1O7N B;  2XFS A;  1NB3 I;  1IYY A;  2W04 A;  4XBY A;  2IMJ A;  3V92 A;  1RNT A;  2E2U A;  5IW9 A;  3CCM 3;  2C4B A;  3CCV 3;  1QAF A;  1W5Z A;  3MYT A;  2H0H A;  3S29 A;  1OF5 B;  1UW1 A;  3BLZ A;  1LNH A;  1HYF A;  3LH4 A;  3BNE A;  1I2F A; 
#chains in the Genus database with same CATH homology
 3DM8 A;  3RGA A;  4IT7 A;  2M7O A;  3EE1 A;  2C11 A;  4BTY A;  3LTD A;  4FCZ A;  3KN4 A;  3NM2 A;  1MOL A;  2CWU A;  2KRT A;  1V74 A;  2HMN B;  1O7M B;  2WO0 A;  5EVH A;  1CYU A;  3JUQ A;  1D6U A;  5AIF A;  4OUQ A;  1STF I;  3PCS A;  1OF5 A;  2OOV C;  1NJI 4;  3EN8 A;  1M1X B;  5FW5 A;  1VZZ A;  4XDW A;  2D1W A;  3U1W A;  2W9Q A;  1SJW A;  2K54 A;  3NHX A;  4N6M A;  1FGM A;  1K28 A;  1GYB A;  3CPO A;  3X40 A;  1TP6 A;  1PFP A;  1UI8 A;  1GY7 A;  3I0Y A;  1UUV B;  3NQZ A;  1SIH A;  4FR9 A;  4BTX A;  2HMO B;  1IVW A;  4X2O A;  3FG1 A;  2HML B;  1YJN 3;  2CIU A;  1JV2 B;  3GZY B;  3PGB A;  3IMA B;  2KXG A;  3OX9 A;  2L4V A;  1VQP 3;  4K1U A;  3K63 A;  1BUQ A;  1FGO A;  3SOY A;  2ML5 A;  1DMM A;  1YIT 3;  2RFR A;  6STD A;  1OGX A;  4MMZ B;  4JF8 A;  2UX0 A;  3UNL A;  1IV9 A;  4AKZ A;  2Y73 A;  1YJW 3;  3D9R A;  1W2Z A;  3SLU A;  1L5G B;  2Z77 A;  4EXR A;  5CF2 A;  3GWR A;  4ORL A;  5AEU B;  2INX A;  1Y4K A;  4N6V 0;  1E3V A;  2GEX A;  1VQK 3;  1LNH A;  2O3O A;  1FGQ A;  4N6T A;  5AYS C;  3GZB A;  1JJ2 2;  1Q86 4;  1IU7 A;  1KWI A;  4MEI A;  4HM7 B;  1FGR A;  1GD3 A;  1VQN 3;  1G96 A;  4HM1 B;  4LMI A;  3GZR A;  3DXO A;  4K1V A;  3CC4 3;  1A67 A;  3FZW A;  1YI2 3;  3G6E 3;  4HKV B;  1U8C B;  3N54 B;  5DRE A;  3KFQ C;  3CMA 3;  2GU1 A;  3OV4 A;  4BTW A;  2OTL 3;  4WP5 A;  2CFD A;  3S67 A;  4HZ9 B;  5JPP A;  1QAK A;  2STD A;  3V98 A;  3LT8 A;  1IQY A;  3UL5 A;  3CCE 3;  2JDI H;  3K9M C;  1K9M 4;  3G16 A;  2W03 A;  4N3V A;  1TU5 A;  3FG4 A;  3EHC A;  4NRE A;  1Q7Y 4;  1ROA A;  4CCV A;  3FCS B;  2F86 B;  2CW9 A;  3EX9 A;  1W02 A;  1S5A A;  4TX4 A;  5HGR A;  3WOF B;  5KP3 A;  3JUO A;  3LTC A;  3B4P A;  2GXF A;  1KSI A;  1YJ9 3;  3DUK A;  2PNC A;  3EBY A;  5IER A;  4LGQ A;  3HII A;  3MSO A;  3B8L A;  3FKA A;  4MMY B;  7STD A;  2ML6 A;  3F8X A;  4XDV A;  1KC8 4;  2OCT A;  3NM7 A;  3CCJ 3;  5D83 A;  1O7H B;  3LXU X;  4EV2 A;  1TFK A;  2XF3 A;  2YFJ B;  3F40 A;  4HVN A;  1K41 A;  3FGY A;  3FF0 A;  2R4I A;  5G2G A;  4O8S A;  3X42 A;  1OCV A;  3TDG A;  1EKM A;  5DRV A;  5IEP A;  3N9H A;  3WOD G;  5AEW B;  4GL6 A;  4O02 B;  1A2V A;  1LOX A;  4MJD A;  3NQY A;  3MG2 A;  1EA2 A;  3BNC A;  3PXM A;  5AIG A;  3K7C A;  3Q2P A;  4J8T A;  1CEW I;  3X41 A;  1IQX A;  5LC7 A;  5CLK A;  2OOV A;  4N6O B;  2C10 A;  3AMO B;  4EYC A;  3BB9 A;  3F14 A;  3F8H A;  4HZB B;  5A0O B;  1GY5 A;  2BNG A;  3LTB A;  4RNY A;  3EB8 A;  4R1K A;  3IJE B;  1W6C A;  3X3X A;  2ZDJ A;  1RKY A;  3G8Z A;  1W00 A;  2W2C A;  4QWT A;  3LZA A;  1N9E A;  3ECF A;  1Q82 4;  2WGO A;  3ALA A;  3FG3 A;  1JB5 A;  4O2H A;  1VQ6 3;  3WA2 X;  3L0R A;  5D81 A;  4ZM8 A;  1VQ4 3;  4N6N B;  3AMO A;  2XRX B;  1JKG B;  4K61 A;  4NHF A;  3BNB A;  3GRD A;  4H61 A;  4IPB A;  1W2B 2;  1ULI B;  5STD A;  4Q53 A;  2P38 A;  3K5T A;  3U97 A;  5KP1 A;  4HM0 B;  3H51 A;  4MMX B;  3WDG B;  3IPT A;  4WYK B;  2WGQ A;  1AV4 A;  4EV5 A;  3DGO A;  2A15 A;  3MG1 A;  3ROB A;  2CG0 A;  2W0Q A;  3KKG A;  4RBN A;  4N6U A;  1JKG A;  4XM4 A;  1NB5 I;  1ROV A;  3O8Y A;  1OPY A;  4HM8 B;  3LML A;  3EJV A;  5I97 A;  3S27 A;  4WYK A;  3G4S 3;  2BO9 B;  3KII A;  1VQL 3;  1QAL A;  2PZV A;  3CD6 3;  1N5H A;  3FSD A;  1N9J A;  2P0M A;  2V1L A;  1WMP A;  4FMC A;  4N6L A;  8CHO A;  1Q40 A;  1W7C A;  3DZL A;  1GY6 A;  4KFE A;  4HM3 B;  1JRQ A;  1VQ5 3;  3STD A;  4EBG A;  4G1M B;  1IV7 A;  1GD4 A;  3T8U A;  3B4O A;  5ELU A;  3CCL 3;  5IG3 A;  1IVX A;  1VQ7 3;  5AYR B;  1JB2 A;  1IDP A;  1TFO A;  5CF1 A;  1VQ8 3;  1A2K A;  3MHE A;  5EEO A;  1HKX A;  3SVA A;  1N8R 4;  3PS8 A;  2Z6B A;  4HM2 B;  2OQE C;  1YGE A;  4FMD A;  1S72 3;  3NX0 A;  4GB5 A;  2E2T A;  5KP4 A;  1O7W B;  2FGT A;  5ELJ A;  4R9L A;  1FUW A;  3F7X A;  2B1X B;  3LT9 A;  3T0U A;  3S28 A;  3M8C A;  2F99 A;  1W01 A;  1A90 A;  3CPW 2;  1SPU A;  2YX9 A;  1JB4 A;  1NU3 A;  2WOH A;  5TGN A;  3S5C A;  3T8N A;  1SQW A;  2GBW B;  2P0X A;  5EQL A;  1AVL A;  4KFD A;  3NV0 B;  2MC8 A;  1RJO A;  2LQV A;  4AKY A;  4LZI A;  4AEQ A;  4HBR A;  1F8N A;  4K90 B;  4FCM A;  1QJG A;  1US1 A;  3HI7 A;  4L7K A;  3EN1 B;  1Q81 4;  1WMN A;  5IEO A;  5CK6 A;  2XGN A;  3PYJ A;  3CCU 3;  3HK4 A;  4KVH A;  2OTJ 3;  2FNQ A;  4RNZ A;  3BND A;  3NV0 A;  4X2H A;  2IUK A;  1D6Y A;  3NUV A;  3X3Z A;  3WOE B;  2ZL8 A;  3OWY A;  3QK9 A;  3X3Y A;  2KCD A;  1DVD A;  3JUP A;  3CC7 3;  3VF1 A;  4JRF A;  2W6J H;  1CYV A;  2IA7 A;  2Z76 A;  3J7Y d;  5JBS A;  2RCD A;  2XEP A;  2MF7 A;  3DMC A;  3LYG A;  1KQS 2;  1M90 4;  1J2B A;  2CC3 A;  3UB1 A;  3FF2 A;  1DMQ A;  2CWV A;  3PZW A;  3MKI A;  4EC6 A;  1HU9 A;  2GEY A;  1O7G B;  3EQQ B;  3B7C A;  4IIA A;  1QVF 2;  2YFI B;  1YHQ 3;  1E3R A;  3VGN A;  3GZX B;  4FMB A;  3N8B A;  2HMJ B;  4R4K A;  5IF6 A;  4J9A A;  1ASK A;  1DMN A;  3G71 3;  3DGN A;  4HM5 B;  3WA3 A;  2JQ5 A;  2K0M A;  1OGZ A;  1VQM 3;  3SX1 A;  1WMO A;  1OHS A;  3G0K A;  2HMK B;  4FCJ A;  3MWZ A;  3DGM A;  2XR8 B;  3KE7 A;  2XSO B;  1QMA A;  2QA4 3;  3I55 3;  3OXA A;  3H3H A;  1RRH A;  1W4N A;  3F7S A;  2CKF B;  1PU4 A;  3Q90 A;  2CH9 A;  2RGQ A;  3NBJ A;  3CCS 3;  1KD1 4;  1WTH A;  2W9P A;  3KZT A;  1SII A;  1ZX2 A;  4HM4 B;  2CG1 A;  2CFK A;  2XFT A;  5LC6 A;  2P09 A;  3JUM A;  1R4C A;  2WOF A;  3D3L A;  3ER7 A;  3HZP A;  3CC2 3;  3DGL A;  1Q40 B;  1DYU A;  5IEN A;  1ISK A;  2SBL A;  2Y74 A;  3CXC 2;  3PCR A;  1OHO A;  2FXT A;  4STD A;  2GBX B;  1VQO 3;  1RRL A;  3WMD A;  4PEJ A;  1FA3 A;  4LEH A;  3SOA A;  3A76 A;  4OK0 A;  3OW2 2;  3CCQ 3;  3LOY A;  4R80 A;  5IG5 A;  3KSE D;  3GAX A;  2LYX A;  4WHA A;  2XH9 A;  3MPH A;  5IG0 A;  1N8Q A;  1OH0 A;  1IQ8 A;  3I56 3;  5FGO A;  2O9U X;  2BHM A;  3EBT A;  1IK3 A;  2OQE A;  1NDO B;  1FGT A;  1TIJ A;  2CFW A;  2QGU A;  2P05 A;  3DY5 A;  3HX8 A;  1EG9 B;  1IVU A;  1ZO2 A;  4L8O A;  3KSP A;  2W56 B;  2QEX 3;  3CCR 3;  3K0Z A;  1AVK A;  1RN7 A;  2Q07 A;  3RDE A;  2CWT A;  4XB5 A;  1STD A;  2XSH B;  5AIH A;  2B24 B;  1YIJ 3;  2E2V A;  4CDL A;  5BXQ A;  2QIY A;  1N5P A;  1LXE A;  1K73 4;  3NXJ A;  3UL6 A;  3CNX A;  2CFL A;  1CQS A;  2I9W A;  2XGL A;  1OAC A;  2F98 A;  3QRD A;  2W56 A;  2OWP A;  4KZ1 A;  1Q42 A;  1M9G A;  1M1K 4;  1JN5 B;  3OWU A;  2IUJ A;  1QVG 2;  1IT7 A;  3LTA A;  3JUN A;  3MG3 A;  1WQL B;  1ULJ B;  1K8A 4;  2BT3 A;  1C7H A;  1GS3 A;  3HIG A;  4FMA A;  4OVM A;  1IT8 A;  1E97 A;  3CNM A;  1LVN A;  3E99 A;  1VQ9 3;  2BMO B;  1UI7 A;  1W6Y A;  4L8P A;  3CU3 A;  3OWS A;  1JN5 A;  3NBR A;  2GU3 A;  1YVB I;  2BMQ B;  4KFF A;  1Z1S A;  1DVC A;  2Z7A A;  4XBX A;  1O7P B;  2D42 A;  5JPU A;  3SXX A;  1OUN A;  3EC9 A;  5IG4 A;  4U13 A;  4R9K A;  1OHP A;  1W6G A;  1EQK A;  4XBT A;  5BVB A;  4LSO A;  3UJM A;  3F9S A;  1JNQ A;  3V99 A;  3NBB A;  5AII A;  1U5O A;  4I4K A;  4O3V A;  4WFO A;  1NWW A;  4HYZ A;  5D82 A;  4RZM A;  3JVC A;  1D6Z A;  1MNL A;  1NO3 A;  1IVV A;  2CHC A;  2RSX A;  3EF8 A;  2YFL B;  4H3U A;  5CXO A;  2HMM B;  1WNH A;  5AI1 A;  1TUH A;  3VSY A;  2CK3 H;  4HM6 B;  1T5Y A;  3Q1C A;  1UUW B;  2BMR B;  1AR0 A;  3RGR A;  3SED A;  3FH1 A;  2CFG A;  4WWU C;  4HJL B;  3CME 3;  3FLJ A;  1O7N B;  1NB3 I;  2W04 A;  4XBY A;  2IMJ A;  3V92 A;  2E2U A;  5IW9 A;  3CCM 3;  3CCV 3;  1QAF A;  1W5Z A;  3MYT A;  3S29 A;  1OF5 B;  1UW1 A;  3BLZ A;  2XFS A;  3LH4 A;  3BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...