1RGEA

Hydrolase, guanyloribonuclease
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (guanyloribonuclease)
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgeA00
1HYFA 1RGEA 1RCLA 3D5GA 2GSPA 6GSPA 1X1XA 1AQZA 1ZGXA 2KF6A 1BRKA 1FYSA 2KF4A 3Q3FA 4GHOA 1YVSA 3KCHA 1G02A 1RGFA 3SYUA 1MGWA 1B2SA 1TRPA 4HOHA 1RDSA 1BRJA 1RGGA 2F56A 2SARA 1RN4A 4BIRA 3AHSA 3URPA 5HOHA 1I0XA 4GSPA 2RBIA 5BIRA 1B3SA 1RSNA 1RGHA 1BNIA 3DH2A 1Q9EA 9RNTA 1TTOA 8RNTA 1LNIA 2F5WA 5GSPA 1BNEA 1BNRA 1RCKA 1BSEA 1I3FA 1BSBA 1T2IA 1RTUA 1UCLA 1AY7A 1BNJA 1BSAA 3DGYA 2KAAA 3D5IA 2BU4A 1HZ1A 3AGNA 3RNTA 1LOVA 1BU4A 1SARA 2RNTA 1JBSA 1IYYA 1I2FA 1RMSA 1B2ZA 1BANA 1PYLA 1A2PA 2KF5A 3BIRA 3AGOA 1BNGA 1BSDA 1I8VA 4J5GA 7RNTA 1DETA 1YNVX 1GOUA 1UCJA 1BRSA 1I0VA 3WHOA 1X1WA 2AAEA 1BAOA 1I2EA 4RNTA 1I3IA 1FUSA 1RGAA 5RNTA 1B21A 1R4YA 1RLSA 1RN1A 7GSPA 1B20A 1B2XA 1FUTA 3BU4A 1BUJA 1RGKA 3D4AA 1BRNL 1DE3A 1BSCA 1GOYA 1CH0A 1BVIA 1RNBA 1B2UA 4HAAA 1TRQA 1X1UA 1FZUA 1UCKA 2C4BA 1GMQA 2F4YA 1JBRA 3GSPA 1GMPA 1RHLA 1BNFA 1GSPA 1I2GA 1BIRA 1BOXA 2AADA 3A5EA 3WR2A 1LOYA 1BRHA 3HOHA 1C54A 1B2MA 2BIRA 1RNTA 1X1YA 1YGWA 1BGSA 1BRGA 1RGLA 1BRIA 1RGCA 1UCIA 3AHWA 4BU4A 1FW7A 1LOWA 1GOVA 1MGRA 1PY3A 2KF3A 4J5KA 1JBTA 1LRAA 2ZA4A 1B27A 2F5MA 1I70A 1BNSA 2HOHA 5BU4A 1GMRA 1T2HA 6RNTA
chains in the Genus database with same CATH superfamily
4PEJA 3LT9A 3CD63 2W0QA 5M1AA 2Y74A 2Z77A 2Z6BA 3MG2A 3JUMA 4HM0B 1JJ22 1TP6A 1X1XA 1ZGXA 2IY2A 4GHOA 1IU7A 3Q3FA 3I553 3KCHA 2CK3H 1RGFA 2OCTA 4R9LA 1UDII 1S5AA 1U5OA 1B2SA 1UUGB 4L8OA 1TIJA 2PZVA 1BRJA 2YFJB 3HIGA 1UUWB 1ROAA 1RN4A 2P09A 5JBSA 3JVCA 2W03A 5DRVA 2OQEA 3CCU3 1OUNA 1QMAA 1W01A 2RBIA 3IJEB 1KSIA 5IW9A 2E2TA 3MSOA 1BNIA 3DH2A 1FW7A 3F8HA 1GY6A 3UL5A 1Q9EA 9RNTA 1US1A 1TTOA 1FGTA 3WOFB 1Y4KA 3WMDA 3G713 1LNIA 2Z76A 2ZDJA 2E2VA 1BSBA 3NV0B 5TGNA 3KIIA 1AY7A 3S27A 1GD4A 2QGUA 3D5IA 2IUKA 2BU4A 3K7CA 1KQS2 2GU3A 1G96A 3T8NA 1YJ93 1B2ZA 1BANA 1DVDA 2H0GA 1A2PA 3BIRA 4N6V0 7STDA 1YIT3 3X41A 3GZYB 3PCRA 5AI1A 4FMBA 2WGOA 4NHFA 3NBJA 1F8NA 7RNTA 1Q814 1IVXA 3JUPA 1VQO3 2AAEA 1I2EA 2UGIA 1AVKA 1C7HA 2XEPA 1SIIA 4JRFA 1CYUA 3KKGA 1DE3A 1KWIA 2XFTA 2QIYA 3BNEA 3NV0A 1BUQA 3LTDA 2CHCA 4N6OB 2CWVA 1RN1A 7GSPA 3RDEA 2W56B 3DY5A 4WYKB 4LSOA 1YI23 1FUTA 3K9MC 3BU4A 1UGIA 2K54A 1RGKA 3T0UA 2K0MA 1BSCA 1JZOA 1BVIA 4EW5A 3AMOA 3PS8A 4HAAA 1J2BA 4R80A 3LOYA 3S67A 1GMQA 1IQ8A 4TX4A 1JBRA 3GSPA 1GMPA 1MNLA 1IQYA 1CQSA 3NM2A 1V58A 1GY7A 3X40A 1EUIC 3BB9A 4HBRA 2R41A 3SVAA 2XR8B 1BOXA 3E99A 4I4KA 1RRHA 4FCJA 1ISKA 3WODG 1LVNA 1VQP3 2L4VA 3LYGA 1C54A 4CJNA 3CPW2 1DMNA 1B2MA 1V74A 4WP5A 2OTL3 3KSED 2CFWA 1RGLA 4HZBB 3CXC2 2F98A 2O3OA 1RRLA 4OUQA 4NREA 1O7NB 4CDLA 3G6E3 4STDA 1W00A 2J8XB 4K61A 3S28A 3N8BA 4BTXA 5FGOA 1LRAA 1ZO2A 5IEOA 3PCSA 4JF8A 2BHMA 3CC43 1B27A 2F5MA 2OQEC 2P38A 4IPBA 1CEWI 4XDWA 5EQLA 3U97A 3FG4A 1O7WB 3PGBA 1DMQA 3VSYA 2CG0A 3FZWA 5CK6A 1HYFA 6RNTA 2XF3A 1D6ZA 2FNQA 1W2B2 4X2OA 4EBGA 2GEYA 2GBWB 5BVBA 2P0MA 2F86B 3EQQB 3T8UA 5IG4A 1FYSA 1W2ZA 1G02A 1QJGA 3K5TA 2W04A 1TRPA 2CFGA 1O7GB 5IEPA 1RGGA 2C10A 5M19A 2SARA 3EN1B 4BIRA 1OHPA 4AKZA 5AEUB 5G2GA 2KXGA 5BIRA 3EF8A 3OWSA 4WFOA 2WOHA 2WGQA 5IENA 4LGQA 1RSNA 3LZAA 4HM1B 4MJDA 2KRTA 3RGRA 4IT7A 3FSDA 1DYUA 1O7HB 1VQQA 1TFOA 2C11A 5G1KA 1E3RA 2F5WA 4QWTA 3CNMA 5GSPA 3I0YA 2V1LA 1I3FA 1HKXA 1YJW3 1BNJA 1NO3A 3NBRA 2STDA 3FCSB 4XDVA 3DGYA 3VGNA 3NBBA 1NWWA 2KCDA 1OF5A 3Q1CA 1EKMA 4H3UA 5KP4A 4XBXA 1K8A4 4HJLB 1IYYA 1I2FA 1WMPA 3X3YA 3WOEB 3KZTA 2KF5A 1VQM3 1W6YA 2CC3A 1LXEA 1BNGA 1BSDA 1I8VA 2R4IA 4LZIA 2MC8A 4EV5A 3EC9A 1M9GA 3SOAA 1IQXA 1BRSA 4KFFA 1BAOA 1NU3A 1IVVA 1FGOA 4HM5B 2P05A 1A2KA 3F40A 3OWYA 3K0ZA 1QAKA 3CME3 1I3IA 1RGAA 2CG1A 1AV4A 4HM7B 4N6NB 4KFEA 3G4S3 1LQMB 2W9QA 4OK0A 5AYRB 1RJOA 2XH9A 4BL3A 1B20A 3J7Yd 1TUHA 3EBTA 5FW5A 1YHQ3 1BUJA 4G1MB 3NQZA 1SPUA 1V57A 1BRNL 5BXQA 1VQ63 1GOYA 1IV9A 1CH0A 1N8QA 2JDIH 3DMCA 3QK9A 3WA2X 1O7PB 1X1UA 3EB8A 3AMOB 4HM6B 4HVNA 1UCKA 2C4BA 1LNHA 1SIHA 2M7OA 2LYXA 1S723 5IG3A 4XBYA 1RHLA 1AVLA 2CW9A 1BIRA 1GSPA 1I2GA 1Q40B 2XGLA 3A5EA 3BNDA 3CPOA 1IDPA 1JV2B 1EA2A 3F14A 4KT3B 2RFRA 2IUJA 3UNLA 5I97A 2IMJA 3EHCA 3UJMA 1JRQA 5AIGA 4AEQA 2BIRA 3HX8A 1RNTA 1X1YA 1YGWA 2HMKB 3LH4A 3NM7A 4U13A 1MWTA 2A15A 4MMXB 1W7CA 2B24B 2BMOB 2CFKA 2BMRB 3AHWA 3D3LA 4RNZA 5G1LA 3HZPA 1VQN3 1LOWA 1IT7A 2CKFB 3F8XA 3JUQA 1GOVA 1MGRA 3IPTA 1HU9A 1RN7A 3V98A 5AEWB 3ZG0A 3Q2PA 3EJVA 4FCMA 2XGNA 4K90B 2ZA4A 2CX1A 2JQ5A 1I70A 5A0OB 5D83A 1NB5I 5IERA 4O02B 3CCQ3 4R4KA 1T2HA 4O2HA 1Q40A 2ZL8A 3D79A 1A90A 1T3BA 4L8PA 1CYVA 3D5GA 1IVWA 1ZX2A 2GSPA 6GSPA 1K41A 2QA43 4CCVA 3G8ZA 3OV4A 1YJN3 4FR9A 1BRKA 2KF4A 3V92A 1YVSA 3DGNA 1QALA 4IIAA 1IK3A 3MHEA 4HOHA 1VQ53 1GD3A 4LYLB 3LT8A 5AIHA 1STFI 2CWTA 3AHSA 3URPA 3CCL3 1WMOA 1STDA 3FH1A 3MYTA 2RCDA 4DKIA 1VQL3 4FCZA 1B3SA 1DMMA 3CC23 1RGHA 2MF7A 2UUGC 3OXAA 3LTAA 5CF2A 6STDA 1W02A 3FG3A 4GL6A 1Z1SA 3DGOA 8RNTA 2LQVA 1SQWA 1FUWA 1DVCA 1LQGC 4MMZB 1BNEA 1BNRA 1RCKA 1VQ73 1BSEA 1T2IA 2XSHB 3BNCA 3CU3A 1RTUA 2ML5A 3JUNA 1PU4A 3X3ZA 1BSAA 3DZLA 3V99A 5IG5A 1K734 2KAAA 1WNHA 4RNYA 1T5YA 3X42A 3CCS3 3RNTA 3FLJA 1VQ43 1JKGB 2ZHXB 1LOVA 1BU4A 1OF5B 1R4CA 1SARA 3SOYA 1WMNA 1VQK3 1RMSA 3DGMA 3B4PA 3H51A 4RBNA 3BNBA 2L1SA 3HK4A 2H0IA 2FGTA 4EC6A 1N8R4 2Q07A 2I9WA 3MKIA 3ZG5A 1KD14 1M1K4 3S5CA 2BO9B 1JNQA 2CFDA 3SX1A 3ECFA 3A76A 3ROBA 1JB4A 1GY5A 1UCJA 3B7CA 4HYZA 3JUOA 1L5GB 2GBXB 3GZRA 4LMIA 3MWZA 4RNTA 3EX9A 3U1WA 1D6YA 1Q864 4I5QA 3DXOA 1B21A 3FG1A 1R4YA 5ELUA 3NHXA 1B2XA 1EG9B 2QEX3 4OVMA 4RZMA 1JKGA 2RGQA 1W4NA 1OHSA 4FMDA 5IG0A 4HKVB 2B1XB 4K1VA 1N9JA 1TRQA 2YFLB 3EBYA 1TU5A 1FZUA 3LTCA 8CHOA 1Q7Y4 3CCJ3 1UUVB 1OACA 3D9RA 3DUKA 4HM4B 1FA3A 4BTWA 2D42A 3F7SA 1LOXA 1NDOB 2INXA 4ORLA 1JB2A 1BNFA 1IVUA 4WHAA 3WR2A 3CC73 1UGHI 3CCV3 1OPYA 1LOYA 1BRHA 3STDA 3RGAA 1ROVA 4O3VA 1U8CB 2HMMB 3H3HA 3MG3A 2OOVA 1BRGA 1FGQA 1A2VA 1SJWA 1AR0A 3FF2A 1ZS7A 4BU4A 2D1WA 4FMCA 3FKAA 3QRDA 4MEIA 4N6TA 5CLKA 2YX9A 1OGZA 3K63A 5JPPA 5D82A 1E3VA 2KF3A 2F99A 2Y73A 3BLZA 3UB1A 2YFIB 1Q7HA 1NB3I 4J5KA 4WWUC 5AIFA 1A67A 2ML6A 3L0RA 1W5ZA 1OHOA 5BU4A 1D6UA 2HOHA 3NUVA 2IYJA 2F56A 3PYJA 3LTBA 5AYSC 3SEDA 2O9UX 3TDGA 1RGEA 2FXTA 1E97A 1N9EA 1JZDA 1Q42A 1RCLA 4NPBA 3KE7A 3GZBA 1ULJB 2HMLB 4BTYA 3CMA3 3NXJA 4N6MA 1Q824 1KC84 5KP1A 1AQZA 1OCVA 2KF6A 1IT8A 1N5HA 2WO0A 3FF0A 3CCE3 1K9M4 3SYUA 1QAFA 2HMJB 3B4OA 1MGWA 1MWUA 4EYCA 2W2CA 2GEXA 4FMAA 1RDSA 3G16A 1YGEA 3ALAA 3GRDA 3N54B 4HM2B 4O8SA 4HM3B 1W6CA 4R9KA 5CF1A 2OTJ3 5ELJA 2XRXB 3MG1A 3LXUX 4KZ1A 1I0XA 4GSPA 4HZ9B 5HOHA 3I563 4HM8B 3EE1A 1G0TA 3DGLA 2W6JH 1N5PA 3PZWA 4N3VA 3GAXA 1O7MB 2P0XA 3O8YA 3OW22 5JPUA 3OWUA 3KN4A 3HI7A 2CFLA 3CNXA 1GS3A 3SLUA 4J8TA 1UCLA 2CIUA 4AKYA 1HZ1A 3AGNA 2RSXA 2IA7A 5LC6A 2RNTA 4L7KA 1JBSA 4N6LA 5CXOA 1EEJA 1PYLA 2Z7AA 3NX0A 3B8LA 1M904 4N6UA 1PFPA 2BNGA 1WTHA 3AGOA 5LC7A 3WDGB 4J5GA 2CWUA 2OWPA 3KFQC 4KFDA 3LMLA 1DETA 4GB5A 4ILFA 1YNVX 2PNCA 2SBLA 3N9HA 5D81A 1GOUA 3EN8A 1GYBA 1MWSA 3CCR3 1I0VA 3WHOA 1NJI4 1VQ83 1X1WA 1M1XB 2HMNB 2BMQB 1JN5B 1IV7A 4MMYB 5DREA 2WOFA 1FUSA 2CH9A 3FGYA 5RNTA 2UX0A 3HIIA 5M18A 4LEHA 3UL6A 2W56A 3F9SA 4WYKA 1RLSA 1FGRA 1NNVA 5STDA 2OOVC 5IF6A 3D4AA 3WA3A 3ER7A 1TJDA 3X3XA 2XFSA 1RNBA 1B2UA 3F7XA 3G0KA 2CX0A 2XSOB 2GXFA 4ZM8A 3IMAB 1RKYA 1QVG2 1ASKA 2F4YA 3M8CA 2GU1A 2W9PA 3PXMA 1UI8A 3VF1A 1MWRA 4CPKA 1OH0A 5HGRA 4KVHA 2AADA 5KP3A 3HOHA 2HMOB 4EV2A 1FGMA 5EVHA 1VZZA 1JN5A 4R1KA 2BT3A 3KSPA 4X2HA 4XB5A 1BGSA 3GWRA 3S29A 1UW1A 1YIJ3 1BRIA 1RGCA 1OGXA 1UCIA 1YVBI 3CCM3 2H0HA 1ULIB 1VQ93 3GZXB 4XM4A 4J9AA 1PY3A 5EEOA 4BL2A 2K3DA 3ZFZA 1MOLA 3SXXA 1WQLB 1JBTA 2E2UA 1W6GA 4Q53A 3Q90A 1TFKA 1JB5A 3NQYA 4K1UA 4EXRA 4H61A 5AIIA 1BNSA 1UI7A 1EQKA 3OX9A 1GMRA 1QVF2 3DM8A 3MPHA 1K28A 4XBTA
chains in the Genus database with same CATH topology
1HYFA 1RGEA 1RCLA 3D5GA 2GSPA 6GSPA 1X1XA 1AQZA 1ZGXA 2KF6A 1BRKA 1FYSA 2KF4A 3Q3FA 4GHOA 1YVSA 3KCHA 1G02A 1RGFA 3SYUA 1MGWA 1B2SA 1TRPA 4HOHA 1RDSA 1BRJA 1RGGA 2F56A 2SARA 1RN4A 4BIRA 3AHSA 3URPA 5HOHA 1I0XA 4GSPA 2RBIA 5BIRA 1B3SA 1RSNA 1RGHA 1BNIA 3DH2A 1Q9EA 9RNTA 1TTOA 8RNTA 1LNIA 2F5WA 5GSPA 1BNEA 1BNRA 1RCKA 1BSEA 1I3FA 1BSBA 1T2IA 1RTUA 1UCLA 1AY7A 1BNJA 1BSAA 3DGYA 2KAAA 3D5IA 2BU4A 1HZ1A 3AGNA 3RNTA 1LOVA 1BU4A 1SARA 2RNTA 1JBSA 1IYYA 1I2FA 1RMSA 1B2ZA 1BANA 1PYLA 1A2PA 2KF5A 3BIRA 3AGOA 1BNGA 1BSDA 1I8VA 4J5GA 7RNTA 1DETA 1YNVX 1GOUA 1UCJA 1BRSA 1I0VA 3WHOA 1X1WA 2AAEA 1BAOA 1I2EA 4RNTA 1I3IA 1FUSA 1RGAA 5RNTA 1B21A 1R4YA 1RLSA 1RN1A 7GSPA 1B20A 1B2XA 1FUTA 3BU4A 1BUJA 1RGKA 3D4AA 1BRNL 1DE3A 1BSCA 1GOYA 1CH0A 1BVIA 1RNBA 1B2UA 4HAAA 1TRQA 1X1UA 1FZUA 1UCKA 2C4BA 1GMQA 2F4YA 1JBRA 3GSPA 1GMPA 1RHLA 1BNFA 1GSPA 1I2GA 1BIRA 1BOXA 2AADA 3A5EA 3WR2A 1LOYA 1BRHA 3HOHA 1C54A 1B2MA 2BIRA 1RNTA 1X1YA 1YGWA 1BGSA 1BRGA 1RGLA 1BRIA 1RGCA 1UCIA 3AHWA 4BU4A 1FW7A 1LOWA 1GOVA 1MGRA 1PY3A 2KF3A 4J5KA 1JBTA 1LRAA 2ZA4A 1B27A 2F5MA 1I70A 1BNSA 2HOHA 5BU4A 1GMRA 1T2HA 6RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYF A;  1RGE A;  1RCL A;  3D5G A;  2GSP A;  6GSP A;  1X1X A;  1AQZ A;  1ZGX A;  2KF6 A;  1BRK A;  1FYS A;  2KF4 A;  3Q3F A;  4GHO A;  1YVS A;  3KCH A;  1G02 A;  1RGF A;  3SYU A;  1MGW A;  1B2S A;  1TRP A;  4HOH A;  1RDS A;  1BRJ A;  1RGG A;  2F56 A;  2SAR A;  1RN4 A;  4BIR A;  3AHS A;  3URP A;  5HOH A;  1I0X A;  4GSP A;  2RBI A;  5BIR A;  1B3S A;  1RSN A;  1RGH A;  1BNI A;  3DH2 A;  1Q9E A;  9RNT A;  1TTO A;  8RNT A;  1LNI A;  2F5W A;  5GSP A;  1BNE A;  1BNR A;  1RCK A;  1BSE A;  1I3F A;  1BSB A;  1T2I A;  1RTU A;  1UCL A;  1AY7 A;  1BNJ A;  1BSA A;  3DGY A;  2KAA A;  3D5I A;  2BU4 A;  1HZ1 A;  3AGN A;  3RNT A;  1LOV A;  1BU4 A;  1SAR A;  2RNT A;  1JBS A;  1IYY A;  1I2F A;  1RMS A;  1B2Z A;  1BAN A;  1PYL A;  1A2P A;  2KF5 A;  3BIR A;  3AGO A;  1BNG A;  1BSD A;  1I8V A;  4J5G A;  7RNT A;  1DET A;  1YNV X;  1GOU A;  1UCJ A;  1BRS A;  1I0V A;  3WHO A;  1X1W A;  2AAE A;  1BAO A;  1I2E A;  4RNT A;  1I3I A;  1FUS A;  1RGA A;  5RNT A;  1B21 A;  1R4Y A;  1RLS A;  1RN1 A;  7GSP A;  1B20 A;  1B2X A;  1FUT A;  3BU4 A;  1BUJ A;  1RGK A;  3D4A A;  1BRN L;  1DE3 A;  1BSC A;  1GOY A;  1CH0 A;  1BVI A;  1RNB A;  1B2U A;  4HAA A;  1TRQ A;  1X1U A;  1FZU A;  1UCK A;  2C4B A;  1GMQ A;  2F4Y A;  1JBR A;  3GSP A;  1GMP A;  1RHL A;  1BNF A;  1GSP A;  1I2G A;  1BIR A;  1BOX A;  2AAD A;  3A5E A;  3WR2 A;  1LOY A;  1BRH A;  3HOH A;  1C54 A;  1B2M A;  2BIR A;  1RNT A;  1X1Y A;  1YGW A;  1BGS A;  1BRG A;  1RGL A;  1BRI A;  1RGC A;  1UCI A;  3AHW A;  4BU4 A;  1FW7 A;  1LOW A;  1GOV A;  1MGR A;  1PY3 A;  2KF3 A;  4J5K A;  1JBT A;  1LRA A;  2ZA4 A;  1B27 A;  2F5M A;  1I70 A;  1BNS A;  2HOH A;  5BU4 A;  1GMR A;  1T2H A;  6RNT A; 
#chains in the Genus database with same CATH topology
 4PEJ A;  3LT9 A;  3CD6 3;  2W0Q A;  5M1A A;  2Y74 A;  2Z77 A;  2Z6B A;  3MG2 A;  3JUM A;  4HM0 B;  1JJ2 2;  1TP6 A;  1X1X A;  1ZGX A;  2IY2 A;  4GHO A;  1IU7 A;  3Q3F A;  3I55 3;  3KCH A;  2CK3 H;  1RGF A;  2OCT A;  4R9L A;  1UDI I;  1S5A A;  1U5O A;  1B2S A;  1UUG B;  4L8O A;  1TIJ A;  2PZV A;  1BRJ A;  2YFJ B;  3HIG A;  1UUW B;  1ROA A;  1RN4 A;  2P09 A;  5JBS A;  3JVC A;  2W03 A;  5DRV A;  2OQE A;  3CCU 3;  1OUN A;  1QMA A;  1W01 A;  2RBI A;  3IJE B;  1KSI A;  5IW9 A;  2E2T A;  3MSO A;  1BNI A;  3DH2 A;  1FW7 A;  3F8H A;  1GY6 A;  3UL5 A;  1Q9E A;  9RNT A;  1US1 A;  1TTO A;  1FGT A;  3WOF B;  1Y4K A;  3WMD A;  3G71 3;  1LNI A;  2Z76 A;  2ZDJ A;  2E2V A;  1BSB A;  3NV0 B;  5TGN A;  3KII A;  1AY7 A;  3S27 A;  1GD4 A;  2QGU A;  3D5I A;  2IUK A;  2BU4 A;  3K7C A;  1KQS 2;  2GU3 A;  1G96 A;  3T8N A;  1YJ9 3;  1B2Z A;  1BAN A;  1DVD A;  2H0G A;  1A2P A;  3BIR A;  4N6V 0;  7STD A;  1YIT 3;  3X41 A;  3GZY B;  3PCR A;  5AI1 A;  4FMB A;  2WGO A;  4NHF A;  3NBJ A;  1F8N A;  7RNT A;  1Q81 4;  1IVX A;  3JUP A;  1VQO 3;  2AAE A;  1I2E A;  2UGI A;  1AVK A;  1C7H A;  2XEP A;  1SII A;  4JRF A;  1CYU A;  3KKG A;  1DE3 A;  1KWI A;  2XFT A;  2QIY A;  3BNE A;  3NV0 A;  1BUQ A;  3LTD A;  2CHC A;  4N6O B;  2CWV A;  1RN1 A;  7GSP A;  3RDE A;  2W56 B;  3DY5 A;  4WYK B;  4LSO A;  1YI2 3;  1FUT A;  3K9M C;  3BU4 A;  1UGI A;  2K54 A;  1RGK A;  3T0U A;  2K0M A;  1BSC A;  1JZO A;  1BVI A;  4EW5 A;  3AMO A;  3PS8 A;  4HAA A;  1J2B A;  4R80 A;  3LOY A;  3S67 A;  1GMQ A;  1IQ8 A;  4TX4 A;  1JBR A;  3GSP A;  1GMP A;  1MNL A;  1IQY A;  1CQS A;  3NM2 A;  1V58 A;  1GY7 A;  3X40 A;  1EUI C;  3BB9 A;  4HBR A;  2R41 A;  3SVA A;  2XR8 B;  1BOX A;  3E99 A;  4I4K A;  1RRH A;  4FCJ A;  1ISK A;  3WOD G;  1LVN A;  1VQP 3;  2L4V A;  3LYG A;  1C54 A;  4CJN A;  3CPW 2;  1DMN A;  1B2M A;  1V74 A;  4WP5 A;  2OTL 3;  3KSE D;  2CFW A;  1RGL A;  4HZB B;  3CXC 2;  2F98 A;  2O3O A;  1RRL A;  4OUQ A;  4NRE A;  1O7N B;  4CDL A;  3G6E 3;  4STD A;  1W00 A;  2J8X B;  4K61 A;  3S28 A;  3N8B A;  4BTX A;  5FGO A;  1LRA A;  1ZO2 A;  5IEO A;  3PCS A;  4JF8 A;  2BHM A;  3CC4 3;  1B27 A;  2F5M A;  2OQE C;  2P38 A;  4IPB A;  1CEW I;  4XDW A;  5EQL A;  3U97 A;  3FG4 A;  1O7W B;  3PGB A;  1DMQ A;  3VSY A;  2CG0 A;  3FZW A;  5CK6 A;  1HYF A;  6RNT A;  2XF3 A;  1D6Z A;  2FNQ A;  1W2B 2;  4X2O A;  4EBG A;  2GEY A;  2GBW B;  5BVB A;  2P0M A;  2F86 B;  3EQQ B;  3T8U A;  5IG4 A;  1FYS A;  1W2Z A;  1G02 A;  1QJG A;  3K5T A;  2W04 A;  1TRP A;  2CFG A;  1O7G B;  5IEP A;  1RGG A;  2C10 A;  5M19 A;  2SAR A;  3EN1 B;  4BIR A;  1OHP A;  4AKZ A;  5AEU B;  5G2G A;  2KXG A;  5BIR A;  3EF8 A;  3OWS A;  4WFO A;  2WOH A;  2WGQ A;  5IEN A;  4LGQ A;  1RSN A;  3LZA A;  4HM1 B;  4MJD A;  2KRT A;  3RGR A;  4IT7 A;  3FSD A;  1DYU A;  1O7H B;  1VQQ A;  1TFO A;  2C11 A;  5G1K A;  1E3R A;  2F5W A;  4QWT A;  3CNM A;  5GSP A;  3I0Y A;  2V1L A;  1I3F A;  1HKX A;  1YJW 3;  1BNJ A;  1NO3 A;  3NBR A;  2STD A;  3FCS B;  4XDV A;  3DGY A;  3VGN A;  3NBB A;  1NWW A;  2KCD A;  1OF5 A;  3Q1C A;  1EKM A;  4H3U A;  5KP4 A;  4XBX A;  1K8A 4;  4HJL B;  1IYY A;  1I2F A;  1WMP A;  3X3Y A;  3WOE B;  3KZT A;  2KF5 A;  1VQM 3;  1W6Y A;  2CC3 A;  1LXE A;  1BNG A;  1BSD A;  1I8V A;  2R4I A;  4LZI A;  2MC8 A;  4EV5 A;  3EC9 A;  1M9G A;  3SOA A;  1IQX A;  1BRS A;  4KFF A;  1BAO A;  1NU3 A;  1IVV A;  1FGO A;  4HM5 B;  2P05 A;  1A2K A;  3F40 A;  3OWY A;  3K0Z A;  1QAK A;  3CME 3;  1I3I A;  1RGA A;  2CG1 A;  1AV4 A;  4HM7 B;  4N6N B;  4KFE A;  3G4S 3;  1LQM B;  2W9Q A;  4OK0 A;  5AYR B;  1RJO A;  2XH9 A;  4BL3 A;  1B20 A;  3J7Y d;  1TUH A;  3EBT A;  5FW5 A;  1YHQ 3;  1BUJ A;  4G1M B;  3NQZ A;  1SPU A;  1V57 A;  1BRN L;  5BXQ A;  1VQ6 3;  1GOY A;  1IV9 A;  1CH0 A;  1N8Q A;  2JDI H;  3DMC A;  3QK9 A;  3WA2 X;  1O7P B;  1X1U A;  3EB8 A;  3AMO B;  4HM6 B;  4HVN A;  1UCK A;  2C4B A;  1LNH A;  1SIH A;  2M7O A;  2LYX A;  1S72 3;  5IG3 A;  4XBY A;  1RHL A;  1AVL A;  2CW9 A;  1BIR A;  1GSP A;  1I2G A;  1Q40 B;  2XGL A;  3A5E A;  3BND A;  3CPO A;  1IDP A;  1JV2 B;  1EA2 A;  3F14 A;  4KT3 B;  2RFR A;  2IUJ A;  3UNL A;  5I97 A;  2IMJ A;  3EHC A;  3UJM A;  1JRQ A;  5AIG A;  4AEQ A;  2BIR A;  3HX8 A;  1RNT A;  1X1Y A;  1YGW A;  2HMK B;  3LH4 A;  3NM7 A;  4U13 A;  1MWT A;  2A15 A;  4MMX B;  1W7C A;  2B24 B;  2BMO B;  2CFK A;  2BMR B;  3AHW A;  3D3L A;  4RNZ A;  5G1L A;  3HZP A;  1VQN 3;  1LOW A;  1IT7 A;  2CKF B;  3F8X A;  3JUQ A;  1GOV A;  1MGR A;  3IPT A;  1HU9 A;  1RN7 A;  3V98 A;  5AEW B;  3ZG0 A;  3Q2P A;  3EJV A;  4FCM A;  2XGN A;  4K90 B;  2ZA4 A;  2CX1 A;  2JQ5 A;  1I70 A;  5A0O B;  5D83 A;  1NB5 I;  5IER A;  4O02 B;  3CCQ 3;  4R4K A;  1T2H A;  4O2H A;  1Q40 A;  2ZL8 A;  3D79 A;  1A90 A;  1T3B A;  4L8P A;  1CYV A;  3D5G A;  1IVW A;  1ZX2 A;  2GSP A;  6GSP A;  1K41 A;  2QA4 3;  4CCV A;  3G8Z A;  3OV4 A;  1YJN 3;  4FR9 A;  1BRK A;  2KF4 A;  3V92 A;  1YVS A;  3DGN A;  1QAL A;  4IIA A;  1IK3 A;  3MHE A;  4HOH A;  1VQ5 3;  1GD3 A;  4LYL B;  3LT8 A;  5AIH A;  1STF I;  2CWT A;  3AHS A;  3URP A;  3CCL 3;  1WMO A;  1STD A;  3FH1 A;  3MYT A;  2RCD A;  4DKI A;  1VQL 3;  4FCZ A;  1B3S A;  1DMM A;  3CC2 3;  1RGH A;  2MF7 A;  2UUG C;  3OXA A;  3LTA A;  5CF2 A;  6STD A;  1W02 A;  3FG3 A;  4GL6 A;  1Z1S A;  3DGO A;  8RNT A;  2LQV A;  1SQW A;  1FUW A;  1DVC A;  1LQG C;  4MMZ B;  1BNE A;  1BNR A;  1RCK A;  1VQ7 3;  1BSE A;  1T2I A;  2XSH B;  3BNC A;  3CU3 A;  1RTU A;  2ML5 A;  3JUN A;  1PU4 A;  3X3Z A;  1BSA A;  3DZL A;  3V99 A;  5IG5 A;  1K73 4;  2KAA A;  1WNH A;  4RNY A;  1T5Y A;  3X42 A;  3CCS 3;  3RNT A;  3FLJ A;  1VQ4 3;  1JKG B;  2ZHX B;  1LOV A;  1BU4 A;  1OF5 B;  1R4C A;  1SAR A;  3SOY A;  1WMN A;  1VQK 3;  1RMS A;  3DGM A;  3B4P A;  3H51 A;  4RBN A;  3BNB A;  2L1S A;  3HK4 A;  2H0I A;  2FGT A;  4EC6 A;  1N8R 4;  2Q07 A;  2I9W A;  3MKI A;  3ZG5 A;  1KD1 4;  1M1K 4;  3S5C A;  2BO9 B;  1JNQ A;  2CFD A;  3SX1 A;  3ECF A;  3A76 A;  3ROB A;  1JB4 A;  1GY5 A;  1UCJ A;  3B7C A;  4HYZ A;  3JUO A;  1L5G B;  2GBX B;  3GZR A;  4LMI A;  3MWZ A;  4RNT A;  3EX9 A;  3U1W A;  1D6Y A;  1Q86 4;  4I5Q A;  3DXO A;  1B21 A;  3FG1 A;  1R4Y A;  5ELU A;  3NHX A;  1B2X A;  1EG9 B;  2QEX 3;  4OVM A;  4RZM A;  1JKG A;  2RGQ A;  1W4N A;  1OHS A;  4FMD A;  5IG0 A;  4HKV B;  2B1X B;  4K1V A;  1N9J A;  1TRQ A;  2YFL B;  3EBY A;  1TU5 A;  1FZU A;  3LTC A;  8CHO A;  1Q7Y 4;  3CCJ 3;  1UUV B;  1OAC A;  3D9R A;  3DUK A;  4HM4 B;  1FA3 A;  4BTW A;  2D42 A;  3F7S A;  1LOX A;  1NDO B;  2INX A;  4ORL A;  1JB2 A;  1BNF A;  1IVU A;  4WHA A;  3WR2 A;  3CC7 3;  1UGH I;  3CCV 3;  1OPY A;  1LOY A;  1BRH A;  3STD A;  3RGA A;  1ROV A;  4O3V A;  1U8C B;  2HMM B;  3H3H A;  3MG3 A;  2OOV A;  1BRG A;  1FGQ A;  1A2V A;  1SJW A;  1AR0 A;  3FF2 A;  1ZS7 A;  4BU4 A;  2D1W A;  4FMC A;  3FKA A;  3QRD A;  4MEI A;  4N6T A;  5CLK A;  2YX9 A;  1OGZ A;  3K63 A;  5JPP A;  5D82 A;  1E3V A;  2KF3 A;  2F99 A;  2Y73 A;  3BLZ A;  3UB1 A;  2YFI B;  1Q7H A;  1NB3 I;  4J5K A;  4WWU C;  5AIF A;  1A67 A;  2ML6 A;  3L0R A;  1W5Z A;  1OHO A;  5BU4 A;  1D6U A;  2HOH A;  3NUV A;  2IYJ A;  2F56 A;  3PYJ A;  3LTB A;  5AYS C;  3SED A;  2O9U X;  3TDG A;  1RGE A;  2FXT A;  1E97 A;  1N9E A;  1JZD A;  1Q42 A;  1RCL A;  4NPB A;  3KE7 A;  3GZB A;  1ULJ B;  2HML B;  4BTY A;  3CMA 3;  3NXJ A;  4N6M A;  1Q82 4;  1KC8 4;  5KP1 A;  1AQZ A;  1OCV A;  2KF6 A;  1IT8 A;  1N5H A;  2WO0 A;  3FF0 A;  3CCE 3;  1K9M 4;  3SYU A;  1QAF A;  2HMJ B;  3B4O A;  1MGW A;  1MWU A;  4EYC A;  2W2C A;  2GEX A;  4FMA A;  1RDS A;  3G16 A;  1YGE A;  3ALA A;  3GRD A;  3N54 B;  4HM2 B;  4O8S A;  4HM3 B;  1W6C A;  4R9K A;  5CF1 A;  2OTJ 3;  5ELJ A;  2XRX B;  3MG1 A;  3LXU X;  4KZ1 A;  1I0X A;  4GSP A;  4HZ9 B;  5HOH A;  3I56 3;  4HM8 B;  3EE1 A;  1G0T A;  3DGL A;  2W6J H;  1N5P A;  3PZW A;  4N3V A;  3GAX A;  1O7M B;  2P0X A;  3O8Y A;  3OW2 2;  5JPU A;  3OWU A;  3KN4 A;  3HI7 A;  2CFL A;  3CNX A;  1GS3 A;  3SLU A;  4J8T A;  1UCL A;  2CIU A;  4AKY A;  1HZ1 A;  3AGN A;  2RSX A;  2IA7 A;  5LC6 A;  2RNT A;  4L7K A;  1JBS A;  4N6L A;  5CXO A;  1EEJ A;  1PYL A;  2Z7A A;  3NX0 A;  3B8L A;  1M90 4;  4N6U A;  1PFP A;  2BNG A;  1WTH A;  3AGO A;  5LC7 A;  3WDG B;  4J5G A;  2CWU A;  2OWP A;  3KFQ C;  4KFD A;  3LML A;  1DET A;  4GB5 A;  4ILF A;  1YNV X;  2PNC A;  2SBL A;  3N9H A;  5D81 A;  1GOU A;  3EN8 A;  1GYB A;  1MWS A;  3CCR 3;  1I0V A;  3WHO A;  1NJI 4;  1VQ8 3;  1X1W A;  1M1X B;  2HMN B;  2BMQ B;  1JN5 B;  1IV7 A;  4MMY B;  5DRE A;  2WOF A;  1FUS A;  2CH9 A;  3FGY A;  5RNT A;  2UX0 A;  3HII A;  5M18 A;  4LEH A;  3UL6 A;  2W56 A;  3F9S A;  4WYK A;  1RLS A;  1FGR A;  1NNV A;  5STD A;  2OOV C;  5IF6 A;  3D4A A;  3WA3 A;  3ER7 A;  1TJD A;  3X3X A;  2XFS A;  1RNB A;  1B2U A;  3F7X A;  3G0K A;  2CX0 A;  2XSO B;  2GXF A;  4ZM8 A;  3IMA B;  1RKY A;  1QVG 2;  1ASK A;  2F4Y A;  3M8C A;  2GU1 A;  2W9P A;  3PXM A;  1UI8 A;  3VF1 A;  1MWR A;  4CPK A;  1OH0 A;  5HGR A;  4KVH A;  2AAD A;  5KP3 A;  3HOH A;  2HMO B;  4EV2 A;  1FGM A;  5EVH A;  1VZZ A;  1JN5 A;  4R1K A;  2BT3 A;  3KSP A;  4X2H A;  4XB5 A;  1BGS A;  3GWR A;  3S29 A;  1UW1 A;  1YIJ 3;  1BRI A;  1RGC A;  1OGX A;  1UCI A;  1YVB I;  3CCM 3;  2H0H A;  1ULI B;  1VQ9 3;  3GZX B;  4XM4 A;  4J9A A;  1PY3 A;  5EEO A;  4BL2 A;  2K3D A;  3ZFZ A;  1MOL A;  3SXX A;  1WQL B;  1JBT A;  2E2U A;  1W6G A;  4Q53 A;  3Q90 A;  1TFK A;  1JB5 A;  3NQY A;  4K1U A;  4EXR A;  4H61 A;  5AII A;  1BNS A;  1UI7 A;  1EQK A;  3OX9 A;  1GMR A;  1QVF 2;  3DM8 A;  3MPH A;  1K28 A;  4XBT A; 
#chains in the Genus database with same CATH homology
 1HYF A;  1RGE A;  1RCL A;  3D5G A;  2GSP A;  6GSP A;  1X1X A;  1AQZ A;  1ZGX A;  2KF6 A;  1BRK A;  1FYS A;  2KF4 A;  3Q3F A;  4GHO A;  1YVS A;  3KCH A;  1G02 A;  1RGF A;  3SYU A;  1MGW A;  1B2S A;  1TRP A;  4HOH A;  1RDS A;  1BRJ A;  1RGG A;  2F56 A;  2SAR A;  1RN4 A;  4BIR A;  3AHS A;  3URP A;  5HOH A;  1I0X A;  4GSP A;  2RBI A;  5BIR A;  1B3S A;  1RSN A;  1RGH A;  1BNI A;  3DH2 A;  1Q9E A;  9RNT A;  1TTO A;  8RNT A;  1LNI A;  2F5W A;  5GSP A;  1BNE A;  1BNR A;  1RCK A;  1BSE A;  1I3F A;  1BSB A;  1T2I A;  1RTU A;  1UCL A;  1AY7 A;  1BNJ A;  1BSA A;  3DGY A;  2KAA A;  3D5I A;  2BU4 A;  1HZ1 A;  3AGN A;  3RNT A;  1LOV A;  1BU4 A;  1SAR A;  2RNT A;  1JBS A;  1IYY A;  1I2F A;  1RMS A;  1B2Z A;  1BAN A;  1PYL A;  1A2P A;  2KF5 A;  3BIR A;  3AGO A;  1BNG A;  1BSD A;  1I8V A;  4J5G A;  7RNT A;  1DET A;  1YNV X;  1GOU A;  1UCJ A;  1BRS A;  1I0V A;  3WHO A;  1X1W A;  2AAE A;  1BAO A;  1I2E A;  4RNT A;  1I3I A;  1FUS A;  1RGA A;  5RNT A;  1B21 A;  1R4Y A;  1RLS A;  1RN1 A;  7GSP A;  1B20 A;  1B2X A;  1FUT A;  3BU4 A;  1BUJ A;  1RGK A;  3D4A A;  1BRN L;  1DE3 A;  1BSC A;  1GOY A;  1CH0 A;  1BVI A;  1RNB A;  1B2U A;  4HAA A;  1TRQ A;  1X1U A;  1FZU A;  1UCK A;  2C4B A;  1GMQ A;  2F4Y A;  1JBR A;  3GSP A;  1GMP A;  1RHL A;  1BNF A;  1GSP A;  1I2G A;  1BIR A;  1BOX A;  2AAD A;  3A5E A;  3WR2 A;  1LOY A;  1BRH A;  3HOH A;  1C54 A;  1B2M A;  2BIR A;  1RNT A;  1X1Y A;  1YGW A;  1BGS A;  1BRG A;  1RGL A;  1BRI A;  1RGC A;  1UCI A;  3AHW A;  4BU4 A;  1FW7 A;  1LOW A;  1GOV A;  1MGR A;  1PY3 A;  2KF3 A;  4J5K A;  1JBT A;  1LRA A;  2ZA4 A;  1B27 A;  2F5M A;  1I70 A;  1BNS A;  2HOH A;  5BU4 A;  1GMR A;  1T2H A;  6RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...