1RGEA

Hydrolase, guanyloribonuclease
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgeA00
1FYSA 2C4BA 2KF4A 1I3IA 1DE3A 5BIRA 1GMQA 1B20A 3D5GA 1BRHA 1A2PA 5HOHA 1B3SA 2RNTA 1T2HA 2AADA 1BRJA 1BANA 1B2MA 1RGLA 1JBRA 1B2ZA 1AY7A 2F4YA 1BSEA 1RN1A 6RNTA 1CH0A 1FUSA 1LRAA 1FUTA 1BU4A 1I3FA 2AAEA 1I0XA 1LOYA 1RSNA 1BNFA 1YNVX 1GSPA 3Q3FA 1RHLA 1R4YA 2F56A 1BNGA 1BNSA 2RBIA 1UCLA 1BNIA 3AHWA 1GOVA 3D4AA 1RCLA 3BIRA 2KF3A 1X1XA 1X1WA 1RGCA 1TTOA 1RNTA 1B21A 2KAAA 1RGEA 1BUJA 1FW7A 3KCHA 3WHOA 7RNTA 1HYFA 1GOUA 3URPA 1I2EA 1GOYA 1RGHA 3AGNA 7GSPA 3GSPA 3SYUA 1RTUA 5RNTA 4RNTA 1IYYA 2SARA 1TRPA 3AGOA 1AQZA 3D5IA 4HAAA 1SARA 1ZGXA 9RNTA 1B2UA 1BNEA 1X1UA 1RCKA 1I8VA 1YVSA 1JBSA 1BNJA 8RNTA 1JBTA 1MGRA 1UCJA 3DH2A 1BVIA 1BRKA 1RGFA 1I2FA 1C54A 1BOXA 6GSPA 1B2XA 5BU4A 1TRQA 1LOVA 1BRSA 1RGKA 1DETA 1RNBA 1BAOA 1I70A 4GSPA 3DGYA 1BGSA 4GHOA 1B2SA 1RN4A 1GMPA 3HOHA 2F5MA 1B27A 2KF6A 1LNIA 1LOWA 3RNTA 1BNRA 2HOHA 1BSBA 3WR2A 4BIRA 2KF5A 5GSPA 2F5WA 1Q9EA 1BSDA 1HZ1A 4HOHA 1UCKA 1BRIA 1UCIA 1BRNL 2ZA4A 4J5KA 1RLSA 1I2GA 1BSCA 1YGWA 3BU4A 4BU4A 1PYLA 1BIRA 1RGAA 1RGGA 1X1YA 1FZUA 2BIRA 2GSPA 1MGWA 1GMRA 1I0VA 3A5EA 1BSAA 1RMSA 1PY3A 1BRGA 4J5GA 2BU4A 1RDSA 3AHSA 1T2IA 1G02A
chains in the Genus database with same CATH superfamily
1FYSA 3FSDA 2Z7AA 3RGRA 1OCVA 3RGAA 4X2HA 1W6GA 2Z76A 2P09A 4JF8A 1FGOA 1I3IA 4K1VA 3CNXA 1DMQA 3D5GA 5AEWB 2SBLA 2O3OA 3ROBA 3B4OA 1VQL3 3HK4A 1CEWI 3IPTA 5HOHA 1B3SA 1VQO3 2ZHXB 2RNTA 2MF7A 1KQS2 4I4KA 1T2HA 2UX0A 3CD63 3K9MC 1RGLA 3LOYA 2F4YA 6RNTA 1JZDA 1VZZA 2H0GA 1CH0A 1KWIA 1ZX2A 2XFTA 2B24B 2BNGA 1I3FA 4AKZA 5AIGA 1K28A 3NHXA 3X41A 3Q3FA 5EVHA 4PEJA 4N6OB 1IU7A 2WGQA 2F56A 2RBIA 1BNGA 1BNSA 3AHWA 1UCLA 1BNIA 1DVCA 3EN8A 1QJGA 2GXFA 1MWTA 1RCLA 2W03A 4H61A 3BIRA 1QVG2 2PNCA 3FGYA 1IDPA 1O7NB 5CXOA 1TTOA 3BNCA 1RNTA 1B21A 1ASKA 3BLZA 4KFEA 3KCHA 3HX8A 3GZRA 3F9SA 3K7CA 1OPYA 2HMLB 3CXC2 4HM7B 1LOXA 1RRLA 2F98A 1MWUA 2P38A 4TX4A 4G1MB 2XR8B 1RGHA 3NM2A 3WOFB 4CDLA 3CCL3 1W2B2 4MMYB 3IMAB 4HM0B 1VQN3 2CX1A 4WYKA 4ORLA 1UUGB 3X3ZA 4CPKA 3D5IA 1AV4A 1UGIA 1MOLA 3BNBA 4HM1B 4KT3B 3DMCA 4FCMA 1SIIA 1BNEA 4HM5B 4HM8B 1BNJA 1VQ43 5D82A 8RNTA 3D3LA 1BRKA 1W2ZA 2RGQA 5IEPA 1JKGB 2Y74A 3CPOA 3CCS3 1C54A 5AIFA 1NO3A 1QALA 1YGEA 3DGMA 1IQ8A 4MMZB 4ILFA 1DYUA 7STDA 5BU4A 1TRQA 3G713 4XBYA 2CG0A 2RSXA 3EX9A 2O9UX 4GSPA 4HJLB 5JBSA 4CCVA 3PCRA 3BNDA 1WMOA 1NU3A 1JB4A 4N3VA 4N6LA 2CIUA 1LNIA 3GZYB 3JUQA 1OUNA 3JVCA 1RKYA 3GZXB 3CCM3 4QWTA 3WR2A 4BIRA 1W6YA 3JUOA 1G96A 5GSPA 3CCE3 5G2GA 1BSDA 1VQQA 4RNYA 4EBGA 3NQZA 3MSOA 1Z1SA 3EN1B 3CME3 1IK3A 4MJDA 4XB5A 1UCIA 2BHMA 2HMJB 4NHFA 3OW22 1N8QA 2GU1A 4XM4A 4RZMA 3ZFZA 1YIJ3 1BSCA 3GAXA 1PYLA 1VQM3 1STFI 3PGBA 1E3VA 3BB9A 3X40A 1JB5A 4XDVA 1K734 4HVNA 1FZUA 1Q7HA 1W6CA 2E2UA 2UUGC 5D81A 2BO9B 1BSAA 1PY3A 3D9RA 4EW5A 5KP1A 8CHOA 2J8XB 3DY5A 3LXUX 3CC23 2GU3A 3V99A 1M1XB 1W02A 1Y4KA 4HZ9B 5EEOA 1UUVB 4N6V0 3SLUA 3MHEA 4KVHA 2B1XB 5JPUA 1OF5B 2WOFA 4OVMA 1N5PA 5M1AA 3WDGB 2HMNB 2CG1A 5ELJA 2GEYA 3DZLA 4N6UA 2OTL3 3CNMA 4I5QA 1ROVA 1YVBI 2AADA 1W5ZA 1BRJA 1B2MA 1GY5A 1O7PB 4EYCA 2Y73A 3FLJA 2CFLA 4K1UA 1Q824 4HM3B 1FUSA 5AIHA 1LOYA 1YNVX 1BNFA 1JN5B 1GSPA 1T3BA 2ML6A 2W9QA 3CPW2 1R4YA 3ER7A 1GOVA 1MWRA 3D4AA 5M18A 2E2VA 3DM8A 4FMBA 1X1WA 1RGCA 2L4VA 1NB3I 1ISKA 2W56B 1ZS7A 2FXTA 4BTYA 1UW1A 1RGEA 2C10A 3A76A 3X3XA 1BUJA 4XBXA 1ULJB 1MWSA 1W00A 2P05A 3B7CA 3H3HA 3GRDA 1GY6A 4JRFA 1HYFA 1GOUA 4IPBA 2IUKA 3DXOA 1I2EA 3CCJ3 1VQP3 1TFOA 1Q7Y4 2HMOB 2CFKA 1G0TA 3GSPA 4RBNA 1IVWA 1UGHI 2CWVA 3OXAA 2P0XA 2XRXB 3O8YA 5DREA 2SARA 3AGOA 4GB5A 1AQZA 3WA2X 2XEPA 5IG5A 4U13A 1U8CB 2R41A 4FMDA 1JB2A 3T8UA 1J2BA 1LVNA 3S29A 3WA3A 4R80A 1FUWA 1JNQA 4L8OA 3SOAA 1CYUA 2H0HA 2QGUA 3OV4A 2WO0A 1SPUA 1AR0A 4LMIA 3K63A 3DH2A 3I563 1EA2A 5I97A 2BMQB 5D83A 5DRVA 3CCV3 2CW9A 2H0IA 4WFOA 3SOYA 5IERA 4K90B 1I2FA 4HM2B 1A2VA 3FZWA 1Q42A 1BOXA 1B2XA 3H51A 1DETA 3JUMA 1AVLA 1BGSA 3T0UA 3KSPA 3FH1A 4GHOA 1IQYA 2W0QA 4N6TA 2KCDA 3EE1A 3HOHA 1TJDA 4IIAA 3EQQB 1JZOA 1B27A 2F5MA 3LT8A 3I0YA 1BSBA 1N5HA 1V57A 4K61A 1TU5A 2IY2A 3WODG 2IUJA 4BL2A 3F8XA 2CKFB 3ZG0A 2F5WA 2YFIB 1N9EA 1Q9EA 4XBTA 1HZ1A 3X3YA 2Q07A 1Q40A 1CQSA 2PZVA 2IMJA 2OWPA 3Q2PA 3N8BA 2W56A 2IYJA 2GEXA 3UL5A 2ZA4A 4FCZA 1M1K4 3LTAA 1GD4A 1I2GA 1S5AA 3BU4A 3FG4A 1L5GB 1KSIA 3NX0A 1BIRA 1OHPA 2GBXB 3FF2A 3LT9A 3RDEA 2GSPA 5CF1A 1N9JA 3QRDA 3CU3A 1MGWA 3KIIA 3UB1A 1W7CA 1U5OA 2FNQA 3WMDA 1YJ93 4J5GA 4LEHA 1IVVA 1G02A 3GZBA 3CCU3 2C4BA 2W9PA 3NUVA 4DKIA 2BMOB 1DE3A 3UL6A 5BIRA 2P0MA 1GMQA 1B20A 3UJMA 3EHCA 1O7GB 3FF0A 1SQWA 1NNVA 4H3UA 4BTXA 3CCR3 3ECFA 4IT7A 3KN4A 4CJNA 4HBRA 1BANA 3KZTA 2Z6BA 3CMA3 3LZAA 1JBRA 3OWYA 1UI7A 3OWUA 1AY7A 4O3VA 2LQVA 2INXA 1LRAA 3F7SA 3VGNA 1BU4A 3B8LA 3EBYA 2CX0A 1RSNA 2XSHB 3BNEA 3VSYA 1S723 3LTCA 1RN7A 1US1A 2XSOB 3F40A 2V1LA 2XFSA 5IG3A 2W6JH 1E3RA 1FGQA 2KF3A 3G8ZA 3G6E3 1D6ZA 5STDA 2M7OA 1HKXA 2KAAA 4N6NB 1O7MB 3SEDA 1ROAA 3KKGA 3NBRA 3WHOA 7RNTA 1JKGA 3FG1A 3URPA 4R4KA 1YJW3 3K5TA 5IENA 1WQLB 3FCSB 1LQGC 3F8HA 2OCTA 2RCDA 3SYUA 1SIHA 4AKYA 1V58A 1RTUA 2JDIH 2ML5A 1TRPA 3UNLA 4HM6B 3MWZA 4L8PA 4N6MA 2CH9A 2CWTA 1K41A 1SARA 4HAAA 9RNTA 5IF6A 4NPBA 1B2UA 1RRHA 3DGOA 5FW5A 1DVDA 2YFJB 3Q90A 4FMAA 1YVSA 2QA43 2KXGA 3N54B 3OX9A 3Q1CA 4R9LA 5HGRA 3ZG5A 1PU4A 2QEX3 1JJ22 1WMPA 1JBTA 1UCJA 1E97A 1BVIA 1D6UA 2HMMB 1GYBA 2CWUA 4X2OA 3CC43 4BL3A 1A90A 1UDII 1WNHA 1YHQ3 5G1KA 1SJWA 2A15A 5JPPA 1LOVA 1BRSA 2D1WA 2KRTA 4WYKB 1F8NA 2STDA 3DGYA 1IVUA 3OWSA 2XGLA 1KC84 3MG1A 1RN4A 3JUNA 1OACA 1IV9A 2YX9A 2CFWA 1OGZA 2OTJ3 2KF5A 3NBJA 2YFLB 1LNHA 1UUWB 1DMNA 1GS3A 4FMCA 1DMMA 4FR9A 5LC7A 5EQLA 5A0OB 5IG4A 5KP4A 1UCKA 3S67A 1BRIA 3M8CA 1FGTA 1C7HA 3PZWA 1FGMA 2CFDA 4O02B 4R1KA 3FKAA 3MYTA 1VQ53 1OF5A 3SX1A 3DGLA 1IQXA 2UGIA 2K54A 1YGWA 2Z77A 5M19A 4MMXB 1EUIC 1RGAA 4HYZA 4OK0A 1YIT3 1NWWA 1NJI4 3TDGA 1X1YA 2BIRA 4RNZA 1D6YA 1LXEA 3B4PA 1I0VA 1AVKA 1RMSA 1TP6A 2CFGA 3A5EA 1OHOA 3EF8A 3HI7A 2C11A 3MG3A 3DUKA 2MC8A 4BTWA 3G0KA 2E2TA 1WTHA 4KFDA 3MG2A 3NBBA 3LTBA 1RDSA 3AHSA 1T2IA 1JN5A 1A2PA 1A67A 4LZIA 2KF4A 4XDWA 2W04A 3G16A 2JQ5A 2OQEC 5CK6A 3STDA 5AYRB 1YI23 1OGXA 3L0RA 4EV5A 3LMLA 3DGNA 1BRHA 1N8R4 1BUQA 3EB8A 5IEOA 3SVAA 2XF3A 2OQEA 5AIIA 1Q814 1Q864 2D42A 1O7HB 3N9HA 2K3DA 1GY7A 1CYVA 1HU9A 1VQ73 3LH4A 1B2ZA 6STDA 1K9M4 1BSEA 1RN1A 5BVBA 3KSED 1TFKA 2QIYA 2ZL8A 1TIJA 3G4S3 1FUTA 2HMKB 2AAEA 1I0XA 4J8TA 3CC73 2ZDJA 3KFQC 2R4IA 1RHLA 1W4NA 3NV0B 3PCSA 3MKIA 4EV2A 5ELUA 1W01A 1ZO2A 4Q53A 5FGOA 1QMAA 3I553 1X1XA 3K0ZA 3AMOB 1NDOB 1R4CA 5AEUB 2LYXA 3LTDA 3D79A 1ULIB 3QK9A 2I9WA 4L7KA 1FW7A 3X42A 2BT3A 4KFFA 2WOHA 3JUPA 5KP3A 4HZBB 4R9KA 2F86B 3S27A 4EXRA 1GOYA 2GBWB 3PXMA 1LQMB 3AGNA 7GSPA 3S28A 4ZM8A 4LYLB 5RNTA 3HZPA 4RNTA 1EQKA 1IYYA 3IJEB 4J9AA 5G1LA 3U1WA 2K0MA 1RJOA 1STDA 3V98A 1ZGXA 3HIGA 2W2CA 3E99A 3SXXA 2OOVC 2XH9A 1X1UA 1I8VA 1RCKA 3EC9A 3LYGA 4GL6A 4O2HA 5CLKA 1JBSA 2CK3H 2CHCA 5IW9A 5IG0A 1IT8A 1YJN3 1FA3A 1MGRA 1IT7A 1OH0A 1RGFA 1QAKA 1TUHA 2OOVA 4HKVB 1M904 1M9GA 1NB5I 3F7XA 1EG9B 1FGRA 6GSPA 4HM4B 1K8A4 1QVF2 3V92A 3VF1A 2BMRB 1OHSA 1RGKA 3CCQ3 1VQK3 1RNBA 5BXQA 1BAOA 1I70A 3PS8A 3PYJA 4WHAA 1B2SA 1WMNA 2RFRA 3NQYA 4WP5A 1GMPA 1PFPA 3EJVA 3S5CA 1UI8A 5LC6A 1GD3A 2KF6A 3RNTA 1LOWA 3NXJA 3WOEB 1BNRA 1JV2B 2HOHA 4STDA 3MPHA 3FG3A 1T5YA 1V74A 3EBTA 3NV0A 4NREA 3ALAA 4WWUC 5AI1A 3U97A 4HOHA 3T8NA 2CC3A 4AEQA 1A2KA 3AMOA 1IV7A 3GWRA 4LGQA 4KZ1A 1BRNL 4J5KA 1EKMA 5CF2A 3HIIA 1RLSA 2WGOA 4FCJA 2XGNA 1IVXA 1O7WB 1JRQA 4BU4A 2FGTA 4EC6A 3KE7A 1KD14 1VQ63 3J7Yd 1RGGA 3F14A 2IA7A 5TGNA 1QAFA 2L1SA 1VQ83 2F99A 4O8SA 4LSOA 1EEJA 1GMRA 4MEIA 1MNLA 1VQ93 4OUQA 5AYSC 1BRGA 3NM7A 2BU4A 1Q40B
chains in the Genus database with same CATH topology
1FYSA 2C4BA 2KF4A 1I3IA 1DE3A 5BIRA 1GMQA 1B20A 3D5GA 1BRHA 1A2PA 5HOHA 1B3SA 2RNTA 1T2HA 2AADA 1BRJA 1BANA 1B2MA 1RGLA 1JBRA 1B2ZA 1AY7A 2F4YA 1BSEA 1RN1A 6RNTA 1CH0A 1FUSA 1LRAA 1FUTA 1BU4A 1I3FA 2AAEA 1I0XA 1LOYA 1RSNA 1BNFA 1YNVX 1GSPA 3Q3FA 1RHLA 1R4YA 2F56A 1BNGA 1BNSA 2RBIA 1UCLA 1BNIA 3AHWA 1GOVA 3D4AA 1RCLA 3BIRA 2KF3A 1X1XA 1X1WA 1RGCA 1TTOA 1RNTA 1B21A 2KAAA 1RGEA 1BUJA 1FW7A 3KCHA 3WHOA 7RNTA 1HYFA 1GOUA 3URPA 1I2EA 1GOYA 1RGHA 3AGNA 7GSPA 3GSPA 3SYUA 1RTUA 5RNTA 4RNTA 1IYYA 2SARA 1TRPA 3AGOA 1AQZA 3D5IA 4HAAA 1SARA 1ZGXA 9RNTA 1B2UA 1BNEA 1X1UA 1RCKA 1I8VA 1YVSA 1JBSA 1BNJA 8RNTA 1JBTA 1MGRA 1UCJA 3DH2A 1BVIA 1BRKA 1RGFA 1I2FA 1C54A 1BOXA 6GSPA 1B2XA 5BU4A 1TRQA 1LOVA 1BRSA 1RGKA 1DETA 1RNBA 1BAOA 1I70A 4GSPA 3DGYA 1BGSA 4GHOA 1B2SA 1RN4A 1GMPA 3HOHA 2F5MA 1B27A 2KF6A 1LNIA 1LOWA 3RNTA 1BNRA 2HOHA 1BSBA 3WR2A 4BIRA 2KF5A 5GSPA 2F5WA 1Q9EA 1BSDA 1HZ1A 4HOHA 1UCKA 1BRIA 1UCIA 1BRNL 2ZA4A 4J5KA 1RLSA 1I2GA 1BSCA 1YGWA 3BU4A 4BU4A 1PYLA 1BIRA 1RGAA 1RGGA 1X1YA 1FZUA 2BIRA 2GSPA 1MGWA 1GMRA 1I0VA 3A5EA 1BSAA 1RMSA 1PY3A 1BRGA 4J5GA 2BU4A 1RDSA 3AHSA 1T2IA 1G02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYS A;  2C4B A;  2KF4 A;  1I3I A;  1DE3 A;  5BIR A;  1GMQ A;  1B20 A;  3D5G A;  1BRH A;  1A2P A;  5HOH A;  1B3S A;  2RNT A;  1T2H A;  2AAD A;  1BRJ A;  1BAN A;  1B2M A;  1RGL A;  1JBR A;  1B2Z A;  1AY7 A;  2F4Y A;  1BSE A;  1RN1 A;  6RNT A;  1CH0 A;  1FUS A;  1LRA A;  1FUT A;  1BU4 A;  1I3F A;  2AAE A;  1I0X A;  1LOY A;  1RSN A;  1BNF A;  1YNV X;  1GSP A;  3Q3F A;  1RHL A;  1R4Y A;  2F56 A;  1BNG A;  1BNS A;  2RBI A;  1UCL A;  1BNI A;  3AHW A;  1GOV A;  3D4A A;  1RCL A;  3BIR A;  2KF3 A;  1X1X A;  1X1W A;  1RGC A;  1TTO A;  1RNT A;  1B21 A;  2KAA A;  1RGE A;  1BUJ A;  1FW7 A;  3KCH A;  3WHO A;  7RNT A;  1HYF A;  1GOU A;  3URP A;  1I2E A;  1GOY A;  1RGH A;  3AGN A;  7GSP A;  3GSP A;  3SYU A;  1RTU A;  5RNT A;  4RNT A;  1IYY A;  2SAR A;  1TRP A;  3AGO A;  1AQZ A;  3D5I A;  4HAA A;  1SAR A;  1ZGX A;  9RNT A;  1B2U A;  1BNE A;  1X1U A;  1RCK A;  1I8V A;  1YVS A;  1JBS A;  1BNJ A;  8RNT A;  1JBT A;  1MGR A;  1UCJ A;  3DH2 A;  1BVI A;  1BRK A;  1RGF A;  1I2F A;  1C54 A;  1BOX A;  6GSP A;  1B2X A;  5BU4 A;  1TRQ A;  1LOV A;  1BRS A;  1RGK A;  1DET A;  1RNB A;  1BAO A;  1I70 A;  4GSP A;  3DGY A;  1BGS A;  4GHO A;  1B2S A;  1RN4 A;  1GMP A;  3HOH A;  2F5M A;  1B27 A;  2KF6 A;  1LNI A;  1LOW A;  3RNT A;  1BNR A;  2HOH A;  1BSB A;  3WR2 A;  4BIR A;  2KF5 A;  5GSP A;  2F5W A;  1Q9E A;  1BSD A;  1HZ1 A;  4HOH A;  1UCK A;  1BRI A;  1UCI A;  1BRN L;  2ZA4 A;  4J5K A;  1RLS A;  1I2G A;  1BSC A;  1YGW A;  3BU4 A;  4BU4 A;  1PYL A;  1BIR A;  1RGA A;  1RGG A;  1X1Y A;  1FZU A;  2BIR A;  2GSP A;  1MGW A;  1GMR A;  1I0V A;  3A5E A;  1BSA A;  1RMS A;  1PY3 A;  1BRG A;  4J5G A;  2BU4 A;  1RDS A;  3AHS A;  1T2I A;  1G02 A; 
#chains in the Genus database with same CATH topology
 1FYS A;  3FSD A;  2Z7A A;  3RGR A;  1OCV A;  3RGA A;  4X2H A;  1W6G A;  2Z76 A;  2P09 A;  4JF8 A;  1FGO A;  1I3I A;  4K1V A;  3CNX A;  1DMQ A;  3D5G A;  5AEW B;  2SBL A;  2O3O A;  3ROB A;  3B4O A;  1VQL 3;  3HK4 A;  1CEW I;  3IPT A;  5HOH A;  1B3S A;  1VQO 3;  2ZHX B;  2RNT A;  2MF7 A;  1KQS 2;  4I4K A;  1T2H A;  2UX0 A;  3CD6 3;  3K9M C;  1RGL A;  3LOY A;  2F4Y A;  6RNT A;  1JZD A;  1VZZ A;  2H0G A;  1CH0 A;  1KWI A;  1ZX2 A;  2XFT A;  2B24 B;  2BNG A;  1I3F A;  4AKZ A;  5AIG A;  1K28 A;  3NHX A;  3X41 A;  3Q3F A;  5EVH A;  4PEJ A;  4N6O B;  1IU7 A;  2WGQ A;  2F56 A;  2RBI A;  1BNG A;  1BNS A;  3AHW A;  1UCL A;  1BNI A;  1DVC A;  3EN8 A;  1QJG A;  2GXF A;  1MWT A;  1RCL A;  2W03 A;  4H61 A;  3BIR A;  1QVG 2;  2PNC A;  3FGY A;  1IDP A;  1O7N B;  5CXO A;  1TTO A;  3BNC A;  1RNT A;  1B21 A;  1ASK A;  3BLZ A;  4KFE A;  3KCH A;  3HX8 A;  3GZR A;  3F9S A;  3K7C A;  1OPY A;  2HML B;  3CXC 2;  4HM7 B;  1LOX A;  1RRL A;  2F98 A;  1MWU A;  2P38 A;  4TX4 A;  4G1M B;  2XR8 B;  1RGH A;  3NM2 A;  3WOF B;  4CDL A;  3CCL 3;  1W2B 2;  4MMY B;  3IMA B;  4HM0 B;  1VQN 3;  2CX1 A;  4WYK A;  4ORL A;  1UUG B;  3X3Z A;  4CPK A;  3D5I A;  1AV4 A;  1UGI A;  1MOL A;  3BNB A;  4HM1 B;  4KT3 B;  3DMC A;  4FCM A;  1SII A;  1BNE A;  4HM5 B;  4HM8 B;  1BNJ A;  1VQ4 3;  5D82 A;  8RNT A;  3D3L A;  1BRK A;  1W2Z A;  2RGQ A;  5IEP A;  1JKG B;  2Y74 A;  3CPO A;  3CCS 3;  1C54 A;  5AIF A;  1NO3 A;  1QAL A;  1YGE A;  3DGM A;  1IQ8 A;  4MMZ B;  4ILF A;  1DYU A;  7STD A;  5BU4 A;  1TRQ A;  3G71 3;  4XBY A;  2CG0 A;  2RSX A;  3EX9 A;  2O9U X;  4GSP A;  4HJL B;  5JBS A;  4CCV A;  3PCR A;  3BND A;  1WMO A;  1NU3 A;  1JB4 A;  4N3V A;  4N6L A;  2CIU A;  1LNI A;  3GZY B;  3JUQ A;  1OUN A;  3JVC A;  1RKY A;  3GZX B;  3CCM 3;  4QWT A;  3WR2 A;  4BIR A;  1W6Y A;  3JUO A;  1G96 A;  5GSP A;  3CCE 3;  5G2G A;  1BSD A;  1VQQ A;  4RNY A;  4EBG A;  3NQZ A;  3MSO A;  1Z1S A;  3EN1 B;  3CME 3;  1IK3 A;  4MJD A;  4XB5 A;  1UCI A;  2BHM A;  2HMJ B;  4NHF A;  3OW2 2;  1N8Q A;  2GU1 A;  4XM4 A;  4RZM A;  3ZFZ A;  1YIJ 3;  1BSC A;  3GAX A;  1PYL A;  1VQM 3;  1STF I;  3PGB A;  1E3V A;  3BB9 A;  3X40 A;  1JB5 A;  4XDV A;  1K73 4;  4HVN A;  1FZU A;  1Q7H A;  1W6C A;  2E2U A;  2UUG C;  5D81 A;  2BO9 B;  1BSA A;  1PY3 A;  3D9R A;  4EW5 A;  5KP1 A;  8CHO A;  2J8X B;  3DY5 A;  3LXU X;  3CC2 3;  2GU3 A;  3V99 A;  1M1X B;  1W02 A;  1Y4K A;  4HZ9 B;  5EEO A;  1UUV B;  4N6V 0;  3SLU A;  3MHE A;  4KVH A;  2B1X B;  5JPU A;  1OF5 B;  2WOF A;  4OVM A;  1N5P A;  5M1A A;  3WDG B;  2HMN B;  2CG1 A;  5ELJ A;  2GEY A;  3DZL A;  4N6U A;  2OTL 3;  3CNM A;  4I5Q A;  1ROV A;  1YVB I;  2AAD A;  1W5Z A;  1BRJ A;  1B2M A;  1GY5 A;  1O7P B;  4EYC A;  2Y73 A;  3FLJ A;  2CFL A;  4K1U A;  1Q82 4;  4HM3 B;  1FUS A;  5AIH A;  1LOY A;  1YNV X;  1BNF A;  1JN5 B;  1GSP A;  1T3B A;  2ML6 A;  2W9Q A;  3CPW 2;  1R4Y A;  3ER7 A;  1GOV A;  1MWR A;  3D4A A;  5M18 A;  2E2V A;  3DM8 A;  4FMB A;  1X1W A;  1RGC A;  2L4V A;  1NB3 I;  1ISK A;  2W56 B;  1ZS7 A;  2FXT A;  4BTY A;  1UW1 A;  1RGE A;  2C10 A;  3A76 A;  3X3X A;  1BUJ A;  4XBX A;  1ULJ B;  1MWS A;  1W00 A;  2P05 A;  3B7C A;  3H3H A;  3GRD A;  1GY6 A;  4JRF A;  1HYF A;  1GOU A;  4IPB A;  2IUK A;  3DXO A;  1I2E A;  3CCJ 3;  1VQP 3;  1TFO A;  1Q7Y 4;  2HMO B;  2CFK A;  1G0T A;  3GSP A;  4RBN A;  1IVW A;  1UGH I;  2CWV A;  3OXA A;  2P0X A;  2XRX B;  3O8Y A;  5DRE A;  2SAR A;  3AGO A;  4GB5 A;  1AQZ A;  3WA2 X;  2XEP A;  5IG5 A;  4U13 A;  1U8C B;  2R41 A;  4FMD A;  1JB2 A;  3T8U A;  1J2B A;  1LVN A;  3S29 A;  3WA3 A;  4R80 A;  1FUW A;  1JNQ A;  4L8O A;  3SOA A;  1CYU A;  2H0H A;  2QGU A;  3OV4 A;  2WO0 A;  1SPU A;  1AR0 A;  4LMI A;  3K63 A;  3DH2 A;  3I56 3;  1EA2 A;  5I97 A;  2BMQ B;  5D83 A;  5DRV A;  3CCV 3;  2CW9 A;  2H0I A;  4WFO A;  3SOY A;  5IER A;  4K90 B;  1I2F A;  4HM2 B;  1A2V A;  3FZW A;  1Q42 A;  1BOX A;  1B2X A;  3H51 A;  1DET A;  3JUM A;  1AVL A;  1BGS A;  3T0U A;  3KSP A;  3FH1 A;  4GHO A;  1IQY A;  2W0Q A;  4N6T A;  2KCD A;  3EE1 A;  3HOH A;  1TJD A;  4IIA A;  3EQQ B;  1JZO A;  1B27 A;  2F5M A;  3LT8 A;  3I0Y A;  1BSB A;  1N5H A;  1V57 A;  4K61 A;  1TU5 A;  2IY2 A;  3WOD G;  2IUJ A;  4BL2 A;  3F8X A;  2CKF B;  3ZG0 A;  2F5W A;  2YFI B;  1N9E A;  1Q9E A;  4XBT A;  1HZ1 A;  3X3Y A;  2Q07 A;  1Q40 A;  1CQS A;  2PZV A;  2IMJ A;  2OWP A;  3Q2P A;  3N8B A;  2W56 A;  2IYJ A;  2GEX A;  3UL5 A;  2ZA4 A;  4FCZ A;  1M1K 4;  3LTA A;  1GD4 A;  1I2G A;  1S5A A;  3BU4 A;  3FG4 A;  1L5G B;  1KSI A;  3NX0 A;  1BIR A;  1OHP A;  2GBX B;  3FF2 A;  3LT9 A;  3RDE A;  2GSP A;  5CF1 A;  1N9J A;  3QRD A;  3CU3 A;  1MGW A;  3KII A;  3UB1 A;  1W7C A;  1U5O A;  2FNQ A;  3WMD A;  1YJ9 3;  4J5G A;  4LEH A;  1IVV A;  1G02 A;  3GZB A;  3CCU 3;  2C4B A;  2W9P A;  3NUV A;  4DKI A;  2BMO B;  1DE3 A;  3UL6 A;  5BIR A;  2P0M A;  1GMQ A;  1B20 A;  3UJM A;  3EHC A;  1O7G B;  3FF0 A;  1SQW A;  1NNV A;  4H3U A;  4BTX A;  3CCR 3;  3ECF A;  4IT7 A;  3KN4 A;  4CJN A;  4HBR A;  1BAN A;  3KZT A;  2Z6B A;  3CMA 3;  3LZA A;  1JBR A;  3OWY A;  1UI7 A;  3OWU A;  1AY7 A;  4O3V A;  2LQV A;  2INX A;  1LRA A;  3F7S A;  3VGN A;  1BU4 A;  3B8L A;  3EBY A;  2CX0 A;  1RSN A;  2XSH B;  3BNE A;  3VSY A;  1S72 3;  3LTC A;  1RN7 A;  1US1 A;  2XSO B;  3F40 A;  2V1L A;  2XFS A;  5IG3 A;  2W6J H;  1E3R A;  1FGQ A;  2KF3 A;  3G8Z A;  3G6E 3;  1D6Z A;  5STD A;  2M7O A;  1HKX A;  2KAA A;  4N6N B;  1O7M B;  3SED A;  1ROA A;  3KKG A;  3NBR A;  3WHO A;  7RNT A;  1JKG A;  3FG1 A;  3URP A;  4R4K A;  1YJW 3;  3K5T A;  5IEN A;  1WQL B;  3FCS B;  1LQG C;  3F8H A;  2OCT A;  2RCD A;  3SYU A;  1SIH A;  4AKY A;  1V58 A;  1RTU A;  2JDI H;  2ML5 A;  1TRP A;  3UNL A;  4HM6 B;  3MWZ A;  4L8P A;  4N6M A;  2CH9 A;  2CWT A;  1K41 A;  1SAR A;  4HAA A;  9RNT A;  5IF6 A;  4NPB A;  1B2U A;  1RRH A;  3DGO A;  5FW5 A;  1DVD A;  2YFJ B;  3Q90 A;  4FMA A;  1YVS A;  2QA4 3;  2KXG A;  3N54 B;  3OX9 A;  3Q1C A;  4R9L A;  5HGR A;  3ZG5 A;  1PU4 A;  2QEX 3;  1JJ2 2;  1WMP A;  1JBT A;  1UCJ A;  1E97 A;  1BVI A;  1D6U A;  2HMM B;  1GYB A;  2CWU A;  4X2O A;  3CC4 3;  4BL3 A;  1A90 A;  1UDI I;  1WNH A;  1YHQ 3;  5G1K A;  1SJW A;  2A15 A;  5JPP A;  1LOV A;  1BRS A;  2D1W A;  2KRT A;  4WYK B;  1F8N A;  2STD A;  3DGY A;  1IVU A;  3OWS A;  2XGL A;  1KC8 4;  3MG1 A;  1RN4 A;  3JUN A;  1OAC A;  1IV9 A;  2YX9 A;  2CFW A;  1OGZ A;  2OTJ 3;  2KF5 A;  3NBJ A;  2YFL B;  1LNH A;  1UUW B;  1DMN A;  1GS3 A;  4FMC A;  1DMM A;  4FR9 A;  5LC7 A;  5EQL A;  5A0O B;  5IG4 A;  5KP4 A;  1UCK A;  3S67 A;  1BRI A;  3M8C A;  1FGT A;  1C7H A;  3PZW A;  1FGM A;  2CFD A;  4O02 B;  4R1K A;  3FKA A;  3MYT A;  1VQ5 3;  1OF5 A;  3SX1 A;  3DGL A;  1IQX A;  2UGI A;  2K54 A;  1YGW A;  2Z77 A;  5M19 A;  4MMX B;  1EUI C;  1RGA A;  4HYZ A;  4OK0 A;  1YIT 3;  1NWW A;  1NJI 4;  3TDG A;  1X1Y A;  2BIR A;  4RNZ A;  1D6Y A;  1LXE A;  3B4P A;  1I0V A;  1AVK A;  1RMS A;  1TP6 A;  2CFG A;  3A5E A;  1OHO A;  3EF8 A;  3HI7 A;  2C11 A;  3MG3 A;  3DUK A;  2MC8 A;  4BTW A;  3G0K A;  2E2T A;  1WTH A;  4KFD A;  3MG2 A;  3NBB A;  3LTB A;  1RDS A;  3AHS A;  1T2I A;  1JN5 A;  1A2P A;  1A67 A;  4LZI A;  2KF4 A;  4XDW A;  2W04 A;  3G16 A;  2JQ5 A;  2OQE C;  5CK6 A;  3STD A;  5AYR B;  1YI2 3;  1OGX A;  3L0R A;  4EV5 A;  3LML A;  3DGN A;  1BRH A;  1N8R 4;  1BUQ A;  3EB8 A;  5IEO A;  3SVA A;  2XF3 A;  2OQE A;  5AII A;  1Q81 4;  1Q86 4;  2D42 A;  1O7H B;  3N9H A;  2K3D A;  1GY7 A;  1CYV A;  1HU9 A;  1VQ7 3;  3LH4 A;  1B2Z A;  6STD A;  1K9M 4;  1BSE A;  1RN1 A;  5BVB A;  3KSE D;  1TFK A;  2QIY A;  2ZL8 A;  1TIJ A;  3G4S 3;  1FUT A;  2HMK B;  2AAE A;  1I0X A;  4J8T A;  3CC7 3;  2ZDJ A;  3KFQ C;  2R4I A;  1RHL A;  1W4N A;  3NV0 B;  3PCS A;  3MKI A;  4EV2 A;  5ELU A;  1W01 A;  1ZO2 A;  4Q53 A;  5FGO A;  1QMA A;  3I55 3;  1X1X A;  3K0Z A;  3AMO B;  1NDO B;  1R4C A;  5AEU B;  2LYX A;  3LTD A;  3D79 A;  1ULI B;  3QK9 A;  2I9W A;  4L7K A;  1FW7 A;  3X42 A;  2BT3 A;  4KFF A;  2WOH A;  3JUP A;  5KP3 A;  4HZB B;  4R9K A;  2F86 B;  3S27 A;  4EXR A;  1GOY A;  2GBW B;  3PXM A;  1LQM B;  3AGN A;  7GSP A;  3S28 A;  4ZM8 A;  4LYL B;  5RNT A;  3HZP A;  4RNT A;  1EQK A;  1IYY A;  3IJE B;  4J9A A;  5G1L A;  3U1W A;  2K0M A;  1RJO A;  1STD A;  3V98 A;  1ZGX A;  3HIG A;  2W2C A;  3E99 A;  3SXX A;  2OOV C;  2XH9 A;  1X1U A;  1I8V A;  1RCK A;  3EC9 A;  3LYG A;  4GL6 A;  4O2H A;  5CLK A;  1JBS A;  2CK3 H;  2CHC A;  5IW9 A;  5IG0 A;  1IT8 A;  1YJN 3;  1FA3 A;  1MGR A;  1IT7 A;  1OH0 A;  1RGF A;  1QAK A;  1TUH A;  2OOV A;  4HKV B;  1M90 4;  1M9G A;  1NB5 I;  3F7X A;  1EG9 B;  1FGR A;  6GSP A;  4HM4 B;  1K8A 4;  1QVF 2;  3V92 A;  3VF1 A;  2BMR B;  1OHS A;  1RGK A;  3CCQ 3;  1VQK 3;  1RNB A;  5BXQ A;  1BAO A;  1I70 A;  3PS8 A;  3PYJ A;  4WHA A;  1B2S A;  1WMN A;  2RFR A;  3NQY A;  4WP5 A;  1GMP A;  1PFP A;  3EJV A;  3S5C A;  1UI8 A;  5LC6 A;  1GD3 A;  2KF6 A;  3RNT A;  1LOW A;  3NXJ A;  3WOE B;  1BNR A;  1JV2 B;  2HOH A;  4STD A;  3MPH A;  3FG3 A;  1T5Y A;  1V74 A;  3EBT A;  3NV0 A;  4NRE A;  3ALA A;  4WWU C;  5AI1 A;  3U97 A;  4HOH A;  3T8N A;  2CC3 A;  4AEQ A;  1A2K A;  3AMO A;  1IV7 A;  3GWR A;  4LGQ A;  4KZ1 A;  1BRN L;  4J5K A;  1EKM A;  5CF2 A;  3HII A;  1RLS A;  2WGO A;  4FCJ A;  2XGN A;  1IVX A;  1O7W B;  1JRQ A;  4BU4 A;  2FGT A;  4EC6 A;  3KE7 A;  1KD1 4;  1VQ6 3;  3J7Y d;  1RGG A;  3F14 A;  2IA7 A;  5TGN A;  1QAF A;  2L1S A;  1VQ8 3;  2F99 A;  4O8S A;  4LSO A;  1EEJ A;  1GMR A;  4MEI A;  1MNL A;  1VQ9 3;  4OUQ A;  5AYS C;  1BRG A;  3NM7 A;  2BU4 A;  1Q40 B; 
#chains in the Genus database with same CATH homology
 1FYS A;  2C4B A;  2KF4 A;  1I3I A;  1DE3 A;  5BIR A;  1GMQ A;  1B20 A;  3D5G A;  1BRH A;  1A2P A;  5HOH A;  1B3S A;  2RNT A;  1T2H A;  2AAD A;  1BRJ A;  1BAN A;  1B2M A;  1RGL A;  1JBR A;  1B2Z A;  1AY7 A;  2F4Y A;  1BSE A;  1RN1 A;  6RNT A;  1CH0 A;  1FUS A;  1LRA A;  1FUT A;  1BU4 A;  1I3F A;  2AAE A;  1I0X A;  1LOY A;  1RSN A;  1BNF A;  1YNV X;  1GSP A;  3Q3F A;  1RHL A;  1R4Y A;  2F56 A;  1BNG A;  1BNS A;  2RBI A;  1UCL A;  1BNI A;  3AHW A;  1GOV A;  3D4A A;  1RCL A;  3BIR A;  2KF3 A;  1X1X A;  1X1W A;  1RGC A;  1TTO A;  1RNT A;  1B21 A;  2KAA A;  1RGE A;  1BUJ A;  1FW7 A;  3KCH A;  3WHO A;  7RNT A;  1HYF A;  1GOU A;  3URP A;  1I2E A;  1GOY A;  1RGH A;  3AGN A;  7GSP A;  3GSP A;  3SYU A;  1RTU A;  5RNT A;  4RNT A;  1IYY A;  2SAR A;  1TRP A;  3AGO A;  1AQZ A;  3D5I A;  4HAA A;  1SAR A;  1ZGX A;  9RNT A;  1B2U A;  1BNE A;  1X1U A;  1RCK A;  1I8V A;  1YVS A;  1JBS A;  1BNJ A;  8RNT A;  1JBT A;  1MGR A;  1UCJ A;  3DH2 A;  1BVI A;  1BRK A;  1RGF A;  1I2F A;  1C54 A;  1BOX A;  6GSP A;  1B2X A;  5BU4 A;  1TRQ A;  1LOV A;  1BRS A;  1RGK A;  1DET A;  1RNB A;  1BAO A;  1I70 A;  4GSP A;  3DGY A;  1BGS A;  4GHO A;  1B2S A;  1RN4 A;  1GMP A;  3HOH A;  2F5M A;  1B27 A;  2KF6 A;  1LNI A;  1LOW A;  3RNT A;  1BNR A;  2HOH A;  1BSB A;  3WR2 A;  4BIR A;  2KF5 A;  5GSP A;  2F5W A;  1Q9E A;  1BSD A;  1HZ1 A;  4HOH A;  1UCK A;  1BRI A;  1UCI A;  1BRN L;  2ZA4 A;  4J5K A;  1RLS A;  1I2G A;  1BSC A;  1YGW A;  3BU4 A;  4BU4 A;  1PYL A;  1BIR A;  1RGA A;  1RGG A;  1X1Y A;  1FZU A;  2BIR A;  2GSP A;  1MGW A;  1GMR A;  1I0V A;  3A5E A;  1BSA A;  1RMS A;  1PY3 A;  1BRG A;  4J5G A;  2BU4 A;  1RDS A;  3AHS A;  1T2I A;  1G02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...