4MJDA

Crystal structure of ketosteroid isomerase fold protein hmuk_0747
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
SNAMDRVATARAYYRALDEHDYDLLSDVLAPDFVHDRPDRTIEGRERFVRFMREERPQTDTSHPIATIYTGASTVAVEGRLLNSDGAEITQFVDVFAFEDGVIGRIRTHTPEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Ketosteroid isomerase fold protein Hmuk_0747
publication title Crystal structure of ketosteroid isomerase fold protein Hmuk_0747
rcsb
source organism Halomicrobium mukohataei
total genus 31
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4mjdA00
3MG1A 3CNXA 1ISKA 4FCMA 3DUKA 4HM7B 4XBXA 1IDPA 2HMLB 1ZX2A 4R9LA 5AEWB 4HZBB 5IEPA 3VGNA 1JB2A 2R4IA 3F9SA 5AEUB 3CU3A 4L8PA 3F8HA 3HK4A 1OPYA 4HJLB 5CK6A 1NU3A 1UUWB 1Q40B 2INXA 2OWPA 5TGNA 2XR8B 3SEDA 5IG4A 2BNGA 4K1VA 3RGAA 3HZPA 2UX0A 3OWYA 4KVHA 1GY5A 4H3UA 2HMKB 3VSYA 3IPTA 4HM5B 1ULIB 4HM6B 3EBYA 2HMOB 6STDA 3NM2A 5IG3A 3OX9A 3F14A 2GEYA 3UNLA 4J8TA 4FCJA 1OHSA 3MHEA 2STDA 3DXOA 4XB5A 1E97A 3A76A 1STDA 4XBTA 1W01A 5AI1A 5JPUA 2K54A 5IENA 4X2HA 5DRVA 3JUOA 5CXOA 3ROBA 1A2KA 3JUMA 2GBXB 5CLKA 3M8CA 1WQLB 3FH1A 1O7GB 5AIIA 1O7NB 8CHOA 5EVHA 3OXAA 2RCDA 4HKVB 3T8NA 1O7MB 3Q90A 3I0YA 2GBWB 4J9AA 3JUNA 3NHXA 1AR0A 1DMMA 3S5CA 1JKGA 1ULJB 3GZXB 1BUQA 4XDWA 1NWWA 2GEXA 1C7HA 3OWSA 1O7PB 3EX9A 3B4OA 4OVMA 2CKFB 2XRXB 1O7HB 1OUNA 3KSPA 1OGXA 3K7CA 5IERA 3JUQA 4LGQA 3EQQB 3F7XA 5JPPA 5STDA 4WYKA 1S5AA 1JKGB 2YFLB 5DREA 2BMQB 5AIHA 1Z1SA 3T8UA 1TUHA 3GZRA 3NBRA 3ECFA 1W6YA 3FGYA 4R9KA 3MG2A 2Z76A 3K0ZA 3MYTA 2GXFA 3GZBA 1TP6A 1JB4A 4K1UA 4XBYA 4PEJA 1ZO2A 1SJWA 3GZYB 1JN5A 2W2CA 5AIFA 1QMAA 4I4KA 5CF2A 3FF2A 4WYKB 3H3HA 1GYBA 3OWUA 1O7WB 4HM8B 3GWRA 5IF6A 7STDA 4XM4A 5KP4A 2CHCA 2XSHB 3DM8A 1NDOB 2RFRA 4GB5A 3SOYA 5KP3A 1OF5A 1OCVA 3F8XA 1JN5B 1OH0A 4HM4B 2Z77A 4MJDA 5D81A 4RZMA 1UUVB 3ER7A 1E3RA 3MKIA 2XSOB 2B1XB 3FSDA 3HX8A 3EBTA 3OV4A 4N3VA 4HM3B 3DMCA 3CPOA 1OHPA 3G0KA 2IMJA 1CQSA 3BLZA 2F86B 3EC9A 3RGRA 2HMNB 3B4PA 3FZWA 1W02A 1GY6A 5D82A 4Q53A 4XDVA 1K41A 3NUVA 3STDA 1OF5B 1VZZA 3GRDA 4R1KA 2YFIB 3G8ZA 2QGUA 5D83A 5AIGA 3KE7A 2JQ5A 1EG9B 2PZVA 3EF8A 4ORLA 4WP5A 1HKXA 1DMNA 1DMQA 1Q42A 5G2GA 3LZAA 4HVNA 2QIYA 3NV0A 1OGZA 2HMJB 5FW5A 3WMDA 3NXJA 5BXQA 3G16A 3SOAA 4L7KA 2YFJB 3EHCA 4STDA 4CDLA 4WWUC 1QJGA 2F99A 3F7SA 3DZLA 4LEHA 4HM1B 3LYGA 1GY7A 3JUPA 4L8OA 3KZTA 4OUQA 1OHOA 3UJMA 3NV0B 1ASKA 3KKGA 2BMRB 3FLJA 2A15A 3EN8A 4HM2B 5KP1A 4HM0B 2HMMB 4IIAA 3B7CA 3MSOA 3EJVA 3MG3A 2Z7AA 3CNMA 5HGRA 1U5OA 2I9WA 3E99A 5IEOA 3B8LA 3EN1B 5BVBA 4U13A 1JB5A 2F98A 5CF1A 1EA2A 3D9RA 2BMOB 3F40A 4LMIA 4HZ9B 1W00A 1GS3A 3FF0A 3H51A 5IG5A 3BB9A 1E3VA 1Q40A 2RGQA 2B24B 4X2OA 3FKAA 5IG0A
chains in the Genus database with same CATH superfamily
1RRLA 3MG1A 3CNXA 1N9JA 3AMOA 1RGLA 4WHAA 4BU4A 1ISKA 4HOHA 4FCMA 3DUKA 2O3OA 7GSPA 4HM7B 4XBXA 1RGCA 1IDPA 2HMLB 1ZX2A 2AAEA 5RNTA 4R9LA 5AEWB 2XF3A 3JVCA 3K9MC 4HZBB 5IEPA 2BIRA 1I3IA 1RGFA 2KF3A 2W56B 2K3DA 1IVWA 3QK9A 1VQ73 8RNTA 4K61A 1UI7A 1Q7Y4 1LXEA 3VGNA 1BNGA 4EC6A 1JB2A 3LT9A 1WTHA 4HAAA 2R4IA 3T0UA 3WHOA 4K90B 3F9SA 4FMAA 1R4CA 5AEUB 4FCZA 3CU3A 4L8PA 1YHQ3 3LMLA 1QAKA 2RSXA 1N8R4 1BGSA 2J8XB 1SPUA 7RNTA 1A90A 2ZHXB 3F8HA 3HK4A 1OPYA 4HJLB 1YJ93 5CK6A 1FGQA 1NU3A 1M9GA 1UUWB 1HZ1A 1Q40B 2GSPA 2INXA 2OWPA 1B2MA 5ELUA 5TGNA 2XR8B 3SEDA 2XEPA 1FGOA 1IQYA 3FG3A 5IG4A 2BNGA 4K1VA 1LOWA 3AGNA 3AMOB 3RGAA 2IUKA 3HZPA 2P05A 2O9UX 1B2XA 2UX0A 1GSPA 4AEQA 1GMRA 1SQWA 3A5EA 1FYSA 1AY7A 1TRQA 3OWYA 4KVHA 1GY5A 1IU7A 4OK0A 2CIUA 4H3UA 2W9QA 3WOFB 2HMKB 1RGAA 3IPTA 3VSYA 4HM5B 1ULIB 4HM6B 3EBYA 2HMOB 1IVVA 1VQP3 3ALAA 3BU4A 5M19A 3CCJ3 6STDA 1IVUA 3NM2A 1K28A 3OX9A 5IG3A 1NO3A 1V57A 3F14A 2GEYA 3EE1A 3UNLA 4J8TA 4FCJA 1RCKA 1OHSA 3MHEA 1LOXA 2STDA 3DXOA 3D3LA 3D4AA 4IT7A 1RTUA 3CCR3 4XB5A 1FW7A 2SBLA 2W0QA 1E97A 4GHOA 1US1A 4BIRA 2CFDA 3HOHA 4HBRA 3A76A 1RSNA 1STDA 3O8YA 2ZA4A 4N6UA 4XBTA 1EEJA 1UGIA 1W01A 1YNVX 2H0GA 4ILFA 5AI1A 4EBGA 5JPUA 2K54A 3DGYA 2CWUA 2W04A 5IENA 3LTDA 4X2HA 5DRVA 1G02A 4EV2A 1TIJA 3DH2A 1LOYA 3JUOA 2OQEA 3EB8A 3CC73 5CXOA 1UCKA 4NREA 1MGWA 1YVBI 1UCJA 3ROBA 1LQGC 2CFWA 1I0XA 1I2EA 2W9PA 1SIIA 4N6NB 4R4KA 3S67A 1A2KA 3JUMA 1Y4KA 1LOVA 3RNTA 2GBXB 1NJI4 5CLKA 1RKYA 3M8CA 1PU4A 1YJN3 1CYVA 2UGIA 1WQLB 1TU5A 3J7Yd 3WA2X 1JRQA 2C4BA 3FH1A 2C10A 1JBSA 1O7GB 1O7NB 5AIIA 1W6CA 5A0OB 8CHOA 3ZG5A 1T3BA 5EVHA 4BL2A 3OXAA 1N8QA 5FGOA 1QAFA 2RCDA 1SIHA 4HKVB 3T8NA 1GD4A 4FMBA 1O7MB 3Q90A 1DVCA 1LVNA 3I0YA 1VQL3 1JBRA 2GBWB 4J9AA 2RBIA 2BT3A 2CC3A 3JUNA 3NHXA 1S723 9RNTA 3CCS3 1AR0A 3K63A 2E2UA 3LOYA 1DMMA 3S5CA 3CXC2 1BNSA 3TDGA 1QVG2 1JKGA 4N6LA 1AQZA 4G1MB 1ULJB 1BNRA 3GZXB 1BUQA 1IT8A 4XDWA 2CX0A 3SXXA 4KZ1A 3NBBA 1NWWA 1STFI 2GEXA 3X40A 1C7HA 3OWSA 1O7PB 3UL6A 2LQVA 3KCHA 3BNCA 3B4OA 3EX9A 1JV2B 4OVMA 1UW1A 1RNTA 2CKFB 3VF1A 1C54A 1MWTA 3CCQ3 2YX9A 4NPBA 4RBNA 1BSBA 2CG0A 1M1XB 1TRPA 2XRXB 2C11A 5I97A 3CCU3 1O7HB 1V74A 1FGRA 3S27A 1AVLA 4MMXB 4N6TA 1RNBA 1BOXA 1OUNA 3BNEA 2CH9A 5LC6A 1YIT3 2L4VA 1K8A4 1BRJA 2W6JH 1TTOA 3BNDA 3V98A 1DE3A 2QEX3 1RGEA 3KSPA 1BRHA 1GOVA 1OGXA 2OCTA 4X2OA 3S29A 3AGOA 1A67A 2OOVC 3K7CA 1I8VA 2F4YA 5IERA 4NHFA 1J2BA 3JUQA 3AHSA 1X1WA 3EQQB 3F7XA 4LGQA 2H0HA 4N6MA 5JPPA 1WMPA 3X3ZA 1VQK3 1ZGXA 1X1XA 5STDA 2CG1A 1VQM3 4WYKA 1S5AA 1JKGB 1FA3A 4CJNA 6GSPA 2YFLB 3PCRA 1RRHA 3I563 3FG4A 4IPBA 3BIRA 5DREA 2BMQB 2UUGC 3X42A 1YJW3 1AVKA 5AIHA 1RCLA 1VQQA 1I0VA 1Z1SA 1KC84 2KF5A 3SYUA 3T8UA 3G4S3 1TUHA 1VQ63 3GZRA 3NBRA 4N6OB 4R80A 4O3VA 3ECFA 1IV9A 1W6YA 3FGYA 4R9KA 5AYRB 1YGEA 1FUTA 3U1WA 3CC43 3MG2A 1RN7A 2Z76A 3K0ZA 4AKZA 1W4NA 4KFEA 3MYTA 2GXFA 3N9HA 3GZBA 2P09A 2D42A 2FGTA 1TP6A 1JB4A 4K1UA 4XBYA 1QALA 1VQ83 4PEJA 1ZO2A 1DETA 1NNVA 1VQN3 1JBTA 1Q9EA 1N5HA 1OACA 1SJWA 1LNHA 1MNLA 2R41A 4J5GA 3GZYB 3WDGB 1RN1A 1RHLA 2D1WA 1JN5A 4HYZA 4AKYA 1VQ93 1EQKA 1A2VA 1M1K4 2W2CA 5AIFA 1QMAA 4I4KA 1BNJA 1B3SA 3D79A 3FCSB 1KD14 2L1SA 4QWTA 1GOYA 1EUIC 3SX1A 1CEWI 1VQ53 1IYYA 1K9M4 3CMA3 5CF2A 1UCIA 3IJEB 5AYSC 3FF2A 4WYKB 5M1AA 1MOLA 1BSEA 1W7CA 3LH4A 1NB3I 3H3HA 5LC7A 1GYBA 3OWUA 1KWIA 1O7WB 4HM8B 3GWRA 3CCL3 1X1YA 3HIGA 4BTYA 5IF6A 4BTXA 3ZG0A 7STDA 3L0RA 1W5ZA 4XM4A 1I2FA 5KP4A 3S28A 3G713 2QA43 3GSPA 4KFDA 2CHCA 2KF4A 1GD3A 2Q07A 1JZDA 2BHMA 1W2B2 3Q1CA 4BL3A 2WO0A 2XSHB 2IY2A 3DM8A 3SLUA 2CX1A 1TJDA 2ZL8A 3LTAA 3PS8A 1NDOB 2RFRA 4GB5A 4ZM8A 3SOYA 1D6ZA 3NBJA 1R4YA 3UL5A 2M7OA 5KP3A 1IV7A 1OF5A 1OCVA 3CC23 1KSIA 3F8XA 1Q7HA 2ML5A 3X3YA 1JN5B 1OH0A 4HM4B 2Z77A 4MJDA 5D81A 5JBSA 1BSDA 1DVDA 2XFSA 3PXMA 2XGNA 1W6GA 2GU3A 4RZMA 3V92A 3NM7A 3U97A 2OTL3 1UUVB 1UCLA 3ER7A 1Q864 1E3RA 3MKIA 1TFOA 2XSOB 1B27A 4I5QA 3I553 3K5TA 1B2UA 2B1XB 4O8SA 1B2SA 2E2VA 1EKMA 3FSDA 4TX4A 3HX8A 1MWUA 3CD63 2BO9B 3EBTA 3OV4A 4N3VA 4HM3B 3DMCA 3CPOA 3PGBA 4JRFA 1OHPA 3G0KA 2F5WA 2IMJA 3CCE3 2P0MA 2WOHA 3HIIA 2OQEC 1CQSA 3BLZA 2F86B 5GSPA 3X3XA 3EC9A 3RGRA 2P38A 2HMNB 3N54B 4FMCA 3B4PA 5BU4A 3FZWA 1W02A 4CCVA 2PNCA 1GY6A 3DGMA 1I3FA 1WMOA 4KT3B 1YIJ3 3D5GA 5D82A 2WOFA 4Q53A 1U8CB 4XDVA 4LZIA 1I70A 1K41A 3KN4A 1WNHA 3NUVA 3STDA 1OF5B 3X41A 2V1LA 3DGLA 1VZZA 1K734 4JF8A 3GRDA 4R1KA 4FMDA 1AV4A 2YFIB 3G8ZA 2SARA 3KIIA 2QGUA 3QRDA 5AIGA 5D83A 2IUJA 2Y73A 2ZDJA 4RNTA 3CME3 5EEOA 3KE7A 1G0TA 2JQ5A 1EG9B 2CFLA 2PZVA 1ROVA 3KSED 3G6E3 3EF8A 4ORLA 1A2PA 4MMYB 1BRKA 3UB1A 1NB5I 4WP5A 1HKXA 1LRAA 3HI7A 1DMNA 4H61A 2E2TA 1D6YA 1DMQA 1IQ8A 1Q42A 2Z6BA 1Q814 2OTJ3 1RMSA 1M904 3IMAB 5G2GA 3LZAA 2CFGA 4HVNA 2QIYA 2HOHA 2LYXA 3NV0A 1OGZA 2XFTA 3MWZA 1L5GB 2HMJB 5FW5A 3WOEB 3WMDA 1N9EA 5G1KA 4KFFA 3BNBA 3NXJA 1IK3A 3PYJA 1RJOA 1X1UA 2K0MA 3NQYA 5BXQA 3G16A 1DYUA 4L7KA 3SOAA 2Y74A 1FUSA 1JZOA 2KRTA 1PYLA 4CPKA 1G96A 1BVIA 2YFJB 3DGOA 4GSPA 4RNZA 1KQS2 3EHCA 4STDA 3LT8A 1IT7A 1MWRA 2CFKA 2FXTA 3GAXA 3KFQC 4EYCA 1T2HA 2IA7A 3OW22 1CYUA 4CDLA 1VQ43 1UDII 2KF6A 4WWUC 3CCV3 1BSCA 4LYLB 2CW9A 1FGTA 1QJGA 1CH0A 3NQZA 4J5KA 2F99A 3DY5A 2F56A 2ML6A 3F7SA 2W03A 3DZLA 1FUWA 3MPHA 1RGGA 4EW5A 2IYJA 1BRIA 1RLSA 4LEHA 4HM1B 1QVF2 3SVAA 1RN4A 4RNYA 3LYGA 1GY7A 4EV5A 3JUPA 5G1LA 1BRNL 1B2ZA 2MC8A 2RNTA 4L8OA 3URPA 4N6V0 3D5IA 4MMZB 3KZTA 4OUQA 1OHOA 1B20A 3UJMA 3NV0B 1ASKA 1TFKA 2WGOA 3KKGA 5EQLA 1BSAA 1BNIA 3WA3A 1W2ZA 3DGNA 2BMRB 3LTBA 1BRGA 3FLJA 4O2HA 2A15A 4O02B 1MWSA 2KCDA 2AADA 1UGHI 1FZUA 2CWVA 1BNFA 1MGRA 1PFPA 3EN8A 4HM2B 4GL6A 1JNQA 1ZS7A 1HYFA 5KP1A 2KXGA 1BUJA 4HM0B 1BRSA 3ZFZA 2HMMB 1LQMB 4IIAA 2XGLA 2CK3H 3PCSA 1YI23 2P0XA 3B7CA 5ELJA 5IW9A 1WMNA 3MSOA 3Q3FA 2XH9A 3LXUX 3PZWA 2MF7A 2GU1A 2FNQA 3EJVA 3MG3A 2BU4A 1D6UA 1UI8A 3LTCA 2Z7AA 1BIRA 3WR2A 6RNTA 4FR9A 3CNMA 1PY3A 3Q2PA 5HGRA 1RGKA 1B21A 1U5OA 2I9WA 1N5PA 1GMQA 1RDSA 3E99A 2F5MA 3AHWA 5BIRA 5HOHA 5IEOA 3B8LA 1T5YA 3EN1B 3WODG 2W56A 1FGMA 2H0IA 4LSOA 4EXRA 5BVBA 1BANA 4U13A 1JB5A 1IVXA 2F98A 2JDIH 2OOVA 1I2GA 4BTWA 5CF1A 1EA2A 1UUGB 1JJ22 3D9RA 3V99A 4MEIA 3CCM3 1BU4A 2BMOB 1ROAA 1VQO3 1SARA 1GOUA 1GMPA 3F40A 4LMIA 4HZ9B 1IQXA 2CWTA 4WFOA 2KAAA 3RDEA 1W00A 1LNIA 3NX0A 1GS3A 1BAOA 3N8BA 3FF0A 1BNEA 1V58A 2WGQA 3H51A 5IG5A 3BB9A 5M18A 1E3VA 1HU9A 1RGHA 1Q824 1Q40A 1T2IA 2RGQA 3FG1A 1F8NA 1YGWA 2B24B 4DKIA 1YVSA 3FKAA 3CPW2 5IG0A
chains in the Genus database with same CATH topology
1RRLA 3MG1A 3CNXA 1N9JA 3AMOA 4WHAA 1ISKA 4FCMA 3DUKA 2O3OA 4HM7B 4XBXA 1IDPA 2HMLB 1ZX2A 4R9LA 5AEWB 2XF3A 3JVCA 3K9MC 4HZBB 5IEPA 2W56B 1IVWA 3QK9A 1VQ73 4K61A 1UI7A 1Q7Y4 1LXEA 3VGNA 4EC6A 1JB2A 3LT9A 1WTHA 2R4IA 3T0UA 4K90B 3F9SA 4FMAA 1R4CA 5AEUB 4FCZA 3CU3A 4L8PA 1YHQ3 3LMLA 1QAKA 2RSXA 1N8R4 1SPUA 1A90A 3F8HA 3HK4A 1OPYA 4HJLB 1YJ93 5CK6A 1FGQA 1NU3A 1M9GA 1UUWB 1Q40B 2INXA 2OWPA 5ELUA 5TGNA 2XR8B 3SEDA 2XEPA 1FGOA 1IQYA 3FG3A 5IG4A 2BNGA 4K1VA 3AMOB 3RGAA 2IUKA 3HZPA 2P05A 2O9UX 2UX0A 4AEQA 1SQWA 3OWYA 4KVHA 1GY5A 1IU7A 4OK0A 2CIUA 4H3UA 2W9QA 3WOFB 2HMKB 3VSYA 3IPTA 4HM5B 1ULIB 4HM6B 3EBYA 2HMOB 1IVVA 1VQP3 3ALAA 3CCJ3 6STDA 1IVUA 3NM2A 1K28A 3OX9A 5IG3A 1NO3A 3F14A 2GEYA 3EE1A 3UNLA 4J8TA 4FCJA 1OHSA 3MHEA 1LOXA 2STDA 3DXOA 3D3LA 4IT7A 3CCR3 4XB5A 2SBLA 2W0QA 1E97A 1US1A 2CFDA 4HBRA 3A76A 1STDA 3O8YA 4N6UA 4XBTA 1W01A 5AI1A 4EBGA 5JPUA 2K54A 2CWUA 2W04A 5IENA 3LTDA 4X2HA 5DRVA 4EV2A 1TIJA 3JUOA 2OQEA 3EB8A 3CC73 5CXOA 4NREA 1YVBI 3ROBA 2CFWA 2W9PA 3S67A 1SIIA 4N6NB 4R4KA 1A2KA 3JUMA 1Y4KA 1NJI4 2GBXB 5CLKA 1RKYA 3M8CA 1PU4A 1YJN3 1CYVA 1WQLB 1TU5A 3J7Yd 3WA2X 1JRQA 3FH1A 2C10A 1O7GB 1O7NB 5AIIA 1W6CA 5A0OB 8CHOA 5EVHA 3OXAA 1N8QA 5FGOA 1QAFA 2RCDA 1SIHA 4HKVB 3T8NA 1GD4A 4FMBA 1O7MB 3Q90A 1DVCA 1LVNA 3I0YA 1VQL3 2GBWB 4J9AA 1S723 2BT3A 2CC3A 3JUNA 3NHXA 3CCS3 1AR0A 3K63A 2E2UA 3LOYA 1DMMA 3S5CA 3CXC2 3TDGA 1QVG2 1JKGA 4N6LA 4G1MB 1ULJB 3GZXB 1BUQA 1IT8A 4XDWA 3SXXA 4KZ1A 3NBBA 1NWWA 1STFI 2GEXA 3X40A 1C7HA 3OWSA 1O7PB 3UL6A 2LQVA 3BNCA 3B4OA 3EX9A 1JV2B 4OVMA 1UW1A 2CKFB 3VF1A 3CCQ3 2YX9A 4RBNA 2CG0A 1M1XB 2XRXB 2C11A 5I97A 3CCU3 1O7HB 1V74A 1FGRA 3S27A 1AVLA 4MMXB 4N6TA 1OUNA 3BNEA 2CH9A 5LC6A 1YIT3 2L4VA 1K8A4 3BNDA 2W6JH 3V98A 2QEX3 3KSPA 1OGXA 2OCTA 3S29A 1A67A 2OOVC 3K7CA 5IERA 4NHFA 1J2BA 3JUQA 4LGQA 3EQQB 3F7XA 4N6MA 5JPPA 1WMPA 3X3ZA 1VQK3 5STDA 2CG1A 1VQM3 4WYKA 1S5AA 1JKGB 1FA3A 2YFLB 3PCRA 1RRHA 3I563 3FG4A 4IPBA 5DREA 2BMQB 3X42A 1YJW3 1AVKA 5AIHA 1Z1SA 1KC84 3T8UA 3G4S3 1TUHA 1VQ63 3GZRA 3NBRA 4N6OB 4R80A 4O3VA 3ECFA 1IV9A 1W6YA 3FGYA 4R9KA 5AYRB 1YGEA 3U1WA 3CC43 3MG2A 1RN7A 2Z76A 3K0ZA 4AKZA 1W4NA 4KFEA 3MYTA 2GXFA 3N9HA 3GZBA 2P09A 2D42A 2FGTA 1TP6A 1JB4A 4K1UA 4XBYA 1QALA 1VQ83 4PEJA 1ZO2A 1VQN3 1N5HA 1OACA 1SJWA 1LNHA 1MNLA 3GZYB 3WDGB 2D1WA 4AKYA 1JN5A 4HYZA 1VQ93 1EQKA 1A2VA 1M1K4 2W2CA 5AIFA 1QMAA 4I4KA 3FCSB 1KD14 4QWTA 3SX1A 1CEWI 1VQ53 1K9M4 3CMA3 5CF2A 3IJEB 5AYSC 3FF2A 4WYKB 1MOLA 1W7CA 3LH4A 1NB3I 3H3HA 5LC7A 1GYBA 3OWUA 1KWIA 1O7WB 4HM8B 3GWRA 3CCL3 3HIGA 4BTYA 5IF6A 4BTXA 7STDA 3L0RA 1W5ZA 4XM4A 5KP4A 3S28A 3G713 2QA43 4KFDA 2CHCA 2Q07A 1GD3A 1W2B2 2BHMA 3Q1CA 2WO0A 2XSHB 3DM8A 3SLUA 2ZL8A 3LTAA 3PS8A 1NDOB 2RFRA 4GB5A 4ZM8A 3SOYA 1D6ZA 3NBJA 3UL5A 2M7OA 5KP3A 1IV7A 1OF5A 1OCVA 3CC23 1KSIA 3F8XA 2ML5A 3X3YA 1JN5B 1OH0A 4HM4B 2Z77A 4MJDA 5D81A 5JBSA 1DVDA 2XFSA 3PXMA 2XGNA 1W6GA 2GU3A 4RZMA 3V92A 3NM7A 3U97A 2OTL3 1UUVB 3ER7A 1Q864 1E3RA 3MKIA 1TFOA 2XSOB 3I553 3K5TA 2B1XB 4O8SA 2E2VA 1EKMA 3FSDA 4TX4A 3HX8A 3CD63 2BO9B 3EBTA 3OV4A 4N3VA 4HM3B 3DMCA 3CPOA 3PGBA 4JRFA 1OHPA 3G0KA 2IMJA 3CCE3 2P0MA 2WOHA 3HIIA 2OQEC 1CQSA 3BLZA 2F86B 3X3XA 3EC9A 3RGRA 2P38A 2HMNB 3N54B 4FMCA 3B4PA 3FZWA 1W02A 4CCVA 2PNCA 1GY6A 3DGMA 1WMOA 1YIJ3 5D82A 2WOFA 4Q53A 1U8CB 4XDVA 4LZIA 1K41A 3KN4A 1WNHA 3NUVA 3STDA 1OF5B 3X41A 2V1LA 3DGLA 1VZZA 1K734 4JF8A 3GRDA 4R1KA 4FMDA 1AV4A 2YFIB 3G8ZA 3KIIA 3QRDA 2QGUA 5D83A 5AIGA 2IUJA 2Y73A 2ZDJA 3CME3 5EEOA 3KE7A 2JQ5A 1EG9B 2CFLA 2PZVA 1ROVA 3KSED 3G6E3 3EF8A 4ORLA 4MMYB 3UB1A 1NB5I 4WP5A 1HKXA 3HI7A 4H61A 1DMNA 2E2TA 1D6YA 1DMQA 1IQ8A 1Q42A 2Z6BA 1Q814 2OTJ3 1M904 3IMAB 5G2GA 3LZAA 2CFGA 4HVNA 2QIYA 3NV0A 2LYXA 1OGZA 2XFTA 3MWZA 1L5GB 2HMJB 5FW5A 3WOEB 3WMDA 1N9EA 4KFFA 3BNBA 3NXJA 1IK3A 3PYJA 1RJOA 2K0MA 3NQYA 5BXQA 3G16A 1DYUA 4L7KA 3SOAA 2Y74A 2KRTA 1G96A 3DGOA 2YFJB 4RNZA 1KQS2 3EHCA 4STDA 3LT8A 1IT7A 2CFKA 2FXTA 3GAXA 3KFQC 4EYCA 2IA7A 3OW22 1CYUA 4CDLA 1VQ43 4WWUC 3CCV3 2CW9A 1FGTA 1QJGA 3NQZA 2F99A 3DY5A 2ML6A 3F7SA 2W03A 3DZLA 1FUWA 3MPHA 4LEHA 4HM1B 1QVF2 3SVAA 4RNYA 3LYGA 1GY7A 4EV5A 3JUPA 2MC8A 4L8OA 4N6V0 4MMZB 3KZTA 4OUQA 1OHOA 3UJMA 3NV0B 1ASKA 1TFKA 2WGOA 3KKGA 5EQLA 3WA3A 1W2ZA 3DGNA 2BMRB 3LTBA 3FLJA 4O2HA 2A15A 4O02B 2KCDA 3EN8A 2CWVA 1PFPA 4HM2B 4GL6A 1JNQA 5KP1A 2KXGA 4HM0B 2HMMB 4IIAA 2XGLA 2CK3H 3PCSA 1YI23 2P0XA 3B7CA 5ELJA 5IW9A 1WMNA 3MSOA 3PZWA 2XH9A 3LXUX 2MF7A 2GU1A 2FNQA 3EJVA 3MG3A 1D6UA 1UI8A 3LTCA 2Z7AA 4FR9A 3CNMA 3Q2PA 5HGRA 1U5OA 2I9WA 1N5PA 3E99A 5IEOA 3B8LA 1T5YA 3EN1B 3WODG 2W56A 1FGMA 5BVBA 4LSOA 4EXRA 4U13A 1JB5A 1IVXA 2F98A 2JDIH 2OOVA 4BTWA 5CF1A 1EA2A 1JJ22 3D9RA 3V99A 4MEIA 3CCM3 1VQO3 2BMOB 1ROAA 3F40A 4LMIA 4HZ9B 1IQXA 2CWTA 4WFOA 3RDEA 1W00A 3NX0A 1GS3A 3N8BA 3FF0A 2WGQA 3H51A 5IG5A 3BB9A 1E3VA 1HU9A 1Q824 1Q40A 2RGQA 3FG1A 1F8NA 2B24B 4X2OA 3FKAA 3CPW2 5IG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG1 A;  3CNX A;  1ISK A;  4FCM A;  3DUK A;  4HM7 B;  4XBX A;  1IDP A;  2HML B;  1ZX2 A;  4R9L A;  5AEW B;  4HZB B;  5IEP A;  3VGN A;  1JB2 A;  2R4I A;  3F9S A;  5AEU B;  3CU3 A;  4L8P A;  3F8H A;  3HK4 A;  1OPY A;  4HJL B;  5CK6 A;  1NU3 A;  1UUW B;  1Q40 B;  2INX A;  2OWP A;  5TGN A;  2XR8 B;  3SED A;  5IG4 A;  2BNG A;  4K1V A;  3RGA A;  3HZP A;  2UX0 A;  3OWY A;  4KVH A;  1GY5 A;  4H3U A;  2HMK B;  3VSY A;  3IPT A;  4HM5 B;  1ULI B;  4HM6 B;  3EBY A;  2HMO B;  6STD A;  3NM2 A;  5IG3 A;  3OX9 A;  3F14 A;  2GEY A;  3UNL A;  4J8T A;  4FCJ A;  1OHS A;  3MHE A;  2STD A;  3DXO A;  4XB5 A;  1E97 A;  3A76 A;  1STD A;  4XBT A;  1W01 A;  5AI1 A;  5JPU A;  2K54 A;  5IEN A;  4X2H A;  5DRV A;  3JUO A;  5CXO A;  3ROB A;  1A2K A;  3JUM A;  2GBX B;  5CLK A;  3M8C A;  1WQL B;  3FH1 A;  1O7G B;  5AII A;  1O7N B;  8CHO A;  5EVH A;  3OXA A;  2RCD A;  4HKV B;  3T8N A;  1O7M B;  3Q90 A;  3I0Y A;  2GBW B;  4J9A A;  3JUN A;  3NHX A;  1AR0 A;  1DMM A;  3S5C A;  1JKG A;  1ULJ B;  3GZX B;  1BUQ A;  4XDW A;  1NWW A;  2GEX A;  1C7H A;  3OWS A;  1O7P B;  3EX9 A;  3B4O A;  4OVM A;  2CKF B;  2XRX B;  1O7H B;  1OUN A;  3KSP A;  1OGX A;  3K7C A;  5IER A;  3JUQ A;  4LGQ A;  3EQQ B;  3F7X A;  5JPP A;  5STD A;  4WYK A;  1S5A A;  1JKG B;  2YFL B;  5DRE A;  2BMQ B;  5AIH A;  1Z1S A;  3T8U A;  1TUH A;  3GZR A;  3NBR A;  3ECF A;  1W6Y A;  3FGY A;  4R9K A;  3MG2 A;  2Z76 A;  3K0Z A;  3MYT A;  2GXF A;  3GZB A;  1TP6 A;  1JB4 A;  4K1U A;  4XBY A;  4PEJ A;  1ZO2 A;  1SJW A;  3GZY B;  1JN5 A;  2W2C A;  5AIF A;  1QMA A;  4I4K A;  5CF2 A;  3FF2 A;  4WYK B;  3H3H A;  1GYB A;  3OWU A;  1O7W B;  4HM8 B;  3GWR A;  5IF6 A;  7STD A;  4XM4 A;  5KP4 A;  2CHC A;  2XSH B;  3DM8 A;  1NDO B;  2RFR A;  4GB5 A;  3SOY A;  5KP3 A;  1OF5 A;  1OCV A;  3F8X A;  1JN5 B;  1OH0 A;  4HM4 B;  2Z77 A;  4MJD A;  5D81 A;  4RZM A;  1UUV B;  3ER7 A;  1E3R A;  3MKI A;  2XSO B;  2B1X B;  3FSD A;  3HX8 A;  3EBT A;  3OV4 A;  4N3V A;  4HM3 B;  3DMC A;  3CPO A;  1OHP A;  3G0K A;  2IMJ A;  1CQS A;  3BLZ A;  2F86 B;  3EC9 A;  3RGR A;  2HMN B;  3B4P A;  3FZW A;  1W02 A;  1GY6 A;  5D82 A;  4Q53 A;  4XDV A;  1K41 A;  3NUV A;  3STD A;  1OF5 B;  1VZZ A;  3GRD A;  4R1K A;  2YFI B;  3G8Z A;  2QGU A;  5D83 A;  5AIG A;  3KE7 A;  2JQ5 A;  1EG9 B;  2PZV A;  3EF8 A;  4ORL A;  4WP5 A;  1HKX A;  1DMN A;  1DMQ A;  1Q42 A;  5G2G A;  3LZA A;  4HVN A;  2QIY A;  3NV0 A;  1OGZ A;  2HMJ B;  5FW5 A;  3WMD A;  3NXJ A;  5BXQ A;  3G16 A;  3SOA A;  4L7K A;  2YFJ B;  3EHC A;  4STD A;  4CDL A;  4WWU C;  1QJG A;  2F99 A;  3F7S A;  3DZL A;  4LEH A;  4HM1 B;  3LYG A;  1GY7 A;  3JUP A;  4L8O A;  3KZT A;  4OUQ A;  1OHO A;  3UJM A;  3NV0 B;  1ASK A;  3KKG A;  2BMR B;  3FLJ A;  2A15 A;  3EN8 A;  4HM2 B;  5KP1 A;  4HM0 B;  2HMM B;  4IIA A;  3B7C A;  3MSO A;  3EJV A;  3MG3 A;  2Z7A A;  3CNM A;  5HGR A;  1U5O A;  2I9W A;  3E99 A;  5IEO A;  3B8L A;  3EN1 B;  5BVB A;  4U13 A;  1JB5 A;  2F98 A;  5CF1 A;  1EA2 A;  3D9R A;  2BMO B;  3F40 A;  4LMI A;  4HZ9 B;  1W00 A;  1GS3 A;  3FF0 A;  3H51 A;  5IG5 A;  3BB9 A;  1E3V A;  1Q40 A;  2RGQ A;  2B24 B;  4X2O A;  3FKA A;  5IG0 A; 
#chains in the Genus database with same CATH topology
 1RRL A;  3MG1 A;  3CNX A;  1N9J A;  3AMO A;  1RGL A;  4WHA A;  4BU4 A;  1ISK A;  4HOH A;  4FCM A;  3DUK A;  2O3O A;  7GSP A;  4HM7 B;  4XBX A;  1RGC A;  1IDP A;  2HML B;  1ZX2 A;  2AAE A;  5RNT A;  4R9L A;  5AEW B;  2XF3 A;  3JVC A;  3K9M C;  4HZB B;  5IEP A;  2BIR A;  1I3I A;  1RGF A;  2KF3 A;  2W56 B;  2K3D A;  1IVW A;  3QK9 A;  1VQ7 3;  8RNT A;  4K61 A;  1UI7 A;  1Q7Y 4;  1LXE A;  3VGN A;  1BNG A;  4EC6 A;  1JB2 A;  3LT9 A;  1WTH A;  4HAA A;  2R4I A;  3T0U A;  3WHO A;  4K90 B;  3F9S A;  4FMA A;  1R4C A;  5AEU B;  4FCZ A;  3CU3 A;  4L8P A;  1YHQ 3;  3LML A;  1QAK A;  2RSX A;  1N8R 4;  1BGS A;  2J8X B;  1SPU A;  7RNT A;  1A90 A;  2ZHX B;  3F8H A;  3HK4 A;  1OPY A;  4HJL B;  1YJ9 3;  5CK6 A;  1FGQ A;  1NU3 A;  1M9G A;  1UUW B;  1HZ1 A;  1Q40 B;  2GSP A;  2INX A;  2OWP A;  1B2M A;  5ELU A;  5TGN A;  2XR8 B;  3SED A;  2XEP A;  1FGO A;  1IQY A;  3FG3 A;  5IG4 A;  2BNG A;  4K1V A;  1LOW A;  3AGN A;  3AMO B;  3RGA A;  2IUK A;  3HZP A;  2P05 A;  2O9U X;  1B2X A;  2UX0 A;  1GSP A;  4AEQ A;  1GMR A;  1SQW A;  3A5E A;  1FYS A;  1AY7 A;  1TRQ A;  3OWY A;  4KVH A;  1GY5 A;  1IU7 A;  4OK0 A;  2CIU A;  4H3U A;  2W9Q A;  3WOF B;  2HMK B;  1RGA A;  3IPT A;  3VSY A;  4HM5 B;  1ULI B;  4HM6 B;  3EBY A;  2HMO B;  1IVV A;  1VQP 3;  3ALA A;  3BU4 A;  5M19 A;  3CCJ 3;  6STD A;  1IVU A;  3NM2 A;  1K28 A;  3OX9 A;  5IG3 A;  1NO3 A;  1V57 A;  3F14 A;  2GEY A;  3EE1 A;  3UNL A;  4J8T A;  4FCJ A;  1RCK A;  1OHS A;  3MHE A;  1LOX A;  2STD A;  3DXO A;  3D3L A;  3D4A A;  4IT7 A;  1RTU A;  3CCR 3;  4XB5 A;  1FW7 A;  2SBL A;  2W0Q A;  1E97 A;  4GHO A;  1US1 A;  4BIR A;  2CFD A;  3HOH A;  4HBR A;  3A76 A;  1RSN A;  1STD A;  3O8Y A;  2ZA4 A;  4N6U A;  4XBT A;  1EEJ A;  1UGI A;  1W01 A;  1YNV X;  2H0G A;  4ILF A;  5AI1 A;  4EBG A;  5JPU A;  2K54 A;  3DGY A;  2CWU A;  2W04 A;  5IEN A;  3LTD A;  4X2H A;  5DRV A;  1G02 A;  4EV2 A;  1TIJ A;  3DH2 A;  1LOY A;  3JUO A;  2OQE A;  3EB8 A;  3CC7 3;  5CXO A;  1UCK A;  4NRE A;  1MGW A;  1YVB I;  1UCJ A;  3ROB A;  1LQG C;  2CFW A;  1I0X A;  1I2E A;  2W9P A;  1SII A;  4N6N B;  4R4K A;  3S67 A;  1A2K A;  3JUM A;  1Y4K A;  1LOV A;  3RNT A;  2GBX B;  1NJI 4;  5CLK A;  1RKY A;  3M8C A;  1PU4 A;  1YJN 3;  1CYV A;  2UGI A;  1WQL B;  1TU5 A;  3J7Y d;  3WA2 X;  1JRQ A;  2C4B A;  3FH1 A;  2C10 A;  1JBS A;  1O7G B;  1O7N B;  5AII A;  1W6C A;  5A0O B;  8CHO A;  3ZG5 A;  1T3B A;  5EVH A;  4BL2 A;  3OXA A;  1N8Q A;  5FGO A;  1QAF A;  2RCD A;  1SIH A;  4HKV B;  3T8N A;  1GD4 A;  4FMB A;  1O7M B;  3Q90 A;  1DVC A;  1LVN A;  3I0Y A;  1VQL 3;  1JBR A;  2GBW B;  4J9A A;  2RBI A;  2BT3 A;  2CC3 A;  3JUN A;  3NHX A;  1S72 3;  9RNT A;  3CCS 3;  1AR0 A;  3K63 A;  2E2U A;  3LOY A;  1DMM A;  3S5C A;  3CXC 2;  1BNS A;  3TDG A;  1QVG 2;  1JKG A;  4N6L A;  1AQZ A;  4G1M B;  1ULJ B;  1BNR A;  3GZX B;  1BUQ A;  1IT8 A;  4XDW A;  2CX0 A;  3SXX A;  4KZ1 A;  3NBB A;  1NWW A;  1STF I;  2GEX A;  3X40 A;  1C7H A;  3OWS A;  1O7P B;  3UL6 A;  2LQV A;  3KCH A;  3BNC A;  3B4O A;  3EX9 A;  1JV2 B;  4OVM A;  1UW1 A;  1RNT A;  2CKF B;  3VF1 A;  1C54 A;  1MWT A;  3CCQ 3;  2YX9 A;  4NPB A;  4RBN A;  1BSB A;  2CG0 A;  1M1X B;  1TRP A;  2XRX B;  2C11 A;  5I97 A;  3CCU 3;  1O7H B;  1V74 A;  1FGR A;  3S27 A;  1AVL A;  4MMX B;  4N6T A;  1RNB A;  1BOX A;  1OUN A;  3BNE A;  2CH9 A;  5LC6 A;  1YIT 3;  2L4V A;  1K8A 4;  1BRJ A;  2W6J H;  1TTO A;  3BND A;  3V98 A;  1DE3 A;  2QEX 3;  1RGE A;  3KSP A;  1BRH A;  1GOV A;  1OGX A;  2OCT A;  4X2O A;  3S29 A;  3AGO A;  1A67 A;  2OOV C;  3K7C A;  1I8V A;  2F4Y A;  5IER A;  4NHF A;  1J2B A;  3JUQ A;  3AHS A;  1X1W A;  3EQQ B;  3F7X A;  4LGQ A;  2H0H A;  4N6M A;  5JPP A;  1WMP A;  3X3Z A;  1VQK 3;  1ZGX A;  1X1X A;  5STD A;  2CG1 A;  1VQM 3;  4WYK A;  1S5A A;  1JKG B;  1FA3 A;  4CJN A;  6GSP A;  2YFL B;  3PCR A;  1RRH A;  3I56 3;  3FG4 A;  4IPB A;  3BIR A;  5DRE A;  2BMQ B;  2UUG C;  3X42 A;  1YJW 3;  1AVK A;  5AIH A;  1RCL A;  1VQQ A;  1I0V A;  1Z1S A;  1KC8 4;  2KF5 A;  3SYU A;  3T8U A;  3G4S 3;  1TUH A;  1VQ6 3;  3GZR A;  3NBR A;  4N6O B;  4R80 A;  4O3V A;  3ECF A;  1IV9 A;  1W6Y A;  3FGY A;  4R9K A;  5AYR B;  1YGE A;  1FUT A;  3U1W A;  3CC4 3;  3MG2 A;  1RN7 A;  2Z76 A;  3K0Z A;  4AKZ A;  1W4N A;  4KFE A;  3MYT A;  2GXF A;  3N9H A;  3GZB A;  2P09 A;  2D42 A;  2FGT A;  1TP6 A;  1JB4 A;  4K1U A;  4XBY A;  1QAL A;  1VQ8 3;  4PEJ A;  1ZO2 A;  1DET A;  1NNV A;  1VQN 3;  1JBT A;  1Q9E A;  1N5H A;  1OAC A;  1SJW A;  1LNH A;  1MNL A;  2R41 A;  4J5G A;  3GZY B;  3WDG B;  1RN1 A;  1RHL A;  2D1W A;  1JN5 A;  4HYZ A;  4AKY A;  1VQ9 3;  1EQK A;  1A2V A;  1M1K 4;  2W2C A;  5AIF A;  1QMA A;  4I4K A;  1BNJ A;  1B3S A;  3D79 A;  3FCS B;  1KD1 4;  2L1S A;  4QWT A;  1GOY A;  1EUI C;  3SX1 A;  1CEW I;  1VQ5 3;  1IYY A;  1K9M 4;  3CMA 3;  5CF2 A;  1UCI A;  3IJE B;  5AYS C;  3FF2 A;  4WYK B;  5M1A A;  1MOL A;  1BSE A;  1W7C A;  3LH4 A;  1NB3 I;  3H3H A;  5LC7 A;  1GYB A;  3OWU A;  1KWI A;  1O7W B;  4HM8 B;  3GWR A;  3CCL 3;  1X1Y A;  3HIG A;  4BTY A;  5IF6 A;  4BTX A;  3ZG0 A;  7STD A;  3L0R A;  1W5Z A;  4XM4 A;  1I2F A;  5KP4 A;  3S28 A;  3G71 3;  2QA4 3;  3GSP A;  4KFD A;  2CHC A;  2KF4 A;  1GD3 A;  2Q07 A;  1JZD A;  2BHM A;  1W2B 2;  3Q1C A;  4BL3 A;  2WO0 A;  2XSH B;  2IY2 A;  3DM8 A;  3SLU A;  2CX1 A;  1TJD A;  2ZL8 A;  3LTA A;  3PS8 A;  1NDO B;  2RFR A;  4GB5 A;  4ZM8 A;  3SOY A;  1D6Z A;  3NBJ A;  1R4Y A;  3UL5 A;  2M7O A;  5KP3 A;  1IV7 A;  1OF5 A;  1OCV A;  3CC2 3;  1KSI A;  3F8X A;  1Q7H A;  2ML5 A;  3X3Y A;  1JN5 B;  1OH0 A;  4HM4 B;  2Z77 A;  4MJD A;  5D81 A;  5JBS A;  1BSD A;  1DVD A;  2XFS A;  3PXM A;  2XGN A;  1W6G A;  2GU3 A;  4RZM A;  3V92 A;  3NM7 A;  3U97 A;  2OTL 3;  1UUV B;  1UCL A;  3ER7 A;  1Q86 4;  1E3R A;  3MKI A;  1TFO A;  2XSO B;  1B27 A;  4I5Q A;  3I55 3;  3K5T A;  1B2U A;  2B1X B;  4O8S A;  1B2S A;  2E2V A;  1EKM A;  3FSD A;  4TX4 A;  3HX8 A;  1MWU A;  3CD6 3;  2BO9 B;  3EBT A;  3OV4 A;  4N3V A;  4HM3 B;  3DMC A;  3CPO A;  3PGB A;  4JRF A;  1OHP A;  3G0K A;  2F5W A;  2IMJ A;  3CCE 3;  2P0M A;  2WOH A;  3HII A;  2OQE C;  1CQS A;  3BLZ A;  2F86 B;  5GSP A;  3X3X A;  3EC9 A;  3RGR A;  2P38 A;  2HMN B;  3N54 B;  4FMC A;  3B4P A;  5BU4 A;  3FZW A;  1W02 A;  4CCV A;  2PNC A;  1GY6 A;  3DGM A;  1I3F A;  1WMO A;  4KT3 B;  1YIJ 3;  3D5G A;  5D82 A;  2WOF A;  4Q53 A;  1U8C B;  4XDV A;  4LZI A;  1I70 A;  1K41 A;  3KN4 A;  1WNH A;  3NUV A;  3STD A;  1OF5 B;  3X41 A;  2V1L A;  3DGL A;  1VZZ A;  1K73 4;  4JF8 A;  3GRD A;  4R1K A;  4FMD A;  1AV4 A;  2YFI B;  3G8Z A;  2SAR A;  3KII A;  2QGU A;  3QRD A;  5AIG A;  5D83 A;  2IUJ A;  2Y73 A;  2ZDJ A;  4RNT A;  3CME 3;  5EEO A;  3KE7 A;  1G0T A;  2JQ5 A;  1EG9 B;  2CFL A;  2PZV A;  1ROV A;  3KSE D;  3G6E 3;  3EF8 A;  4ORL A;  1A2P A;  4MMY B;  1BRK A;  3UB1 A;  1NB5 I;  4WP5 A;  1HKX A;  1LRA A;  3HI7 A;  1DMN A;  4H61 A;  2E2T A;  1D6Y A;  1DMQ A;  1IQ8 A;  1Q42 A;  2Z6B A;  1Q81 4;  2OTJ 3;  1RMS A;  1M90 4;  3IMA B;  5G2G A;  3LZA A;  2CFG A;  4HVN A;  2QIY A;  2HOH A;  2LYX A;  3NV0 A;  1OGZ A;  2XFT A;  3MWZ A;  1L5G B;  2HMJ B;  5FW5 A;  3WOE B;  3WMD A;  1N9E A;  5G1K A;  4KFF A;  3BNB A;  3NXJ A;  1IK3 A;  3PYJ A;  1RJO A;  1X1U A;  2K0M A;  3NQY A;  5BXQ A;  3G16 A;  1DYU A;  4L7K A;  3SOA A;  2Y74 A;  1FUS A;  1JZO A;  2KRT A;  1PYL A;  4CPK A;  1G96 A;  1BVI A;  2YFJ B;  3DGO A;  4GSP A;  4RNZ A;  1KQS 2;  3EHC A;  4STD A;  3LT8 A;  1IT7 A;  1MWR A;  2CFK A;  2FXT A;  3GAX A;  3KFQ C;  4EYC A;  1T2H A;  2IA7 A;  3OW2 2;  1CYU A;  4CDL A;  1VQ4 3;  1UDI I;  2KF6 A;  4WWU C;  3CCV 3;  1BSC A;  4LYL B;  2CW9 A;  1FGT A;  1QJG A;  1CH0 A;  3NQZ A;  4J5K A;  2F99 A;  3DY5 A;  2F56 A;  2ML6 A;  3F7S A;  2W03 A;  3DZL A;  1FUW A;  3MPH A;  1RGG A;  4EW5 A;  2IYJ A;  1BRI A;  1RLS A;  4LEH A;  4HM1 B;  1QVF 2;  3SVA A;  1RN4 A;  4RNY A;  3LYG A;  1GY7 A;  4EV5 A;  3JUP A;  5G1L A;  1BRN L;  1B2Z A;  2MC8 A;  2RNT A;  4L8O A;  3URP A;  4N6V 0;  3D5I A;  4MMZ B;  3KZT A;  4OUQ A;  1OHO A;  1B20 A;  3UJM A;  3NV0 B;  1ASK A;  1TFK A;  2WGO A;  3KKG A;  5EQL A;  1BSA A;  1BNI A;  3WA3 A;  1W2Z A;  3DGN A;  2BMR B;  3LTB A;  1BRG A;  3FLJ A;  4O2H A;  2A15 A;  4O02 B;  1MWS A;  2KCD A;  2AAD A;  1UGH I;  1FZU A;  2CWV A;  1BNF A;  1MGR A;  1PFP A;  3EN8 A;  4HM2 B;  4GL6 A;  1JNQ A;  1ZS7 A;  1HYF A;  5KP1 A;  2KXG A;  1BUJ A;  4HM0 B;  1BRS A;  3ZFZ A;  2HMM B;  1LQM B;  4IIA A;  2XGL A;  2CK3 H;  3PCS A;  1YI2 3;  2P0X A;  3B7C A;  5ELJ A;  5IW9 A;  1WMN A;  3MSO A;  3Q3F A;  2XH9 A;  3LXU X;  3PZW A;  2MF7 A;  2GU1 A;  2FNQ A;  3EJV A;  3MG3 A;  2BU4 A;  1D6U A;  1UI8 A;  3LTC A;  2Z7A A;  1BIR A;  3WR2 A;  6RNT A;  4FR9 A;  3CNM A;  1PY3 A;  3Q2P A;  5HGR A;  1RGK A;  1B21 A;  1U5O A;  2I9W A;  1N5P A;  1GMQ A;  1RDS A;  3E99 A;  2F5M A;  3AHW A;  5BIR A;  5HOH A;  5IEO A;  3B8L A;  1T5Y A;  3EN1 B;  3WOD G;  2W56 A;  1FGM A;  2H0I A;  4LSO A;  4EXR A;  5BVB A;  1BAN A;  4U13 A;  1JB5 A;  1IVX A;  2F98 A;  2JDI H;  2OOV A;  1I2G A;  4BTW A;  5CF1 A;  1EA2 A;  1UUG B;  1JJ2 2;  3D9R A;  3V99 A;  4MEI A;  3CCM 3;  1BU4 A;  2BMO B;  1ROA A;  1VQO 3;  1SAR A;  1GOU A;  1GMP A;  3F40 A;  4LMI A;  4HZ9 B;  1IQX A;  2CWT A;  4WFO A;  2KAA A;  3RDE A;  1W00 A;  1LNI A;  3NX0 A;  1GS3 A;  1BAO A;  3N8B A;  3FF0 A;  1BNE A;  1V58 A;  2WGQ A;  3H51 A;  5IG5 A;  3BB9 A;  5M18 A;  1E3V A;  1HU9 A;  1RGH A;  1Q82 4;  1Q40 A;  1T2I A;  2RGQ A;  3FG1 A;  1F8N A;  1YGW A;  2B24 B;  4DKI A;  1YVS A;  3FKA A;  3CPW 2;  5IG0 A; 
#chains in the Genus database with same CATH homology
 1RRL A;  3MG1 A;  3CNX A;  1N9J A;  3AMO A;  4WHA A;  1ISK A;  4FCM A;  3DUK A;  2O3O A;  4HM7 B;  4XBX A;  1IDP A;  2HML B;  1ZX2 A;  4R9L A;  5AEW B;  2XF3 A;  3JVC A;  3K9M C;  4HZB B;  5IEP A;  2W56 B;  1IVW A;  3QK9 A;  1VQ7 3;  4K61 A;  1UI7 A;  1Q7Y 4;  1LXE A;  3VGN A;  4EC6 A;  1JB2 A;  3LT9 A;  1WTH A;  2R4I A;  3T0U A;  4K90 B;  3F9S A;  4FMA A;  1R4C A;  5AEU B;  4FCZ A;  3CU3 A;  4L8P A;  1YHQ 3;  3LML A;  1QAK A;  2RSX A;  1N8R 4;  1SPU A;  1A90 A;  3F8H A;  3HK4 A;  1OPY A;  4HJL B;  1YJ9 3;  5CK6 A;  1FGQ A;  1NU3 A;  1M9G A;  1UUW B;  1Q40 B;  2INX A;  2OWP A;  5ELU A;  5TGN A;  2XR8 B;  3SED A;  2XEP A;  1FGO A;  1IQY A;  3FG3 A;  5IG4 A;  2BNG A;  4K1V A;  3AMO B;  3RGA A;  2IUK A;  3HZP A;  2P05 A;  2O9U X;  2UX0 A;  4AEQ A;  1SQW A;  3OWY A;  4KVH A;  1GY5 A;  1IU7 A;  4OK0 A;  2CIU A;  4H3U A;  2W9Q A;  3WOF B;  2HMK B;  3VSY A;  3IPT A;  4HM5 B;  1ULI B;  4HM6 B;  3EBY A;  2HMO B;  1IVV A;  1VQP 3;  3ALA A;  3CCJ 3;  6STD A;  1IVU A;  3NM2 A;  1K28 A;  3OX9 A;  5IG3 A;  1NO3 A;  3F14 A;  2GEY A;  3EE1 A;  3UNL A;  4J8T A;  4FCJ A;  1OHS A;  3MHE A;  1LOX A;  2STD A;  3DXO A;  3D3L A;  4IT7 A;  3CCR 3;  4XB5 A;  2SBL A;  2W0Q A;  1E97 A;  1US1 A;  2CFD A;  4HBR A;  3A76 A;  1STD A;  3O8Y A;  4N6U A;  4XBT A;  1W01 A;  5AI1 A;  4EBG A;  5JPU A;  2K54 A;  2CWU A;  2W04 A;  5IEN A;  3LTD A;  4X2H A;  5DRV A;  4EV2 A;  1TIJ A;  3JUO A;  2OQE A;  3EB8 A;  3CC7 3;  5CXO A;  4NRE A;  1YVB I;  3ROB A;  2CFW A;  2W9P A;  3S67 A;  1SII A;  4N6N B;  4R4K A;  1A2K A;  3JUM A;  1Y4K A;  1NJI 4;  2GBX B;  5CLK A;  1RKY A;  3M8C A;  1PU4 A;  1YJN 3;  1CYV A;  1WQL B;  1TU5 A;  3J7Y d;  3WA2 X;  1JRQ A;  3FH1 A;  2C10 A;  1O7G B;  1O7N B;  5AII A;  1W6C A;  5A0O B;  8CHO A;  5EVH A;  3OXA A;  1N8Q A;  5FGO A;  1QAF A;  2RCD A;  1SIH A;  4HKV B;  3T8N A;  1GD4 A;  4FMB A;  1O7M B;  3Q90 A;  1DVC A;  1LVN A;  3I0Y A;  1VQL 3;  2GBW B;  4J9A A;  1S72 3;  2BT3 A;  2CC3 A;  3JUN A;  3NHX A;  3CCS 3;  1AR0 A;  3K63 A;  2E2U A;  3LOY A;  1DMM A;  3S5C A;  3CXC 2;  3TDG A;  1QVG 2;  1JKG A;  4N6L A;  4G1M B;  1ULJ B;  3GZX B;  1BUQ A;  1IT8 A;  4XDW A;  3SXX A;  4KZ1 A;  3NBB A;  1NWW A;  1STF I;  2GEX A;  3X40 A;  1C7H A;  3OWS A;  1O7P B;  3UL6 A;  2LQV A;  3BNC A;  3B4O A;  3EX9 A;  1JV2 B;  4OVM A;  1UW1 A;  2CKF B;  3VF1 A;  3CCQ 3;  2YX9 A;  4RBN A;  2CG0 A;  1M1X B;  2XRX B;  2C11 A;  5I97 A;  3CCU 3;  1O7H B;  1V74 A;  1FGR A;  3S27 A;  1AVL A;  4MMX B;  4N6T A;  1OUN A;  3BNE A;  2CH9 A;  5LC6 A;  1YIT 3;  2L4V A;  1K8A 4;  3BND A;  2W6J H;  3V98 A;  2QEX 3;  3KSP A;  1OGX A;  2OCT A;  3S29 A;  1A67 A;  2OOV C;  3K7C A;  5IER A;  4NHF A;  1J2B A;  3JUQ A;  4LGQ A;  3EQQ B;  3F7X A;  4N6M A;  5JPP A;  1WMP A;  3X3Z A;  1VQK 3;  5STD A;  2CG1 A;  1VQM 3;  4WYK A;  1S5A A;  1JKG B;  1FA3 A;  2YFL B;  3PCR A;  1RRH A;  3I56 3;  3FG4 A;  4IPB A;  5DRE A;  2BMQ B;  3X42 A;  1YJW 3;  1AVK A;  5AIH A;  1Z1S A;  1KC8 4;  3T8U A;  3G4S 3;  1TUH A;  1VQ6 3;  3GZR A;  3NBR A;  4N6O B;  4R80 A;  4O3V A;  3ECF A;  1IV9 A;  1W6Y A;  3FGY A;  4R9K A;  5AYR B;  1YGE A;  3U1W A;  3CC4 3;  3MG2 A;  1RN7 A;  2Z76 A;  3K0Z A;  4AKZ A;  1W4N A;  4KFE A;  3MYT A;  2GXF A;  3N9H A;  3GZB A;  2P09 A;  2D42 A;  2FGT A;  1TP6 A;  1JB4 A;  4K1U A;  4XBY A;  1QAL A;  1VQ8 3;  4PEJ A;  1ZO2 A;  1VQN 3;  1N5H A;  1OAC A;  1SJW A;  1LNH A;  1MNL A;  3GZY B;  3WDG B;  2D1W A;  4AKY A;  1JN5 A;  4HYZ A;  1VQ9 3;  1EQK A;  1A2V A;  1M1K 4;  2W2C A;  5AIF A;  1QMA A;  4I4K A;  3FCS B;  1KD1 4;  4QWT A;  3SX1 A;  1CEW I;  1VQ5 3;  1K9M 4;  3CMA 3;  5CF2 A;  3IJE B;  5AYS C;  3FF2 A;  4WYK B;  1MOL A;  1W7C A;  3LH4 A;  1NB3 I;  3H3H A;  5LC7 A;  1GYB A;  3OWU A;  1KWI A;  1O7W B;  4HM8 B;  3GWR A;  3CCL 3;  3HIG A;  4BTY A;  5IF6 A;  4BTX A;  7STD A;  3L0R A;  1W5Z A;  4XM4 A;  5KP4 A;  3S28 A;  3G71 3;  2QA4 3;  4KFD A;  2CHC A;  2Q07 A;  1GD3 A;  1W2B 2;  2BHM A;  3Q1C A;  2WO0 A;  2XSH B;  3DM8 A;  3SLU A;  2ZL8 A;  3LTA A;  3PS8 A;  1NDO B;  2RFR A;  4GB5 A;  4ZM8 A;  3SOY A;  1D6Z A;  3NBJ A;  3UL5 A;  2M7O A;  5KP3 A;  1IV7 A;  1OF5 A;  1OCV A;  3CC2 3;  1KSI A;  3F8X A;  2ML5 A;  3X3Y A;  1JN5 B;  1OH0 A;  4HM4 B;  2Z77 A;  4MJD A;  5D81 A;  5JBS A;  1DVD A;  2XFS A;  3PXM A;  2XGN A;  1W6G A;  2GU3 A;  4RZM A;  3V92 A;  3NM7 A;  3U97 A;  2OTL 3;  1UUV B;  3ER7 A;  1Q86 4;  1E3R A;  3MKI A;  1TFO A;  2XSO B;  3I55 3;  3K5T A;  2B1X B;  4O8S A;  2E2V A;  1EKM A;  3FSD A;  4TX4 A;  3HX8 A;  3CD6 3;  2BO9 B;  3EBT A;  3OV4 A;  4N3V A;  4HM3 B;  3DMC A;  3CPO A;  3PGB A;  4JRF A;  1OHP A;  3G0K A;  2IMJ A;  3CCE 3;  2P0M A;  2WOH A;  3HII A;  2OQE C;  1CQS A;  3BLZ A;  2F86 B;  3X3X A;  3EC9 A;  3RGR A;  2P38 A;  2HMN B;  3N54 B;  4FMC A;  3B4P A;  3FZW A;  1W02 A;  4CCV A;  2PNC A;  1GY6 A;  3DGM A;  1WMO A;  1YIJ 3;  5D82 A;  2WOF A;  4Q53 A;  1U8C B;  4XDV A;  4LZI A;  1K41 A;  3KN4 A;  1WNH A;  3NUV A;  3STD A;  1OF5 B;  3X41 A;  2V1L A;  3DGL A;  1VZZ A;  1K73 4;  4JF8 A;  3GRD A;  4R1K A;  4FMD A;  1AV4 A;  2YFI B;  3G8Z A;  3KII A;  3QRD A;  2QGU A;  5D83 A;  5AIG A;  2IUJ A;  2Y73 A;  2ZDJ A;  3CME 3;  5EEO A;  3KE7 A;  2JQ5 A;  1EG9 B;  2CFL A;  2PZV A;  1ROV A;  3KSE D;  3G6E 3;  3EF8 A;  4ORL A;  4MMY B;  3UB1 A;  1NB5 I;  4WP5 A;  1HKX A;  3HI7 A;  4H61 A;  1DMN A;  2E2T A;  1D6Y A;  1DMQ A;  1IQ8 A;  1Q42 A;  2Z6B A;  1Q81 4;  2OTJ 3;  1M90 4;  3IMA B;  5G2G A;  3LZA A;  2CFG A;  4HVN A;  2QIY A;  3NV0 A;  2LYX A;  1OGZ A;  2XFT A;  3MWZ A;  1L5G B;  2HMJ B;  5FW5 A;  3WOE B;  3WMD A;  1N9E A;  4KFF A;  3BNB A;  3NXJ A;  1IK3 A;  3PYJ A;  1RJO A;  2K0M A;  3NQY A;  5BXQ A;  3G16 A;  1DYU A;  4L7K A;  3SOA A;  2Y74 A;  2KRT A;  1G96 A;  3DGO A;  2YFJ B;  4RNZ A;  1KQS 2;  3EHC A;  4STD A;  3LT8 A;  1IT7 A;  2CFK A;  2FXT A;  3GAX A;  3KFQ C;  4EYC A;  2IA7 A;  3OW2 2;  1CYU A;  4CDL A;  1VQ4 3;  4WWU C;  3CCV 3;  2CW9 A;  1FGT A;  1QJG A;  3NQZ A;  2F99 A;  3DY5 A;  2ML6 A;  3F7S A;  2W03 A;  3DZL A;  1FUW A;  3MPH A;  4LEH A;  4HM1 B;  1QVF 2;  3SVA A;  4RNY A;  3LYG A;  1GY7 A;  4EV5 A;  3JUP A;  2MC8 A;  4L8O A;  4N6V 0;  4MMZ B;  3KZT A;  4OUQ A;  1OHO A;  3UJM A;  3NV0 B;  1ASK A;  1TFK A;  2WGO A;  3KKG A;  5EQL A;  3WA3 A;  1W2Z A;  3DGN A;  2BMR B;  3LTB A;  3FLJ A;  4O2H A;  2A15 A;  4O02 B;  2KCD A;  3EN8 A;  2CWV A;  1PFP A;  4HM2 B;  4GL6 A;  1JNQ A;  5KP1 A;  2KXG A;  4HM0 B;  2HMM B;  4IIA A;  2XGL A;  2CK3 H;  3PCS A;  1YI2 3;  2P0X A;  3B7C A;  5ELJ A;  5IW9 A;  1WMN A;  3MSO A;  3PZW A;  2XH9 A;  3LXU X;  2MF7 A;  2GU1 A;  2FNQ A;  3EJV A;  3MG3 A;  1D6U A;  1UI8 A;  3LTC A;  2Z7A A;  4FR9 A;  3CNM A;  3Q2P A;  5HGR A;  1U5O A;  2I9W A;  1N5P A;  3E99 A;  5IEO A;  3B8L A;  1T5Y A;  3EN1 B;  3WOD G;  2W56 A;  1FGM A;  5BVB A;  4LSO A;  4EXR A;  4U13 A;  1JB5 A;  1IVX A;  2F98 A;  2JDI H;  2OOV A;  4BTW A;  5CF1 A;  1EA2 A;  1JJ2 2;  3D9R A;  3V99 A;  4MEI A;  3CCM 3;  1VQO 3;  2BMO B;  1ROA A;  3F40 A;  4LMI A;  4HZ9 B;  1IQX A;  2CWT A;  4WFO A;  3RDE A;  1W00 A;  3NX0 A;  1GS3 A;  3N8B A;  3FF0 A;  2WGQ A;  3H51 A;  5IG5 A;  3BB9 A;  1E3V A;  1HU9 A;  1Q82 4;  1Q40 A;  2RGQ A;  3FG1 A;  1F8N A;  2B24 B;  4X2O A;  3FKA A;  3CPW 2;  5IG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...