4MJDA

Crystal structure of ketosteroid isomerase fold protein hmuk_0747
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
SNAMDRVATARAYYRALDEHDYDLLSDVLAPDFVHDRPDRTIEGRERFVRFMREERPQTDTSHPIATIYTGASTVAVEGRLLNSDGAEITQFVDVFAFEDGVIGRIRTHTPEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ketosteroid isomerase fold protein Hmuk_0747
rcsb
source organism Halomicrobium mukohataei
molecule tags Unknown function
molecule keywords Ketosteroid isomerase fold protein Hmuk_0747
total genus 31
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4mjdA00
3JUNA 3HK4A 5AI1A 3T8UA 2OWPA 1K41A 2XR8B 3G0KA 3K7CA 3ECFA 5D81A 1NDOB 3DM8A 1W02A 1OCVA 2BMOB 5IERA 1OHSA 2R4IA 3FF2A 1ZO2A 1EG9B 3NUVA 4I4KA 2HMKB 3E99A 1STDA 5KP1A 3EX9A 1E3RA 2F98A 3JUPA 4HM1B 4HM2B 3DUKA 2UX0A 4FCMA 3G8ZA 4X2OA 3ROBA 1ISKA 3DZLA 4HKVB 4K1VA 2HMMB 1JKGA 3EF8A 3OWSA 2BMQB 3OWYA 5CLKA 2F99A 2RGQA 5DRVA 3M8CA 3MG1A 5D82A 2GBXB 1GY6A 3GRDA 1BUQA 4WP5A 3SOAA 4ORLA 3KKGA 1OHPA 1Q42A 3JUQA 4L8OA 4CDLA 4X2HA 3G16A 3MSOA 1JKGB 3FZWA 1DMQA 3EQQB 1GY7A 5CK6A 3F8HA 5HGRA 2INXA 2B24B 1OF5B 1GYBA 2QGUA 2XRXB 3F14A 5AEWB 3LYGA 5D83A 2BNGA 4XBTA 2RFRA 2GXFA 1E3VA 3CU3A 1DMMA 2RCDA 3I0YA 4HM0B 5IG5A 1HKXA 3EBYA 4Q53A 4U13A 3RGRA 3UJMA 1A2KA 3CNXA 3FSDA 1GS3A 4HJLB 3STDA 2YFLB 4HM3B 3HX8A 1UUWB 1S5AA 3FKAA 1OPYA 3NBRA 4HM4B 3EN8A 1ULJB 2QIYA 4XBXA 3RGAA 1JB4A 3LZAA 4LEHA 3CNMA 5AIHA 3EHCA 3BLZA 1OH0A 4STDA 3GZXB 2B1XB 1IDPA 3H3HA 4L7KA 3VSYA 5BVBA 1C7HA 4MJDA 1W01A 1TP6A 2Z77A 3NHXA 4J8TA 1QJGA 1Q40A 1W6YA 4H3UA 3IPTA 4R1KA 1JN5A 5IEPA 1O7GB 4HZ9B 2BMRB 1NWWA 3MYTA 2HMOB 3UNLA 3T8NA 4OVMA 4HM5B 3KSPA 5CF1A 5KP4A 3B4OA 3NV0B 2I9WA 3MG3A 3OX9A 3OWUA 4PEJA 3BB9A 1CQSA 3KE7A 3B8LA 2CHCA 3WMDA 3OXAA 3JUMA 3MKIA 4XDVA 2A15A 4XB5A 2HMNB 5AIFA 5STDA 3FF0A 4K1UA 2JQ5A 1O7NB 2Z7AA 3F7SA 5TGNA 2K54A 5AEUB 1JN5B 2CKFB 1TUHA 4WYKB 5KP3A 5FW5A 1OF5A 3CPOA 3F9SA 4J9AA 4RZMA 1O7WB 4LMIA 5IG0A 1E97A 5IG4A 3HZPA 2F86B 2XSHB 4HM7B 3NXJA 4R9LA 5G2GA 1JB5A 4OUQA 3JUOA 3KZTA 1O7PB 1O7HB 3D9RA 2HMLB 1QMAA 3EBTA 3VGNA 4WWUC 1W00A 2GEXA 3FLJA 4N3VA 3K0ZA 3DXOA 3B4PA 4XM4A 2STDA 3OV4A 5BXQA 5JPUA 3MG2A 3MHEA 5JPPA 3S5CA 4XDWA 3FH1A 3F7XA 1OUNA 3F8XA 1OGZA 3DMCA 3A76A 4HM8B 4R9KA 3GZBA 4WYKA 5AIIA 2GBWB 2YFIB 4FCJA 2PZVA 3GZYB 4HM6B 1OHOA 5AIGA 1Q40B 1WQLB 1Z1SA 3FGYA 5DREA 3SEDA 2XSOB 1GY5A 2IMJA 3ER7A 1AR0A 4HZBB 4KVHA 3F40A 3GZRA 1NU3A 4XBYA 5CXOA 5IEOA 2Z76A 3NV0A 4LGQA 4GB5A 4HVNA 5IF6A 1EA2A 1UUVB 1ASKA 3B7CA 3Q90A 5EVHA 1JB2A 5IG3A 1VZZA 4IIAA 2HMJB 2YFJB 1OGXA 1O7MB 6STDA 2GEYA 1DMNA 1U5OA 1ZX2A 3NM2A 2W2CA 3EN1B 3H51A 1SJWA 1ULIB 8CHOA 3EJVA 3GWRA 5IENA 5CF2A 3SOYA 4L8PA 7STDA 3EC9A
chains in the Genus database with same CATH superfamily
1BNIA 3HK4A 4O8SA 1V74A 5AI1A 1N8R4 2CW9A 1K41A 2XR8B 3G0KA 3MWZA 1W02A 4BL3A 1N9EA 1OCVA 1IVWA 2BMOB 2XFTA 2R4IA 3FF2A 1M904 3E99A 5FGOA 3D3LA 3EX9A 1UUGB 3NBBA 1RRHA 4EC6A 4LZIA 3G8ZA 1KC84 3EE1A 1S723 4HKVB 1B21A 1JKGA 1N8QA 2HMMB 3OWSA 3OWYA 1JZOA 3AHSA 4N6LA 1I3IA 3SYUA 1B2ZA 3V99A 4AKYA 1WMPA 1YVSA 3GRDA 3PCRA 3NQYA 4WP5A 4CDLA 1FA3A 4L8OA 4X2HA 4EV5A 1LVNA 1SPUA 3A5EA 1DMQA 3EQQB 1JNQA 1GY7A 5CK6A 3SXXA 4NPBA 2INXA 2KXGA 3F14A 2XF3A 5M18A 1YIT3 3G713 2V1LA 1RNBA 2RFRA 2CX1A 1LNHA 2ZL8A 3CU3A 4FMDA 2CFWA 3EBYA 4U13A 3RGRA 3CNXA 3STDA 1GS3A 4HAAA 1BSAA 2XGNA 3Q1CA 1RHLA 4N6OB 1Q864 4IPBA 4HM3B 3HX8A 1UUWB 3BNCA 1QAKA 2F5WA 2KF4A 1QAFA 2C11A 4NREA 1NB3I 3LZAA 1AQZA 3CNMA 4KFDA 3CCS3 3EHCA 4CPKA 4STDA 3VSYA 3D5IA 1JJ22 1GOVA 2CK3H 3U97A 2OCTA 5AIHA 1BNFA 2Z77A 4FMCA 2QA43 1GMQA 3IPTA 4R1KA 1JN5A 5IEPA 4HZ9B 1T2IA 3BNBA 3AMOB 3LTAA 3T8NA 1PU4A 1BU4A 2CFDA 5CF1A 3OX9A 4EV2A 3KE7A 1CQSA 1W6GA 4OK0A 1FGTA 5STDA 1I0VA 4R80A 3CCJ3 1O7NB 1X1XA 2Z7AA 6GSPA 2K54A 2OOVA 4GHOA 5AEUB 1I0XA 1TUHA 3WOEB 3CPOA 3CCL3 1STFI 1T5YA 2XSHB 4HM7B 3NXJA 3VF1A 1GMRA 3LTBA 1JB5A 2MF7A 2LQVA 1O7HB 3D9RA 2HMLB 3D79A 1BNSA 3X41A 3LTDA 2GEXA 3K9MC 4J5KA 3SX1A 2WOHA 3DXOA 3OV4A 3MHEA 3CCM3 1QVG2 4CJNA 3FH1A 4HM8B 3X42A 4WYKA 1UCKA 3A76A 5AIIA 3GZBA 1B2UA 1I2FA 3LH4A 3WODG 2D42A 1OHOA 1AVKA 1Q40B 3CD63 2RNTA 3FGYA 4MMYB 4O02B 1AR0A 1FGRA 2YX9A 3BU4A 1LOVA 1T2HA 1MOLA 1D6YA 2Z76A 4N6UA 5I97A 5A0OB 4GB5A 4HVNA 4EXRA 1EA2A 1CH0A 1B3SA 1I3FA 3KSED 1UUVB 5EVHA 1JB2A 1KSIA 1O7MB 1RGFA 4HOHA 1DMNA 1ULIB 1TJDA 3PGBA 2IUJA 5IENA 3DGYA 3AGOA 7STDA 5EQLA 3JUNA 3K7CA 5D81A 2H0IA 3DM8A 3CXC2 2WGQA 2RSXA 1ZO2A 3NUVA 1K734 3AHWA 1AVLA 5HOHA 2BO9B 2F98A 4HM1B 1RN7A 5AYRB 1DETA 1LOXA 2UX0A 2OOVC 4X2OA 1YHQ3 1I70A 1ISKA 1KWIA 1WNHA 3DZLA 4GL6A 2H0GA 4AEQA 3CC73 1FYSA 1X1YA 5DRVA 3M8CA 3KCHA 1BUQA 2GBXB 1GY6A 3OW22 1BRNL 1LXEA 3SOAA 1B20A 1VQN3 1OHPA 1Q42A 1W2ZA 4BL2A 3FZWA 2IUKA 3FG4A 3F8HA 5HGRA 1OF5B 1UCJA 2XRXB 4NHFA 1BNEA 5D83A 3AMOA 4XBTA 2QEX3 3X3YA 4MMXB 1DMMA 2BT3A 2WOFA 3CC43 1A2VA 1G0TA 4ILFA 2JDIH 4HJLB 1RGHA 2IYJA 1UW1A 1MWRA 1PYLA 4BTYA 1L5GB 1LQGC 3DGOA 1JBRA 3EN8A 1FUSA 2QIYA 1M1K4 3EB8A 3NM7A 3PYJA 3BNDA 1JB4A 3J7Yd 1YI23 1BNGA 3BLZA 1N5HA 2ZA4A 3GZXB 3H3HA 1SIHA 3LT8A 4L7KA 4N6NB 1BVIA 4MJDA 5BVBA 1YJ93 1IVVA 2Z6BA 4J8TA 1O7GB 1TRPA 1IQYA 1UI8A 3BIRA 5G1LA 2KF3A 1MWUA 4OVMA 2OQEC 1RCLA 3T8UA 1RMSA 4FMAA 1LOYA 3BB9A 3UB1A 4JRFA 5M1AA 3URPA 4XDVA 1RGKA 1IQXA 1DE3A 4K1UA 1US1A 5TGNA 1YIJ3 2SBLA 1VQ43 1MNLA 3CCR3 1IVXA 1JN5B 2CKFB 4WYKB 5KP3A 3LTCA 3F9SA 3BNEA 2CG0A 4H61A 4R9LA 3I563 2CX0A 4OUQA 1RGAA 4J5GA 2PNCA 1PFPA 3CME3 4N6TA 1QMAA 1VQL3 2E2UA 1N5PA 4RNYA 4WWUC 1J2BA 1YVBI 4N3VA 5BXQA 4LYLB 5LC6A 1GSPA 3DGLA 1NJI4 3S5CA 4XDWA 1JV2B 2ML5A 3F8XA 5AYSC 1T3BA 2WGOA 1G96A 4BIRA 1HU9A 2P05A 4R4KA 2YFIB 3ALAA 2PZVA 2XGLA 3GZYB 4RNTA 3ZFZA 3G6E3 1TRQA 2KRTA 2OTL3 3FCSB 2XSOB 1Q7Y4 4O3VA 5G1KA 1BNJA 3ER7A 2D1WA 5CXOA 2MC8A 3WMDA 3GZRA 3FG1A 2F4YA 1MWSA 1B27A 4WFOA 3N9HA 1BIRA 1MGRA 3WR2A 3L0RA 4IIAA 2YFJB 1DVDA 1OGXA 3MPHA 1BANA 1YNVX 3NQZA 1DYUA 3CC23 1ZX2A 1SJWA 3EJVA 1BRHA 2FXTA 3GWRA 1FGMA 1BRGA 8RNTA 1MGWA 1BAOA 1VQ53 1TIJA 3CCV3 2CWUA 1FGOA 3ECFA 4EBGA 1KQS2 1RGCA 2F5MA 5IERA 1HYFA 3O8YA 1D6ZA 2P38A 1FGQA 1EG9B 1MWTA 3LMLA 4I4KA 4KFEA 3I553 5KP1A 1W2B2 1Q824 1E3RA 2HOHA 2J8XB 1KD14 4HM2B 1LOWA 1M1XB 3ROBA 2BU4A 1VQQA 1EUIC 3EF8A 2BMQB 2Q07A 5EEOA 2F99A 2RGQA 4EW5A 1A67A 1BGSA 1RDSA 3IJEB 1NB5I 3KKGA 3SLUA 3G16A 3K5TA 3WDGB 1JKGB 3DGMA 4ZM8A 4LSOA 2B24B 3PCSA 4MEIA 2QGUA 2BHMA 2CFLA 1ROVA 5AEWB 5BIRA 1I8VA 1BSCA 1UGIA 1E3VA 1V57A 5GSPA 2CWVA 2ZHXB 5IG5A 1HKXA 1Y4KA 1Q7HA 1CYUA 3LOYA 1QVF2 1RGLA 1IYYA 1RTUA 3DGNA 1ZS7A 2CIUA 3PS8A 2KF5A 1S5AA 3FKAA 4FMBA 2K0MA 1GOYA 3SVAA 3S29A 1FUWA 3LXUX 4LEHA 3D4AA 2H0HA 4KT3B 5ELUA 1OH0A 2B1XB 1X1UA 1W01A 1TP6A 1I2EA 2WO0A 3NHXA 1QJGA 1Q40A 1NO3A 1W6YA 2RBIA 1TTOA 3X40A 3ZG5A 2UUGC 1Q814 7GSPA 1NWWA 1WMOA 3MYTA 3UNLA 9RNTA 1UI7A 1NNVA 2R41A 3HOHA 3N8BA 4HM5B 5LC7A 5KP4A 4O2HA 3NV0B 1IVUA 3MG3A 2GU3A 4PEJA 4AKZA 1YJW3 3B8LA 1VQO3 1JBTA 3OXAA 2P0MA 3JUMA 3MKIA 2A15A 2W56A 2HMNB 1LQMB 1IQ8A 2AAEA 3V92A 4BU4A 2JQ5A 2GSPA 3F7SA 3S28A 1BRJA 1GD4A 1EEJA 2W03A 1CEWI 5FW5A 4RZMA 3HIGA 4J9AA 5IG4A 1JRQA 4LMIA 3CCU3 1E97A 1IU7A 3KIIA 2F86B 3KN4A 1ZGXA 3HIIA 1W7CA 1FUTA 1O7PB 1BSEA 1Q9EA 2P0XA 2FGTA 3VGNA 3TDGA 3PZWA 3FLJA 1B2SA 2IY2A 3K0ZA 5BU4A 2STDA 4HYZA 3MG2A 1CYVA 5JPPA 2L4VA 2F56A 1M9GA 3F7XA 1LNIA 1OGZA 1BRIA 1QALA 2CWTA 1BSDA 1W6CA 1WTHA 4BTXA 3CCQ3 3CMA3 2FNQA 4HM6B 1GOUA 2XFSA 5AIGA 4R9KA 3RDEA 5DREA 5JBSA 3UL6A 3Q3FA 1TU5A 1GY5A 1K28A 3PXMA 1RGEA 4HZBB 4KVHA 4DKIA 3F40A 1NU3A 2W9QA 1VQ73 2AADA 4LGQA 2W04A 1JBSA 5IF6A 1UCLA 1BRKA 4CCVA 1ASKA 2KAAA 3B7CA 3Q90A 5M19A 5IG3A 1VZZA 4FCZA 3WHOA 1RCKA 1C54A 6STDA 4RNZA 1IK3A 1UDII 3N54B 2GEYA 2W0QA 4K61A 3NM2A 2W2CA 8CHOA 2C4BA 3HI7A 1VQK3 3V98A 2OWPA 4N6MA 1EKMA 3S27A 4MMZB 1IV7A 2OQEA 1NDOB 3GAXA 2Y73A 1IT8A 3DY5A 1OHSA 4RBNA 2HMKB 2UGIA 1STDA 3U1WA 4WHAA 1TFKA 3JUPA 4K90B 3CCE3 5ELJA 1RGGA 1TFOA 3DUKA 4FCMA 3QRDA 4K1VA 5CLKA 2E2TA 4TX4A 2CH9A 1FZUA 2KCDA 3MG1A 5D82A 3DH2A 2ZDJA 1W4NA 4ORLA 3JUQA 3KFQC 2CG1A 4KFFA 2Y74A 3MSOA 5IW9A 2XH9A 4G1MB 1N9JA 2E2VA 1GYBA 2O9UX 1X1WA 3LYGA 2BNGA 2GXFA 2RCDA 3I0YA 4HM0B 4Q53A 3D5GA 4HBRA 3UJMA 1A2KA 3G4S3 1VQ83 3FSDA 1EQKA 2W6JH 3LT9A 3X3XA 2YFLB 1JZDA 3AGNA 1BOXA 4IT7A 1SIIA 3NBRA 4HM4B 1OPYA 3NX0A 1ULJB 4XBXA 3RGAA 2K3DA 2KF6A 1D6UA 2ML6A 2C10A 1B2XA 1IDPA 1SARA 1C7HA 4H3UA 1DVCA 1RSNA 2BMRB 1R4YA 2HMOB 1VQ93 3KSPA 3B4OA 2I9WA 3OWUA 1BNRA 3T0UA 1RKYA 2CHCA 1U8CB 3GSPA 1R4CA 1RJOA 2M7OA 1I2GA 2XEPA 4XB5A 5AIFA 1RN4A 1GMPA 2CFGA 3FF0A 3WA3A 1B2MA 1GD3A 1VQ63 1OF5A 1O7WB 1AY7A 5IG0A 2BIRA 2SARA 3UL5A 3HZPA 3CPW2 2O3OA 1YJN3 5G2GA 1IV9A 4N6V0 3WA2X 2W9PA 1PY3A 2L1SA 3JUOA 3KZTA 1WMNA 2CC3A 4FR9A 1RRLA 2OTJ3 1BRSA 3EBTA 2LYXA 3WOFB 4BTWA 1BUJA 1W00A 2CFKA 4XM4A 5JPUA 4JF8A 3B4PA 1A2PA 1F8NA 1K9M4 1OUNA 3DMCA 1UCIA 5RNTA 2GBWB 3NBJA 1RN1A 4FCJA 3RNTA 3FG3A 1BSBA 1Z1SA 1WQLB 2W56B 1RNTA 3X3ZA 1G02A 3IMAB 3SEDA 4EYCA 7RNTA 2IMJA 2P09A 4KZ1A 5IEOA 4XBYA 1W5ZA 4I5QA 1OACA 1LRAA 1YGEA 3NV0A 1IT7A 1SQWA 1ROAA 4QWTA 3JVCA 1A90A 2GU1A 3S67A 1V58A 1YGWA 1VQM3 1UGHI 1AV4A 2HMJB 3Q2PA 2IA7A 1U5OA 1RLSA 3QK9A 1HZ1A 3K63A 1K8A4 3EN1B 3H51A 4GSPA 1VQP3 5CF2A 3SOYA 3ZG0A 4L8PA 1FW7A 6RNTA 3EC9A
chains in the Genus database with same CATH topology
5AI1A 3HK4A 4O8SA 1V74A 1N8R4 2CW9A 1K41A 2XR8B 3G0KA 3MWZA 1W02A 1N9EA 1OCVA 1IVWA 2BMOB 2XFTA 2R4IA 3FF2A 1M904 3E99A 5FGOA 3D3LA 3EX9A 3NBBA 1RRHA 4EC6A 4LZIA 3G8ZA 1KC84 3EE1A 1S723 4HKVB 2HMMB 1JKGA 1N8QA 3OWSA 3OWYA 4N6LA 3V99A 4AKYA 1WMPA 3GRDA 3PCRA 3NQYA 4WP5A 4CDLA 1FA3A 4L8OA 4X2HA 4EV5A 1LVNA 1SPUA 1DMQA 3EQQB 1JNQA 1GY7A 5CK6A 3SXXA 2INXA 2KXGA 3F14A 2XF3A 1YIT3 3G713 2V1LA 2RFRA 1LNHA 2ZL8A 3CU3A 4FMDA 2CFWA 3EBYA 4U13A 3RGRA 3CNXA 3STDA 1GS3A 2XGNA 3Q1CA 4N6OB 1Q864 4IPBA 4HM3B 3HX8A 1UUWB 3BNCA 1QAKA 1QAFA 2C11A 4NREA 1NB3I 3LZAA 3CNMA 3CCS3 4KFDA 3EHCA 4STDA 3VSYA 1JJ22 2CK3H 3U97A 2OCTA 5AIHA 2Z77A 4FMCA 2QA43 3IPTA 4R1KA 1JN5A 5IEPA 4HZ9B 3BNBA 3AMOB 3LTAA 3T8NA 1PU4A 2CFDA 5CF1A 3OX9A 4EV2A 3KE7A 1CQSA 1W6GA 4OK0A 1FGTA 5STDA 4R80A 3CCJ3 1O7NB 2Z7AA 2K54A 2OOVA 5AEUB 1TUHA 3WOEB 3CPOA 3CCL3 1STFI 1T5YA 2XSHB 4HM7B 3NXJA 3VF1A 3LTBA 1JB5A 2MF7A 2LQVA 1O7HB 3D9RA 2HMLB 3X41A 3LTDA 2GEXA 3K9MC 3SX1A 2WOHA 3DXOA 3OV4A 3MHEA 3CCM3 1QVG2 3FH1A 4HM8B 3X42A 4WYKA 3A76A 5AIIA 3GZBA 3LH4A 3WODG 2D42A 1OHOA 1AVKA 1Q40B 3CD63 3FGYA 4MMYB 4O02B 1AR0A 1FGRA 2YX9A 4N6UA 1MOLA 1D6YA 2Z76A 5I97A 5A0OB 4GB5A 4HVNA 4EXRA 1EA2A 3KSED 1UUVB 5EVHA 1JB2A 1KSIA 1O7MB 1DMNA 1ULIB 2IUJA 3PGBA 5IENA 7STDA 5EQLA 3JUNA 3K7CA 5D81A 3DM8A 3CXC2 2WGQA 2RSXA 1ZO2A 3NUVA 1K734 1AVLA 2BO9B 2F98A 4HM1B 1RN7A 5AYRB 1LOXA 2UX0A 2OOVC 4X2OA 1YHQ3 1ISKA 1KWIA 1WNHA 3DZLA 4GL6A 4AEQA 3CC73 5DRVA 3M8CA 1BUQA 2GBXB 1GY6A 3OW22 1LXEA 3SOAA 1VQN3 1OHPA 1Q42A 1W2ZA 3FZWA 2IUKA 3FG4A 3F8HA 5HGRA 1OF5B 2XRXB 5D83A 3AMOA 4XBTA 2QEX3 3X3YA 4MMXB 1DMMA 2BT3A 2WOFA 3CC43 1A2VA 2JDIH 4HJLB 1UW1A 4BTYA 1L5GB 3DGOA 3EN8A 1M1K4 2QIYA 3EB8A 3NM7A 3PYJA 3BNDA 1JB4A 3J7Yd 1YI23 3BLZA 1N5HA 3GZXB 3H3HA 3LT8A 1SIHA 4L7KA 4N6NB 5BVBA 4MJDA 1YJ93 1IVVA 2Z6BA 4J8TA 1O7GB 1IQYA 1UI8A 4OVMA 2OQEC 3T8UA 4FMAA 3BB9A 3UB1A 4JRFA 4XDVA 1IQXA 4K1UA 1US1A 5TGNA 1YIJ3 2SBLA 1VQ43 1MNLA 3CCR3 1IVXA 1JN5B 2CKFB 4WYKB 5KP3A 3LTCA 3F9SA 3BNEA 2CG0A 4H61A 4R9LA 3I563 4OUQA 2PNCA 1PFPA 3CME3 4N6TA 1QMAA 1VQL3 2E2UA 1N5PA 4RNYA 4WWUC 1J2BA 1YVBI 4N3VA 5BXQA 5LC6A 1NJI4 3DGLA 3S5CA 4XDWA 1JV2B 2ML5A 3F8XA 5AYSC 2WGOA 1G96A 1HU9A 2P05A 4R4KA 2YFIB 3ALAA 2PZVA 2XGLA 3GZYB 3G6E3 2KRTA 2OTL3 3FCSB 2XSOB 1Q7Y4 4O3VA 2MC8A 3ER7A 2D1WA 5CXOA 3WMDA 3GZRA 3FG1A 4WFOA 3N9HA 3L0RA 4IIAA 2YFJB 1DVDA 1OGXA 3MPHA 3NQZA 3CC23 1DYUA 1ZX2A 1SJWA 3EJVA 2FXTA 3GWRA 1FGMA 1VQ53 1TIJA 3CCV3 2CWUA 1FGOA 3ECFA 4EBGA 1KQS2 5IERA 3O8YA 1D6ZA 2P38A 1FGQA 1EG9B 3LMLA 4I4KA 4KFEA 3I553 5KP1A 1W2B2 1Q824 1E3RA 1KD14 4HM2B 1M1XB 3ROBA 3EF8A 2BMQB 2Q07A 5EEOA 2F99A 2RGQA 1A67A 1NB5I 3IJEB 3KKGA 3SLUA 3G16A 3K5TA 3WDGB 1JKGB 3DGMA 4ZM8A 4LSOA 2B24B 3PCSA 4MEIA 2QGUA 2BHMA 2CFLA 1ROVA 5AEWB 1E3VA 2CWVA 5IG5A 1HKXA 1Y4KA 1CYUA 3LOYA 1QVF2 3DGNA 2CIUA 3PS8A 1S5AA 3FKAA 4FMBA 2K0MA 3SVAA 3S29A 1FUWA 3LXUX 4LEHA 5ELUA 1OH0A 2B1XB 1W01A 1TP6A 2WO0A 3NHXA 4NHFA 1QJGA 1Q40A 1NO3A 1W6YA 3X40A 1Q814 1NWWA 1WMOA 3MYTA 3UNLA 1UI7A 5LC7A 3N8BA 4HM5B 5KP4A 4O2HA 3NV0B 1IVUA 3MG3A 2GU3A 4PEJA 4AKZA 1YJW3 3B8LA 1VQO3 3OXAA 2P0MA 3JUMA 3MKIA 2A15A 2W56A 2HMNB 1IQ8A 3V92A 2JQ5A 3F7SA 3S28A 1GD4A 2W03A 1CEWI 5FW5A 4RZMA 3HIGA 4J9AA 5IG4A 1JRQA 4LMIA 3CCU3 1E97A 1IU7A 3KIIA 2F86B 3KN4A 3HIIA 1W7CA 1O7PB 2P0XA 3VGNA 2FGTA 3TDGA 3PZWA 3FLJA 3K0ZA 2STDA 4HYZA 3MG2A 1CYVA 5JPPA 2L4VA 1M9GA 3F7XA 4R9KA 1OGZA 4BTXA 1QALA 2CWTA 1W6CA 1WTHA 3CCQ3 3CMA3 2FNQA 4HM6B 2XFSA 5AIGA 3RDEA 5DREA 5JBSA 3UL6A 1TU5A 1GY5A 1K28A 3PXMA 4HZBB 4KVHA 3F40A 1NU3A 2W9QA 1VQ73 4LGQA 2W04A 5IF6A 4CCVA 1ASKA 3B7CA 3Q90A 5IG3A 1VZZA 4FCZA 6STDA 4RNZA 1IK3A 3N54B 2GEYA 2W0QA 4K61A 3NM2A 2W2CA 8CHOA 3HI7A 1VQK3 3V98A 2OWPA 4N6MA 1EKMA 3S27A 4MMZB 1IV7A 2OQEA 1NDOB 3GAXA 2Y73A 1IT8A 3DY5A 1OHSA 4RBNA 2HMKB 1STDA 3U1WA 4WHAA 1TFKA 3JUPA 4K90B 3CCE3 5ELJA 1TFOA 3DUKA 4FCMA 3QRDA 4K1VA 5CLKA 2E2TA 4TX4A 2CH9A 2KCDA 3MG1A 5D82A 2ZDJA 1W4NA 4ORLA 3JUQA 3KFQC 2CG1A 4KFFA 2Y74A 3MSOA 5IW9A 2XH9A 4G1MB 1N9JA 2E2VA 1GYBA 2O9UX 3LYGA 2BNGA 2GXFA 2RCDA 3I0YA 4HM0B 4Q53A 4HBRA 1VQ83 3UJMA 1A2KA 3G4S3 1EQKA 3FSDA 2W6JH 3LT9A 3X3XA 2YFLB 4IT7A 1SIIA 3NBRA 4HM4B 1OPYA 3NX0A 1ULJB 4XBXA 3RGAA 1D6UA 2ML6A 2C10A 1IDPA 1C7HA 4H3UA 1DVCA 2BMRB 2HMOB 1VQ93 3KSPA 3B4OA 2I9WA 3OWUA 3T0UA 1RKYA 2CHCA 1U8CB 1R4CA 1RJOA 2M7OA 2XEPA 4XB5A 5AIFA 3FF0A 2CFGA 3WA3A 1GD3A 1VQ63 1OF5A 1O7WB 5IG0A 3UL5A 3HZPA 3CPW2 2O3OA 1YJN3 5G2GA 1IV9A 4N6V0 3WA2X 2W9PA 3JUOA 3KZTA 1WMNA 2CC3A 4FR9A 1RRLA 2OTJ3 3EBTA 2LYXA 3WOFB 4BTWA 1W00A 2CFKA 4XM4A 5JPUA 4JF8A 3B4PA 1F8NA 1K9M4 1OUNA 3DMCA 2GBWB 3NBJA 4FCJA 3FG3A 1Z1SA 1WQLB 2W56B 3X3ZA 4EYCA 3IMAB 3SEDA 2IMJA 2P09A 4KZ1A 5IEOA 4XBYA 1W5ZA 1OACA 1YGEA 3NV0A 1IT7A 1SQWA 1ROAA 4QWTA 3JVCA 1A90A 2GU1A 3S67A 1VQM3 1AV4A 2HMJB 3Q2PA 2IA7A 1U5OA 3QK9A 3K63A 1K8A4 3EN1B 3H51A 1VQP3 5CF2A 3SOYA 4L8PA 3EC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUN A;  3HK4 A;  5AI1 A;  3T8U A;  2OWP A;  1K41 A;  2XR8 B;  3G0K A;  3K7C A;  3ECF A;  5D81 A;  1NDO B;  3DM8 A;  1W02 A;  1OCV A;  2BMO B;  5IER A;  1OHS A;  2R4I A;  3FF2 A;  1ZO2 A;  1EG9 B;  3NUV A;  4I4K A;  2HMK B;  3E99 A;  1STD A;  5KP1 A;  3EX9 A;  1E3R A;  2F98 A;  3JUP A;  4HM1 B;  4HM2 B;  3DUK A;  2UX0 A;  4FCM A;  3G8Z A;  4X2O A;  3ROB A;  1ISK A;  3DZL A;  4HKV B;  4K1V A;  2HMM B;  1JKG A;  3EF8 A;  3OWS A;  2BMQ B;  3OWY A;  5CLK A;  2F99 A;  2RGQ A;  5DRV A;  3M8C A;  3MG1 A;  5D82 A;  2GBX B;  1GY6 A;  3GRD A;  1BUQ A;  4WP5 A;  3SOA A;  4ORL A;  3KKG A;  1OHP A;  1Q42 A;  3JUQ A;  4L8O A;  4CDL A;  4X2H A;  3G16 A;  3MSO A;  1JKG B;  3FZW A;  1DMQ A;  3EQQ B;  1GY7 A;  5CK6 A;  3F8H A;  5HGR A;  2INX A;  2B24 B;  1OF5 B;  1GYB A;  2QGU A;  2XRX B;  3F14 A;  5AEW B;  3LYG A;  5D83 A;  2BNG A;  4XBT A;  2RFR A;  2GXF A;  1E3V A;  3CU3 A;  1DMM A;  2RCD A;  3I0Y A;  4HM0 B;  5IG5 A;  1HKX A;  3EBY A;  4Q53 A;  4U13 A;  3RGR A;  3UJM A;  1A2K A;  3CNX A;  3FSD A;  1GS3 A;  4HJL B;  3STD A;  2YFL B;  4HM3 B;  3HX8 A;  1UUW B;  1S5A A;  3FKA A;  1OPY A;  3NBR A;  4HM4 B;  3EN8 A;  1ULJ B;  2QIY A;  4XBX A;  3RGA A;  1JB4 A;  3LZA A;  4LEH A;  3CNM A;  5AIH A;  3EHC A;  3BLZ A;  1OH0 A;  4STD A;  3GZX B;  2B1X B;  1IDP A;  3H3H A;  4L7K A;  3VSY A;  5BVB A;  1C7H A;  4MJD A;  1W01 A;  1TP6 A;  2Z77 A;  3NHX A;  4J8T A;  1QJG A;  1Q40 A;  1W6Y A;  4H3U A;  3IPT A;  4R1K A;  1JN5 A;  5IEP A;  1O7G B;  4HZ9 B;  2BMR B;  1NWW A;  3MYT A;  2HMO B;  3UNL A;  3T8N A;  4OVM A;  4HM5 B;  3KSP A;  5CF1 A;  5KP4 A;  3B4O A;  3NV0 B;  2I9W A;  3MG3 A;  3OX9 A;  3OWU A;  4PEJ A;  3BB9 A;  1CQS A;  3KE7 A;  3B8L A;  2CHC A;  3WMD A;  3OXA A;  3JUM A;  3MKI A;  4XDV A;  2A15 A;  4XB5 A;  2HMN B;  5AIF A;  5STD A;  3FF0 A;  4K1U A;  2JQ5 A;  1O7N B;  2Z7A A;  3F7S A;  5TGN A;  2K54 A;  5AEU B;  1JN5 B;  2CKF B;  1TUH A;  4WYK B;  5KP3 A;  5FW5 A;  1OF5 A;  3CPO A;  3F9S A;  4J9A A;  4RZM A;  1O7W B;  4LMI A;  5IG0 A;  1E97 A;  5IG4 A;  3HZP A;  2F86 B;  2XSH B;  4HM7 B;  3NXJ A;  4R9L A;  5G2G A;  1JB5 A;  4OUQ A;  3JUO A;  3KZT A;  1O7P B;  1O7H B;  3D9R A;  2HML B;  1QMA A;  3EBT A;  3VGN A;  4WWU C;  1W00 A;  2GEX A;  3FLJ A;  4N3V A;  3K0Z A;  3DXO A;  3B4P A;  4XM4 A;  2STD A;  3OV4 A;  5BXQ A;  5JPU A;  3MG2 A;  3MHE A;  5JPP A;  3S5C A;  4XDW A;  3FH1 A;  3F7X A;  1OUN A;  3F8X A;  1OGZ A;  3DMC A;  3A76 A;  4HM8 B;  4R9K A;  3GZB A;  4WYK A;  5AII A;  2GBW B;  2YFI B;  4FCJ A;  2PZV A;  3GZY B;  4HM6 B;  1OHO A;  5AIG A;  1Q40 B;  1WQL B;  1Z1S A;  3FGY A;  5DRE A;  3SED A;  2XSO B;  1GY5 A;  2IMJ A;  3ER7 A;  1AR0 A;  4HZB B;  4KVH A;  3F40 A;  3GZR A;  1NU3 A;  4XBY A;  5CXO A;  5IEO A;  2Z76 A;  3NV0 A;  4LGQ A;  4GB5 A;  4HVN A;  5IF6 A;  1EA2 A;  1UUV B;  1ASK A;  3B7C A;  3Q90 A;  5EVH A;  1JB2 A;  5IG3 A;  1VZZ A;  4IIA A;  2HMJ B;  2YFJ B;  1OGX A;  1O7M B;  6STD A;  2GEY A;  1DMN A;  1U5O A;  1ZX2 A;  3NM2 A;  2W2C A;  3EN1 B;  3H51 A;  1SJW A;  1ULI B;  8CHO A;  3EJV A;  3GWR A;  5IEN A;  5CF2 A;  3SOY A;  4L8P A;  7STD A;  3EC9 A; 
#chains in the Genus database with same CATH topology
 1BNI A;  3HK4 A;  4O8S A;  1V74 A;  5AI1 A;  1N8R 4;  2CW9 A;  1K41 A;  2XR8 B;  3G0K A;  3MWZ A;  1W02 A;  4BL3 A;  1N9E A;  1OCV A;  1IVW A;  2BMO B;  2XFT A;  2R4I A;  3FF2 A;  1M90 4;  3E99 A;  5FGO A;  3D3L A;  3EX9 A;  1UUG B;  3NBB A;  1RRH A;  4EC6 A;  4LZI A;  3G8Z A;  1KC8 4;  3EE1 A;  1S72 3;  4HKV B;  1B21 A;  1JKG A;  1N8Q A;  2HMM B;  3OWS A;  3OWY A;  1JZO A;  3AHS A;  4N6L A;  1I3I A;  3SYU A;  1B2Z A;  3V99 A;  4AKY A;  1WMP A;  1YVS A;  3GRD A;  3PCR A;  3NQY A;  4WP5 A;  4CDL A;  1FA3 A;  4L8O A;  4X2H A;  4EV5 A;  1LVN A;  1SPU A;  3A5E A;  1DMQ A;  3EQQ B;  1JNQ A;  1GY7 A;  5CK6 A;  3SXX A;  4NPB A;  2INX A;  2KXG A;  3F14 A;  2XF3 A;  5M18 A;  1YIT 3;  3G71 3;  2V1L A;  1RNB A;  2RFR A;  2CX1 A;  1LNH A;  2ZL8 A;  3CU3 A;  4FMD A;  2CFW A;  3EBY A;  4U13 A;  3RGR A;  3CNX A;  3STD A;  1GS3 A;  4HAA A;  1BSA A;  2XGN A;  3Q1C A;  1RHL A;  4N6O B;  1Q86 4;  4IPB A;  4HM3 B;  3HX8 A;  1UUW B;  3BNC A;  1QAK A;  2F5W A;  2KF4 A;  1QAF A;  2C11 A;  4NRE A;  1NB3 I;  3LZA A;  1AQZ A;  3CNM A;  4KFD A;  3CCS 3;  3EHC A;  4CPK A;  4STD A;  3VSY A;  3D5I A;  1JJ2 2;  1GOV A;  2CK3 H;  3U97 A;  2OCT A;  5AIH A;  1BNF A;  2Z77 A;  4FMC A;  2QA4 3;  1GMQ A;  3IPT A;  4R1K A;  1JN5 A;  5IEP A;  4HZ9 B;  1T2I A;  3BNB A;  3AMO B;  3LTA A;  3T8N A;  1PU4 A;  1BU4 A;  2CFD A;  5CF1 A;  3OX9 A;  4EV2 A;  3KE7 A;  1CQS A;  1W6G A;  4OK0 A;  1FGT A;  5STD A;  1I0V A;  4R80 A;  3CCJ 3;  1O7N B;  1X1X A;  2Z7A A;  6GSP A;  2K54 A;  2OOV A;  4GHO A;  5AEU B;  1I0X A;  1TUH A;  3WOE B;  3CPO A;  3CCL 3;  1STF I;  1T5Y A;  2XSH B;  4HM7 B;  3NXJ A;  3VF1 A;  1GMR A;  3LTB A;  1JB5 A;  2MF7 A;  2LQV A;  1O7H B;  3D9R A;  2HML B;  3D79 A;  1BNS A;  3X41 A;  3LTD A;  2GEX A;  3K9M C;  4J5K A;  3SX1 A;  2WOH A;  3DXO A;  3OV4 A;  3MHE A;  3CCM 3;  1QVG 2;  4CJN A;  3FH1 A;  4HM8 B;  3X42 A;  4WYK A;  1UCK A;  3A76 A;  5AII A;  3GZB A;  1B2U A;  1I2F A;  3LH4 A;  3WOD G;  2D42 A;  1OHO A;  1AVK A;  1Q40 B;  3CD6 3;  2RNT A;  3FGY A;  4MMY B;  4O02 B;  1AR0 A;  1FGR A;  2YX9 A;  3BU4 A;  1LOV A;  1T2H A;  1MOL A;  1D6Y A;  2Z76 A;  4N6U A;  5I97 A;  5A0O B;  4GB5 A;  4HVN A;  4EXR A;  1EA2 A;  1CH0 A;  1B3S A;  1I3F A;  3KSE D;  1UUV B;  5EVH A;  1JB2 A;  1KSI A;  1O7M B;  1RGF A;  4HOH A;  1DMN A;  1ULI B;  1TJD A;  3PGB A;  2IUJ A;  5IEN A;  3DGY A;  3AGO A;  7STD A;  5EQL A;  3JUN A;  3K7C A;  5D81 A;  2H0I A;  3DM8 A;  3CXC 2;  2WGQ A;  2RSX A;  1ZO2 A;  3NUV A;  1K73 4;  3AHW A;  1AVL A;  5HOH A;  2BO9 B;  2F98 A;  4HM1 B;  1RN7 A;  5AYR B;  1DET A;  1LOX A;  2UX0 A;  2OOV C;  4X2O A;  1YHQ 3;  1I70 A;  1ISK A;  1KWI A;  1WNH A;  3DZL A;  4GL6 A;  2H0G A;  4AEQ A;  3CC7 3;  1FYS A;  1X1Y A;  5DRV A;  3M8C A;  3KCH A;  1BUQ A;  2GBX B;  1GY6 A;  3OW2 2;  1BRN L;  1LXE A;  3SOA A;  1B20 A;  1VQN 3;  1OHP A;  1Q42 A;  1W2Z A;  4BL2 A;  3FZW A;  2IUK A;  3FG4 A;  3F8H A;  5HGR A;  1OF5 B;  1UCJ A;  2XRX B;  4NHF A;  1BNE A;  5D83 A;  3AMO A;  4XBT A;  2QEX 3;  3X3Y A;  4MMX B;  1DMM A;  2BT3 A;  2WOF A;  3CC4 3;  1A2V A;  1G0T A;  4ILF A;  2JDI H;  4HJL B;  1RGH A;  2IYJ A;  1UW1 A;  1MWR A;  1PYL A;  4BTY A;  1L5G B;  1LQG C;  3DGO A;  1JBR A;  3EN8 A;  1FUS A;  2QIY A;  1M1K 4;  3EB8 A;  3NM7 A;  3PYJ A;  3BND A;  1JB4 A;  3J7Y d;  1YI2 3;  1BNG A;  3BLZ A;  1N5H A;  2ZA4 A;  3GZX B;  3H3H A;  1SIH A;  3LT8 A;  4L7K A;  4N6N B;  1BVI A;  4MJD A;  5BVB A;  1YJ9 3;  1IVV A;  2Z6B A;  4J8T A;  1O7G B;  1TRP A;  1IQY A;  1UI8 A;  3BIR A;  5G1L A;  2KF3 A;  1MWU A;  4OVM A;  2OQE C;  1RCL A;  3T8U A;  1RMS A;  4FMA A;  1LOY A;  3BB9 A;  3UB1 A;  4JRF A;  5M1A A;  3URP A;  4XDV A;  1RGK A;  1IQX A;  1DE3 A;  4K1U A;  1US1 A;  5TGN A;  1YIJ 3;  2SBL A;  1VQ4 3;  1MNL A;  3CCR 3;  1IVX A;  1JN5 B;  2CKF B;  4WYK B;  5KP3 A;  3LTC A;  3F9S A;  3BNE A;  2CG0 A;  4H61 A;  4R9L A;  3I56 3;  2CX0 A;  4OUQ A;  1RGA A;  4J5G A;  2PNC A;  1PFP A;  3CME 3;  4N6T A;  1QMA A;  1VQL 3;  2E2U A;  1N5P A;  4RNY A;  4WWU C;  1J2B A;  1YVB I;  4N3V A;  5BXQ A;  4LYL B;  5LC6 A;  1GSP A;  3DGL A;  1NJI 4;  3S5C A;  4XDW A;  1JV2 B;  2ML5 A;  3F8X A;  5AYS C;  1T3B A;  2WGO A;  1G96 A;  4BIR A;  1HU9 A;  2P05 A;  4R4K A;  2YFI B;  3ALA A;  2PZV A;  2XGL A;  3GZY B;  4RNT A;  3ZFZ A;  3G6E 3;  1TRQ A;  2KRT A;  2OTL 3;  3FCS B;  2XSO B;  1Q7Y 4;  4O3V A;  5G1K A;  1BNJ A;  3ER7 A;  2D1W A;  5CXO A;  2MC8 A;  3WMD A;  3GZR A;  3FG1 A;  2F4Y A;  1MWS A;  1B27 A;  4WFO A;  3N9H A;  1BIR A;  1MGR A;  3WR2 A;  3L0R A;  4IIA A;  2YFJ B;  1DVD A;  1OGX A;  3MPH A;  1BAN A;  1YNV X;  3NQZ A;  1DYU A;  3CC2 3;  1ZX2 A;  1SJW A;  3EJV A;  1BRH A;  2FXT A;  3GWR A;  1FGM A;  1BRG A;  8RNT A;  1MGW A;  1BAO A;  1VQ5 3;  1TIJ A;  3CCV 3;  2CWU A;  1FGO A;  3ECF A;  4EBG A;  1KQS 2;  1RGC A;  2F5M A;  5IER A;  1HYF A;  3O8Y A;  1D6Z A;  2P38 A;  1FGQ A;  1EG9 B;  1MWT A;  3LML A;  4I4K A;  4KFE A;  3I55 3;  5KP1 A;  1W2B 2;  1Q82 4;  1E3R A;  2HOH A;  2J8X B;  1KD1 4;  4HM2 B;  1LOW A;  1M1X B;  3ROB A;  2BU4 A;  1VQQ A;  1EUI C;  3EF8 A;  2BMQ B;  2Q07 A;  5EEO A;  2F99 A;  2RGQ A;  4EW5 A;  1A67 A;  1BGS A;  1RDS A;  3IJE B;  1NB5 I;  3KKG A;  3SLU A;  3G16 A;  3K5T A;  3WDG B;  1JKG B;  3DGM A;  4ZM8 A;  4LSO A;  2B24 B;  3PCS A;  4MEI A;  2QGU A;  2BHM A;  2CFL A;  1ROV A;  5AEW B;  5BIR A;  1I8V A;  1BSC A;  1UGI A;  1E3V A;  1V57 A;  5GSP A;  2CWV A;  2ZHX B;  5IG5 A;  1HKX A;  1Y4K A;  1Q7H A;  1CYU A;  3LOY A;  1QVF 2;  1RGL A;  1IYY A;  1RTU A;  3DGN A;  1ZS7 A;  2CIU A;  3PS8 A;  2KF5 A;  1S5A A;  3FKA A;  4FMB A;  2K0M A;  1GOY A;  3SVA A;  3S29 A;  1FUW A;  3LXU X;  4LEH A;  3D4A A;  2H0H A;  4KT3 B;  5ELU A;  1OH0 A;  2B1X B;  1X1U A;  1W01 A;  1TP6 A;  1I2E A;  2WO0 A;  3NHX A;  1QJG A;  1Q40 A;  1NO3 A;  1W6Y A;  2RBI A;  1TTO A;  3X40 A;  3ZG5 A;  2UUG C;  1Q81 4;  7GSP A;  1NWW A;  1WMO A;  3MYT A;  3UNL A;  9RNT A;  1UI7 A;  1NNV A;  2R41 A;  3HOH A;  3N8B A;  4HM5 B;  5LC7 A;  5KP4 A;  4O2H A;  3NV0 B;  1IVU A;  3MG3 A;  2GU3 A;  4PEJ A;  4AKZ A;  1YJW 3;  3B8L A;  1VQO 3;  1JBT A;  3OXA A;  2P0M A;  3JUM A;  3MKI A;  2A15 A;  2W56 A;  2HMN B;  1LQM B;  1IQ8 A;  2AAE A;  3V92 A;  4BU4 A;  2JQ5 A;  2GSP A;  3F7S A;  3S28 A;  1BRJ A;  1GD4 A;  1EEJ A;  2W03 A;  1CEW I;  5FW5 A;  4RZM A;  3HIG A;  4J9A A;  5IG4 A;  1JRQ A;  4LMI A;  3CCU 3;  1E97 A;  1IU7 A;  3KII A;  2F86 B;  3KN4 A;  1ZGX A;  3HII A;  1W7C A;  1FUT A;  1O7P B;  1BSE A;  1Q9E A;  2P0X A;  2FGT A;  3VGN A;  3TDG A;  3PZW A;  3FLJ A;  1B2S A;  2IY2 A;  3K0Z A;  5BU4 A;  2STD A;  4HYZ A;  3MG2 A;  1CYV A;  5JPP A;  2L4V A;  2F56 A;  1M9G A;  3F7X A;  1LNI A;  1OGZ A;  1BRI A;  1QAL A;  2CWT A;  1BSD A;  1W6C A;  1WTH A;  4BTX A;  3CCQ 3;  3CMA 3;  2FNQ A;  4HM6 B;  1GOU A;  2XFS A;  5AIG A;  4R9K A;  3RDE A;  5DRE A;  5JBS A;  3UL6 A;  3Q3F A;  1TU5 A;  1GY5 A;  1K28 A;  3PXM A;  1RGE A;  4HZB B;  4KVH A;  4DKI A;  3F40 A;  1NU3 A;  2W9Q A;  1VQ7 3;  2AAD A;  4LGQ A;  2W04 A;  1JBS A;  5IF6 A;  1UCL A;  1BRK A;  4CCV A;  1ASK A;  2KAA A;  3B7C A;  3Q90 A;  5M19 A;  5IG3 A;  1VZZ A;  4FCZ A;  3WHO A;  1RCK A;  1C54 A;  6STD A;  4RNZ A;  1IK3 A;  1UDI I;  3N54 B;  2GEY A;  2W0Q A;  4K61 A;  3NM2 A;  2W2C A;  8CHO A;  2C4B A;  3HI7 A;  1VQK 3;  3V98 A;  2OWP A;  4N6M A;  1EKM A;  3S27 A;  4MMZ B;  1IV7 A;  2OQE A;  1NDO B;  3GAX A;  2Y73 A;  1IT8 A;  3DY5 A;  1OHS A;  4RBN A;  2HMK B;  2UGI A;  1STD A;  3U1W A;  4WHA A;  1TFK A;  3JUP A;  4K90 B;  3CCE 3;  5ELJ A;  1RGG A;  1TFO A;  3DUK A;  4FCM A;  3QRD A;  4K1V A;  5CLK A;  2E2T A;  4TX4 A;  2CH9 A;  1FZU A;  2KCD A;  3MG1 A;  5D82 A;  3DH2 A;  2ZDJ A;  1W4N A;  4ORL A;  3JUQ A;  3KFQ C;  2CG1 A;  4KFF A;  2Y74 A;  3MSO A;  5IW9 A;  2XH9 A;  4G1M B;  1N9J A;  2E2V A;  1GYB A;  2O9U X;  1X1W A;  3LYG A;  2BNG A;  2GXF A;  2RCD A;  3I0Y A;  4HM0 B;  4Q53 A;  3D5G A;  4HBR A;  3UJM A;  1A2K A;  3G4S 3;  1VQ8 3;  3FSD A;  1EQK A;  2W6J H;  3LT9 A;  3X3X A;  2YFL B;  1JZD A;  3AGN A;  1BOX A;  4IT7 A;  1SII A;  3NBR A;  4HM4 B;  1OPY A;  3NX0 A;  1ULJ B;  4XBX A;  3RGA A;  2K3D A;  2KF6 A;  1D6U A;  2ML6 A;  2C10 A;  1B2X A;  1IDP A;  1SAR A;  1C7H A;  4H3U A;  1DVC A;  1RSN A;  2BMR B;  1R4Y A;  2HMO B;  1VQ9 3;  3KSP A;  3B4O A;  2I9W A;  3OWU A;  1BNR A;  3T0U A;  1RKY A;  2CHC A;  1U8C B;  3GSP A;  1R4C A;  1RJO A;  2M7O A;  1I2G A;  2XEP A;  4XB5 A;  5AIF A;  1RN4 A;  1GMP A;  2CFG A;  3FF0 A;  3WA3 A;  1B2M A;  1GD3 A;  1VQ6 3;  1OF5 A;  1O7W B;  1AY7 A;  5IG0 A;  2BIR A;  2SAR A;  3UL5 A;  3HZP A;  3CPW 2;  2O3O A;  1YJN 3;  5G2G A;  1IV9 A;  4N6V 0;  3WA2 X;  2W9P A;  1PY3 A;  2L1S A;  3JUO A;  3KZT A;  1WMN A;  2CC3 A;  4FR9 A;  1RRL A;  2OTJ 3;  1BRS A;  3EBT A;  2LYX A;  3WOF B;  4BTW A;  1BUJ A;  1W00 A;  2CFK A;  4XM4 A;  5JPU A;  4JF8 A;  3B4P A;  1A2P A;  1F8N A;  1K9M 4;  1OUN A;  3DMC A;  1UCI A;  5RNT A;  2GBW B;  3NBJ A;  1RN1 A;  4FCJ A;  3RNT A;  3FG3 A;  1BSB A;  1Z1S A;  1WQL B;  2W56 B;  1RNT A;  3X3Z A;  1G02 A;  3IMA B;  3SED A;  4EYC A;  7RNT A;  2IMJ A;  2P09 A;  4KZ1 A;  5IEO A;  4XBY A;  1W5Z A;  4I5Q A;  1OAC A;  1LRA A;  1YGE A;  3NV0 A;  1IT7 A;  1SQW A;  1ROA A;  4QWT A;  3JVC A;  1A90 A;  2GU1 A;  3S67 A;  1V58 A;  1YGW A;  1VQM 3;  1UGH I;  1AV4 A;  2HMJ B;  3Q2P A;  2IA7 A;  1U5O A;  1RLS A;  3QK9 A;  1HZ1 A;  3K63 A;  1K8A 4;  3EN1 B;  3H51 A;  4GSP A;  1VQP 3;  5CF2 A;  3SOY A;  3ZG0 A;  4L8P A;  1FW7 A;  6RNT A;  3EC9 A; 
#chains in the Genus database with same CATH homology
 5AI1 A;  3HK4 A;  4O8S A;  1V74 A;  1N8R 4;  2CW9 A;  1K41 A;  2XR8 B;  3G0K A;  3MWZ A;  1W02 A;  1N9E A;  1OCV A;  1IVW A;  2BMO B;  2XFT A;  2R4I A;  3FF2 A;  1M90 4;  3E99 A;  5FGO A;  3D3L A;  3EX9 A;  3NBB A;  1RRH A;  4EC6 A;  4LZI A;  3G8Z A;  1KC8 4;  3EE1 A;  1S72 3;  4HKV B;  2HMM B;  1JKG A;  1N8Q A;  3OWS A;  3OWY A;  4N6L A;  3V99 A;  4AKY A;  1WMP A;  3GRD A;  3PCR A;  3NQY A;  4WP5 A;  4CDL A;  1FA3 A;  4L8O A;  4X2H A;  4EV5 A;  1LVN A;  1SPU A;  1DMQ A;  3EQQ B;  1JNQ A;  1GY7 A;  5CK6 A;  3SXX A;  2INX A;  2KXG A;  3F14 A;  2XF3 A;  1YIT 3;  3G71 3;  2V1L A;  2RFR A;  1LNH A;  2ZL8 A;  3CU3 A;  4FMD A;  2CFW A;  3EBY A;  4U13 A;  3RGR A;  3CNX A;  3STD A;  1GS3 A;  2XGN A;  3Q1C A;  4N6O B;  1Q86 4;  4IPB A;  4HM3 B;  3HX8 A;  1UUW B;  3BNC A;  1QAK A;  1QAF A;  2C11 A;  4NRE A;  1NB3 I;  3LZA A;  3CNM A;  3CCS 3;  4KFD A;  3EHC A;  4STD A;  3VSY A;  1JJ2 2;  2CK3 H;  3U97 A;  2OCT A;  5AIH A;  2Z77 A;  4FMC A;  2QA4 3;  3IPT A;  4R1K A;  1JN5 A;  5IEP A;  4HZ9 B;  3BNB A;  3AMO B;  3LTA A;  3T8N A;  1PU4 A;  2CFD A;  5CF1 A;  3OX9 A;  4EV2 A;  3KE7 A;  1CQS A;  1W6G A;  4OK0 A;  1FGT A;  5STD A;  4R80 A;  3CCJ 3;  1O7N B;  2Z7A A;  2K54 A;  2OOV A;  5AEU B;  1TUH A;  3WOE B;  3CPO A;  3CCL 3;  1STF I;  1T5Y A;  2XSH B;  4HM7 B;  3NXJ A;  3VF1 A;  3LTB A;  1JB5 A;  2MF7 A;  2LQV A;  1O7H B;  3D9R A;  2HML B;  3X41 A;  3LTD A;  2GEX A;  3K9M C;  3SX1 A;  2WOH A;  3DXO A;  3OV4 A;  3MHE A;  3CCM 3;  1QVG 2;  3FH1 A;  4HM8 B;  3X42 A;  4WYK A;  3A76 A;  5AII A;  3GZB A;  3LH4 A;  3WOD G;  2D42 A;  1OHO A;  1AVK A;  1Q40 B;  3CD6 3;  3FGY A;  4MMY B;  4O02 B;  1AR0 A;  1FGR A;  2YX9 A;  4N6U A;  1MOL A;  1D6Y A;  2Z76 A;  5I97 A;  5A0O B;  4GB5 A;  4HVN A;  4EXR A;  1EA2 A;  3KSE D;  1UUV B;  5EVH A;  1JB2 A;  1KSI A;  1O7M B;  1DMN A;  1ULI B;  2IUJ A;  3PGB A;  5IEN A;  7STD A;  5EQL A;  3JUN A;  3K7C A;  5D81 A;  3DM8 A;  3CXC 2;  2WGQ A;  2RSX A;  1ZO2 A;  3NUV A;  1K73 4;  1AVL A;  2BO9 B;  2F98 A;  4HM1 B;  1RN7 A;  5AYR B;  1LOX A;  2UX0 A;  2OOV C;  4X2O A;  1YHQ 3;  1ISK A;  1KWI A;  1WNH A;  3DZL A;  4GL6 A;  4AEQ A;  3CC7 3;  5DRV A;  3M8C A;  1BUQ A;  2GBX B;  1GY6 A;  3OW2 2;  1LXE A;  3SOA A;  1VQN 3;  1OHP A;  1Q42 A;  1W2Z A;  3FZW A;  2IUK A;  3FG4 A;  3F8H A;  5HGR A;  1OF5 B;  2XRX B;  5D83 A;  3AMO A;  4XBT A;  2QEX 3;  3X3Y A;  4MMX B;  1DMM A;  2BT3 A;  2WOF A;  3CC4 3;  1A2V A;  2JDI H;  4HJL B;  1UW1 A;  4BTY A;  1L5G B;  3DGO A;  3EN8 A;  1M1K 4;  2QIY A;  3EB8 A;  3NM7 A;  3PYJ A;  3BND A;  1JB4 A;  3J7Y d;  1YI2 3;  3BLZ A;  1N5H A;  3GZX B;  3H3H A;  3LT8 A;  1SIH A;  4L7K A;  4N6N B;  5BVB A;  4MJD A;  1YJ9 3;  1IVV A;  2Z6B A;  4J8T A;  1O7G B;  1IQY A;  1UI8 A;  4OVM A;  2OQE C;  3T8U A;  4FMA A;  3BB9 A;  3UB1 A;  4JRF A;  4XDV A;  1IQX A;  4K1U A;  1US1 A;  5TGN A;  1YIJ 3;  2SBL A;  1VQ4 3;  1MNL A;  3CCR 3;  1IVX A;  1JN5 B;  2CKF B;  4WYK B;  5KP3 A;  3LTC A;  3F9S A;  3BNE A;  2CG0 A;  4H61 A;  4R9L A;  3I56 3;  4OUQ A;  2PNC A;  1PFP A;  3CME 3;  4N6T A;  1QMA A;  1VQL 3;  2E2U A;  1N5P A;  4RNY A;  4WWU C;  1J2B A;  1YVB I;  4N3V A;  5BXQ A;  5LC6 A;  1NJI 4;  3DGL A;  3S5C A;  4XDW A;  1JV2 B;  2ML5 A;  3F8X A;  5AYS C;  2WGO A;  1G96 A;  1HU9 A;  2P05 A;  4R4K A;  2YFI B;  3ALA A;  2PZV A;  2XGL A;  3GZY B;  3G6E 3;  2KRT A;  2OTL 3;  3FCS B;  2XSO B;  1Q7Y 4;  4O3V A;  2MC8 A;  3ER7 A;  2D1W A;  5CXO A;  3WMD A;  3GZR A;  3FG1 A;  4WFO A;  3N9H A;  3L0R A;  4IIA A;  2YFJ B;  1DVD A;  1OGX A;  3MPH A;  3NQZ A;  3CC2 3;  1DYU A;  1ZX2 A;  1SJW A;  3EJV A;  2FXT A;  3GWR A;  1FGM A;  1VQ5 3;  1TIJ A;  3CCV 3;  2CWU A;  1FGO A;  3ECF A;  4EBG A;  1KQS 2;  5IER A;  3O8Y A;  1D6Z A;  2P38 A;  1FGQ A;  1EG9 B;  3LML A;  4I4K A;  4KFE A;  3I55 3;  5KP1 A;  1W2B 2;  1Q82 4;  1E3R A;  1KD1 4;  4HM2 B;  1M1X B;  3ROB A;  3EF8 A;  2BMQ B;  2Q07 A;  5EEO A;  2F99 A;  2RGQ A;  1A67 A;  1NB5 I;  3IJE B;  3KKG A;  3SLU A;  3G16 A;  3K5T A;  3WDG B;  1JKG B;  3DGM A;  4ZM8 A;  4LSO A;  2B24 B;  3PCS A;  4MEI A;  2QGU A;  2BHM A;  2CFL A;  1ROV A;  5AEW B;  1E3V A;  2CWV A;  5IG5 A;  1HKX A;  1Y4K A;  1CYU A;  3LOY A;  1QVF 2;  3DGN A;  2CIU A;  3PS8 A;  1S5A A;  3FKA A;  4FMB A;  2K0M A;  3SVA A;  3S29 A;  1FUW A;  3LXU X;  4LEH A;  5ELU A;  1OH0 A;  2B1X B;  1W01 A;  1TP6 A;  2WO0 A;  3NHX A;  4NHF A;  1QJG A;  1Q40 A;  1NO3 A;  1W6Y A;  3X40 A;  1Q81 4;  1NWW A;  1WMO A;  3MYT A;  3UNL A;  1UI7 A;  5LC7 A;  3N8B A;  4HM5 B;  5KP4 A;  4O2H A;  3NV0 B;  1IVU A;  3MG3 A;  2GU3 A;  4PEJ A;  4AKZ A;  1YJW 3;  3B8L A;  1VQO 3;  3OXA A;  2P0M A;  3JUM A;  3MKI A;  2A15 A;  2W56 A;  2HMN B;  1IQ8 A;  3V92 A;  2JQ5 A;  3F7S A;  3S28 A;  1GD4 A;  2W03 A;  1CEW I;  5FW5 A;  4RZM A;  3HIG A;  4J9A A;  5IG4 A;  1JRQ A;  4LMI A;  3CCU 3;  1E97 A;  1IU7 A;  3KII A;  2F86 B;  3KN4 A;  3HII A;  1W7C A;  1O7P B;  2P0X A;  3VGN A;  2FGT A;  3TDG A;  3PZW A;  3FLJ A;  3K0Z A;  2STD A;  4HYZ A;  3MG2 A;  1CYV A;  5JPP A;  2L4V A;  1M9G A;  3F7X A;  4R9K A;  1OGZ A;  4BTX A;  1QAL A;  2CWT A;  1W6C A;  1WTH A;  3CCQ 3;  3CMA 3;  2FNQ A;  4HM6 B;  2XFS A;  5AIG A;  3RDE A;  5DRE A;  5JBS A;  3UL6 A;  1TU5 A;  1GY5 A;  1K28 A;  3PXM A;  4HZB B;  4KVH A;  3F40 A;  1NU3 A;  2W9Q A;  1VQ7 3;  4LGQ A;  2W04 A;  5IF6 A;  4CCV A;  1ASK A;  3B7C A;  3Q90 A;  5IG3 A;  1VZZ A;  4FCZ A;  6STD A;  4RNZ A;  1IK3 A;  3N54 B;  2GEY A;  2W0Q A;  4K61 A;  3NM2 A;  2W2C A;  8CHO A;  3HI7 A;  1VQK 3;  3V98 A;  2OWP A;  4N6M A;  1EKM A;  3S27 A;  4MMZ B;  1IV7 A;  2OQE A;  1NDO B;  3GAX A;  2Y73 A;  1IT8 A;  3DY5 A;  1OHS A;  4RBN A;  2HMK B;  1STD A;  3U1W A;  4WHA A;  1TFK A;  3JUP A;  4K90 B;  3CCE 3;  5ELJ A;  1TFO A;  3DUK A;  4FCM A;  3QRD A;  4K1V A;  5CLK A;  2E2T A;  4TX4 A;  2CH9 A;  2KCD A;  3MG1 A;  5D82 A;  2ZDJ A;  1W4N A;  4ORL A;  3JUQ A;  3KFQ C;  2CG1 A;  4KFF A;  2Y74 A;  3MSO A;  5IW9 A;  2XH9 A;  4G1M B;  1N9J A;  2E2V A;  1GYB A;  2O9U X;  3LYG A;  2BNG A;  2GXF A;  2RCD A;  3I0Y A;  4HM0 B;  4Q53 A;  4HBR A;  1VQ8 3;  3UJM A;  1A2K A;  3G4S 3;  1EQK A;  3FSD A;  2W6J H;  3LT9 A;  3X3X A;  2YFL B;  4IT7 A;  1SII A;  3NBR A;  4HM4 B;  1OPY A;  3NX0 A;  1ULJ B;  4XBX A;  3RGA A;  1D6U A;  2ML6 A;  2C10 A;  1IDP A;  1C7H A;  4H3U A;  1DVC A;  2BMR B;  2HMO B;  1VQ9 3;  3KSP A;  3B4O A;  2I9W A;  3OWU A;  3T0U A;  1RKY A;  2CHC A;  1U8C B;  1R4C A;  1RJO A;  2M7O A;  2XEP A;  4XB5 A;  5AIF A;  3FF0 A;  2CFG A;  3WA3 A;  1GD3 A;  1VQ6 3;  1OF5 A;  1O7W B;  5IG0 A;  3UL5 A;  3HZP A;  3CPW 2;  2O3O A;  1YJN 3;  5G2G A;  1IV9 A;  4N6V 0;  3WA2 X;  2W9P A;  3JUO A;  3KZT A;  1WMN A;  2CC3 A;  4FR9 A;  1RRL A;  2OTJ 3;  3EBT A;  2LYX A;  3WOF B;  4BTW A;  1W00 A;  2CFK A;  4XM4 A;  5JPU A;  4JF8 A;  3B4P A;  1F8N A;  1K9M 4;  1OUN A;  3DMC A;  2GBW B;  3NBJ A;  4FCJ A;  3FG3 A;  1Z1S A;  1WQL B;  2W56 B;  3X3Z A;  4EYC A;  3IMA B;  3SED A;  2IMJ A;  2P09 A;  4KZ1 A;  5IEO A;  4XBY A;  1W5Z A;  1OAC A;  1YGE A;  3NV0 A;  1IT7 A;  1SQW A;  1ROA A;  4QWT A;  3JVC A;  1A90 A;  2GU1 A;  3S67 A;  1VQM 3;  1AV4 A;  2HMJ B;  3Q2P A;  2IA7 A;  1U5O A;  3QK9 A;  3K63 A;  1K8A 4;  3EN1 B;  3H51 A;  1VQP 3;  5CF2 A;  3SOY A;  4L8P A;  3EC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...