3MYTA

Crystal structure of ketosteroid isomerase d38hd99n from pseudomonas testosteroni (tksi)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEHPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ketosteroid Isomerase D38HD99N from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 34
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3mytA00
2PZVA 1O7MB 1E97A 1QJGA 4L8OA 5KP4A 5DREA 3K0ZA 3DUKA 1EG9B 4OUQA 3G8ZA 1SJWA 1ZO2A 3FSDA 3JUPA 3MG1A 4XDWA 3SOYA 1ASKA 3CPOA 2RCDA 3HK4A 1OHPA 2XSOB 3IPTA 1DMMA 2XR8B 3JUOA 1Q42A 3F40A 1O7PB 2BMOB 1K41A 2HMOB 3E99A 3OWUA 4HM8B 2GEXA 2YFJB 3K7CA 4LGQA 5KP3A 3B8LA 3RGAA 6STDA 2RFRA 3SOAA 2R4IA 5AIFA 5CF2A 3MSOA 5D83A 2CKFB 4HJLB 1GYBA 1BUQA 4LEHA 1OCVA 3EF8A 1S5AA 4J8TA 4HKVB 2F99A 4L8PA 1NU3A 4K1VA 2Z77A 1E3VA 1U5OA 3CNXA 3FZWA 4HVNA 1UUWB 4Q53A 3NV0B 3ROBA 4WYKB 1OH0A 3ECFA 2Z7AA 3FGYA 5IERA 1W02A 1WQLB 2F98A 4H3UA 2CHCA 4GB5A 1DMQA 3ER7A 1W01A 4WWUC 3KE7A 3FKAA 1GY7A 1JB4A 2HMLB 3EC9A 3EQQB 3G16A 1OF5B 3JUNA 3NUVA 3BB9A 4HM0B 1A2KA 5D81A 3EHCA 1ULIB 2GBWB 4WYKA 1JKGA 1STDA 5CXOA 2Z76A 3NHXA 1ULJB 3EBTA 5CK6A 3NXJA 3SEDA 4N3VA 4J9AA 4MJDA 4ORLA 5DRVA 5IF6A 4XBYA 3WMDA 1Z1SA 5HGRA 4XBXA 3NM2A 3OWSA 5BVBA 4HM1B 3OXAA 1TP6A 4L7KA 1ISKA 3G0KA 3KZTA 3HX8A 3LZAA 4LMIA 2K54A 4X2OA 5IG0A 1QMAA 1IDPA 3T8UA 5AI1A 2GBXB 3DM8A 3NBRA 2BMRB 3T8NA 1GY5A 5AIIA 1O7NB 2I9WA 3Q90A 5CF1A 2OWPA 3D9RA 3GZYB 2HMKB 3H3HA 3KKGA 4HM4B 5JPUA 2F86B 4WP5A 3FLJA 4XBTA 4X2HA 3F8HA 3UNLA 1JB5A 3GZXB 5IG3A 3LYGA 3VSYA 3GZRA 3STDA 3A76A 3OWYA 4HM7B 3KSPA 1JKGB 5G2GA 3OV4A 4XB5A 1OHSA 4FCMA 2A15A 3FF0A 1OPYA 1OGZA 1GS3A 5IEPA 3F14A 1CQSA 1E3RA 3FH1A 2GEYA 3DMCA 4HM6B 7STDA 3MG2A 5FW5A 4HM5B 2XRXB 3JUMA 3MHEA 5KP1A 4R9KA 1JN5B 5AIGA 3M8CA 3OX9A 4HM3B 4OVMA 2QGUA 1JB2A 5IEOA 5IG5A 2INXA 5JPPA 5AEUB 2QIYA 1O7GB 1ZX2A 2GXFA 3F7XA 1OF5A 3DXOA 3I0YA 3MKIA 3F7SA 1NWWA 4STDA 4XM4A 1AR0A 4XDVA 3CNMA 3FF2A 1EA2A 4R1KA 3GRDA 2IMJA 1TUHA 2HMJB 2RGQA 2W2CA 3EX9A 3GZBA 3HZPA 4PEJA 2HMNB 3H51A 5AIHA 4HZ9B 8CHOA 4KVHA 5D82A 2B24B 3MG3A 4HM2B 1GY6A 3B7CA 1HKXA 2BNGA 1W00A 5EVHA 3RGRA 3UJMA 5STDA 1OHOA 1Q40B 4HZBB 4FCJA 4RZMA 1UUVB 3GWRA 5CLKA 2JQ5A 3BLZA 3F9SA 3MYTA 2YFLB 1W6YA 4IIAA 2XSHB 3VGNA 4CDLA 1DMNA 1OGXA 2B1XB 3EJVA 5IG4A 3EBYA 3CU3A 1O7WB 1VZZA 3B4PA 3EN1B 2STDA 3EN8A 4K1UA 2HMMB 3B4OA 5TGNA 5BXQA 3JUQA 4U13A 4R9LA 3DZLA 2YFIB 4I4KA 5IENA 1Q40A 2BMQB 1C7HA 1NDOB 3NV0A 5AEWB 1O7HB 3F8XA 1JN5A 3S5CA 2UX0A 1OUNA
chains in the Genus database with same CATH superfamily
2PZVA 2OTJ3 1CEWI 1FW7A 5DREA 2QEX3 1GD3A 3DGLA 1EG9B 1V58A 4XDWA 1ZO2A 3S29A 1SQWA 1ASKA 3SLUA 1I2EA 2RCDA 3CPOA 3HK4A 4HAAA 2FXTA 5EEOA 3SX1A 1UI8A 5I97A 3E99A 2KRTA 1K41A 4HM8B 1YVBI 1VQP3 5IW9A 3CD63 1FGRA 1RSNA 2RFRA 1L5GB 1EKMA 2F5WA 3PS8A 3GSPA 4HJLB 4RNYA 1I8VA 1OCVA 1K8A4 3PZWA 4IPBA 1JBSA 4L8PA 2XGNA 1M1K4 2E2UA 4Q53A 3SVAA 1YIJ3 2W04A 3CCQ3 1BSAA 2C10A 3G713 1VQQA 1RNBA 2AAEA 5IERA 3UL5A 4H3UA 5FGOA 2CHCA 1M9GA 1CYVA 1BRIA 2RNTA 1I3IA 4CCVA 1YI23 3ER7A 1W01A 3J7Yd 1W4NA 4WWUC 3KE7A 5A0OB 2D42A 3FKAA 3NUVA 1JB4A 2KF6A 3JUNA 1GMRA 4FMAA 4K90B 6GSPA 8RNTA 1A67A 2XEPA 3HIGA 2KCDA 3ZFZA 3QRDA 7GSPA 3AMOB 1GOVA 5CXOA 2OOVC 1NB5I 1IQYA 3EBTA 3KSED 4BTWA 4EXRA 5IF6A 3CCM3 2GU1A 2SBLA 4XBYA 1NJI4 5HGRA 4MMYB 1W6GA 1K28A 1TFKA 2M7OA 2RSXA 2ML5A 3QK9A 4EV2A 3N9HA 1QMAA 2CFGA 2KAAA 1VQ83 2BMRB 2LQVA 4HBRA 5AIIA 3D5IA 3HIIA 4KT3B 5CF1A 3K5TA 1RGEA 3GZYB 3H3HA 3LMLA 9RNTA 2F86B 2KF4A 3FLJA 1GMPA 3F8HA 1BRJA 4BL3A 1A2VA 5M18A 3K63A 5IG3A 1TTOA 3FG3A 2BHMA 5JBSA 1N8R4 4FMDA 1JKGB 2V1LA 4N6TA 4FCMA 2A15A 1BIRA 1X1UA 1STFI 1WMNA 2WO0A 3F14A 1CQSA 2J8XB 1RTUA 1RGAA 3DMCA 4HM6B 2R41A 3BIRA 2CK3H 5KP1A 1G02A 4HM3B 4OVMA 5IEOA 2INXA 3WODG 1O7GB 3I553 5AEWB 3MKIA 1NB3I 4STDA 1AV4A 1RRLA 3CNMA 2IMJA 2RGQA 3BNCA 1VQ43 4PEJA 4EBGA 3CCU3 4HZ9B 2CFKA 3NM7A 1BRKA 1GY6A 1RN4A 1C54A 1W00A 1KWIA 1T3BA 3V92A 5STDA 1VQM3 5BIRA 1WNHA 1BU4A 1X1XA 3F9SA 2YFLB 1BRNL 1BUJA 5RNTA 1VQO3 1OGXA 1O7WB 1T5YA 1VZZA 1LOVA 1LNHA 3EN1B 5TGNA 1LQMB 3JUQA 3DGNA 4AKZA 1PYLA 4HOHA 1Q9EA 4R9LA 2HOHA 3DZLA 4I4KA 3CC23 1NDOB 3WR2A 1QAFA 1I70A 1ZS7A 1EQKA 1RKYA 4MMZB 3ALAA 1I0VA 1IU7A 3CCV3 1Q864 1B2UA 3CCL3 1PFPA 5IENA 3MYTA 1YNVX 3JUOA 1IVVA 3F40A 3OWUA 1R4CA 4LGQA 1W2B2 1UDII 3D3LA 1UCJA 2GEXA 3Q3FA 2OOVA 3B8LA 1UCIA 1I0XA 3SOAA 3X40A 4BU4A 1RDSA 1B2XA 1HYFA 3Q2PA 4LEHA 1JBRA 3DH2A 3O8YA 4R80A 5GSPA 1KQS2 3EF8A 3LTBA 1AY7A 4IT7A 3ZG5A 1E3VA 2ZDJA 1BNJA 3FZWA 1UUWB 4KFDA 4QWTA 2CC3A 2W0QA 2WOFA 3ECFA 1EEJA 1TFOA 2FGTA 1WQLB 2XFTA 3DGMA 2CIUA 3VF1A 4LSOA 1DETA 4GB5A 2QA43 1QVG2 1QVF2 2CX1A 1T2HA 1D6UA 3EQQB 1N9JA 3CC73 2IA7A 4HM0B 2MF7A 2RBIA 1ZGXA 1LOYA 1RJOA 4WYKA 1PU4A 1VQL3 3SEDA 1B21A 3NXJA 5M19A 1SIIA 2OCTA 4FMCA 4MJDA 4ILFA 1Z1SA 2W9PA 4N6MA 1FYSA 3D4AA 2GU3A 2CFLA 4AKYA 1TP6A 1ISKA 3LZAA 3HX8A 4LMIA 2CW9A 3D5GA 3T8UA 4KFFA 5AI1A 5HOHA 1RGHA 1N8QA 2C11A 1VQN3 2I9WA 2XFSA 7RNTA 3D9RA 4HM4B 1IV9A 4MMXB 5M1AA 4NHFA 3AHWA 1Q824 4X2HA 3UB1A 1RCLA 3GZXB 4GSPA 1JJ22 1OACA 1FZUA 3S67A 3A76A 4KZ1A 3AMOA 3LTAA 4XB5A 2F56A 1GOYA 1GS3A 3DY5A 5IEPA 1B27A 1RGFA 3FH1A 1YJ93 1FGMA 3MG2A 4LZIA 3JVCA 3JUMA 3MHEA 1SARA 4R9KA 1VQK3 2H0IA 2W56B 3M8CA 3OX9A 5ELJA 3I563 1JB2A 2WOHA 3LT9A 5IG5A 1VQ63 2CFWA 1W5ZA 1CYUA 1ZX2A 4RNZA 4WP5A 1OF5A 3DXOA 4BTXA 4J5KA 3TDGA 4KFEA 2P0MA 1VQ73 4RNTA 3ROBA 1YJW3 1Q7Y4 3EX9A 3T0UA 3FG4A 3H51A 4FMBA 1PY3A 4O3VA 1RMSA 4O8SA 1FUWA 2B24B 3MG3A 4HM2B 1K734 3AHSA 1WTHA 3RGRA 3OW22 1US1A 1BGSA 3FCSB 3RNTA 1LXEA 3GWRA 4IIAA 4EW5A 4I5QA 1LOWA 3EB8A 2OQEC 1YGEA 1WMPA 1MOLA 3B4PA 1I2GA 4K1UA 3D79A 1NO3A 2HMMB 1DVCA 1UW1A 1Q40A 2BMQB 1UCKA 1WMOA 3NV0A 1DYUA 2JDIH 3EE1A 3S5CA 1OUNA 5EQLA 1DVDA 1QJGA 4L8OA 3K0ZA 2P05A 2SARA 2E2TA 4FCZA 4OUQA 1SJWA 1GD4A 2P38A 3FSDA 3JUPA 3N8BA 4K61A 2LYXA 1OHPA 2XSOB 3IPTA 1DMMA 2XR8B 2IUJA 1Q42A 3X3ZA 1LNIA 2BMOB 1IQXA 5KP3A 3BU4A 3AGOA 1B2SA 3PXMA 4RBNA 6STDA 2R4IA 1BNGA 1X1YA 3K9MC 3MSOA 5D83A 2CKFB 2CH9A 1GYBA 1BUQA 2AADA 2CWTA 1KC84 1M1XB 3MPHA 2GSPA 4HKVB 4FR9A 3NQYA 4K1VA 2Z77A 4HVNA 1N5PA 1RN1A 2Z7AA 1RN7A 3FGYA 1S723 3G6E3 1GOUA 2KF5A 3SXXA 1YJN3 2F5MA 2H0HA 2W56A 3X3YA 1QAKA 1RHLA 3WHOA 1LOXA 4LYLB 1GMQA 3G16A 3EC9A 1FGTA 1OF5B 1UGIA 3BB9A 3EHCA 1ULIB 2GBWB 4BL2A 3V98A 3LH4A 1STDA 3NHXA 1IQ8A 2ZHXB 4N6V0 4N3VA 1UI7A 5DRVA 3S27A 4EV5A 1I2FA 1BANA 2WGOA 3NM2A 3OWSA 5BVBA 1RGKA 4HM1B 3OXAA 4L7KA 1FGQA 3G0KA 3LT8A 1W2ZA 2K54A 1BSEA 1W7CA 1IDPA 2GBXB 2W9QA 3LTDA 5AYSC 2ZA4A 1GY5A 3GAXA 1TRPA 4N6NB 3Q90A 3WOFB 1BOXA 2OWPA 5JPUA 1LQGC 1N9EA 2HMKB 3DGYA 1JB5A 1BSDA 3CME3 4TX4A 2UUGC 4N6OB 4HM7B 4NREA 3RDEA 3PGBA 5G2GA 1OHSA 3WOEB 3URPA 1OPYA 3HI7A 1OGZA 4BTYA 2UGIA 1UGHI 3V99A 2O3OA 4WHAA 4HYZA 2YX9A 1FA3A 2CWUA 1HU9A 1BNSA 1JN5B 2F4YA 5AIGA 4AEQA 3NBBA 3Q1CA 3CC43 1AQZA 2D1WA 3BNDA 2MC8A 1DE3A 1M904 1JNQA 1BNIA 2QIYA 3NBJA 2GXFA 3KIIA 3F7XA 2OTL3 1RCKA 3F7SA 1NWWA 4XDVA 3FF2A 1EA2A 3GRDA 1RGGA 3WMDA 3HZPA 3GZBA 1V57A 1RNTA 8CHOA 3AGNA 3KCHA 4R4KA 5BU4A 5EVHA 2CWVA 2CFDA 4RZMA 1I3FA 1UUVB 2XH9A 3BLZA 4OK0A 1W6YA 3VGNA 2XSHB 4CDLA 1RGLA 3A5EA 4O02B 3WDGB 1W6CA 3EJVA 3EBYA 2H0GA 3ZG0A 3X41A 1HZ1A 2CG0A 3EN8A 2STDA 4WFOA 1RGCA 4U13A 3WA2X 1BRHA 2CX0A 3X3XA 3BNBA 4EYCA 2BIRA 3WA3A 1TJDA 5AIHA 4J8TA 2BT3A 1JN5A 2O9UX 1J2BA 1IK3A 2P0XA 1EUIC 1O7MB 1E97A 5KP4A 2PNCA 3DUKA 1TU5A 3G8ZA 1LRAA 3MG1A 4BIRA 2K0MA 3SOYA 2E2VA 1V74A 4R1KA 2IUKA 1SIHA 1O7PB 1N5HA 1UCLA 2HMOB 2XF3A 3HOHA 2YFJB 3K7CA 1MWRA 2CG1A 3RGAA 5CF2A 5AIFA 1AVKA 2C4BA 5AYRB 2Z6BA 1ROAA 1BAOA 1LVNA 1MGWA 1S5AA 1GSPA 2F99A 3CXC2 1NU3A 3UJMA 2Y73A 1U5OA 3BNEA 2W6JH 3CNXA 3IMAB 1Q814 3NV0B 3UL6A 1BVIA 1YHQ3 4WYKB 1BSBA 2XGLA 1JZDA 1OH0A 2KF3A 3MWZA 3FG1A 1W02A 4N6UA 2F98A 4MEIA 1AVLA 1DMQA 1X1WA 1G96A 1IVXA 1VQ53 3CCE3 4N6LA 3NX0A 5ELUA 1D6YA 1GY7A 2HMLB 1KSIA 3CMA3 5D81A 1A2KA 4GHOA 1IYYA 1JKGA 2Z76A 1ULJB 5CK6A 4J9AA 4ORLA 1B20A 1UUGB 3CCS3 2L4VA 4XBXA 1MNLA 1RRHA 1FGOA 2KXGA 1BNRA 1B2MA 5IG0A 1MWTA 3KZTA 1Q7HA 1BRSA 4X2OA 4O2HA 1IVUA 3DM8A 1JZOA 3NBRA 1D6ZA 3L0RA 2Y74A 3T8NA 1SPUA 1O7NB 2W03A 3S28A 4EC6A 2K3DA 1RLSA 3KKGA 1BSCA 3PCRA 3PCSA 1CH0A 4XBTA 1JRQA 3UNLA 4ZM8A 1K9M4 1U8CB 1YIT3 1MWSA 3LYGA 3GZRA 3STDA 3OWYA 3VSYA 4CJNA 2OQEA 1BNEA 3KN4A 3KSPA 3CPW2 3OV4A 1A90A 3X42A 3FF0A 2Q07A 4JF8A 5G1KA 1JBTA 3NQZA 1IV7A 3LXUX 1IT8A 1E3RA 1IVWA 1FUSA 2GEYA 5LC6A 7STDA 1KD14 5FW5A 4HM5B 2XRXB 3CCJ3 3PYJA 5G1LA 3SYUA 6RNTA 5LC7A 2QGUA 4NPBA 5JPPA 5AEUB 2P09A 4H61A 1YVSA 1QALA 1NNVA 3LOYA 2IY2A 1B2ZA 2L1SA 2BO9B 3I0YA 3IJEB 2ML6A 4XM4A 1MWUA 4J5GA 4DKIA 1AR0A 1G0TA 4G1MB 1MGRA 1R4YA 1TUHA 2HMJB 2W2CA 1F8NA 1TIJA 3LTCA 3U1WA 2HMNB 3U97A 4KVHA 5D82A 3N54B 3DGOA 2ZL8A 3B7CA 1BNFA 1HKXA 2BNGA 1TRQA 2FNQA 1OHOA 1Q40B 4HZBB 4FCJA 4JRFA 1IT7A 2IYJA 5CLKA 2JQ5A 1VQ93 1Y4KA 1T2IA 2WGQA 1DMNA 1BRGA 2B1XB 5IG4A 3CU3A 3KFQC 3G4S3 1ROVA 3B4OA 5BXQA 1FUTA 1YGWA 4CPKA 2BU4A 2YFIB 3CCR3 1C7HA 4GL6A 1A2PA 1B3SA 1O7HB 3F8XA 1JV2B 2UX0A
chains in the Genus database with same CATH topology
2PZVA 2OTJ3 1CEWI 5DREA 2QEX3 1GD3A 3DGLA 1EG9B 4XDWA 1ZO2A 3S29A 1SQWA 1ASKA 3SLUA 3CPOA 2RCDA 3HK4A 2FXTA 5EEOA 3SX1A 1UI8A 5I97A 3E99A 2KRTA 1K41A 4HM8B 1YVBI 1VQP3 5IW9A 3CD63 1FGRA 2RFRA 1L5GB 1EKMA 3PS8A 4RNYA 4HJLB 1OCVA 1K8A4 3PZWA 4IPBA 4L8PA 2XGNA 1M1K4 2E2UA 4Q53A 3SVAA 1YIJ3 2W04A 3CCQ3 2C10A 3G713 5IERA 3UL5A 4H3UA 5FGOA 2CHCA 1M9GA 1CYVA 1YI23 4CCVA 3ER7A 1W01A 3J7Yd 1W4NA 4WWUC 3KE7A 5A0OB 2D42A 3FKAA 3NUVA 1JB4A 4FMAA 3JUNA 4K90B 1A67A 2XEPA 3HIGA 2KCDA 3QRDA 3AMOB 5CXOA 2OOVC 1NB5I 1IQYA 3EBTA 3KSED 4BTWA 4EXRA 5IF6A 3CCM3 2GU1A 2SBLA 4XBYA 1NJI4 5HGRA 4MMYB 1W6GA 1K28A 1TFKA 2M7OA 2RSXA 2ML5A 3QK9A 4EV2A 3N9HA 1QMAA 2CFGA 1VQ83 2BMRB 2LQVA 4HBRA 5AIIA 3HIIA 5CF1A 3K5TA 3GZYB 3H3HA 3LMLA 2F86B 3FLJA 3F8HA 1A2VA 3K63A 5IG3A 3FG3A 2BHMA 5JBSA 1N8R4 4FMDA 1JKGB 2V1LA 4N6TA 4FCMA 2A15A 1STFI 1WMNA 2WO0A 3F14A 1CQSA 3DMCA 4HM6B 2CK3H 5KP1A 4HM3B 4OVMA 5IEOA 2INXA 3WODG 1O7GB 3I553 5AEWB 3MKIA 1NB3I 4STDA 1AV4A 1RRLA 3CNMA 2IMJA 2RGQA 3BNCA 1VQ43 4PEJA 4EBGA 3CCU3 4HZ9B 2CFKA 3NM7A 1GY6A 1W00A 1KWIA 3V92A 5STDA 1VQM3 1WNHA 3F9SA 2YFLB 1VQO3 1OGXA 1O7WB 1T5YA 1VZZA 1LNHA 3EN1B 5TGNA 3JUQA 3DGNA 4AKZA 4R9LA 3DZLA 4I4KA 3CC23 1NDOB 1QAFA 1EQKA 1RKYA 4MMZB 3ALAA 3CCV3 1IU7A 1Q864 3CCL3 1PFPA 5IENA 3MYTA 3JUOA 1IVVA 3F40A 3OWUA 1R4CA 4LGQA 1W2B2 3D3LA 2GEXA 2OOVA 3B8LA 3X40A 3SOAA 3Q2PA 4LEHA 3O8YA 4R80A 1KQS2 3EF8A 3LTBA 4IT7A 1E3VA 2ZDJA 3FZWA 1UUWB 4KFDA 4QWTA 2CC3A 2W0QA 2WOFA 3ECFA 1TFOA 2FGTA 1WQLB 2XFTA 3DGMA 2CIUA 3VF1A 4LSOA 4GB5A 2QA43 1QVG2 1QVF2 1D6UA 3EQQB 1N9JA 3CC73 2IA7A 4HM0B 2MF7A 1RJOA 4WYKA 1PU4A 1VQL3 3SEDA 3NXJA 1SIIA 2OCTA 4FMCA 4MJDA 1Z1SA 2W9PA 4N6MA 2GU3A 2CFLA 4AKYA 1TP6A 1ISKA 3LZAA 3HX8A 4LMIA 2CW9A 3T8UA 4KFFA 5AI1A 1N8QA 2C11A 1VQN3 2I9WA 2XFSA 3D9RA 4HM4B 1IV9A 4MMXB 1Q824 4NHFA 4X2HA 3UB1A 3GZXB 1JJ22 1OACA 3S67A 3A76A 4KZ1A 3AMOA 3LTAA 4XB5A 1GS3A 3DY5A 5IEPA 3FH1A 1YJ93 1FGMA 3MG2A 4LZIA 3JVCA 3JUMA 3MHEA 4R9KA 1VQK3 2W56B 3M8CA 3OX9A 5ELJA 3I563 1JB2A 2WOHA 3LT9A 5IG5A 1VQ63 2CFWA 1W5ZA 1CYUA 1ZX2A 4RNZA 4WP5A 1OF5A 3DXOA 4BTXA 3TDGA 4KFEA 2P0MA 1VQ73 1Q7Y4 3ROBA 1YJW3 3EX9A 3T0UA 3FG4A 3H51A 4FMBA 4O3VA 4O8SA 1FUWA 2B24B 3MG3A 4HM2B 1K734 1WTHA 3RGRA 3OW22 1US1A 3FCSB 1LXEA 3GWRA 4IIAA 3EB8A 2OQEC 1YGEA 1WMPA 1MOLA 3B4PA 4K1UA 1NO3A 2HMMB 1DVCA 1UW1A 1Q40A 2BMQB 3NV0A 1WMOA 1DYUA 2JDIH 3EE1A 3S5CA 1OUNA 5EQLA 1DVDA 1QJGA 4L8OA 3K0ZA 2P05A 4FCZA 2E2TA 4OUQA 1SJWA 1GD4A 2P38A 3FSDA 3JUPA 3N8BA 4K61A 2LYXA 1OHPA 2XSOB 3IPTA 1DMMA 2XR8B 2IUJA 1Q42A 3X3ZA 2BMOB 1IQXA 5KP3A 3PXMA 4RBNA 6STDA 2R4IA 3K9MC 3MSOA 5D83A 2CKFB 2CH9A 1GYBA 1BUQA 2CWTA 1KC84 1M1XB 3MPHA 4HKVB 4FR9A 3NQYA 4K1VA 2Z77A 4HVNA 1N5PA 2Z7AA 1RN7A 3FGYA 1S723 3G6E3 3SXXA 1YJN3 2W56A 3X3YA 1QAKA 1LOXA 3G16A 3EC9A 1FGTA 1OF5B 3BB9A 3EHCA 1ULIB 2GBWB 3V98A 3LH4A 1STDA 3NHXA 1IQ8A 4N6V0 4N3VA 1UI7A 5DRVA 3S27A 4EV5A 2WGOA 3NM2A 3OWSA 5BVBA 4HM1B 3OXAA 4L7KA 1FGQA 3G0KA 3LT8A 1W2ZA 2K54A 1W7CA 1IDPA 2GBXB 2W9QA 3LTDA 5AYSC 1GY5A 3GAXA 4N6NB 3Q90A 3WOFB 2OWPA 5JPUA 1N9EA 2HMKB 1JB5A 3CME3 4TX4A 4N6OB 4HM7B 4NREA 3RDEA 3PGBA 5G2GA 1OHSA 3WOEB 1OPYA 3HI7A 1OGZA 4BTYA 3V99A 2O3OA 4WHAA 4HYZA 2YX9A 1FA3A 2CWUA 1HU9A 1JN5B 5AIGA 4AEQA 3NBBA 3Q1CA 3CC43 2D1WA 3BNDA 2MC8A 1M904 1JNQA 2QIYA 3NBJA 2GXFA 3KIIA 3F7XA 2OTL3 3F7SA 1NWWA 4XDVA 3FF2A 1EA2A 3GRDA 3WMDA 3HZPA 3GZBA 8CHOA 4R4KA 5EVHA 2CWVA 2CFDA 4RZMA 1UUVB 2XH9A 3BLZA 4OK0A 1W6YA 3VGNA 2XSHB 4CDLA 4O02B 3WDGB 3EJVA 1W6CA 3EBYA 3X41A 2CG0A 3EN8A 2STDA 4WFOA 4U13A 3WA2X 3X3XA 3BNBA 4EYCA 3WA3A 5AIHA 4J8TA 2BT3A 1JN5A 2O9UX 1J2BA 1IK3A 2P0XA 1O7MB 1E97A 5KP4A 2PNCA 3DUKA 1TU5A 3G8ZA 3MG1A 2K0MA 3SOYA 2E2VA 1V74A 4R1KA 2IUKA 1SIHA 1O7PB 1N5HA 2XF3A 2HMOB 2YFJB 3K7CA 2CG1A 3RGAA 5CF2A 5AIFA 1AVKA 5AYRB 2Z6BA 1ROAA 1LVNA 1S5AA 2F99A 3CXC2 1NU3A 3UJMA 2Y73A 1U5OA 3BNEA 2W6JH 3CNXA 3IMAB 1Q814 3NV0B 3UL6A 1YHQ3 4WYKB 2XGLA 1OH0A 3MWZA 3FG1A 1W02A 4N6UA 2F98A 4MEIA 1AVLA 1DMQA 1G96A 1IVXA 1VQ53 3CCE3 4N6LA 3NX0A 5ELUA 1D6YA 1GY7A 2HMLB 1KSIA 3CMA3 5D81A 1A2KA 1JKGA 2Z76A 1ULJB 5CK6A 4J9AA 4ORLA 3CCS3 2L4VA 4XBXA 1MNLA 1RRHA 1FGOA 2KXGA 5IG0A 3KZTA 4X2OA 4O2HA 1IVUA 3DM8A 3NBRA 1D6ZA 3L0RA 2Y74A 3T8NA 1SPUA 1O7NB 2W03A 3S28A 4EC6A 3KKGA 3PCRA 3PCSA 3UNLA 4XBTA 1JRQA 4ZM8A 1K9M4 1U8CB 3LYGA 3VSYA 3GZRA 3STDA 3OWYA 2OQEA 3KN4A 3KSPA 3CPW2 3OV4A 1A90A 3X42A 3FF0A 2Q07A 4JF8A 3NQZA 1IV7A 3LXUX 1IT8A 1E3RA 1IVWA 2GEYA 5LC6A 7STDA 1KD14 5FW5A 4HM5B 2XRXB 3CCJ3 3PYJA 5LC7A 2QGUA 5JPPA 5AEUB 2P09A 4H61A 1QALA 3LOYA 4XM4A 3I0YA 2BO9B 3IJEB 2ML6A 1AR0A 4G1MB 1TUHA 2HMJB 2W2CA 3U1WA 1F8NA 1TIJA 3LTCA 2HMNB 3U97A 4KVHA 5D82A 3N54B 3DGOA 2ZL8A 3B7CA 1HKXA 2BNGA 2FNQA 1OHOA 1Q40B 4HZBB 4FCJA 4JRFA 1IT7A 5CLKA 2JQ5A 1VQ93 1Y4KA 2WGQA 1DMNA 2B1XB 5IG4A 3CU3A 3KFQC 3G4S3 1ROVA 3B4OA 5BXQA 2YFIB 3CCR3 1C7HA 4GL6A 1YIT3 1O7HB 3F8XA 1JV2B 2UX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZV A;  1O7M B;  1E97 A;  1QJG A;  4L8O A;  5KP4 A;  5DRE A;  3K0Z A;  3DUK A;  1EG9 B;  4OUQ A;  3G8Z A;  1SJW A;  1ZO2 A;  3FSD A;  3JUP A;  3MG1 A;  4XDW A;  3SOY A;  1ASK A;  3CPO A;  2RCD A;  3HK4 A;  1OHP A;  2XSO B;  3IPT A;  1DMM A;  2XR8 B;  3JUO A;  1Q42 A;  3F40 A;  1O7P B;  2BMO B;  1K41 A;  2HMO B;  3E99 A;  3OWU A;  4HM8 B;  2GEX A;  2YFJ B;  3K7C A;  4LGQ A;  5KP3 A;  3B8L A;  3RGA A;  6STD A;  2RFR A;  3SOA A;  2R4I A;  5AIF A;  5CF2 A;  3MSO A;  5D83 A;  2CKF B;  4HJL B;  1GYB A;  1BUQ A;  4LEH A;  1OCV A;  3EF8 A;  1S5A A;  4J8T A;  4HKV B;  2F99 A;  4L8P A;  1NU3 A;  4K1V A;  2Z77 A;  1E3V A;  1U5O A;  3CNX A;  3FZW A;  4HVN A;  1UUW B;  4Q53 A;  3NV0 B;  3ROB A;  4WYK B;  1OH0 A;  3ECF A;  2Z7A A;  3FGY A;  5IER A;  1W02 A;  1WQL B;  2F98 A;  4H3U A;  2CHC A;  4GB5 A;  1DMQ A;  3ER7 A;  1W01 A;  4WWU C;  3KE7 A;  3FKA A;  1GY7 A;  1JB4 A;  2HML B;  3EC9 A;  3EQQ B;  3G16 A;  1OF5 B;  3JUN A;  3NUV A;  3BB9 A;  4HM0 B;  1A2K A;  5D81 A;  3EHC A;  1ULI B;  2GBW B;  4WYK A;  1JKG A;  1STD A;  5CXO A;  2Z76 A;  3NHX A;  1ULJ B;  3EBT A;  5CK6 A;  3NXJ A;  3SED A;  4N3V A;  4J9A A;  4MJD A;  4ORL A;  5DRV A;  5IF6 A;  4XBY A;  3WMD A;  1Z1S A;  5HGR A;  4XBX A;  3NM2 A;  3OWS A;  5BVB A;  4HM1 B;  3OXA A;  1TP6 A;  4L7K A;  1ISK A;  3G0K A;  3KZT A;  3HX8 A;  3LZA A;  4LMI A;  2K54 A;  4X2O A;  5IG0 A;  1QMA A;  1IDP A;  3T8U A;  5AI1 A;  2GBX B;  3DM8 A;  3NBR A;  2BMR B;  3T8N A;  1GY5 A;  5AII A;  1O7N B;  2I9W A;  3Q90 A;  5CF1 A;  2OWP A;  3D9R A;  3GZY B;  2HMK B;  3H3H A;  3KKG A;  4HM4 B;  5JPU A;  2F86 B;  4WP5 A;  3FLJ A;  4XBT A;  4X2H A;  3F8H A;  3UNL A;  1JB5 A;  3GZX B;  5IG3 A;  3LYG A;  3VSY A;  3GZR A;  3STD A;  3A76 A;  3OWY A;  4HM7 B;  3KSP A;  1JKG B;  5G2G A;  3OV4 A;  4XB5 A;  1OHS A;  4FCM A;  2A15 A;  3FF0 A;  1OPY A;  1OGZ A;  1GS3 A;  5IEP A;  3F14 A;  1CQS A;  1E3R A;  3FH1 A;  2GEY A;  3DMC A;  4HM6 B;  7STD A;  3MG2 A;  5FW5 A;  4HM5 B;  2XRX B;  3JUM A;  3MHE A;  5KP1 A;  4R9K A;  1JN5 B;  5AIG A;  3M8C A;  3OX9 A;  4HM3 B;  4OVM A;  2QGU A;  1JB2 A;  5IEO A;  5IG5 A;  2INX A;  5JPP A;  5AEU B;  2QIY A;  1O7G B;  1ZX2 A;  2GXF A;  3F7X A;  1OF5 A;  3DXO A;  3I0Y A;  3MKI A;  3F7S A;  1NWW A;  4STD A;  4XM4 A;  1AR0 A;  4XDV A;  3CNM A;  3FF2 A;  1EA2 A;  4R1K A;  3GRD A;  2IMJ A;  1TUH A;  2HMJ B;  2RGQ A;  2W2C A;  3EX9 A;  3GZB A;  3HZP A;  4PEJ A;  2HMN B;  3H51 A;  5AIH A;  4HZ9 B;  8CHO A;  4KVH A;  5D82 A;  2B24 B;  3MG3 A;  4HM2 B;  1GY6 A;  3B7C A;  1HKX A;  2BNG A;  1W00 A;  5EVH A;  3RGR A;  3UJM A;  5STD A;  1OHO A;  1Q40 B;  4HZB B;  4FCJ A;  4RZM A;  1UUV B;  3GWR A;  5CLK A;  2JQ5 A;  3BLZ A;  3F9S A;  3MYT A;  2YFL B;  1W6Y A;  4IIA A;  2XSH B;  3VGN A;  4CDL A;  1DMN A;  1OGX A;  2B1X B;  3EJV A;  5IG4 A;  3EBY A;  3CU3 A;  1O7W B;  1VZZ A;  3B4P A;  3EN1 B;  2STD A;  3EN8 A;  4K1U A;  2HMM B;  3B4O A;  5TGN A;  5BXQ A;  3JUQ A;  4U13 A;  4R9L A;  3DZL A;  2YFI B;  4I4K A;  5IEN A;  1Q40 A;  2BMQ B;  1C7H A;  1NDO B;  3NV0 A;  5AEW B;  1O7H B;  3F8X A;  1JN5 A;  3S5C A;  2UX0 A;  1OUN A; 
#chains in the Genus database with same CATH topology
 2PZV A;  2OTJ 3;  1CEW I;  1FW7 A;  5DRE A;  2QEX 3;  1GD3 A;  3DGL A;  1EG9 B;  1V58 A;  4XDW A;  1ZO2 A;  3S29 A;  1SQW A;  1ASK A;  3SLU A;  1I2E A;  2RCD A;  3CPO A;  3HK4 A;  4HAA A;  2FXT A;  5EEO A;  3SX1 A;  1UI8 A;  5I97 A;  3E99 A;  2KRT A;  1K41 A;  4HM8 B;  1YVB I;  1VQP 3;  5IW9 A;  3CD6 3;  1FGR A;  1RSN A;  2RFR A;  1L5G B;  1EKM A;  2F5W A;  3PS8 A;  3GSP A;  4HJL B;  4RNY A;  1I8V A;  1OCV A;  1K8A 4;  3PZW A;  4IPB A;  1JBS A;  4L8P A;  2XGN A;  1M1K 4;  2E2U A;  4Q53 A;  3SVA A;  1YIJ 3;  2W04 A;  3CCQ 3;  1BSA A;  2C10 A;  3G71 3;  1VQQ A;  1RNB A;  2AAE A;  5IER A;  3UL5 A;  4H3U A;  5FGO A;  2CHC A;  1M9G A;  1CYV A;  1BRI A;  2RNT A;  1I3I A;  4CCV A;  1YI2 3;  3ER7 A;  1W01 A;  3J7Y d;  1W4N A;  4WWU C;  3KE7 A;  5A0O B;  2D42 A;  3FKA A;  3NUV A;  1JB4 A;  2KF6 A;  3JUN A;  1GMR A;  4FMA A;  4K90 B;  6GSP A;  8RNT A;  1A67 A;  2XEP A;  3HIG A;  2KCD A;  3ZFZ A;  3QRD A;  7GSP A;  3AMO B;  1GOV A;  5CXO A;  2OOV C;  1NB5 I;  1IQY A;  3EBT A;  3KSE D;  4BTW A;  4EXR A;  5IF6 A;  3CCM 3;  2GU1 A;  2SBL A;  4XBY A;  1NJI 4;  5HGR A;  4MMY B;  1W6G A;  1K28 A;  1TFK A;  2M7O A;  2RSX A;  2ML5 A;  3QK9 A;  4EV2 A;  3N9H A;  1QMA A;  2CFG A;  2KAA A;  1VQ8 3;  2BMR B;  2LQV A;  4HBR A;  5AII A;  3D5I A;  3HII A;  4KT3 B;  5CF1 A;  3K5T A;  1RGE A;  3GZY B;  3H3H A;  3LML A;  9RNT A;  2F86 B;  2KF4 A;  3FLJ A;  1GMP A;  3F8H A;  1BRJ A;  4BL3 A;  1A2V A;  5M18 A;  3K63 A;  5IG3 A;  1TTO A;  3FG3 A;  2BHM A;  5JBS A;  1N8R 4;  4FMD A;  1JKG B;  2V1L A;  4N6T A;  4FCM A;  2A15 A;  1BIR A;  1X1U A;  1STF I;  1WMN A;  2WO0 A;  3F14 A;  1CQS A;  2J8X B;  1RTU A;  1RGA A;  3DMC A;  4HM6 B;  2R41 A;  3BIR A;  2CK3 H;  5KP1 A;  1G02 A;  4HM3 B;  4OVM A;  5IEO A;  2INX A;  3WOD G;  1O7G B;  3I55 3;  5AEW B;  3MKI A;  1NB3 I;  4STD A;  1AV4 A;  1RRL A;  3CNM A;  2IMJ A;  2RGQ A;  3BNC A;  1VQ4 3;  4PEJ A;  4EBG A;  3CCU 3;  4HZ9 B;  2CFK A;  3NM7 A;  1BRK A;  1GY6 A;  1RN4 A;  1C54 A;  1W00 A;  1KWI A;  1T3B A;  3V92 A;  5STD A;  1VQM 3;  5BIR A;  1WNH A;  1BU4 A;  1X1X A;  3F9S A;  2YFL B;  1BRN L;  1BUJ A;  5RNT A;  1VQO 3;  1OGX A;  1O7W B;  1T5Y A;  1VZZ A;  1LOV A;  1LNH A;  3EN1 B;  5TGN A;  1LQM B;  3JUQ A;  3DGN A;  4AKZ A;  1PYL A;  4HOH A;  1Q9E A;  4R9L A;  2HOH A;  3DZL A;  4I4K A;  3CC2 3;  1NDO B;  3WR2 A;  1QAF A;  1I70 A;  1ZS7 A;  1EQK A;  1RKY A;  4MMZ B;  3ALA A;  1I0V A;  1IU7 A;  3CCV 3;  1Q86 4;  1B2U A;  3CCL 3;  1PFP A;  5IEN A;  3MYT A;  1YNV X;  3JUO A;  1IVV A;  3F40 A;  3OWU A;  1R4C A;  4LGQ A;  1W2B 2;  1UDI I;  3D3L A;  1UCJ A;  2GEX A;  3Q3F A;  2OOV A;  3B8L A;  1UCI A;  1I0X A;  3SOA A;  3X40 A;  4BU4 A;  1RDS A;  1B2X A;  1HYF A;  3Q2P A;  4LEH A;  1JBR A;  3DH2 A;  3O8Y A;  4R80 A;  5GSP A;  1KQS 2;  3EF8 A;  3LTB A;  1AY7 A;  4IT7 A;  3ZG5 A;  1E3V A;  2ZDJ A;  1BNJ A;  3FZW A;  1UUW B;  4KFD A;  4QWT A;  2CC3 A;  2W0Q A;  2WOF A;  3ECF A;  1EEJ A;  1TFO A;  2FGT A;  1WQL B;  2XFT A;  3DGM A;  2CIU A;  3VF1 A;  4LSO A;  1DET A;  4GB5 A;  2QA4 3;  1QVG 2;  1QVF 2;  2CX1 A;  1T2H A;  1D6U A;  3EQQ B;  1N9J A;  3CC7 3;  2IA7 A;  4HM0 B;  2MF7 A;  2RBI A;  1ZGX A;  1LOY A;  1RJO A;  4WYK A;  1PU4 A;  1VQL 3;  3SED A;  1B21 A;  3NXJ A;  5M19 A;  1SII A;  2OCT A;  4FMC A;  4MJD A;  4ILF A;  1Z1S A;  2W9P A;  4N6M A;  1FYS A;  3D4A A;  2GU3 A;  2CFL A;  4AKY A;  1TP6 A;  1ISK A;  3LZA A;  3HX8 A;  4LMI A;  2CW9 A;  3D5G A;  3T8U A;  4KFF A;  5AI1 A;  5HOH A;  1RGH A;  1N8Q A;  2C11 A;  1VQN 3;  2I9W A;  2XFS A;  7RNT A;  3D9R A;  4HM4 B;  1IV9 A;  4MMX B;  5M1A A;  4NHF A;  3AHW A;  1Q82 4;  4X2H A;  3UB1 A;  1RCL A;  3GZX B;  4GSP A;  1JJ2 2;  1OAC A;  1FZU A;  3S67 A;  3A76 A;  4KZ1 A;  3AMO A;  3LTA A;  4XB5 A;  2F56 A;  1GOY A;  1GS3 A;  3DY5 A;  5IEP A;  1B27 A;  1RGF A;  3FH1 A;  1YJ9 3;  1FGM A;  3MG2 A;  4LZI A;  3JVC A;  3JUM A;  3MHE A;  1SAR A;  4R9K A;  1VQK 3;  2H0I A;  2W56 B;  3M8C A;  3OX9 A;  5ELJ A;  3I56 3;  1JB2 A;  2WOH A;  3LT9 A;  5IG5 A;  1VQ6 3;  2CFW A;  1W5Z A;  1CYU A;  1ZX2 A;  4RNZ A;  4WP5 A;  1OF5 A;  3DXO A;  4BTX A;  4J5K A;  3TDG A;  4KFE A;  2P0M A;  1VQ7 3;  4RNT A;  3ROB A;  1YJW 3;  1Q7Y 4;  3EX9 A;  3T0U A;  3FG4 A;  3H51 A;  4FMB A;  1PY3 A;  4O3V A;  1RMS A;  4O8S A;  1FUW A;  2B24 B;  3MG3 A;  4HM2 B;  1K73 4;  3AHS A;  1WTH A;  3RGR A;  3OW2 2;  1US1 A;  1BGS A;  3FCS B;  3RNT A;  1LXE A;  3GWR A;  4IIA A;  4EW5 A;  4I5Q A;  1LOW A;  3EB8 A;  2OQE C;  1YGE A;  1WMP A;  1MOL A;  3B4P A;  1I2G A;  4K1U A;  3D79 A;  1NO3 A;  2HMM B;  1DVC A;  1UW1 A;  1Q40 A;  2BMQ B;  1UCK A;  1WMO A;  3NV0 A;  1DYU A;  2JDI H;  3EE1 A;  3S5C A;  1OUN A;  5EQL A;  1DVD A;  1QJG A;  4L8O A;  3K0Z A;  2P05 A;  2SAR A;  2E2T A;  4FCZ A;  4OUQ A;  1SJW A;  1GD4 A;  2P38 A;  3FSD A;  3JUP A;  3N8B A;  4K61 A;  2LYX A;  1OHP A;  2XSO B;  3IPT A;  1DMM A;  2XR8 B;  2IUJ A;  1Q42 A;  3X3Z A;  1LNI A;  2BMO B;  1IQX A;  5KP3 A;  3BU4 A;  3AGO A;  1B2S A;  3PXM A;  4RBN A;  6STD A;  2R4I A;  1BNG A;  1X1Y A;  3K9M C;  3MSO A;  5D83 A;  2CKF B;  2CH9 A;  1GYB A;  1BUQ A;  2AAD A;  2CWT A;  1KC8 4;  1M1X B;  3MPH A;  2GSP A;  4HKV B;  4FR9 A;  3NQY A;  4K1V A;  2Z77 A;  4HVN A;  1N5P A;  1RN1 A;  2Z7A A;  1RN7 A;  3FGY A;  1S72 3;  3G6E 3;  1GOU A;  2KF5 A;  3SXX A;  1YJN 3;  2F5M A;  2H0H A;  2W56 A;  3X3Y A;  1QAK A;  1RHL A;  3WHO A;  1LOX A;  4LYL B;  1GMQ A;  3G16 A;  3EC9 A;  1FGT A;  1OF5 B;  1UGI A;  3BB9 A;  3EHC A;  1ULI B;  2GBW B;  4BL2 A;  3V98 A;  3LH4 A;  1STD A;  3NHX A;  1IQ8 A;  2ZHX B;  4N6V 0;  4N3V A;  1UI7 A;  5DRV A;  3S27 A;  4EV5 A;  1I2F A;  1BAN A;  2WGO A;  3NM2 A;  3OWS A;  5BVB A;  1RGK A;  4HM1 B;  3OXA A;  4L7K A;  1FGQ A;  3G0K A;  3LT8 A;  1W2Z A;  2K54 A;  1BSE A;  1W7C A;  1IDP A;  2GBX B;  2W9Q A;  3LTD A;  5AYS C;  2ZA4 A;  1GY5 A;  3GAX A;  1TRP A;  4N6N B;  3Q90 A;  3WOF B;  1BOX A;  2OWP A;  5JPU A;  1LQG C;  1N9E A;  2HMK B;  3DGY A;  1JB5 A;  1BSD A;  3CME 3;  4TX4 A;  2UUG C;  4N6O B;  4HM7 B;  4NRE A;  3RDE A;  3PGB A;  5G2G A;  1OHS A;  3WOE B;  3URP A;  1OPY A;  3HI7 A;  1OGZ A;  4BTY A;  2UGI A;  1UGH I;  3V99 A;  2O3O A;  4WHA A;  4HYZ A;  2YX9 A;  1FA3 A;  2CWU A;  1HU9 A;  1BNS A;  1JN5 B;  2F4Y A;  5AIG A;  4AEQ A;  3NBB A;  3Q1C A;  3CC4 3;  1AQZ A;  2D1W A;  3BND A;  2MC8 A;  1DE3 A;  1M90 4;  1JNQ A;  1BNI A;  2QIY A;  3NBJ A;  2GXF A;  3KII A;  3F7X A;  2OTL 3;  1RCK A;  3F7S A;  1NWW A;  4XDV A;  3FF2 A;  1EA2 A;  3GRD A;  1RGG A;  3WMD A;  3HZP A;  3GZB A;  1V57 A;  1RNT A;  8CHO A;  3AGN A;  3KCH A;  4R4K A;  5BU4 A;  5EVH A;  2CWV A;  2CFD A;  4RZM A;  1I3F A;  1UUV B;  2XH9 A;  3BLZ A;  4OK0 A;  1W6Y A;  3VGN A;  2XSH B;  4CDL A;  1RGL A;  3A5E A;  4O02 B;  3WDG B;  1W6C A;  3EJV A;  3EBY A;  2H0G A;  3ZG0 A;  3X41 A;  1HZ1 A;  2CG0 A;  3EN8 A;  2STD A;  4WFO A;  1RGC A;  4U13 A;  3WA2 X;  1BRH A;  2CX0 A;  3X3X A;  3BNB A;  4EYC A;  2BIR A;  3WA3 A;  1TJD A;  5AIH A;  4J8T A;  2BT3 A;  1JN5 A;  2O9U X;  1J2B A;  1IK3 A;  2P0X A;  1EUI C;  1O7M B;  1E97 A;  5KP4 A;  2PNC A;  3DUK A;  1TU5 A;  3G8Z A;  1LRA A;  3MG1 A;  4BIR A;  2K0M A;  3SOY A;  2E2V A;  1V74 A;  4R1K A;  2IUK A;  1SIH A;  1O7P B;  1N5H A;  1UCL A;  2HMO B;  2XF3 A;  3HOH A;  2YFJ B;  3K7C A;  1MWR A;  2CG1 A;  3RGA A;  5CF2 A;  5AIF A;  1AVK A;  2C4B A;  5AYR B;  2Z6B A;  1ROA A;  1BAO A;  1LVN A;  1MGW A;  1S5A A;  1GSP A;  2F99 A;  3CXC 2;  1NU3 A;  3UJM A;  2Y73 A;  1U5O A;  3BNE A;  2W6J H;  3CNX A;  3IMA B;  1Q81 4;  3NV0 B;  3UL6 A;  1BVI A;  1YHQ 3;  4WYK B;  1BSB A;  2XGL A;  1JZD A;  1OH0 A;  2KF3 A;  3MWZ A;  3FG1 A;  1W02 A;  4N6U A;  2F98 A;  4MEI A;  1AVL A;  1DMQ A;  1X1W A;  1G96 A;  1IVX A;  1VQ5 3;  3CCE 3;  4N6L A;  3NX0 A;  5ELU A;  1D6Y A;  1GY7 A;  2HML B;  1KSI A;  3CMA 3;  5D81 A;  1A2K A;  4GHO A;  1IYY A;  1JKG A;  2Z76 A;  1ULJ B;  5CK6 A;  4J9A A;  4ORL A;  1B20 A;  1UUG B;  3CCS 3;  2L4V A;  4XBX A;  1MNL A;  1RRH A;  1FGO A;  2KXG A;  1BNR A;  1B2M A;  5IG0 A;  1MWT A;  3KZT A;  1Q7H A;  1BRS A;  4X2O A;  4O2H A;  1IVU A;  3DM8 A;  1JZO A;  3NBR A;  1D6Z A;  3L0R A;  2Y74 A;  3T8N A;  1SPU A;  1O7N B;  2W03 A;  3S28 A;  4EC6 A;  2K3D A;  1RLS A;  3KKG A;  1BSC A;  3PCR A;  3PCS A;  1CH0 A;  4XBT A;  1JRQ A;  3UNL A;  4ZM8 A;  1K9M 4;  1U8C B;  1YIT 3;  1MWS A;  3LYG A;  3GZR A;  3STD A;  3OWY A;  3VSY A;  4CJN A;  2OQE A;  1BNE A;  3KN4 A;  3KSP A;  3CPW 2;  3OV4 A;  1A90 A;  3X42 A;  3FF0 A;  2Q07 A;  4JF8 A;  5G1K A;  1JBT A;  3NQZ A;  1IV7 A;  3LXU X;  1IT8 A;  1E3R A;  1IVW A;  1FUS A;  2GEY A;  5LC6 A;  7STD A;  1KD1 4;  5FW5 A;  4HM5 B;  2XRX B;  3CCJ 3;  3PYJ A;  5G1L A;  3SYU A;  6RNT A;  5LC7 A;  2QGU A;  4NPB A;  5JPP A;  5AEU B;  2P09 A;  4H61 A;  1YVS A;  1QAL A;  1NNV A;  3LOY A;  2IY2 A;  1B2Z A;  2L1S A;  2BO9 B;  3I0Y A;  3IJE B;  2ML6 A;  4XM4 A;  1MWU A;  4J5G A;  4DKI A;  1AR0 A;  1G0T A;  4G1M B;  1MGR A;  1R4Y A;  1TUH A;  2HMJ B;  2W2C A;  1F8N A;  1TIJ A;  3LTC A;  3U1W A;  2HMN B;  3U97 A;  4KVH A;  5D82 A;  3N54 B;  3DGO A;  2ZL8 A;  3B7C A;  1BNF A;  1HKX A;  2BNG A;  1TRQ A;  2FNQ A;  1OHO A;  1Q40 B;  4HZB B;  4FCJ A;  4JRF A;  1IT7 A;  2IYJ A;  5CLK A;  2JQ5 A;  1VQ9 3;  1Y4K A;  1T2I A;  2WGQ A;  1DMN A;  1BRG A;  2B1X B;  5IG4 A;  3CU3 A;  3KFQ C;  3G4S 3;  1ROV A;  3B4O A;  5BXQ A;  1FUT A;  1YGW A;  4CPK A;  2BU4 A;  2YFI B;  3CCR 3;  1C7H A;  4GL6 A;  1A2P A;  1B3S A;  1O7H B;  3F8X A;  1JV2 B;  2UX0 A; 
#chains in the Genus database with same CATH homology
 2PZV A;  2OTJ 3;  1CEW I;  5DRE A;  2QEX 3;  1GD3 A;  3DGL A;  1EG9 B;  4XDW A;  1ZO2 A;  3S29 A;  1SQW A;  1ASK A;  3SLU A;  3CPO A;  2RCD A;  3HK4 A;  2FXT A;  5EEO A;  3SX1 A;  1UI8 A;  5I97 A;  3E99 A;  2KRT A;  1K41 A;  4HM8 B;  1YVB I;  1VQP 3;  5IW9 A;  3CD6 3;  1FGR A;  2RFR A;  1L5G B;  1EKM A;  3PS8 A;  4RNY A;  4HJL B;  1OCV A;  1K8A 4;  3PZW A;  4IPB A;  4L8P A;  2XGN A;  1M1K 4;  2E2U A;  4Q53 A;  3SVA A;  1YIJ 3;  2W04 A;  3CCQ 3;  2C10 A;  3G71 3;  5IER A;  3UL5 A;  4H3U A;  5FGO A;  2CHC A;  1M9G A;  1CYV A;  1YI2 3;  4CCV A;  3ER7 A;  1W01 A;  3J7Y d;  1W4N A;  4WWU C;  3KE7 A;  5A0O B;  2D42 A;  3FKA A;  3NUV A;  1JB4 A;  4FMA A;  3JUN A;  4K90 B;  1A67 A;  2XEP A;  3HIG A;  2KCD A;  3QRD A;  3AMO B;  5CXO A;  2OOV C;  1NB5 I;  1IQY A;  3EBT A;  3KSE D;  4BTW A;  4EXR A;  5IF6 A;  3CCM 3;  2GU1 A;  2SBL A;  4XBY A;  1NJI 4;  5HGR A;  4MMY B;  1W6G A;  1K28 A;  1TFK A;  2M7O A;  2RSX A;  2ML5 A;  3QK9 A;  4EV2 A;  3N9H A;  1QMA A;  2CFG A;  1VQ8 3;  2BMR B;  2LQV A;  4HBR A;  5AII A;  3HII A;  5CF1 A;  3K5T A;  3GZY B;  3H3H A;  3LML A;  2F86 B;  3FLJ A;  3F8H A;  1A2V A;  3K63 A;  5IG3 A;  3FG3 A;  2BHM A;  5JBS A;  1N8R 4;  4FMD A;  1JKG B;  2V1L A;  4N6T A;  4FCM A;  2A15 A;  1STF I;  1WMN A;  2WO0 A;  3F14 A;  1CQS A;  3DMC A;  4HM6 B;  2CK3 H;  5KP1 A;  4HM3 B;  4OVM A;  5IEO A;  2INX A;  3WOD G;  1O7G B;  3I55 3;  5AEW B;  3MKI A;  1NB3 I;  4STD A;  1AV4 A;  1RRL A;  3CNM A;  2IMJ A;  2RGQ A;  3BNC A;  1VQ4 3;  4PEJ A;  4EBG A;  3CCU 3;  4HZ9 B;  2CFK A;  3NM7 A;  1GY6 A;  1W00 A;  1KWI A;  3V92 A;  5STD A;  1VQM 3;  1WNH A;  3F9S A;  2YFL B;  1VQO 3;  1OGX A;  1O7W B;  1T5Y A;  1VZZ A;  1LNH A;  3EN1 B;  5TGN A;  3JUQ A;  3DGN A;  4AKZ A;  4R9L A;  3DZL A;  4I4K A;  3CC2 3;  1NDO B;  1QAF A;  1EQK A;  1RKY A;  4MMZ B;  3ALA A;  3CCV 3;  1IU7 A;  1Q86 4;  3CCL 3;  1PFP A;  5IEN A;  3MYT A;  3JUO A;  1IVV A;  3F40 A;  3OWU A;  1R4C A;  4LGQ A;  1W2B 2;  3D3L A;  2GEX A;  2OOV A;  3B8L A;  3X40 A;  3SOA A;  3Q2P A;  4LEH A;  3O8Y A;  4R80 A;  1KQS 2;  3EF8 A;  3LTB A;  4IT7 A;  1E3V A;  2ZDJ A;  3FZW A;  1UUW B;  4KFD A;  4QWT A;  2CC3 A;  2W0Q A;  2WOF A;  3ECF A;  1TFO A;  2FGT A;  1WQL B;  2XFT A;  3DGM A;  2CIU A;  3VF1 A;  4LSO A;  4GB5 A;  2QA4 3;  1QVG 2;  1QVF 2;  1D6U A;  3EQQ B;  1N9J A;  3CC7 3;  2IA7 A;  4HM0 B;  2MF7 A;  1RJO A;  4WYK A;  1PU4 A;  1VQL 3;  3SED A;  3NXJ A;  1SII A;  2OCT A;  4FMC A;  4MJD A;  1Z1S A;  2W9P A;  4N6M A;  2GU3 A;  2CFL A;  4AKY A;  1TP6 A;  1ISK A;  3LZA A;  3HX8 A;  4LMI A;  2CW9 A;  3T8U A;  4KFF A;  5AI1 A;  1N8Q A;  2C11 A;  1VQN 3;  2I9W A;  2XFS A;  3D9R A;  4HM4 B;  1IV9 A;  4MMX B;  1Q82 4;  4NHF A;  4X2H A;  3UB1 A;  3GZX B;  1JJ2 2;  1OAC A;  3S67 A;  3A76 A;  4KZ1 A;  3AMO A;  3LTA A;  4XB5 A;  1GS3 A;  3DY5 A;  5IEP A;  3FH1 A;  1YJ9 3;  1FGM A;  3MG2 A;  4LZI A;  3JVC A;  3JUM A;  3MHE A;  4R9K A;  1VQK 3;  2W56 B;  3M8C A;  3OX9 A;  5ELJ A;  3I56 3;  1JB2 A;  2WOH A;  3LT9 A;  5IG5 A;  1VQ6 3;  2CFW A;  1W5Z A;  1CYU A;  1ZX2 A;  4RNZ A;  4WP5 A;  1OF5 A;  3DXO A;  4BTX A;  3TDG A;  4KFE A;  2P0M A;  1VQ7 3;  1Q7Y 4;  3ROB A;  1YJW 3;  3EX9 A;  3T0U A;  3FG4 A;  3H51 A;  4FMB A;  4O3V A;  4O8S A;  1FUW A;  2B24 B;  3MG3 A;  4HM2 B;  1K73 4;  1WTH A;  3RGR A;  3OW2 2;  1US1 A;  3FCS B;  1LXE A;  3GWR A;  4IIA A;  3EB8 A;  2OQE C;  1YGE A;  1WMP A;  1MOL A;  3B4P A;  4K1U A;  1NO3 A;  2HMM B;  1DVC A;  1UW1 A;  1Q40 A;  2BMQ B;  3NV0 A;  1WMO A;  1DYU A;  2JDI H;  3EE1 A;  3S5C A;  1OUN A;  5EQL A;  1DVD A;  1QJG A;  4L8O A;  3K0Z A;  2P05 A;  4FCZ A;  2E2T A;  4OUQ A;  1SJW A;  1GD4 A;  2P38 A;  3FSD A;  3JUP A;  3N8B A;  4K61 A;  2LYX A;  1OHP A;  2XSO B;  3IPT A;  1DMM A;  2XR8 B;  2IUJ A;  1Q42 A;  3X3Z A;  2BMO B;  1IQX A;  5KP3 A;  3PXM A;  4RBN A;  6STD A;  2R4I A;  3K9M C;  3MSO A;  5D83 A;  2CKF B;  2CH9 A;  1GYB A;  1BUQ A;  2CWT A;  1KC8 4;  1M1X B;  3MPH A;  4HKV B;  4FR9 A;  3NQY A;  4K1V A;  2Z77 A;  4HVN A;  1N5P A;  2Z7A A;  1RN7 A;  3FGY A;  1S72 3;  3G6E 3;  3SXX A;  1YJN 3;  2W56 A;  3X3Y A;  1QAK A;  1LOX A;  3G16 A;  3EC9 A;  1FGT A;  1OF5 B;  3BB9 A;  3EHC A;  1ULI B;  2GBW B;  3V98 A;  3LH4 A;  1STD A;  3NHX A;  1IQ8 A;  4N6V 0;  4N3V A;  1UI7 A;  5DRV A;  3S27 A;  4EV5 A;  2WGO A;  3NM2 A;  3OWS A;  5BVB A;  4HM1 B;  3OXA A;  4L7K A;  1FGQ A;  3G0K A;  3LT8 A;  1W2Z A;  2K54 A;  1W7C A;  1IDP A;  2GBX B;  2W9Q A;  3LTD A;  5AYS C;  1GY5 A;  3GAX A;  4N6N B;  3Q90 A;  3WOF B;  2OWP A;  5JPU A;  1N9E A;  2HMK B;  1JB5 A;  3CME 3;  4TX4 A;  4N6O B;  4HM7 B;  4NRE A;  3RDE A;  3PGB A;  5G2G A;  1OHS A;  3WOE B;  1OPY A;  3HI7 A;  1OGZ A;  4BTY A;  3V99 A;  2O3O A;  4WHA A;  4HYZ A;  2YX9 A;  1FA3 A;  2CWU A;  1HU9 A;  1JN5 B;  5AIG A;  4AEQ A;  3NBB A;  3Q1C A;  3CC4 3;  2D1W A;  3BND A;  2MC8 A;  1M90 4;  1JNQ A;  2QIY A;  3NBJ A;  2GXF A;  3KII A;  3F7X A;  2OTL 3;  3F7S A;  1NWW A;  4XDV A;  3FF2 A;  1EA2 A;  3GRD A;  3WMD A;  3HZP A;  3GZB A;  8CHO A;  4R4K A;  5EVH A;  2CWV A;  2CFD A;  4RZM A;  1UUV B;  2XH9 A;  3BLZ A;  4OK0 A;  1W6Y A;  3VGN A;  2XSH B;  4CDL A;  4O02 B;  3WDG B;  3EJV A;  1W6C A;  3EBY A;  3X41 A;  2CG0 A;  3EN8 A;  2STD A;  4WFO A;  4U13 A;  3WA2 X;  3X3X A;  3BNB A;  4EYC A;  3WA3 A;  5AIH A;  4J8T A;  2BT3 A;  1JN5 A;  2O9U X;  1J2B A;  1IK3 A;  2P0X A;  1O7M B;  1E97 A;  5KP4 A;  2PNC A;  3DUK A;  1TU5 A;  3G8Z A;  3MG1 A;  2K0M A;  3SOY A;  2E2V A;  1V74 A;  4R1K A;  2IUK A;  1SIH A;  1O7P B;  1N5H A;  2XF3 A;  2HMO B;  2YFJ B;  3K7C A;  2CG1 A;  3RGA A;  5CF2 A;  5AIF A;  1AVK A;  5AYR B;  2Z6B A;  1ROA A;  1LVN A;  1S5A A;  2F99 A;  3CXC 2;  1NU3 A;  3UJM A;  2Y73 A;  1U5O A;  3BNE A;  2W6J H;  3CNX A;  3IMA B;  1Q81 4;  3NV0 B;  3UL6 A;  1YHQ 3;  4WYK B;  2XGL A;  1OH0 A;  3MWZ A;  3FG1 A;  1W02 A;  4N6U A;  2F98 A;  4MEI A;  1AVL A;  1DMQ A;  1G96 A;  1IVX A;  1VQ5 3;  3CCE 3;  4N6L A;  3NX0 A;  5ELU A;  1D6Y A;  1GY7 A;  2HML B;  1KSI A;  3CMA 3;  5D81 A;  1A2K A;  1JKG A;  2Z76 A;  1ULJ B;  5CK6 A;  4J9A A;  4ORL A;  3CCS 3;  2L4V A;  4XBX A;  1MNL A;  1RRH A;  1FGO A;  2KXG A;  5IG0 A;  3KZT A;  4X2O A;  4O2H A;  1IVU A;  3DM8 A;  3NBR A;  1D6Z A;  3L0R A;  2Y74 A;  3T8N A;  1SPU A;  1O7N B;  2W03 A;  3S28 A;  4EC6 A;  3KKG A;  3PCR A;  3PCS A;  3UNL A;  4XBT A;  1JRQ A;  4ZM8 A;  1K9M 4;  1U8C B;  3LYG A;  3VSY A;  3GZR A;  3STD A;  3OWY A;  2OQE A;  3KN4 A;  3KSP A;  3CPW 2;  3OV4 A;  1A90 A;  3X42 A;  3FF0 A;  2Q07 A;  4JF8 A;  3NQZ A;  1IV7 A;  3LXU X;  1IT8 A;  1E3R A;  1IVW A;  2GEY A;  5LC6 A;  7STD A;  1KD1 4;  5FW5 A;  4HM5 B;  2XRX B;  3CCJ 3;  3PYJ A;  5LC7 A;  2QGU A;  5JPP A;  5AEU B;  2P09 A;  4H61 A;  1QAL A;  3LOY A;  4XM4 A;  3I0Y A;  2BO9 B;  3IJE B;  2ML6 A;  1AR0 A;  4G1M B;  1TUH A;  2HMJ B;  2W2C A;  3U1W A;  1F8N A;  1TIJ A;  3LTC A;  2HMN B;  3U97 A;  4KVH A;  5D82 A;  3N54 B;  3DGO A;  2ZL8 A;  3B7C A;  1HKX A;  2BNG A;  2FNQ A;  1OHO A;  1Q40 B;  4HZB B;  4FCJ A;  4JRF A;  1IT7 A;  5CLK A;  2JQ5 A;  1VQ9 3;  1Y4K A;  2WGQ A;  1DMN A;  2B1X B;  5IG4 A;  3CU3 A;  3KFQ C;  3G4S 3;  1ROV A;  3B4O A;  5BXQ A;  2YFI B;  3CCR 3;  1C7H A;  4GL6 A;  1YIT 3;  1O7H B;  3F8X A;  1JV2 B;  2UX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...