3MYTA

Crystal structure of ketosteroid isomerase d38hd99n from pseudomonas testosteroni (tksi)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
b'MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEHPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D38HD99N from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 34
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3mytA00
4KVHA 2OWPA 5KP3A 5BVBA 1JKGB 1BUQA 3DUKA 4XM4A 5D81A 4HZ9B 3OWSA 5IG5A 4LMIA 1OHPA 2BMRB 4HM5B 3GZXB 1VZZA 3RGRA 2XR8B 3KZTA 1SJWA 3EN8A 3Q90A 3KSPA 3KKGA 4FCMA 3MKIA 2F99A 1NWWA 4XB5A 3GZYB 3JUPA 1ASKA 1IDPA 2B1XB 2QGUA 3EJVA 2Z77A 3LYGA 1NDOB 4N3VA 4PEJA 5AIFA 1TP6A 2IMJA 3I0YA 3NBRA 2RCDA 1O7PB 2B24B 3FF0A 3FSDA 4XBYA 1O7MB 3F8XA 3NV0A 4HM2B 5CK6A 3MG2A 1JN5B 1U5OA 3DMCA 3OV4A 4WYKA 4HJLB 5JPUA 1W02A 3ROBA 4MJDA 3FKAA 3CPOA 2GXFA 4XDVA 3H51A 5DREA 1DMNA 5IG3A 4CDLA 3M8CA 5AIIA 4I4KA 4ORLA 2XSOB 3FF2A 2K54A 3G16A 5IEPA 4R1KA 1HKXA 1OGZA 3NM2A 2YFJB 2F86B 5D82A 3F40A 2XRXB 2CHCA 3VGNA 3OX9A 1OGXA 3K0ZA 3T8NA 2I9WA 3EHCA 3UNLA 6STDA 5HGRA 2GBWB 1UUWB 1DMQA 3F7SA 3STDA 4OUQA 5KP4A 3UJMA 1W01A 1QJGA 3DXOA 2GEYA 3G0KA 5G2GA 2HMJB 2HMLB 1GY7A 3JUMA 5CF2A 1O7NB 1O7HB 4J8TA 3ECFA 2STDA 3GZRA 1CQSA 3WMDA 2QIYA 3FH1A 2R4IA 1ZX2A 3GRDA 1JB5A 3SOYA 1S5AA 1OCVA 1OPYA 3NV0B 2BMOB 4U13A 5EVHA 4WYKB 2UX0A 1E97A 1OH0A 3F8HA 1Q40A 3BLZA 1O7WB 3MG3A 4XDWA 3A76A 4HZBB 3HK4A 1GY6A 2INXA 1WQLB 3NHXA 3B4PA 3MSOA 5KP1A 2BMQB 4XBTA 2HMMB 4OVMA 3F14A 3JUQA 1ULIB 5CXOA 4LGQA 3RGAA 2Z76A 3B7CA 3EBTA 1GY5A 3EF8A 4FCJA 1OHSA 1UUVB 5AIHA 3EC9A 3JUOA 4WP5A 3T8UA 1W00A 2CKFB 2JQ5A 3EBYA 4HM0B 2GBXB 3LZAA 1AR0A 3SOAA 7STDA 2Z7AA 3HZPA 4HM1B 5AI1A 1OF5A 3OXAA 5STDA 1GYBA 2F98A 1Z1SA 4X2OA 1E3RA 1O7GB 3NUVA 2YFLB 4RZMA 2PZVA 5TGNA 4J9AA 4HKVB 2A15A 3FZWA 5CF1A 3GZBA 3F7XA 1ULJB 1QMAA 5AEWB 1OUNA 5IG0A 1OHOA 3DZLA 1ZO2A 5DRVA 3OWUA 5IERA 3EN1B 5IENA 3G8ZA 5BXQA 1EA2A 5IG4A 4XBXA 3VSYA 4LEHA 1EG9B 1Q42A 4L8OA 1JKGA 3FGYA 1Q40B 1DMMA 3EX9A 1TUHA 3FLJA 3B4OA 3F9SA 4HM3B 3EQQB 4GB5A 4WWUC 4K1UA 3JUNA 5IEOA 3MG1A 3GWRA 1NU3A 2W2CA 5AIGA 1K41A 4R9LA 4Q53A 1E3VA 2BNGA 3IPTA 5FW5A 3OWYA 5D83A 5JPPA 2RGQA 4HVNA 2GEXA 3MYTA 4HM4B 1STDA 4HM8B 4R9KA 4H3UA 3HX8A 2RFRA 4HM6B 1JB4A 2XSHB 1GS3A 4L7KA 1JB2A 3H3HA 1A2KA 5AEUB 3NXJA 3K7CA 2HMKB 3S5CA 3BB9A 3ER7A 3MHEA 2HMOB 3SEDA 1OF5B 3CNMA 8CHOA 1JN5A 5CLKA 3CNXA 4L8PA 3CU3A 1W6YA 2YFIB 5IF6A 3E99A 3DM8A 4HM7B 3D9RA 4IIAA 4K1VA 1ISKA 4X2HA 1C7HA 4STDA 2HMNB 3B8LA 3KE7A
chains in the Genus database with same CATH superfamily
1WMNA 4KVHA 1FUSA 1W5ZA 1IV9A 3ZG0A 3S29A 2OWPA 3NBJA 5KP3A 4BTWA 1IV7A 2IUKA 5BVBA 3D5GA 2H0GA 1U8CB 4HAAA 1JKGB 2F5MA 1BUQA 1UCIA 3DUKA 5M18A 1M1XB 4XM4A 4O02B 1AQZA 1DYUA 1N9JA 5D81A 1T2IA 4HZ9B 1RGGA 3OWSA 1I70A 5IG5A 1FGQA 1GOUA 1RCLA 1LQMB 3HI7A 4LMIA 5G1KA 1TFKA 2ZA4A 1OHPA 4N6UA 1JV2B 2P09A 4FCZA 1VQ73 2WGQA 1MWSA 4NHFA 2BMRB 1DVDA 4HM5B 3S27A 3GZXB 1VZZA 3FG4A 3DGNA 1RGAA 1YIJ3 4IT7A 2RSXA 4R4KA 1OACA 1FGRA 3S28A 1KD14 2E2TA 3NQYA 1ZS7A 2W56A 5AYSC 1N9EA 1BSDA 3RGRA 1K9M4 1IT7A 3KN4A 1VQO3 2XR8B 3AMOB 3LXUX 4K90B 1FA3A 3KZTA 3A5EA 2K3DA 1A67A 1RN7A 1SJWA 2BIRA 2OOVA 3EN8A 3Q90A 3KSPA 2K0MA 1K8A4 4BIRA 1K734 2P0MA 1RSNA 4N6NB 1T5YA 3WA2X 3KKGA 1UGIA 1RDSA 4FCMA 1BSCA 3MKIA 2QEX3 1B2MA 1FGMA 2F99A 3KFQC 1M904 1PU4A 2SARA 3LMLA 3N54B 1NWWA 2CW9A 4QWTA 3UL6A 1TU5A 4XB5A 4I5QA 3EB8A 1CYVA 3GZYB 3JUPA 1MWUA 1TJDA 1ASKA 3LTCA 4CJNA 2F56A 4N6MA 4AEQA 1IDPA 2B1XB 2QGUA 3CCR3 3EJVA 2Z77A 3LYGA 2LYXA 1NDOB 1RMSA 2Y73A 4N3VA 3X41A 3MPHA 4BTXA 4PEJA 1YHQ3 5BU4A 5AIFA 2CX1A 2GU1A 2WO0A 4FMCA 1WMPA 1TP6A 1BRSA 2IMJA 3I0YA 3AHSA 2CH9A 3L0RA 3HOHA 3CME3 1G96A 3NBRA 2RCDA 2W04A 3U97A 1QVF2 5GSPA 3BNCA 1YJW3 1O7PB 2B24B 1RGKA 2CWUA 4EYCA 3FF0A 3FSDA 1Q864 3LH4A 1KC84 4XBYA 1HZ1A 1O7MB 1WMOA 3F8XA 2CFDA 2FXTA 3NV0A 4RNZA 2Q07A 4HM2B 1T2HA 5CK6A 3MG2A 4NREA 1JN5B 1U5OA 3DMCA 3RDEA 1LQGC 3CC73 3OV4A 2CFLA 4WYKA 4EW5A 2JDIH 1VQQA 4HJLB 2Z6BA 5ELUA 1W02A 4G1MB 5JPUA 3J7Yd 1VQ83 3OW22 3LTDA 3ROBA 4RNYA 2KRTA 4BTYA 1X1YA 3PYJA 1VQP3 4MJDA 3D5IA 4EV2A 3LT8A 3FKAA 3NQZA 3CPOA 2GXFA 4XDVA 1RRHA 1LXEA 1LRAA 3K9MC 2XGLA 1AVLA 1TTOA 1MOLA 3H51A 5DREA 1DMNA 4KFFA 1RGFA 4RBNA 5IG3A 3SYUA 1DE3A 4CDLA 3M8CA 2L1SA 2W03A 2IUJA 3RNTA 5AIIA 3U1WA 4ZM8A 2GSPA 1BNSA 1QAKA 3G6E3 3AGOA 4I4KA 4ORLA 1TFOA 2ML5A 2XSOB 3LOYA 3FF2A 2K54A 3G16A 4KT3B 4RNTA 5IEPA 3O8YA 1LOYA 1MGRA 3ZG5A 3CCQ3 1I3FA 4R1KA 1HKXA 1OGZA 3NM2A 5LC6A 1M1K4 3EE1A 2YFJB 2F86B 8RNTA 1CYUA 1YNVX 1JBTA 5D82A 4JF8A 1LOVA 3V99A 3F40A 4MMXB 2XRXB 1BNIA 1R4CA 1JZDA 3CCU3 1BU4A 1B3SA 1L5GB 5EQLA 4TX4A 2CG1A 3ZFZA 2CHCA 1KSIA 3SX1A 5ELJA 2P0XA 3OX9A 4KFEA 3VGNA 1OGXA 3K0ZA 3NX0A 3T8NA 1JJ22 1FYSA 2W9PA 5RNTA 1A2VA 2I9WA 2W56B 2E2UA 3EHCA 3UNLA 1VQ43 3IJEB 4GL6A 5LC7A 2CIUA 1BRNL 1BRKA 3DGOA 1EQKA 2UGIA 1LOXA 2BO9B 6STDA 3CC43 5HGRA 2GBWB 4LZIA 2WGOA 4EBGA 1RGLA 3SVAA 1UUWB 1DMQA 3F7SA 1RN1A 1RN4A 1W2B2 3STDA 4OUQA 4KFDA 5KP4A 3UJMA 1NB5I 1W01A 4O3VA 1QJGA 1B21A 2CFGA 2KXGA 3DXOA 2GEYA 1BSEA 3CCJ3 3G0KA 3FG1A 1UW1A 5G2GA 2HMJB 2HMLB 2OQEA 1GY7A 3JUMA 2FNQA 7GSPA 5M19A 1HYFA 5A0OB 5CF2A 4K61A 2CWVA 3URPA 1O7NB 1AVKA 1FW7A 1I0XA 3CCE3 1O7HB 2V1LA 1GMQA 2C4BA 3LT9A 4J8TA 2CC3A 3ECFA 1VQN3 1D6YA 3SLUA 3CD63 1BRHA 1RNTA 2STDA 1PY3A 1MNLA 3GZRA 1WNHA 1N8R4 1CQSA 3WMDA 2QIYA 3FH1A 2R4IA 1IQ8A 3PS8A 3WR2A 1ZX2A 1I8VA 1I2GA 3GRDA 1JB5A 3MWZA 3SOYA 1S5AA 1OCVA 1OPYA 3NV0B 1KQS2 1A90A 1GSPA 1YVSA 2C11A 2BMOB 3CCL3 1SPUA 1UUGB 1YI23 4U13A 2D42A 4N6V0 4CPKA 1B2XA 5EVHA 4WYKB 2UX0A 1E97A 1IVUA 1Q7HA 1VQ63 1SIHA 1OH0A 1RNBA 4N6OB 3F8HA 3CPW2 1Q40A 3BLZA 3DGMA 1PFPA 2KF4A 1O7WB 3MG3A 2D1WA 1AY7A 2RNTA 4XDWA 1CEWI 3A76A 3T0UA 3WODG 5IW9A 4HZBB 1GMRA 2IA7A 4HYZA 4N6LA 3HK4A 3BU4A 4R80A 3S67A 1SIIA 1GY6A 2INXA 4LYLB 1IVVA 1WQLB 9RNTA 1I3IA 1X1WA 3K5TA 3PCRA 3WA3A 2OTL3 1G02A 3NHXA 1VQM3 1SQWA 2M7OA 3BNDA 1X1XA 1FUWA 3B4PA 1MGWA 1TIJA 3HIGA 3MSOA 1DVCA 1Y4KA 5KP1A 1IT8A 1W7CA 2BMQB 4CCVA 2OQEC 1A2PA 4XBTA 2HMMB 1V74A 4EV5A 1F8NA 3I553 3BNBA 4OVMA 1RLSA 1BRJA 3F14A 3JUQA 1Q814 1BSAA 1ULIB 1S723 4GSPA 2HOHA 5CXOA 3FCSB 3D3LA 4LGQA 1LOWA 3CMA3 7RNTA 5M1AA 3PCSA 3RGAA 1LNIA 2ZL8A 1W6GA 1FUTA 3X42A 2Z76A 1KWIA 3B7CA 1UI7A 3EBTA 1IQYA 1GY5A 1YJN3 4HBRA 1C54A 1V58A 2L4VA 3EF8A 4FCJA 1OHSA 3WDGB 4N6TA 1UUVB 5AIHA 1TRQA 1JZOA 4O2HA 1B2SA 3EC9A 3JUOA 4WP5A 3DGYA 4MMZB 3T8UA 1W00A 3WOFB 1MWTA 1EKMA 2CKFB 3IMAB 1BSBA 1Q7Y4 1VQ93 4J5KA 2JQ5A 2W0QA 5AYRB 3WOEB 1JRQA 1RTUA 3EBYA 4HM0B 2GBXB 2ML6A 2WOHA 3LZAA 4DKIA 4FMDA 2O9UX 1BNFA 1AR0A 1IQXA 2ZHXB 1RGHA 3SOAA 3TDGA 3AGNA 4MEIA 1YVBI 3BNEA 2PNCA 3X40A 3G4S3 7STDA 1V57A 2Z7AA 3HZPA 4HM1B 5AI1A 1FGOA 1OF5A 3D4AA 2J8XB 3CCM3 2XEPA 2KAAA 3OXAA 5STDA 1GYBA 1HU9A 2F98A 2W9QA 1N8QA 1Z1SA 2KF5A 4X2OA 2CFWA 3UL5A 1BNEA 1E3RA 1O7GB 3DGLA 3NUVA 2YFLB 3KIIA 4LSOA 4RZMA 5HOHA 1IK3A 1GD4A 4AKZA 2IYJA 1YIT3 2CFKA 3N8BA 2PZVA 3PZWA 1FZUA 5TGNA 3BIRA 4J9AA 4FMBA 4HKVB 2A15A 3FZWA 1TRPA 5CF1A 2SBLA 3Q1CA 1EUIC 2BT3A 5EEOA 3GZBA 3F7XA 3K63A 1ULJB 3NBBA 1RGEA 3UB1A 1B20A 1QMAA 5AEWB 1OUNA 1NB3I 1OHOA 5IG0A 3DZLA 1W2ZA 1ZO2A 3SXXA 4WHAA 5DRVA 4HOHA 5JBSA 1N5PA 3OWUA 5IERA 3I563 1IVWA 1VQ53 3EN1B 1G0TA 3G8ZA 5BXQA 5IENA 1EA2A 1BRGA 2UUGC 1YGEA 5BIRA 5IG4A 4BL3A 1VQL3 2E2VA 4XBXA 3JVCA 3VSYA 3G713 1B2UA 1I2FA 1ZGXA 1LVNA 2XF3A 3GAXA 4LEHA 1EG9B 1Q42A 1YJ93 1UGHI 2ZDJA 4L8OA 1JKGA 4AKYA 3NM7A 3FGYA 6GSPA 1GOYA 1BIRA 1Q40B 1DMMA 3EX9A 1TUHA 3FLJA 2F4YA 5I97A 1BUJA 3B4OA 3KSED 1D6UA 4OK0A 2WOFA 3KCHA 1I0VA 2XFSA 3PGBA 2IY2A 3WHOA 1QAFA 2RBIA 3F9SA 1GOVA 2H0HA 4FMAA 1EEJA 3LTAA 4HM3B 1AV4A 2H0IA 1STFI 2OTJ3 1I2EA 1ROVA 3EQQB 5G1LA 3CC23 2F5WA 4GB5A 1BNRA 4WWUC 1BOXA 1BGSA 3FG3A 4K1UA 2FGTA 4WFOA 1RRLA 3JUNA 2P38A 2MF7A 1RJOA 5IEOA 2OCTA 4J5GA 3MG1A 3GWRA 1X1UA 1NU3A 2O3OA 1Q9EA 2W2CA 3DY5A 5AIGA 1K41A 4R9LA 3Q3FA 2MC8A 3X3ZA 4Q53A 3AMOA 1E3VA 2BNGA 4GHOA 3IPTA 3V92A 2AADA 1JBSA 1BRIA 1JBRA 5FW5A 2BHMA 2R41A 3OWYA 5D83A 5JPPA 2RGQA 6RNTA 1VQK3 4HVNA 3X3YA 4EC6A 2GEXA 4O8SA 1B2ZA 3DH2A 3MYTA 1BNJA 1T3BA 2XFTA 1UCLA 1NJI4 3Q2PA 4HM4B 1STDA 2Y74A 1UCJA 4HM8B 1J2BA 4R9KA 4ILFA 1BVIA 4H3UA 3HX8A 2RFRA 4HM6B 1JB4A 4MMYB 1RKYA 1UDII 2XSHB 4JRFA 1RCKA 3LTBA 1GS3A 2CK3H 4L7KA 1JB2A 3ALAA 3AHWA 3H3HA 2QA43 1UCKA 1YGWA 1A2KA 3QK9A 1UI8A 4IPBA 5AEUB 1GMPA 2LQVA 3NXJA 3K7CA 2HMKB 1QALA 2BU4A 3HIIA 1R4YA 1K28A 1US1A 3S5CA 1QVG2 2YX9A 1N5HA 1M9GA 3BB9A 1Q824 3ER7A 2CX0A 1BNGA 3PXMA 3MHEA 3CXC2 1IU7A 2HMOB 3V98A 2KF6A 1SARA 1BAOA 1FGTA 2OOVC 3SEDA 1D6ZA 1OF5B 3CNMA 8CHOA 2XH9A 1ROAA 2W6JH 4H61A 1WTHA 4EXRA 4BU4A 3QRDA 1JN5A 1W4NA 1RHLA 5CLKA 3CNXA 1RGCA 4L8PA 3CU3A 1W6YA 2YFIB 2KCDA 5IF6A 3CCS3 3D79A 3X3XA 2P05A 3VF1A 1PYLA 2XGNA 1IYYA 1CH0A 1GD3A 2GU3A 2KF3A 3DM8A 2C10A 3E99A 2AAEA 4HM7B 4NPBA 3D9RA 1BANA 4IIAA 4K1VA 2CWTA 1IVXA 1NO3A 1DETA 4X2HA 1ISKA 1C7HA 4KZ1A 3GSPA 4STDA 1B27A 2CG0A 4FR9A 2HMNB 1NNVA 1JNQA 1W6CA 3B8LA 1MWRA 3N9HA 3KE7A 5FGOA 3CCV3 4BL2A 1LNHA
chains in the Genus database with same CATH topology
1WMNA 4KVHA 1W5ZA 1IV9A 3S29A 2OWPA 3NBJA 5KP3A 4BTWA 1IV7A 2IUKA 5BVBA 1U8CB 1JKGB 1BUQA 3DUKA 1M1XB 4XM4A 4O02B 1DYUA 1N9JA 5D81A 4HZ9B 3OWSA 5IG5A 1FGQA 3HI7A 4LMIA 1TFKA 1OHPA 4N6UA 1JV2B 2P09A 4FCZA 1VQ73 2WGQA 4NHFA 2BMRB 1DVDA 4HM5B 3S27A 3GZXB 1VZZA 3FG4A 3DGNA 1YIJ3 4IT7A 2RSXA 4R4KA 1OACA 1FGRA 3S28A 1KD14 2E2TA 3NQYA 5AYSC 2W56A 1K9M4 1N9EA 3RGRA 1IT7A 3KN4A 1VQO3 2XR8B 3AMOB 3LXUX 4K90B 1FA3A 3KZTA 1A67A 1RN7A 1SJWA 2OOVA 3EN8A 3Q90A 3KSPA 2K0MA 1K8A4 1K734 2P0MA 4N6NB 1T5YA 3WA2X 3KKGA 4FCMA 3MKIA 2QEX3 1FGMA 2F99A 3KFQC 1M904 1PU4A 3LMLA 3N54B 1NWWA 2CW9A 4QWTA 3UL6A 1TU5A 4XB5A 3EB8A 1CYVA 3GZYB 3JUPA 1ASKA 3LTCA 4N6MA 4AEQA 1IDPA 2B1XB 2QGUA 3CCR3 3EJVA 2Z77A 3LYGA 2LYXA 1NDOB 2Y73A 4N3VA 3X41A 1YHQ3 3MPHA 4BTXA 4PEJA 5AIFA 2GU1A 2WO0A 4FMCA 1WMPA 1TP6A 2IMJA 3I0YA 2CH9A 3L0RA 3CME3 1G96A 3NBRA 2RCDA 2W04A 3U97A 1QVF2 3BNCA 1YJW3 1O7PB 2B24B 2CWUA 4EYCA 3FF0A 3FSDA 1Q864 3LH4A 1KC84 4XBYA 1O7MB 1WMOA 3F8XA 2CFDA 2FXTA 3NV0A 4RNZA 2Q07A 4HM2B 5CK6A 3MG2A 4NREA 1JN5B 1U5OA 3DMCA 3RDEA 3CC73 3OV4A 2CFLA 4WYKA 2JDIH 4HJLB 2Z6BA 5ELUA 1W02A 4G1MB 5JPUA 3J7Yd 1VQ83 3OW22 3LTDA 3ROBA 4RNYA 2KRTA 4BTYA 3PYJA 1VQP3 4MJDA 4EV2A 3LT8A 3FKAA 3NQZA 3CPOA 2GXFA 4XDVA 1RRHA 1LXEA 3K9MC 2XGLA 1AVLA 1MOLA 3H51A 5DREA 1DMNA 4KFFA 5IG3A 4RBNA 4CDLA 3M8CA 3U1WA 2W03A 2IUJA 4ZM8A 5AIIA 1QAKA 3G6E3 4I4KA 4ORLA 1TFOA 2ML5A 2XSOB 3LOYA 3FF2A 2K54A 3G16A 5IEPA 3O8YA 3CCQ3 4R1KA 1HKXA 1OGZA 3NM2A 5LC6A 1M1K4 3EE1A 2YFJB 2F86B 1CYUA 5D82A 4JF8A 3V99A 3F40A 4MMXB 2XRXB 1R4CA 3CCU3 1L5GB 5EQLA 4TX4A 2CG1A 2CHCA 1KSIA 3SX1A 5ELJA 2P0XA 3OX9A 4KFEA 3VGNA 1OGXA 3K0ZA 3NX0A 3T8NA 1JJ22 2W9PA 1A2VA 2I9WA 2W56B 2E2UA 3EHCA 3UNLA 1VQ43 3IJEB 4GL6A 5LC7A 2CIUA 1EQKA 3DGOA 1LOXA 2BO9B 6STDA 3CC43 5HGRA 2GBWB 4LZIA 2WGOA 4EBGA 3SVAA 1UUWB 1DMQA 3F7SA 1W2B2 3STDA 4OUQA 4KFDA 5KP4A 3UJMA 1NB5I 1W01A 4O3VA 1QJGA 2CFGA 2KXGA 3DXOA 2GEYA 3CCJ3 3G0KA 3FG1A 1UW1A 5G2GA 2HMJB 2HMLB 2OQEA 1GY7A 3JUMA 2FNQA 5A0OB 5CF2A 4K61A 2CWVA 1O7NB 1AVKA 3CCE3 1O7HB 2V1LA 3LT9A 4J8TA 2CC3A 3ECFA 1VQN3 1D6YA 3SLUA 3CD63 2STDA 3GZRA 1MNLA 1WNHA 1N8R4 1CQSA 3WMDA 2QIYA 3FH1A 2R4IA 1IQ8A 3PS8A 1ZX2A 3GRDA 1JB5A 3MWZA 3SOYA 1S5AA 1OCVA 1OPYA 3NV0B 1KQS2 1A90A 3CCL3 2C11A 2BMOB 1SPUA 1YI23 4U13A 2D42A 4N6V0 5EVHA 4WYKB 2UX0A 1E97A 1IVUA 1VQ63 1SIHA 1OH0A 4N6OB 3F8HA 3CPW2 1Q40A 3BLZA 3DGMA 1PFPA 1O7WB 3MG3A 2D1WA 3WODG 4XDWA 3T0UA 1CEWI 3A76A 5IW9A 4HZBB 2IA7A 4HYZA 4N6LA 3HK4A 4R80A 3S67A 1SIIA 1GY6A 2INXA 1IVVA 1WQLB 3K5TA 3PCRA 3WA3A 2OTL3 3NHXA 1VQM3 1SQWA 2M7OA 3BNDA 1FUWA 3B4PA 1TIJA 3HIGA 3MSOA 1DVCA 1Y4KA 5KP1A 1IT8A 1W7CA 2BMQB 4CCVA 2OQEC 4XBTA 2HMMB 1V74A 4EV5A 1F8NA 3I553 3BNBA 4OVMA 3F14A 3JUQA 1Q814 1S723 1ULIB 5CXOA 3FCSB 3D3LA 4LGQA 3CMA3 3PCSA 3RGAA 2ZL8A 1W6GA 3X42A 2Z76A 1KWIA 3B7CA 1UI7A 3EBTA 1IQYA 1GY5A 1YJN3 4HBRA 2L4VA 3EF8A 4FCJA 1OHSA 3WDGB 4N6TA 1UUVB 5AIHA 4O2HA 3EC9A 3JUOA 4WP5A 4MMZB 3T8UA 1W00A 3WOFB 1EKMA 2CKFB 3IMAB 1Q7Y4 1VQ93 2JQ5A 2W0QA 5AYRB 3WOEB 1JRQA 3EBYA 4HM0B 2GBXB 2ML6A 2WOHA 3LZAA 4FMDA 2O9UX 1IQXA 1AR0A 3SOAA 3TDGA 4MEIA 1YVBI 3BNEA 2PNCA 3X40A 3G4S3 7STDA 2Z7AA 3HZPA 4HM1B 5AI1A 1FGOA 1OF5A 3CCM3 2XEPA 3OXAA 5STDA 1GYBA 2W9QA 1HU9A 2F98A 1N8QA 1Z1SA 4X2OA 2CFWA 3UL5A 1E3RA 1O7GB 3DGLA 3NUVA 2YFLB 3KIIA 4LSOA 4RZMA 1IK3A 1GD4A 4AKZA 1YIT3 2CFKA 3N8BA 2PZVA 3PZWA 5TGNA 4J9AA 4FMBA 4HKVB 2A15A 3FZWA 5CF1A 2SBLA 3Q1CA 2BT3A 5EEOA 3GZBA 3F7XA 3K63A 1ULJB 3NBBA 3UB1A 1QMAA 5AEWB 1OUNA 1NB3I 1OHOA 5IG0A 3DZLA 1W2ZA 1ZO2A 3SXXA 4WHAA 5DRVA 5JBSA 1N5PA 3OWUA 5IERA 3I563 1IVWA 1VQ53 3EN1B 5IENA 3G8ZA 5BXQA 1EA2A 1YGEA 5IG4A 1VQL3 2E2VA 4XBXA 3JVCA 3VSYA 3G713 2XF3A 3GAXA 1LVNA 1YJ93 4LEHA 1EG9B 1Q42A 2ZDJA 4L8OA 1JKGA 4AKYA 3NM7A 3FGYA 1Q40B 1DMMA 3EX9A 1TUHA 3FLJA 5I97A 3B4OA 3KSED 1D6UA 4OK0A 2WOFA 2XFSA 3PGBA 1QAFA 4FMAA 3F9SA 4HM3B 3LTAA 1AV4A 1STFI 2OTJ3 1ROVA 3EQQB 3CC23 4GB5A 4WWUC 3FG3A 4K1UA 2FGTA 4WFOA 1RRLA 3JUNA 2P38A 2MF7A 1RJOA 5IEOA 2OCTA 3MG1A 3GWRA 1NU3A 2O3OA 2W2CA 3DY5A 5AIGA 1K41A 4R9LA 2MC8A 3X3ZA 4Q53A 3AMOA 1E3VA 2BNGA 3V92A 3IPTA 5FW5A 2BHMA 3OWYA 5D83A 5JPPA 2RGQA 1VQK3 4HVNA 3X3YA 4EC6A 2GEXA 4O8SA 1NJI4 3MYTA 2XFTA 3Q2PA 4HM4B 1STDA 2Y74A 4HM8B 1J2BA 4R9KA 4H3UA 3HX8A 2RFRA 4HM6B 1JB4A 4MMYB 1RKYA 2XSHB 4JRFA 3LTBA 1GS3A 2CK3H 4L7KA 1JB2A 3ALAA 3H3HA 2QA43 1A2KA 3QK9A 1UI8A 4IPBA 5AEUB 2LQVA 3NXJA 3K7CA 2HMKB 1QALA 3HIIA 1K28A 1US1A 3S5CA 1QVG2 2YX9A 1N5HA 1M9GA 3BB9A 1Q824 3ER7A 3PXMA 3MHEA 3CXC2 1IU7A 2HMOB 3V98A 1FGTA 2OOVC 3SEDA 1D6ZA 1OF5B 3CNMA 8CHOA 2XH9A 1ROAA 2W6JH 4H61A 1WTHA 4EXRA 3QRDA 1JN5A 1W4NA 5CLKA 3CNXA 4L8PA 3CU3A 1W6YA 2YFIB 2KCDA 5IF6A 3CCS3 3X3XA 2P05A 3VF1A 2XGNA 1GD3A 2GU3A 3DM8A 3E99A 2C10A 4HM7B 3D9RA 4IIAA 4K1VA 2CWTA 1IVXA 1NO3A 1ISKA 4X2HA 1C7HA 4KZ1A 4STDA 2CG0A 4FR9A 2HMNB 1JNQA 1W6CA 3B8LA 3N9HA 3KE7A 5FGOA 3CCV3 1LNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVH A;  2OWP A;  5KP3 A;  5BVB A;  1JKG B;  1BUQ A;  3DUK A;  4XM4 A;  5D81 A;  4HZ9 B;  3OWS A;  5IG5 A;  4LMI A;  1OHP A;  2BMR B;  4HM5 B;  3GZX B;  1VZZ A;  3RGR A;  2XR8 B;  3KZT A;  1SJW A;  3EN8 A;  3Q90 A;  3KSP A;  3KKG A;  4FCM A;  3MKI A;  2F99 A;  1NWW A;  4XB5 A;  3GZY B;  3JUP A;  1ASK A;  1IDP A;  2B1X B;  2QGU A;  3EJV A;  2Z77 A;  3LYG A;  1NDO B;  4N3V A;  4PEJ A;  5AIF A;  1TP6 A;  2IMJ A;  3I0Y A;  3NBR A;  2RCD A;  1O7P B;  2B24 B;  3FF0 A;  3FSD A;  4XBY A;  1O7M B;  3F8X A;  3NV0 A;  4HM2 B;  5CK6 A;  3MG2 A;  1JN5 B;  1U5O A;  3DMC A;  3OV4 A;  4WYK A;  4HJL B;  5JPU A;  1W02 A;  3ROB A;  4MJD A;  3FKA A;  3CPO A;  2GXF A;  4XDV A;  3H51 A;  5DRE A;  1DMN A;  5IG3 A;  4CDL A;  3M8C A;  5AII A;  4I4K A;  4ORL A;  2XSO B;  3FF2 A;  2K54 A;  3G16 A;  5IEP A;  4R1K A;  1HKX A;  1OGZ A;  3NM2 A;  2YFJ B;  2F86 B;  5D82 A;  3F40 A;  2XRX B;  2CHC A;  3VGN A;  3OX9 A;  1OGX A;  3K0Z A;  3T8N A;  2I9W A;  3EHC A;  3UNL A;  6STD A;  5HGR A;  2GBW B;  1UUW B;  1DMQ A;  3F7S A;  3STD A;  4OUQ A;  5KP4 A;  3UJM A;  1W01 A;  1QJG A;  3DXO A;  2GEY A;  3G0K A;  5G2G A;  2HMJ B;  2HML B;  1GY7 A;  3JUM A;  5CF2 A;  1O7N B;  1O7H B;  4J8T A;  3ECF A;  2STD A;  3GZR A;  1CQS A;  3WMD A;  2QIY A;  3FH1 A;  2R4I A;  1ZX2 A;  3GRD A;  1JB5 A;  3SOY A;  1S5A A;  1OCV A;  1OPY A;  3NV0 B;  2BMO B;  4U13 A;  5EVH A;  4WYK B;  2UX0 A;  1E97 A;  1OH0 A;  3F8H A;  1Q40 A;  3BLZ A;  1O7W B;  3MG3 A;  4XDW A;  3A76 A;  4HZB B;  3HK4 A;  1GY6 A;  2INX A;  1WQL B;  3NHX A;  3B4P A;  3MSO A;  5KP1 A;  2BMQ B;  4XBT A;  2HMM B;  4OVM A;  3F14 A;  3JUQ A;  1ULI B;  5CXO A;  4LGQ A;  3RGA A;  2Z76 A;  3B7C A;  3EBT A;  1GY5 A;  3EF8 A;  4FCJ A;  1OHS A;  1UUV B;  5AIH A;  3EC9 A;  3JUO A;  4WP5 A;  3T8U A;  1W00 A;  2CKF B;  2JQ5 A;  3EBY A;  4HM0 B;  2GBX B;  3LZA A;  1AR0 A;  3SOA A;  7STD A;  2Z7A A;  3HZP A;  4HM1 B;  5AI1 A;  1OF5 A;  3OXA A;  5STD A;  1GYB A;  2F98 A;  1Z1S A;  4X2O A;  1E3R A;  1O7G B;  3NUV A;  2YFL B;  4RZM A;  2PZV A;  5TGN A;  4J9A A;  4HKV B;  2A15 A;  3FZW A;  5CF1 A;  3GZB A;  3F7X A;  1ULJ B;  1QMA A;  5AEW B;  1OUN A;  5IG0 A;  1OHO A;  3DZL A;  1ZO2 A;  5DRV A;  3OWU A;  5IER A;  3EN1 B;  5IEN A;  3G8Z A;  5BXQ A;  1EA2 A;  5IG4 A;  4XBX A;  3VSY A;  4LEH A;  1EG9 B;  1Q42 A;  4L8O A;  1JKG A;  3FGY A;  1Q40 B;  1DMM A;  3EX9 A;  1TUH A;  3FLJ A;  3B4O A;  3F9S A;  4HM3 B;  3EQQ B;  4GB5 A;  4WWU C;  4K1U A;  3JUN A;  5IEO A;  3MG1 A;  3GWR A;  1NU3 A;  2W2C A;  5AIG A;  1K41 A;  4R9L A;  4Q53 A;  1E3V A;  2BNG A;  3IPT A;  5FW5 A;  3OWY A;  5D83 A;  5JPP A;  2RGQ A;  4HVN A;  2GEX A;  3MYT A;  4HM4 B;  1STD A;  4HM8 B;  4R9K A;  4H3U A;  3HX8 A;  2RFR A;  4HM6 B;  1JB4 A;  2XSH B;  1GS3 A;  4L7K A;  1JB2 A;  3H3H A;  1A2K A;  5AEU B;  3NXJ A;  3K7C A;  2HMK B;  3S5C A;  3BB9 A;  3ER7 A;  3MHE A;  2HMO B;  3SED A;  1OF5 B;  3CNM A;  8CHO A;  1JN5 A;  5CLK A;  3CNX A;  4L8P A;  3CU3 A;  1W6Y A;  2YFI B;  5IF6 A;  3E99 A;  3DM8 A;  4HM7 B;  3D9R A;  4IIA A;  4K1V A;  1ISK A;  4X2H A;  1C7H A;  4STD A;  2HMN B;  3B8L A;  3KE7 A; 
#chains in the Genus database with same CATH topology
 1WMN A;  4KVH A;  1FUS A;  1W5Z A;  1IV9 A;  3ZG0 A;  3S29 A;  2OWP A;  3NBJ A;  5KP3 A;  4BTW A;  1IV7 A;  2IUK A;  5BVB A;  3D5G A;  2H0G A;  1U8C B;  4HAA A;  1JKG B;  2F5M A;  1BUQ A;  1UCI A;  3DUK A;  5M18 A;  1M1X B;  4XM4 A;  4O02 B;  1AQZ A;  1DYU A;  1N9J A;  5D81 A;  1T2I A;  4HZ9 B;  1RGG A;  3OWS A;  1I70 A;  5IG5 A;  1FGQ A;  1GOU A;  1RCL A;  1LQM B;  3HI7 A;  4LMI A;  5G1K A;  1TFK A;  2ZA4 A;  1OHP A;  4N6U A;  1JV2 B;  2P09 A;  4FCZ A;  1VQ7 3;  2WGQ A;  1MWS A;  4NHF A;  2BMR B;  1DVD A;  4HM5 B;  3S27 A;  3GZX B;  1VZZ A;  3FG4 A;  3DGN A;  1RGA A;  1YIJ 3;  4IT7 A;  2RSX A;  4R4K A;  1OAC A;  1FGR A;  3S28 A;  1KD1 4;  2E2T A;  3NQY A;  1ZS7 A;  2W56 A;  5AYS C;  1N9E A;  1BSD A;  3RGR A;  1K9M 4;  1IT7 A;  3KN4 A;  1VQO 3;  2XR8 B;  3AMO B;  3LXU X;  4K90 B;  1FA3 A;  3KZT A;  3A5E A;  2K3D A;  1A67 A;  1RN7 A;  1SJW A;  2BIR A;  2OOV A;  3EN8 A;  3Q90 A;  3KSP A;  2K0M A;  1K8A 4;  4BIR A;  1K73 4;  2P0M A;  1RSN A;  4N6N B;  1T5Y A;  3WA2 X;  3KKG A;  1UGI A;  1RDS A;  4FCM A;  1BSC A;  3MKI A;  2QEX 3;  1B2M A;  1FGM A;  2F99 A;  3KFQ C;  1M90 4;  1PU4 A;  2SAR A;  3LML A;  3N54 B;  1NWW A;  2CW9 A;  4QWT A;  3UL6 A;  1TU5 A;  4XB5 A;  4I5Q A;  3EB8 A;  1CYV A;  3GZY B;  3JUP A;  1MWU A;  1TJD A;  1ASK A;  3LTC A;  4CJN A;  2F56 A;  4N6M A;  4AEQ A;  1IDP A;  2B1X B;  2QGU A;  3CCR 3;  3EJV A;  2Z77 A;  3LYG A;  2LYX A;  1NDO B;  1RMS A;  2Y73 A;  4N3V A;  3X41 A;  3MPH A;  4BTX A;  4PEJ A;  1YHQ 3;  5BU4 A;  5AIF A;  2CX1 A;  2GU1 A;  2WO0 A;  4FMC A;  1WMP A;  1TP6 A;  1BRS A;  2IMJ A;  3I0Y A;  3AHS A;  2CH9 A;  3L0R A;  3HOH A;  3CME 3;  1G96 A;  3NBR A;  2RCD A;  2W04 A;  3U97 A;  1QVF 2;  5GSP A;  3BNC A;  1YJW 3;  1O7P B;  2B24 B;  1RGK A;  2CWU A;  4EYC A;  3FF0 A;  3FSD A;  1Q86 4;  3LH4 A;  1KC8 4;  4XBY A;  1HZ1 A;  1O7M B;  1WMO A;  3F8X A;  2CFD A;  2FXT A;  3NV0 A;  4RNZ A;  2Q07 A;  4HM2 B;  1T2H A;  5CK6 A;  3MG2 A;  4NRE A;  1JN5 B;  1U5O A;  3DMC A;  3RDE A;  1LQG C;  3CC7 3;  3OV4 A;  2CFL A;  4WYK A;  4EW5 A;  2JDI H;  1VQQ A;  4HJL B;  2Z6B A;  5ELU A;  1W02 A;  4G1M B;  5JPU A;  3J7Y d;  1VQ8 3;  3OW2 2;  3LTD A;  3ROB A;  4RNY A;  2KRT A;  4BTY A;  1X1Y A;  3PYJ A;  1VQP 3;  4MJD A;  3D5I A;  4EV2 A;  3LT8 A;  3FKA A;  3NQZ A;  3CPO A;  2GXF A;  4XDV A;  1RRH A;  1LXE A;  1LRA A;  3K9M C;  2XGL A;  1AVL A;  1TTO A;  1MOL A;  3H51 A;  5DRE A;  1DMN A;  4KFF A;  1RGF A;  4RBN A;  5IG3 A;  3SYU A;  1DE3 A;  4CDL A;  3M8C A;  2L1S A;  2W03 A;  2IUJ A;  3RNT A;  5AII A;  3U1W A;  4ZM8 A;  2GSP A;  1BNS A;  1QAK A;  3G6E 3;  3AGO A;  4I4K A;  4ORL A;  1TFO A;  2ML5 A;  2XSO B;  3LOY A;  3FF2 A;  2K54 A;  3G16 A;  4KT3 B;  4RNT A;  5IEP A;  3O8Y A;  1LOY A;  1MGR A;  3ZG5 A;  3CCQ 3;  1I3F A;  4R1K A;  1HKX A;  1OGZ A;  3NM2 A;  5LC6 A;  1M1K 4;  3EE1 A;  2YFJ B;  2F86 B;  8RNT A;  1CYU A;  1YNV X;  1JBT A;  5D82 A;  4JF8 A;  1LOV A;  3V99 A;  3F40 A;  4MMX B;  2XRX B;  1BNI A;  1R4C A;  1JZD A;  3CCU 3;  1BU4 A;  1B3S A;  1L5G B;  5EQL A;  4TX4 A;  2CG1 A;  3ZFZ A;  2CHC A;  1KSI A;  3SX1 A;  5ELJ A;  2P0X A;  3OX9 A;  4KFE A;  3VGN A;  1OGX A;  3K0Z A;  3NX0 A;  3T8N A;  1JJ2 2;  1FYS A;  2W9P A;  5RNT A;  1A2V A;  2I9W A;  2W56 B;  2E2U A;  3EHC A;  3UNL A;  1VQ4 3;  3IJE B;  4GL6 A;  5LC7 A;  2CIU A;  1BRN L;  1BRK A;  3DGO A;  1EQK A;  2UGI A;  1LOX A;  2BO9 B;  6STD A;  3CC4 3;  5HGR A;  2GBW B;  4LZI A;  2WGO A;  4EBG A;  1RGL A;  3SVA A;  1UUW B;  1DMQ A;  3F7S A;  1RN1 A;  1RN4 A;  1W2B 2;  3STD A;  4OUQ A;  4KFD A;  5KP4 A;  3UJM A;  1NB5 I;  1W01 A;  4O3V A;  1QJG A;  1B21 A;  2CFG A;  2KXG A;  3DXO A;  2GEY A;  1BSE A;  3CCJ 3;  3G0K A;  3FG1 A;  1UW1 A;  5G2G A;  2HMJ B;  2HML B;  2OQE A;  1GY7 A;  3JUM A;  2FNQ A;  7GSP A;  5M19 A;  1HYF A;  5A0O B;  5CF2 A;  4K61 A;  2CWV A;  3URP A;  1O7N B;  1AVK A;  1FW7 A;  1I0X A;  3CCE 3;  1O7H B;  2V1L A;  1GMQ A;  2C4B A;  3LT9 A;  4J8T A;  2CC3 A;  3ECF A;  1VQN 3;  1D6Y A;  3SLU A;  3CD6 3;  1BRH A;  1RNT A;  2STD A;  1PY3 A;  1MNL A;  3GZR A;  1WNH A;  1N8R 4;  1CQS A;  3WMD A;  2QIY A;  3FH1 A;  2R4I A;  1IQ8 A;  3PS8 A;  3WR2 A;  1ZX2 A;  1I8V A;  1I2G A;  3GRD A;  1JB5 A;  3MWZ A;  3SOY A;  1S5A A;  1OCV A;  1OPY A;  3NV0 B;  1KQS 2;  1A90 A;  1GSP A;  1YVS A;  2C11 A;  2BMO B;  3CCL 3;  1SPU A;  1UUG B;  1YI2 3;  4U13 A;  2D42 A;  4N6V 0;  4CPK A;  1B2X A;  5EVH A;  4WYK B;  2UX0 A;  1E97 A;  1IVU A;  1Q7H A;  1VQ6 3;  1SIH A;  1OH0 A;  1RNB A;  4N6O B;  3F8H A;  3CPW 2;  1Q40 A;  3BLZ A;  3DGM A;  1PFP A;  2KF4 A;  1O7W B;  3MG3 A;  2D1W A;  1AY7 A;  2RNT A;  4XDW A;  1CEW I;  3A76 A;  3T0U A;  3WOD G;  5IW9 A;  4HZB B;  1GMR A;  2IA7 A;  4HYZ A;  4N6L A;  3HK4 A;  3BU4 A;  4R80 A;  3S67 A;  1SII A;  1GY6 A;  2INX A;  4LYL B;  1IVV A;  1WQL B;  9RNT A;  1I3I A;  1X1W A;  3K5T A;  3PCR A;  3WA3 A;  2OTL 3;  1G02 A;  3NHX A;  1VQM 3;  1SQW A;  2M7O A;  3BND A;  1X1X A;  1FUW A;  3B4P A;  1MGW A;  1TIJ A;  3HIG A;  3MSO A;  1DVC A;  1Y4K A;  5KP1 A;  1IT8 A;  1W7C A;  2BMQ B;  4CCV A;  2OQE C;  1A2P A;  4XBT A;  2HMM B;  1V74 A;  4EV5 A;  1F8N A;  3I55 3;  3BNB A;  4OVM A;  1RLS A;  1BRJ A;  3F14 A;  3JUQ A;  1Q81 4;  1BSA A;  1ULI B;  1S72 3;  4GSP A;  2HOH A;  5CXO A;  3FCS B;  3D3L A;  4LGQ A;  1LOW A;  3CMA 3;  7RNT A;  5M1A A;  3PCS A;  3RGA A;  1LNI A;  2ZL8 A;  1W6G A;  1FUT A;  3X42 A;  2Z76 A;  1KWI A;  3B7C A;  1UI7 A;  3EBT A;  1IQY A;  1GY5 A;  1YJN 3;  4HBR A;  1C54 A;  1V58 A;  2L4V A;  3EF8 A;  4FCJ A;  1OHS A;  3WDG B;  4N6T A;  1UUV B;  5AIH A;  1TRQ A;  1JZO A;  4O2H A;  1B2S A;  3EC9 A;  3JUO A;  4WP5 A;  3DGY A;  4MMZ B;  3T8U A;  1W00 A;  3WOF B;  1MWT A;  1EKM A;  2CKF B;  3IMA B;  1BSB A;  1Q7Y 4;  1VQ9 3;  4J5K A;  2JQ5 A;  2W0Q A;  5AYR B;  3WOE B;  1JRQ A;  1RTU A;  3EBY A;  4HM0 B;  2GBX B;  2ML6 A;  2WOH A;  3LZA A;  4DKI A;  4FMD A;  2O9U X;  1BNF A;  1AR0 A;  1IQX A;  2ZHX B;  1RGH A;  3SOA A;  3TDG A;  3AGN A;  4MEI A;  1YVB I;  3BNE A;  2PNC A;  3X40 A;  3G4S 3;  7STD A;  1V57 A;  2Z7A A;  3HZP A;  4HM1 B;  5AI1 A;  1FGO A;  1OF5 A;  3D4A A;  2J8X B;  3CCM 3;  2XEP A;  2KAA A;  3OXA A;  5STD A;  1GYB A;  1HU9 A;  2F98 A;  2W9Q A;  1N8Q A;  1Z1S A;  2KF5 A;  4X2O A;  2CFW A;  3UL5 A;  1BNE A;  1E3R A;  1O7G B;  3DGL A;  3NUV A;  2YFL B;  3KII A;  4LSO A;  4RZM A;  5HOH A;  1IK3 A;  1GD4 A;  4AKZ A;  2IYJ A;  1YIT 3;  2CFK A;  3N8B A;  2PZV A;  3PZW A;  1FZU A;  5TGN A;  3BIR A;  4J9A A;  4FMB A;  4HKV B;  2A15 A;  3FZW A;  1TRP A;  5CF1 A;  2SBL A;  3Q1C A;  1EUI C;  2BT3 A;  5EEO A;  3GZB A;  3F7X A;  3K63 A;  1ULJ B;  3NBB A;  1RGE A;  3UB1 A;  1B20 A;  1QMA A;  5AEW B;  1OUN A;  1NB3 I;  1OHO A;  5IG0 A;  3DZL A;  1W2Z A;  1ZO2 A;  3SXX A;  4WHA A;  5DRV A;  4HOH A;  5JBS A;  1N5P A;  3OWU A;  5IER A;  3I56 3;  1IVW A;  1VQ5 3;  3EN1 B;  1G0T A;  3G8Z A;  5BXQ A;  5IEN A;  1EA2 A;  1BRG A;  2UUG C;  1YGE A;  5BIR A;  5IG4 A;  4BL3 A;  1VQL 3;  2E2V A;  4XBX A;  3JVC A;  3VSY A;  3G71 3;  1B2U A;  1I2F A;  1ZGX A;  1LVN A;  2XF3 A;  3GAX A;  4LEH A;  1EG9 B;  1Q42 A;  1YJ9 3;  1UGH I;  2ZDJ A;  4L8O A;  1JKG A;  4AKY A;  3NM7 A;  3FGY A;  6GSP A;  1GOY A;  1BIR A;  1Q40 B;  1DMM A;  3EX9 A;  1TUH A;  3FLJ A;  2F4Y A;  5I97 A;  1BUJ A;  3B4O A;  3KSE D;  1D6U A;  4OK0 A;  2WOF A;  3KCH A;  1I0V A;  2XFS A;  3PGB A;  2IY2 A;  3WHO A;  1QAF A;  2RBI A;  3F9S A;  1GOV A;  2H0H A;  4FMA A;  1EEJ A;  3LTA A;  4HM3 B;  1AV4 A;  2H0I A;  1STF I;  2OTJ 3;  1I2E A;  1ROV A;  3EQQ B;  5G1L A;  3CC2 3;  2F5W A;  4GB5 A;  1BNR A;  4WWU C;  1BOX A;  1BGS A;  3FG3 A;  4K1U A;  2FGT A;  4WFO A;  1RRL A;  3JUN A;  2P38 A;  2MF7 A;  1RJO A;  5IEO A;  2OCT A;  4J5G A;  3MG1 A;  3GWR A;  1X1U A;  1NU3 A;  2O3O A;  1Q9E A;  2W2C A;  3DY5 A;  5AIG A;  1K41 A;  4R9L A;  3Q3F A;  2MC8 A;  3X3Z A;  4Q53 A;  3AMO A;  1E3V A;  2BNG A;  4GHO A;  3IPT A;  3V92 A;  2AAD A;  1JBS A;  1BRI A;  1JBR A;  5FW5 A;  2BHM A;  2R41 A;  3OWY A;  5D83 A;  5JPP A;  2RGQ A;  6RNT A;  1VQK 3;  4HVN A;  3X3Y A;  4EC6 A;  2GEX A;  4O8S A;  1B2Z A;  3DH2 A;  3MYT A;  1BNJ A;  1T3B A;  2XFT A;  1UCL A;  1NJI 4;  3Q2P A;  4HM4 B;  1STD A;  2Y74 A;  1UCJ A;  4HM8 B;  1J2B A;  4R9K A;  4ILF A;  1BVI A;  4H3U A;  3HX8 A;  2RFR A;  4HM6 B;  1JB4 A;  4MMY B;  1RKY A;  1UDI I;  2XSH B;  4JRF A;  1RCK A;  3LTB A;  1GS3 A;  2CK3 H;  4L7K A;  1JB2 A;  3ALA A;  3AHW A;  3H3H A;  2QA4 3;  1UCK A;  1YGW A;  1A2K A;  3QK9 A;  1UI8 A;  4IPB A;  5AEU B;  1GMP A;  2LQV A;  3NXJ A;  3K7C A;  2HMK B;  1QAL A;  2BU4 A;  3HII A;  1R4Y A;  1K28 A;  1US1 A;  3S5C A;  1QVG 2;  2YX9 A;  1N5H A;  1M9G A;  3BB9 A;  1Q82 4;  3ER7 A;  2CX0 A;  1BNG A;  3PXM A;  3MHE A;  3CXC 2;  1IU7 A;  2HMO B;  3V98 A;  2KF6 A;  1SAR A;  1BAO A;  1FGT A;  2OOV C;  3SED A;  1D6Z A;  1OF5 B;  3CNM A;  8CHO A;  2XH9 A;  1ROA A;  2W6J H;  4H61 A;  1WTH A;  4EXR A;  4BU4 A;  3QRD A;  1JN5 A;  1W4N A;  1RHL A;  5CLK A;  3CNX A;  1RGC A;  4L8P A;  3CU3 A;  1W6Y A;  2YFI B;  2KCD A;  5IF6 A;  3CCS 3;  3D79 A;  3X3X A;  2P05 A;  3VF1 A;  1PYL A;  2XGN A;  1IYY A;  1CH0 A;  1GD3 A;  2GU3 A;  2KF3 A;  3DM8 A;  2C10 A;  3E99 A;  2AAE A;  4HM7 B;  4NPB A;  3D9R A;  1BAN A;  4IIA A;  4K1V A;  2CWT A;  1IVX A;  1NO3 A;  1DET A;  4X2H A;  1ISK A;  1C7H A;  4KZ1 A;  3GSP A;  4STD A;  1B27 A;  2CG0 A;  4FR9 A;  2HMN B;  1NNV A;  1JNQ A;  1W6C A;  3B8L A;  1MWR A;  3N9H A;  3KE7 A;  5FGO A;  3CCV 3;  4BL2 A;  1LNH A; 
#chains in the Genus database with same CATH homology
 1WMN A;  4KVH A;  1W5Z A;  1IV9 A;  3S29 A;  2OWP A;  3NBJ A;  5KP3 A;  4BTW A;  1IV7 A;  2IUK A;  5BVB A;  1U8C B;  1JKG B;  1BUQ A;  3DUK A;  1M1X B;  4XM4 A;  4O02 B;  1DYU A;  1N9J A;  5D81 A;  4HZ9 B;  3OWS A;  5IG5 A;  1FGQ A;  3HI7 A;  4LMI A;  1TFK A;  1OHP A;  4N6U A;  1JV2 B;  2P09 A;  4FCZ A;  1VQ7 3;  2WGQ A;  4NHF A;  2BMR B;  1DVD A;  4HM5 B;  3S27 A;  3GZX B;  1VZZ A;  3FG4 A;  3DGN A;  1YIJ 3;  4IT7 A;  2RSX A;  4R4K A;  1OAC A;  1FGR A;  3S28 A;  1KD1 4;  2E2T A;  3NQY A;  5AYS C;  2W56 A;  1K9M 4;  1N9E A;  3RGR A;  1IT7 A;  3KN4 A;  1VQO 3;  2XR8 B;  3AMO B;  3LXU X;  4K90 B;  1FA3 A;  3KZT A;  1A67 A;  1RN7 A;  1SJW A;  2OOV A;  3EN8 A;  3Q90 A;  3KSP A;  2K0M A;  1K8A 4;  1K73 4;  2P0M A;  4N6N B;  1T5Y A;  3WA2 X;  3KKG A;  4FCM A;  3MKI A;  2QEX 3;  1FGM A;  2F99 A;  3KFQ C;  1M90 4;  1PU4 A;  3LML A;  3N54 B;  1NWW A;  2CW9 A;  4QWT A;  3UL6 A;  1TU5 A;  4XB5 A;  3EB8 A;  1CYV A;  3GZY B;  3JUP A;  1ASK A;  3LTC A;  4N6M A;  4AEQ A;  1IDP A;  2B1X B;  2QGU A;  3CCR 3;  3EJV A;  2Z77 A;  3LYG A;  2LYX A;  1NDO B;  2Y73 A;  4N3V A;  3X41 A;  1YHQ 3;  3MPH A;  4BTX A;  4PEJ A;  5AIF A;  2GU1 A;  2WO0 A;  4FMC A;  1WMP A;  1TP6 A;  2IMJ A;  3I0Y A;  2CH9 A;  3L0R A;  3CME 3;  1G96 A;  3NBR A;  2RCD A;  2W04 A;  3U97 A;  1QVF 2;  3BNC A;  1YJW 3;  1O7P B;  2B24 B;  2CWU A;  4EYC A;  3FF0 A;  3FSD A;  1Q86 4;  3LH4 A;  1KC8 4;  4XBY A;  1O7M B;  1WMO A;  3F8X A;  2CFD A;  2FXT A;  3NV0 A;  4RNZ A;  2Q07 A;  4HM2 B;  5CK6 A;  3MG2 A;  4NRE A;  1JN5 B;  1U5O A;  3DMC A;  3RDE A;  3CC7 3;  3OV4 A;  2CFL A;  4WYK A;  2JDI H;  4HJL B;  2Z6B A;  5ELU A;  1W02 A;  4G1M B;  5JPU A;  3J7Y d;  1VQ8 3;  3OW2 2;  3LTD A;  3ROB A;  4RNY A;  2KRT A;  4BTY A;  3PYJ A;  1VQP 3;  4MJD A;  4EV2 A;  3LT8 A;  3FKA A;  3NQZ A;  3CPO A;  2GXF A;  4XDV A;  1RRH A;  1LXE A;  3K9M C;  2XGL A;  1AVL A;  1MOL A;  3H51 A;  5DRE A;  1DMN A;  4KFF A;  5IG3 A;  4RBN A;  4CDL A;  3M8C A;  3U1W A;  2W03 A;  2IUJ A;  4ZM8 A;  5AII A;  1QAK A;  3G6E 3;  4I4K A;  4ORL A;  1TFO A;  2ML5 A;  2XSO B;  3LOY A;  3FF2 A;  2K54 A;  3G16 A;  5IEP A;  3O8Y A;  3CCQ 3;  4R1K A;  1HKX A;  1OGZ A;  3NM2 A;  5LC6 A;  1M1K 4;  3EE1 A;  2YFJ B;  2F86 B;  1CYU A;  5D82 A;  4JF8 A;  3V99 A;  3F40 A;  4MMX B;  2XRX B;  1R4C A;  3CCU 3;  1L5G B;  5EQL A;  4TX4 A;  2CG1 A;  2CHC A;  1KSI A;  3SX1 A;  5ELJ A;  2P0X A;  3OX9 A;  4KFE A;  3VGN A;  1OGX A;  3K0Z A;  3NX0 A;  3T8N A;  1JJ2 2;  2W9P A;  1A2V A;  2I9W A;  2W56 B;  2E2U A;  3EHC A;  3UNL A;  1VQ4 3;  3IJE B;  4GL6 A;  5LC7 A;  2CIU A;  1EQK A;  3DGO A;  1LOX A;  2BO9 B;  6STD A;  3CC4 3;  5HGR A;  2GBW B;  4LZI A;  2WGO A;  4EBG A;  3SVA A;  1UUW B;  1DMQ A;  3F7S A;  1W2B 2;  3STD A;  4OUQ A;  4KFD A;  5KP4 A;  3UJM A;  1NB5 I;  1W01 A;  4O3V A;  1QJG A;  2CFG A;  2KXG A;  3DXO A;  2GEY A;  3CCJ 3;  3G0K A;  3FG1 A;  1UW1 A;  5G2G A;  2HMJ B;  2HML B;  2OQE A;  1GY7 A;  3JUM A;  2FNQ A;  5A0O B;  5CF2 A;  4K61 A;  2CWV A;  1O7N B;  1AVK A;  3CCE 3;  1O7H B;  2V1L A;  3LT9 A;  4J8T A;  2CC3 A;  3ECF A;  1VQN 3;  1D6Y A;  3SLU A;  3CD6 3;  2STD A;  3GZR A;  1MNL A;  1WNH A;  1N8R 4;  1CQS A;  3WMD A;  2QIY A;  3FH1 A;  2R4I A;  1IQ8 A;  3PS8 A;  1ZX2 A;  3GRD A;  1JB5 A;  3MWZ A;  3SOY A;  1S5A A;  1OCV A;  1OPY A;  3NV0 B;  1KQS 2;  1A90 A;  3CCL 3;  2C11 A;  2BMO B;  1SPU A;  1YI2 3;  4U13 A;  2D42 A;  4N6V 0;  5EVH A;  4WYK B;  2UX0 A;  1E97 A;  1IVU A;  1VQ6 3;  1SIH A;  1OH0 A;  4N6O B;  3F8H A;  3CPW 2;  1Q40 A;  3BLZ A;  3DGM A;  1PFP A;  1O7W B;  3MG3 A;  2D1W A;  3WOD G;  4XDW A;  3T0U A;  1CEW I;  3A76 A;  5IW9 A;  4HZB B;  2IA7 A;  4HYZ A;  4N6L A;  3HK4 A;  4R80 A;  3S67 A;  1SII A;  1GY6 A;  2INX A;  1IVV A;  1WQL B;  3K5T A;  3PCR A;  3WA3 A;  2OTL 3;  3NHX A;  1VQM 3;  1SQW A;  2M7O A;  3BND A;  1FUW A;  3B4P A;  1TIJ A;  3HIG A;  3MSO A;  1DVC A;  1Y4K A;  5KP1 A;  1IT8 A;  1W7C A;  2BMQ B;  4CCV A;  2OQE C;  4XBT A;  2HMM B;  1V74 A;  4EV5 A;  1F8N A;  3I55 3;  3BNB A;  4OVM A;  3F14 A;  3JUQ A;  1Q81 4;  1S72 3;  1ULI B;  5CXO A;  3FCS B;  3D3L A;  4LGQ A;  3CMA 3;  3PCS A;  3RGA A;  2ZL8 A;  1W6G A;  3X42 A;  2Z76 A;  1KWI A;  3B7C A;  1UI7 A;  3EBT A;  1IQY A;  1GY5 A;  1YJN 3;  4HBR A;  2L4V A;  3EF8 A;  4FCJ A;  1OHS A;  3WDG B;  4N6T A;  1UUV B;  5AIH A;  4O2H A;  3EC9 A;  3JUO A;  4WP5 A;  4MMZ B;  3T8U A;  1W00 A;  3WOF B;  1EKM A;  2CKF B;  3IMA B;  1Q7Y 4;  1VQ9 3;  2JQ5 A;  2W0Q A;  5AYR B;  3WOE B;  1JRQ A;  3EBY A;  4HM0 B;  2GBX B;  2ML6 A;  2WOH A;  3LZA A;  4FMD A;  2O9U X;  1IQX A;  1AR0 A;  3SOA A;  3TDG A;  4MEI A;  1YVB I;  3BNE A;  2PNC A;  3X40 A;  3G4S 3;  7STD A;  2Z7A A;  3HZP A;  4HM1 B;  5AI1 A;  1FGO A;  1OF5 A;  3CCM 3;  2XEP A;  3OXA A;  5STD A;  1GYB A;  2W9Q A;  1HU9 A;  2F98 A;  1N8Q A;  1Z1S A;  4X2O A;  2CFW A;  3UL5 A;  1E3R A;  1O7G B;  3DGL A;  3NUV A;  2YFL B;  3KII A;  4LSO A;  4RZM A;  1IK3 A;  1GD4 A;  4AKZ A;  1YIT 3;  2CFK A;  3N8B A;  2PZV A;  3PZW A;  5TGN A;  4J9A A;  4FMB A;  4HKV B;  2A15 A;  3FZW A;  5CF1 A;  2SBL A;  3Q1C A;  2BT3 A;  5EEO A;  3GZB A;  3F7X A;  3K63 A;  1ULJ B;  3NBB A;  3UB1 A;  1QMA A;  5AEW B;  1OUN A;  1NB3 I;  1OHO A;  5IG0 A;  3DZL A;  1W2Z A;  1ZO2 A;  3SXX A;  4WHA A;  5DRV A;  5JBS A;  1N5P A;  3OWU A;  5IER A;  3I56 3;  1IVW A;  1VQ5 3;  3EN1 B;  5IEN A;  3G8Z A;  5BXQ A;  1EA2 A;  1YGE A;  5IG4 A;  1VQL 3;  2E2V A;  4XBX A;  3JVC A;  3VSY A;  3G71 3;  2XF3 A;  3GAX A;  1LVN A;  1YJ9 3;  4LEH A;  1EG9 B;  1Q42 A;  2ZDJ A;  4L8O A;  1JKG A;  4AKY A;  3NM7 A;  3FGY A;  1Q40 B;  1DMM A;  3EX9 A;  1TUH A;  3FLJ A;  5I97 A;  3B4O A;  3KSE D;  1D6U A;  4OK0 A;  2WOF A;  2XFS A;  3PGB A;  1QAF A;  4FMA A;  3F9S A;  4HM3 B;  3LTA A;  1AV4 A;  1STF I;  2OTJ 3;  1ROV A;  3EQQ B;  3CC2 3;  4GB5 A;  4WWU C;  3FG3 A;  4K1U A;  2FGT A;  4WFO A;  1RRL A;  3JUN A;  2P38 A;  2MF7 A;  1RJO A;  5IEO A;  2OCT A;  3MG1 A;  3GWR A;  1NU3 A;  2O3O A;  2W2C A;  3DY5 A;  5AIG A;  1K41 A;  4R9L A;  2MC8 A;  3X3Z A;  4Q53 A;  3AMO A;  1E3V A;  2BNG A;  3V92 A;  3IPT A;  5FW5 A;  2BHM A;  3OWY A;  5D83 A;  5JPP A;  2RGQ A;  1VQK 3;  4HVN A;  3X3Y A;  4EC6 A;  2GEX A;  4O8S A;  1NJI 4;  3MYT A;  2XFT A;  3Q2P A;  4HM4 B;  1STD A;  2Y74 A;  4HM8 B;  1J2B A;  4R9K A;  4H3U A;  3HX8 A;  2RFR A;  4HM6 B;  1JB4 A;  4MMY B;  1RKY A;  2XSH B;  4JRF A;  3LTB A;  1GS3 A;  2CK3 H;  4L7K A;  1JB2 A;  3ALA A;  3H3H A;  2QA4 3;  1A2K A;  3QK9 A;  1UI8 A;  4IPB A;  5AEU B;  2LQV A;  3NXJ A;  3K7C A;  2HMK B;  1QAL A;  3HII A;  1K28 A;  1US1 A;  3S5C A;  1QVG 2;  2YX9 A;  1N5H A;  1M9G A;  3BB9 A;  1Q82 4;  3ER7 A;  3PXM A;  3MHE A;  3CXC 2;  1IU7 A;  2HMO B;  3V98 A;  1FGT A;  2OOV C;  3SED A;  1D6Z A;  1OF5 B;  3CNM A;  8CHO A;  2XH9 A;  1ROA A;  2W6J H;  4H61 A;  1WTH A;  4EXR A;  3QRD A;  1JN5 A;  1W4N A;  5CLK A;  3CNX A;  4L8P A;  3CU3 A;  1W6Y A;  2YFI B;  2KCD A;  5IF6 A;  3CCS 3;  3X3X A;  2P05 A;  3VF1 A;  2XGN A;  1GD3 A;  2GU3 A;  3DM8 A;  3E99 A;  2C10 A;  4HM7 B;  3D9R A;  4IIA A;  4K1V A;  2CWT A;  1IVX A;  1NO3 A;  1ISK A;  4X2H A;  1C7H A;  4KZ1 A;  4STD A;  2CG0 A;  4FR9 A;  2HMN B;  1JNQ A;  1W6C A;  3B8L A;  3N9H A;  3KE7 A;  5FGO A;  3CCV 3;  1LNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...