1VQ93

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq9300
1Q864 2OTL3 1VQK3 3CC43 1K734 3CCV3 1K8A4 1YJ93 1VQ93 1KD14 3CC73 1M1K4 1VQM3 1W2B2 3CCS3 1YHQ3 3CCR3 1YI23 1Q814 2OTJ3 1Q7Y4 1YJN3 1QVF2 1KC84 3G4S3 3CCL3 1VQ63 3CC23 3OW22 1VQP3 1VQN3 1QVG2 1JJ22 3I563 1M904 1N8R4 1VQ53 1YIJ3 1YIT3 3CPW2 3CCQ3 3CXC2 1KQS2 1VQ43 3CCE3 3G6E3 1VQ83 2QA43 3CCM3 1Q824 3CCJ3 3CCU3 1NJI4 1S723 1K9M4 3CME3 1VQL3 3CMA3 1VQO3 2QEX3 3CD63 1YJW3 3I553 3G713 1VQ73
chains in the Genus database with same CATH superfamily
4BIRA 3EF8A 1OF5A 2WOHA 4XDWA 1X1UA 1TFKA 3D3LA 2CWTA 3F8XA 4OVMA 1OHSA 1RCKA 1MWSA 1JV2B 4BTWA 1YJN3 4LSOA 2E2VA 4KFFA 1UI7A 5BIRA 1OF5B 3WHOA 3T0UA 2CX1A 1RRHA 2GEYA 2L1SA 3I563 1RGLA 5IF6A 5JBSA 1BNEA 3A5EA 1C7HA 1MWUA 1ASKA 3NQYA 1JB5A 1JB4A 1UDII 1ZGXA 1FGTA 3K9MC 2CWUA 2CKFB 4XM4A 1Q7HA 4N6LA 1N5HA 3WDGB 3BNBA 4J9AA 2W9QA 4WP5A 7STDA 3CD63 1WQLB 2UUGC 2OCTA 3ALAA 1GYBA 3V98A 1RGEA 3S5CA 3V92A 3HIIA 5LC6A 3LYGA 2P09A 3NM2A 1CEWI 4HBRA 4R80A 3CCS3 1LVNA 2O9UX 1UCKA 5D82A 1BSEA 3Q1CA 1QVF2 1OCVA 1BRSA 3CCL3 4HM8B 5EEOA 1W02A 2HMNB 3T8NA 5G2GA 1JKGB 4G1MB 3H3HA 3MPHA 2K0MA 4WFOA 3RGAA 1WMPA 1RN4A 1AR0A 1BNRA 3HOHA 4ILFA 1W2ZA 4K61A 2F5MA 3S27A 6RNTA 3CCQ3 1RGCA 1BRKA 1RGAA 4R9KA 3SX1A 1NJI4 3B8LA 1JZDA 1LNIA 3GAXA 2RFRA 3WR2A 4HOHA 2CC3A 1D6YA 1GY6A 3EHCA 1V57A 1IK3A 3FG4A 3SYUA 5TGNA 4FMBA 1EKMA 3EQQB 1RTUA 2RNTA 4LGQA 2ML6A 4KVHA 1UGHI 1MOLA 2P0MA 4EC6A 1RNBA 3NBRA 3EBYA 1HZ1A 1YI23 1IDPA 4HM2B 1CYUA 3FGYA 5AIHA 3DMCA 1TIJA 1X1WA 1ULJB 3S67A 1B21A 1QALA 1V74A 2M7OA 1AVLA 3UNLA 5AIGA 2CG0A 3U97A 1JB2A 2KF4A 1NNVA 3IJEB 2IY2A 1FA3A 3CCJ3 3DGOA 4XBTA 1QJGA 2INXA 1I3FA 4FMAA 1M1XB 4HJLB 2GU1A 4BU4A 1NWWA 3G713 1I0XA 1VQQA 4FMCA 1IVWA 2LQVA 5RNTA 1NU3A 3FZWA 1PFPA 3LT9A 4BL2A 1VQ93 1B2UA 2W2CA 3Q90A 1Q40A 1ZX2A 1VQM3 1RRLA 2BU4A 3FF2A 1Q814 3IMAB 1PYLA 4O3VA 5BU4A 5G1KA 3G4S3 1US1A 4OK0A 4AEQA 3UJMA 1Q40B 3Q3FA 4O2HA 1OACA 1BVIA 2KAAA 3F7XA 3RGRA 2H0HA 2Y74A 3SXXA 2XFSA 1KWIA 3MHEA 3ZG0A 4IIAA 1BRGA 3AGOA 4KFEA 1SIHA 2RBIA 3CME3 3CMA3 3X3YA 1Y4KA 2WGQA 3LXUX 3SLUA 1CQSA 1GY5A 3PXMA 2R4IA 2CHCA 2ZDJA 1IQ8A 3NXJA 4BL3A 3OWUA 1K734 3JUPA 3LTCA 3UB1A 1GS3A 2CFGA 3PCRA 1RGFA 3X3XA 3ER7A 1E3VA 3D9RA 2W9PA 2HMKB 2CH9A 5FGOA 1S5AA 1B27A 2YFIB 1KC84 5BVBA 2BNGA 2JQ5A 1A67A 1VQP3 1YVBI 3L0RA 2XFTA 3NX0A 1FYSA 1I2FA 4L7KA 1B2ZA 3LMLA 1JNQA 2ZA4A 2KCDA 5IEPA 1SJWA 1VQ83 5AIIA 5KP4A 2WOFA 2HMOB 2YX9A 3DXOA 3MG1A 1TRQA 1N8QA 1G96A 3PZWA 1I70A 2P0XA 1OPYA 5EQLA 2F98A 2SARA 2XR8B 2YFJB 3EN1B 1BUJA 1IYYA 5CF2A 1LOVA 2UX0A 4Q53A 4EXRA 1A2VA 2PZVA 1GOVA 4RNYA 4MMYB 1TUHA 2SBLA 1G0TA 4MMZB 2F99A 1VQ63 3SEDA 4XBYA 3RNTA 1PU4A 2GBXB 1BSCA 2Q07A 1ISKA 2XSOB 3B4PA 2PNCA 5M1AA 1YIT3 2K54A 3EJVA 1FGRA 1OHPA 1BU4A 1A2PA 1FGMA 4LMIA 4K1UA 2O3OA 2W04A 3WA3A 3HIGA 3UL6A 3DGNA 1K41A 1VQK3 4J5KA 4N6TA 4HM0B 1LOYA 3BIRA 2C11A 1YJ93 1DETA 1IV9A 1OHOA 1JKGA 4HM4B 4RNZA 5AI1A 1UCIA 1ZO2A 5IERA 2AADA 3BNDA 2I9WA 1DVDA 1BRHA 1IQXA 3X40A 3EN8A 3NBJA 3BB9A 2RSXA 1T3BA 2HOHA 1GOUA 3CXC2 1FUSA 1KQS2 1RGHA 5GSPA 4EYCA 4L8OA 4HM3B 5JPUA 5KP3A 1B2MA 4GHOA 1DMQA 3EBTA 2UGIA 3LTDA 3D5IA 2AAEA 3D79A 3BNEA 1FGQA 1BAOA 1AV4A 2CG1A 1BANA 4MJDA 1FW7A 4O8SA 1K8A4 1WTHA 1KD14 1CH0A 1QMAA 1LOXA 2Z6BA 1IVXA 1Q7Y4 3URPA 1GOYA 1GMPA 2ZL8A 3DY5A 2XEPA 1T5YA 3AGNA 4L8PA 1TU5A 1NB3I 3F8HA 1DE3A 2CFWA 3NHXA 1V58A 1VQN3 1QVG2 3OX9A 4STDA 1VQ53 2BT3A 1UUWB 2XRXB 2B1XB 3N54B 3MWZA 3PS8A 4R1KA 1VQ43 1Q824 3VGNA 2GBWB 1BGSA 1TRPA 4X2HA 1SIIA 1IVUA 1AQZA 3NBBA 5D81A 4MEIA 4N6NB 3X42A 3KZTA 3QRDA 1Q864 2F4YA 1LOWA 4KZ1A 2P38A 2QIYA 5HGRA 4CPKA 1K28A 1UCLA 2ZHXB 3FG1A 2IUKA 1LQMB 3DGYA 3KIIA 4RBNA 3VF1A 3CCR3 1FUTA 1UCJA 2KRTA 1BNGA 3G16A 3STDA 4NREA 1UW1A 1RMSA 3LH4A 3CC23 2HMLB 5CK6A 3TDGA 1BUQA 1W5ZA 2CWVA 2IA7A 3FCSB 3LOYA 1F8NA 6STDA 5M18A 5DREA 1GD4A 3S28A 2W56B 5CLKA 3OV4A 2XSHB 1CYVA 3G6E3 2QGUA 1C54A 1O7NB 1Q42A 2HMJB 1O7WB 2HMMB 2WO0A 3HZPA 4LZIA 3DGMA 3ROBA 4EV5A 5AYRB 5IG3A 4HAAA 1BIRA 1X1YA 3LT8A 5I97A 3JUNA 1B2XA 1VQ73 4HZBB 3HK4A 1EUIC 2STDA 1BRNL 3PYJA 1N9EA 2XGNA 4IPBA 5AEUB 4HM1B 4MMXB 5ELJA 2OTJ3 1LRAA 1E97A 1BNIA 2K3DA 3GZXB 3N8BA 3B4OA 1OGXA 2CFKA 2Y73A 4U13A 4EV2A 3KSED 3OW22 1GD3A 3PGBA 1UUGB 3QK9A 4FCZA 1YNVX 4N6V0 1YIJ3 3BU4A 3M8CA 2KF5A 3MSOA 2OWPA 4FCMA 4FR9A 3CCE3 2OQEC 3FH1A 1MNLA 3RDEA 2QA43 3X3ZA 3U1WA 9RNTA 4I4KA 4HM7B 2BIRA 1SPUA 5AEWB 3EE1A 3FF0A 3D4AA 1EG9B 1MWRA 1MWTA 1RDSA 3F7SA 1IQYA 3GSPA 3JUQA 3O8YA 1R4YA 1M1K4 1BSDA 1W2B2 1O7PB 2OOVC 4FCJA 3GZYB 4GB5A 1EQKA 4K90B 4PEJA 4HVNA 2KF3A 5DRVA 1JZOA 5A0OB 2L4VA 3VSYA 2A15A 3LTBA 1O7HB 1U8CB 2V1LA 3GWRA 4HZ9B 3DGLA 4JRFA 3KN4A 4KT3B 4R4KA 5IG5A 1JBRA 1BNJA 3B7CA 1WMNA 3EX9A 1W4NA 3I0YA 2BMQB 3DUKA 3NQZA 2W0QA 1RGKA 5ELUA 1IU7A 1RGGA 4O02B 1RJOA 5LC7A 4N3VA 2GXFA 1VQO3 1IT7A 1UI8A 4DKIA 1FZUA 1OGZA 2XF3A 4WHAA 1O7MB 1A2KA 1ZS7A 3BLZA 3HI7A 3X41A 4ZM8A 1I3IA 3SVAA 1DMNA 4ORLA 1TP6A 1B2SA 2Z76A 3E99A 4HKVB 5EVHA 2GU3A 2E2TA 4TX4A 3WMDA 2ML5A 4J5GA 3NV0A 4R9LA 5AIFA 3ZFZA 5BXQA 2F56A 1GMRA 3MG2A 1JJ22 2J8XB 1BRIA 3G8ZA 3CPW2 3NV0B 2B24B 2CW9A 1NB5I 1BSBA 2CX0A 4N6OB 1ROAA 1I2GA 4N6MA 3N9HA 1JBTA 3OXAA 2C10A 1J2BA 2BMOB 1IVVA 1SARA 1RLSA 4QWTA 5G1LA 3T8UA 8CHOA 2BMRB 3WA2X 1A90A 1NDOB 1EA2A 1YGEA 3CNMA 4FMDA 4CDLA 4GL6A 2F86B 4OUQA 4CCVA 1BSAA 1JN5A 3WODG 1X1XA 2OQEA 1VZZA 5JPPA 1BNSA 1TFOA 1D6UA 4WYKA 3FLJA 2LYXA 1I2EA 2JDIH 2E2UA 1B20A 3GZRA 4I5QA 2MF7A 1T2HA 1FUWA 1STFI 4EW5A 1RHLA 1JN5B 4X2OA 1DYUA 2IYJA 1MGWA 1YVSA 2Z7AA 4WYKB 2GSPA 4EBGA 3CCU3 1I8VA 3AHSA 1RCLA 3AMOA 1HYFA 2XGLA 4AKZA 5IENA 1D6ZA 2W6JH 2FNQA 2RGQA 2OOVA 1W7CA 1YJW3 3PCSA 4AKYA 1RN7A 2CIUA 1T2IA 3CU3A 1DMMA 1LXEA 2IMJA 4RNTA 2WGOA 3HX8A 3UL5A 3AMOB 1RNTA 1U5OA 2F5WA 3CC73 5IW9A 4J8TA 4JF8A 2FXTA 3H51A 1BOXA 3V99A 3K5TA 3LZAA 2BO9B 4LYLB 2W56A 4XB5A 1GY7A 6GSPA 2FGTA 3FG3A 1Q9EA 1GMQA 1AVKA 3ECFA 3IPTA 3F9SA 4N6UA 4XDVA 4H61A 4HM6B 1G02A 1N8R4 2GEXA 1FGOA 2MC8A 2BHMA 4NPBA 1STDA 5CF1A 3KFQC 3SOAA 1M9GA 1IT8A 1GSPA 1KSIA 1EEJA 1S723 2H0GA 4XBXA 3D5GA 3DZLA 2IUJA 2QEX3 3S29A 1SQWA 3OWSA 5KP1A 1W00A 4BTYA 2OTL3 1ROVA 4NHFA 5IG4A 3MKIA 1Z1SA 2D1WA 1RSNA 3DH2A 3KSPA 3CCV3 3KCHA 1N9JA 1TJDA 2CFLA 8RNTA 1YHQ3 3KKGA 2KF6A 3MYTA 2CFDA 1RN1A 1UUVB 4LEHA 1UGIA 2D42A 3JVCA 5AYSC 3EB8A 4KFDA 1E3RA 5IEOA 1LQGC 1DVCA 1ULIB 1OUNA 3NUVA 3WOFB 4HYZA 1M904 1NO3A 4GSPA 4H3UA 3GRDA 3K63A 1MGRA 3NM7A 1B3SA 3JUOA 2Z77A 1OH0A 3BNCA 3GZBA 1QAFA 4IT7A 1RKYA 5FW5A 1K9M4 3F40A 1IV7A 1O7GB 3WOEB 3FKAA 3ZG5A 3I553 3SOYA 4BTXA 2YFLB 1JRQA 5HOHA 3A76A 4RZMA 1QAKA 1W01A 3CC43 3K0ZA 1BRJA 1LNHA 3JUMA 3LTAA 1WMOA 2H0IA 1JBSA 3CPOA 3F14A 1AY7A 1WNHA 2CK3H 3Q2PA 4K1VA 5D83A 3OWYA 3G0KA 3MG3A 1HU9A 5M19A 4WWUC 2RCDA 3J7Yd 5STDA 3EC9A 2W03A 1W6CA 5CXOA 1PY3A 1TTOA 2C4BA 4HM5B 7RNTA 3K7CA 5IG0A 3DM8A 3KE7A 2KXGA 2R41A 1I0VA 2P05A 1N5PA 1L5GB 3CCM3 4CJNA 1BNFA 3FSDA 1R4CA 7GSPA 1W6GA 2XH9A 1VQL3 3AHWA 1W6YA 3CNXA 1YGWA 1HKXA
chains in the Genus database with same CATH topology
3EF8A 1OF5A 2WOHA 4XDWA 1TFKA 3D3LA 2CWTA 3F8XA 4OVMA 1OHSA 1JV2B 4BTWA 1YJN3 4LSOA 2E2VA 4KFFA 1UI7A 1OF5B 3T0UA 1RRHA 2GEYA 3I563 5JBSA 5IF6A 3NQYA 1C7HA 1ASKA 1JB5A 1JB4A 1FGTA 3K9MC 2CWUA 2CKFB 4XM4A 4N6LA 1N5HA 3WDGB 3BNBA 4J9AA 2W9QA 4WP5A 7STDA 3CD63 1WQLB 2OCTA 3ALAA 1GYBA 3V98A 3S5CA 3V92A 3HIIA 5LC6A 3LYGA 2P09A 3NM2A 1CEWI 4HBRA 4R80A 3CCS3 1LVNA 2O9UX 5D82A 3Q1CA 1QVF2 1OCVA 3CCL3 4HM8B 5EEOA 1W02A 2HMNB 3T8NA 5G2GA 1JKGB 4G1MB 3H3HA 3MPHA 2K0MA 4WFOA 3RGAA 1WMPA 1AR0A 1W2ZA 4K61A 3S27A 3CCQ3 3SX1A 4R9KA 1NJI4 3B8LA 3GAXA 2RFRA 2CC3A 1D6YA 1GY6A 3EHCA 1IK3A 3FG4A 5TGNA 4FMBA 1EKMA 3EQQB 4LGQA 2ML6A 4KVHA 2P0MA 1MOLA 4EC6A 3NBRA 3EBYA 1YI23 1IDPA 4HM2B 1CYUA 3FGYA 5AIHA 3DMCA 1TIJA 1ULJB 3S67A 1QALA 1V74A 2M7OA 1AVLA 3UNLA 5AIGA 2CG0A 3U97A 1JB2A 3IJEB 1FA3A 3CCJ3 3DGOA 4XBTA 1QJGA 2INXA 4FMAA 1M1XB 4HJLB 2GU1A 1NWWA 3G713 4FMCA 1IVWA 2LQVA 1NU3A 3FZWA 1PFPA 3LT9A 2W2CA 3Q90A 1Q40A 1ZX2A 1VQM3 1RRLA 3FF2A 1Q814 3IMAB 4O3VA 3G4S3 1US1A 4OK0A 4AEQA 3UJMA 1Q40B 4O2HA 1OACA 3F7XA 3RGRA 2Y74A 3SXXA 2XFSA 1KWIA 3MHEA 4IIAA 4KFEA 3CMA3 1SIHA 3CME3 3X3YA 1Y4KA 2WGQA 3LXUX 3SLUA 1CQSA 1GY5A 3PXMA 2R4IA 2CHCA 2ZDJA 1IQ8A 3NXJA 3OWUA 1K734 3JUPA 3LTCA 3UB1A 1GS3A 2CFGA 3PCRA 3X3XA 3ER7A 1E3VA 3D9RA 2W9PA 2HMKB 2CH9A 5FGOA 1S5AA 1KC84 2YFIB 5BVBA 2BNGA 2JQ5A 1A67A 1VQP3 1YVBI 3L0RA 2XFTA 3NX0A 4L7KA 3LMLA 1JNQA 2KCDA 5IEPA 1SJWA 1VQ83 5AIIA 5KP4A 2WOFA 2HMOB 2YX9A 3DXOA 3MG1A 1N8QA 1G96A 3PZWA 2P0XA 1OPYA 5EQLA 2F98A 2XR8B 2YFJB 3EN1B 5CF2A 2UX0A 4Q53A 4EXRA 1A2VA 2PZVA 4RNYA 4MMYB 1TUHA 2SBLA 4MMZB 2F99A 1VQ63 3SEDA 4XBYA 1PU4A 2GBXB 2Q07A 1ISKA 2XSOB 3B4PA 2PNCA 1YIT3 2K54A 3EJVA 1FGRA 1OHPA 1FGMA 4LMIA 4K1UA 2O3OA 2W04A 3WA3A 3HIGA 3UL6A 3DGNA 1K41A 1VQK3 4N6TA 4HM0B 2C11A 1YJ93 1OHOA 1IV9A 4HM4B 1JKGA 4RNZA 5AI1A 5IERA 1ZO2A 1VQ93 3BNDA 2I9WA 1DVDA 1IQXA 3X40A 3EN8A 3NBJA 3BB9A 2RSXA 3CXC2 1KQS2 4EYCA 4L8OA 4HM3B 5JPUA 5KP3A 1DMQA 3EBTA 3LTDA 3BNEA 1FGQA 1AV4A 2CG1A 4MJDA 4O8SA 1K8A4 1WTHA 1KD14 1QMAA 1LOXA 2Z6BA 1IVXA 1Q7Y4 2ZL8A 3DY5A 4L8PA 2XEPA 1T5YA 1TU5A 1NB3I 3F8HA 2CFWA 3NHXA 1VQN3 1QVG2 3OX9A 4STDA 1VQ53 2BT3A 1UUWB 2XRXB 2B1XB 3N54B 3MWZA 3PS8A 4R1KA 1VQ43 1Q824 3VGNA 2GBWB 4X2HA 1SIIA 1IVUA 3NBBA 5D81A 4MEIA 4N6NB 3X42A 3KZTA 3QRDA 1Q864 4KZ1A 2P38A 2QIYA 5HGRA 1K28A 3FG1A 2IUKA 3KIIA 4RBNA 3VF1A 3CCR3 2KRTA 3G16A 3STDA 4NREA 1UW1A 3LH4A 3CC23 2HMLB 5CK6A 3TDGA 1BUQA 1W5ZA 2CWVA 2IA7A 3FCSB 3LOYA 1F8NA 6STDA 5DREA 1GD4A 3S28A 2W56B 5CLKA 3OV4A 2XSHB 1CYVA 3G6E3 2QGUA 1O7NB 1Q42A 2HMJB 1O7WB 2HMMB 2WO0A 3HZPA 4LZIA 3DGMA 3ROBA 4EV5A 5AYRB 5IG3A 3LT8A 5I97A 3JUNA 1VQ73 4HZBB 3HK4A 2STDA 3PYJA 1N9EA 2XGNA 4IPBA 5AEUB 4HM1B 4MMXB 5ELJA 2OTJ3 1E97A 3GZXB 3N8BA 4U13A 4EV2A 3B4OA 1OGXA 2CFKA 2Y73A 3KSED 3OW22 1GD3A 3PGBA 3QK9A 4FCZA 4N6V0 1YIJ3 3M8CA 3MSOA 2OWPA 4FCMA 4FR9A 3CCE3 2OQEC 3FH1A 1MNLA 3RDEA 2QA43 3X3ZA 3U1WA 4I4KA 4HM7B 1SPUA 5AEWB 3EE1A 3FF0A 1EG9B 3F7SA 1IQYA 3JUQA 3O8YA 1M1K4 1W2B2 1O7PB 2OOVC 4FCJA 3GZYB 4GB5A 1EQKA 4K90B 4PEJA 4HVNA 5DRVA 5A0OB 2L4VA 3VSYA 2A15A 3LTBA 1O7HB 1U8CB 2V1LA 3GWRA 4HZ9B 3DGLA 4JRFA 3KN4A 4R4KA 5IG5A 3B7CA 1WMNA 3EX9A 1W4NA 3I0YA 2BMQB 3DUKA 3NQZA 2W0QA 5ELUA 1IU7A 4O02B 5LC7A 1RJOA 4N3VA 2GXFA 1VQO3 1IT7A 1UI8A 1OGZA 2XF3A 4WHAA 1O7MB 1A2KA 3BLZA 3HI7A 3X41A 4ZM8A 3SVAA 1DMNA 4ORLA 1TP6A 2Z76A 3E99A 4HKVB 5EVHA 2GU3A 2E2TA 4TX4A 3WMDA 2ML5A 3NV0A 4R9LA 5AIFA 5BXQA 3MG2A 1JJ22 3G8ZA 3CPW2 3NV0B 2B24B 2CW9A 1NB5I 4N6OB 1ROAA 4N6MA 3N9HA 1J2BA 3OXAA 2C10A 2BMOB 1IVVA 4QWTA 3T8UA 8CHOA 2BMRB 3WA2X 1A90A 1NDOB 1EA2A 1YGEA 3CNMA 4FMDA 4CDLA 4GL6A 2F86B 4OUQA 4CCVA 1JN5A 3WODG 2OQEA 1VZZA 5JPPA 1TFOA 1D6UA 4WYKA 3FLJA 2LYXA 2JDIH 2E2UA 3GZRA 2MF7A 1FUWA 1STFI 4X2OA 1JN5B 1DYUA 2Z7AA 4WYKB 4EBGA 3CCU3 3AMOA 4AKZA 2XGLA 5IENA 1D6ZA 2W6JH 2FNQA 2RGQA 2OOVA 1W7CA 1YJW3 3PCSA 4AKYA 1RN7A 2CIUA 3CU3A 1DMMA 1LXEA 2IMJA 2WGOA 3HX8A 3UL5A 3AMOB 1U5OA 3CC73 5IW9A 4J8TA 4JF8A 2FXTA 3H51A 3V99A 3K5TA 3LZAA 2BO9B 4XB5A 2W56A 1GY7A 2FGTA 3FG3A 3ECFA 1AVKA 3IPTA 3F9SA 4N6UA 4XDVA 4H61A 4HM6B 1N8R4 2GEXA 1FGOA 2MC8A 2BHMA 1STDA 5CF1A 3KFQC 3SOAA 1M9GA 1IT8A 1KSIA 1S723 4XBXA 3DZLA 2IUJA 2QEX3 3S29A 1SQWA 3OWSA 5KP1A 1W00A 4BTYA 2OTL3 1ROVA 4NHFA 5IG4A 3MKIA 1Z1SA 2D1WA 3CCV3 3KSPA 1N9JA 2CFLA 1YHQ3 3KKGA 3MYTA 2CFDA 1UUVB 4LEHA 5AYSC 2D42A 3JVCA 3EB8A 4KFDA 1E3RA 5IEOA 1DVCA 1ULIB 1OUNA 3NUVA 3WOFB 4HYZA 1M904 1NO3A 4H3UA 3GRDA 3K63A 3NM7A 3JUOA 2Z77A 1OH0A 3BNCA 3GZBA 1QAFA 4IT7A 1RKYA 5FW5A 1K9M4 3F40A 1IV7A 1O7GB 3WOEB 3FKAA 3I553 3SOYA 4BTXA 2YFLB 1JRQA 3A76A 4RZMA 1QAKA 1W01A 3CC43 3K0ZA 1LNHA 3JUMA 3LTAA 1WMOA 3CPOA 3F14A 1WNHA 2CK3H 3Q2PA 4K1VA 5D83A 3OWYA 3G0KA 3MG3A 1HU9A 4WWUC 2RCDA 3J7Yd 5STDA 3EC9A 2W03A 1W6CA 5CXOA 4HM5B 3K7CA 5IG0A 3DM8A 3KE7A 2KXGA 2P05A 1N5PA 1L5GB 3CCM3 3FSDA 1R4CA 1W6GA 2XH9A 1VQL3 1W6YA 3CNXA 1HKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 4;  2OTL 3;  1VQK 3;  3CC4 3;  1K73 4;  3CCV 3;  1K8A 4;  1YJ9 3;  1VQ9 3;  1KD1 4;  3CC7 3;  1M1K 4;  1VQM 3;  1W2B 2;  3CCS 3;  1YHQ 3;  3CCR 3;  1YI2 3;  1Q81 4;  2OTJ 3;  1Q7Y 4;  1YJN 3;  1QVF 2;  1KC8 4;  3G4S 3;  3CCL 3;  1VQ6 3;  3CC2 3;  3OW2 2;  1VQP 3;  1VQN 3;  1QVG 2;  1JJ2 2;  3I56 3;  1M90 4;  1N8R 4;  1VQ5 3;  1YIJ 3;  1YIT 3;  3CPW 2;  3CCQ 3;  3CXC 2;  1KQS 2;  1VQ4 3;  3CCE 3;  3G6E 3;  1VQ8 3;  2QA4 3;  3CCM 3;  1Q82 4;  3CCJ 3;  3CCU 3;  1NJI 4;  1S72 3;  1K9M 4;  3CME 3;  1VQL 3;  3CMA 3;  1VQO 3;  2QEX 3;  3CD6 3;  1YJW 3;  3I55 3;  3G71 3;  1VQ7 3; 
#chains in the Genus database with same CATH topology
 4BIR A;  3EF8 A;  1OF5 A;  2WOH A;  4XDW A;  1X1U A;  1TFK A;  3D3L A;  2CWT A;  3F8X A;  4OVM A;  1OHS A;  1RCK A;  1MWS A;  1JV2 B;  4BTW A;  1YJN 3;  4LSO A;  2E2V A;  4KFF A;  1UI7 A;  5BIR A;  1OF5 B;  3WHO A;  3T0U A;  2CX1 A;  1RRH A;  2GEY A;  2L1S A;  3I56 3;  1RGL A;  5IF6 A;  5JBS A;  1BNE A;  3A5E A;  1C7H A;  1MWU A;  1ASK A;  3NQY A;  1JB5 A;  1JB4 A;  1UDI I;  1ZGX A;  1FGT A;  3K9M C;  2CWU A;  2CKF B;  4XM4 A;  1Q7H A;  4N6L A;  1N5H A;  3WDG B;  3BNB A;  4J9A A;  2W9Q A;  4WP5 A;  7STD A;  3CD6 3;  1WQL B;  2UUG C;  2OCT A;  3ALA A;  1GYB A;  3V98 A;  1RGE A;  3S5C A;  3V92 A;  3HII A;  5LC6 A;  3LYG A;  2P09 A;  3NM2 A;  1CEW I;  4HBR A;  4R80 A;  3CCS 3;  1LVN A;  2O9U X;  1UCK A;  5D82 A;  1BSE A;  3Q1C A;  1QVF 2;  1OCV A;  1BRS A;  3CCL 3;  4HM8 B;  5EEO A;  1W02 A;  2HMN B;  3T8N A;  5G2G A;  1JKG B;  4G1M B;  3H3H A;  3MPH A;  2K0M A;  4WFO A;  3RGA A;  1WMP A;  1RN4 A;  1AR0 A;  1BNR A;  3HOH A;  4ILF A;  1W2Z A;  4K61 A;  2F5M A;  3S27 A;  6RNT A;  3CCQ 3;  1RGC A;  1BRK A;  1RGA A;  4R9K A;  3SX1 A;  1NJI 4;  3B8L A;  1JZD A;  1LNI A;  3GAX A;  2RFR A;  3WR2 A;  4HOH A;  2CC3 A;  1D6Y A;  1GY6 A;  3EHC A;  1V57 A;  1IK3 A;  3FG4 A;  3SYU A;  5TGN A;  4FMB A;  1EKM A;  3EQQ B;  1RTU A;  2RNT A;  4LGQ A;  2ML6 A;  4KVH A;  1UGH I;  1MOL A;  2P0M A;  4EC6 A;  1RNB A;  3NBR A;  3EBY A;  1HZ1 A;  1YI2 3;  1IDP A;  4HM2 B;  1CYU A;  3FGY A;  5AIH A;  3DMC A;  1TIJ A;  1X1W A;  1ULJ B;  3S67 A;  1B21 A;  1QAL A;  1V74 A;  2M7O A;  1AVL A;  3UNL A;  5AIG A;  2CG0 A;  3U97 A;  1JB2 A;  2KF4 A;  1NNV A;  3IJE B;  2IY2 A;  1FA3 A;  3CCJ 3;  3DGO A;  4XBT A;  1QJG A;  2INX A;  1I3F A;  4FMA A;  1M1X B;  4HJL B;  2GU1 A;  4BU4 A;  1NWW A;  3G71 3;  1I0X A;  1VQQ A;  4FMC A;  1IVW A;  2LQV A;  5RNT A;  1NU3 A;  3FZW A;  1PFP A;  3LT9 A;  4BL2 A;  1VQ9 3;  1B2U A;  2W2C A;  3Q90 A;  1Q40 A;  1ZX2 A;  1VQM 3;  1RRL A;  2BU4 A;  3FF2 A;  1Q81 4;  3IMA B;  1PYL A;  4O3V A;  5BU4 A;  5G1K A;  3G4S 3;  1US1 A;  4OK0 A;  4AEQ A;  3UJM A;  1Q40 B;  3Q3F A;  4O2H A;  1OAC A;  1BVI A;  2KAA A;  3F7X A;  3RGR A;  2H0H A;  2Y74 A;  3SXX A;  2XFS A;  1KWI A;  3MHE A;  3ZG0 A;  4IIA A;  1BRG A;  3AGO A;  4KFE A;  1SIH A;  2RBI A;  3CME 3;  3CMA 3;  3X3Y A;  1Y4K A;  2WGQ A;  3LXU X;  3SLU A;  1CQS A;  1GY5 A;  3PXM A;  2R4I A;  2CHC A;  2ZDJ A;  1IQ8 A;  3NXJ A;  4BL3 A;  3OWU A;  1K73 4;  3JUP A;  3LTC A;  3UB1 A;  1GS3 A;  2CFG A;  3PCR A;  1RGF A;  3X3X A;  3ER7 A;  1E3V A;  3D9R A;  2W9P A;  2HMK B;  2CH9 A;  5FGO A;  1S5A A;  1B27 A;  2YFI B;  1KC8 4;  5BVB A;  2BNG A;  2JQ5 A;  1A67 A;  1VQP 3;  1YVB I;  3L0R A;  2XFT A;  3NX0 A;  1FYS A;  1I2F A;  4L7K A;  1B2Z A;  3LML A;  1JNQ A;  2ZA4 A;  2KCD A;  5IEP A;  1SJW A;  1VQ8 3;  5AII A;  5KP4 A;  2WOF A;  2HMO B;  2YX9 A;  3DXO A;  3MG1 A;  1TRQ A;  1N8Q A;  1G96 A;  3PZW A;  1I70 A;  2P0X A;  1OPY A;  5EQL A;  2F98 A;  2SAR A;  2XR8 B;  2YFJ B;  3EN1 B;  1BUJ A;  1IYY A;  5CF2 A;  1LOV A;  2UX0 A;  4Q53 A;  4EXR A;  1A2V A;  2PZV A;  1GOV A;  4RNY A;  4MMY B;  1TUH A;  2SBL A;  1G0T A;  4MMZ B;  2F99 A;  1VQ6 3;  3SED A;  4XBY A;  3RNT A;  1PU4 A;  2GBX B;  1BSC A;  2Q07 A;  1ISK A;  2XSO B;  3B4P A;  2PNC A;  5M1A A;  1YIT 3;  2K54 A;  3EJV A;  1FGR A;  1OHP A;  1BU4 A;  1A2P A;  1FGM A;  4LMI A;  4K1U A;  2O3O A;  2W04 A;  3WA3 A;  3HIG A;  3UL6 A;  3DGN A;  1K41 A;  1VQK 3;  4J5K A;  4N6T A;  4HM0 B;  1LOY A;  3BIR A;  2C11 A;  1YJ9 3;  1DET A;  1IV9 A;  1OHO A;  1JKG A;  4HM4 B;  4RNZ A;  5AI1 A;  1UCI A;  1ZO2 A;  5IER A;  2AAD A;  3BND A;  2I9W A;  1DVD A;  1BRH A;  1IQX A;  3X40 A;  3EN8 A;  3NBJ A;  3BB9 A;  2RSX A;  1T3B A;  2HOH A;  1GOU A;  3CXC 2;  1FUS A;  1KQS 2;  1RGH A;  5GSP A;  4EYC A;  4L8O A;  4HM3 B;  5JPU A;  5KP3 A;  1B2M A;  4GHO A;  1DMQ A;  3EBT A;  2UGI A;  3LTD A;  3D5I A;  2AAE A;  3D79 A;  3BNE A;  1FGQ A;  1BAO A;  1AV4 A;  2CG1 A;  1BAN A;  4MJD A;  1FW7 A;  4O8S A;  1K8A 4;  1WTH A;  1KD1 4;  1CH0 A;  1QMA A;  1LOX A;  2Z6B A;  1IVX A;  1Q7Y 4;  3URP A;  1GOY A;  1GMP A;  2ZL8 A;  3DY5 A;  2XEP A;  1T5Y A;  3AGN A;  4L8P A;  1TU5 A;  1NB3 I;  3F8H A;  1DE3 A;  2CFW A;  3NHX A;  1V58 A;  1VQN 3;  1QVG 2;  3OX9 A;  4STD A;  1VQ5 3;  2BT3 A;  1UUW B;  2XRX B;  2B1X B;  3N54 B;  3MWZ A;  3PS8 A;  4R1K A;  1VQ4 3;  1Q82 4;  3VGN A;  2GBW B;  1BGS A;  1TRP A;  4X2H A;  1SII A;  1IVU A;  1AQZ A;  3NBB A;  5D81 A;  4MEI A;  4N6N B;  3X42 A;  3KZT A;  3QRD A;  1Q86 4;  2F4Y A;  1LOW A;  4KZ1 A;  2P38 A;  2QIY A;  5HGR A;  4CPK A;  1K28 A;  1UCL A;  2ZHX B;  3FG1 A;  2IUK A;  1LQM B;  3DGY A;  3KII A;  4RBN A;  3VF1 A;  3CCR 3;  1FUT A;  1UCJ A;  2KRT A;  1BNG A;  3G16 A;  3STD A;  4NRE A;  1UW1 A;  1RMS A;  3LH4 A;  3CC2 3;  2HML B;  5CK6 A;  3TDG A;  1BUQ A;  1W5Z A;  2CWV A;  2IA7 A;  3FCS B;  3LOY A;  1F8N A;  6STD A;  5M18 A;  5DRE A;  1GD4 A;  3S28 A;  2W56 B;  5CLK A;  3OV4 A;  2XSH B;  1CYV A;  3G6E 3;  2QGU A;  1C54 A;  1O7N B;  1Q42 A;  2HMJ B;  1O7W B;  2HMM B;  2WO0 A;  3HZP A;  4LZI A;  3DGM A;  3ROB A;  4EV5 A;  5AYR B;  5IG3 A;  4HAA A;  1BIR A;  1X1Y A;  3LT8 A;  5I97 A;  3JUN A;  1B2X A;  1VQ7 3;  4HZB B;  3HK4 A;  1EUI C;  2STD A;  1BRN L;  3PYJ A;  1N9E A;  2XGN A;  4IPB A;  5AEU B;  4HM1 B;  4MMX B;  5ELJ A;  2OTJ 3;  1LRA A;  1E97 A;  1BNI A;  2K3D A;  3GZX B;  3N8B A;  3B4O A;  1OGX A;  2CFK A;  2Y73 A;  4U13 A;  4EV2 A;  3KSE D;  3OW2 2;  1GD3 A;  3PGB A;  1UUG B;  3QK9 A;  4FCZ A;  1YNV X;  4N6V 0;  1YIJ 3;  3BU4 A;  3M8C A;  2KF5 A;  3MSO A;  2OWP A;  4FCM A;  4FR9 A;  3CCE 3;  2OQE C;  3FH1 A;  1MNL A;  3RDE A;  2QA4 3;  3X3Z A;  3U1W A;  9RNT A;  4I4K A;  4HM7 B;  2BIR A;  1SPU A;  5AEW B;  3EE1 A;  3FF0 A;  3D4A A;  1EG9 B;  1MWR A;  1MWT A;  1RDS A;  3F7S A;  1IQY A;  3GSP A;  3JUQ A;  3O8Y A;  1R4Y A;  1M1K 4;  1BSD A;  1W2B 2;  1O7P B;  2OOV C;  4FCJ A;  3GZY B;  4GB5 A;  1EQK A;  4K90 B;  4PEJ A;  4HVN A;  2KF3 A;  5DRV A;  1JZO A;  5A0O B;  2L4V A;  3VSY A;  2A15 A;  3LTB A;  1O7H B;  1U8C B;  2V1L A;  3GWR A;  4HZ9 B;  3DGL A;  4JRF A;  3KN4 A;  4KT3 B;  4R4K A;  5IG5 A;  1JBR A;  1BNJ A;  3B7C A;  1WMN A;  3EX9 A;  1W4N A;  3I0Y A;  2BMQ B;  3DUK A;  3NQZ A;  2W0Q A;  1RGK A;  5ELU A;  1IU7 A;  1RGG A;  4O02 B;  1RJO A;  5LC7 A;  4N3V A;  2GXF A;  1VQO 3;  1IT7 A;  1UI8 A;  4DKI A;  1FZU A;  1OGZ A;  2XF3 A;  4WHA A;  1O7M B;  1A2K A;  1ZS7 A;  3BLZ A;  3HI7 A;  3X41 A;  4ZM8 A;  1I3I A;  3SVA A;  1DMN A;  4ORL A;  1TP6 A;  1B2S A;  2Z76 A;  3E99 A;  4HKV B;  5EVH A;  2GU3 A;  2E2T A;  4TX4 A;  3WMD A;  2ML5 A;  4J5G A;  3NV0 A;  4R9L A;  5AIF A;  3ZFZ A;  5BXQ A;  2F56 A;  1GMR A;  3MG2 A;  1JJ2 2;  2J8X B;  1BRI A;  3G8Z A;  3CPW 2;  3NV0 B;  2B24 B;  2CW9 A;  1NB5 I;  1BSB A;  2CX0 A;  4N6O B;  1ROA A;  1I2G A;  4N6M A;  3N9H A;  1JBT A;  3OXA A;  2C10 A;  1J2B A;  2BMO B;  1IVV A;  1SAR A;  1RLS A;  4QWT A;  5G1L A;  3T8U A;  8CHO A;  2BMR B;  3WA2 X;  1A90 A;  1NDO B;  1EA2 A;  1YGE A;  3CNM A;  4FMD A;  4CDL A;  4GL6 A;  2F86 B;  4OUQ A;  4CCV A;  1BSA A;  1JN5 A;  3WOD G;  1X1X A;  2OQE A;  1VZZ A;  5JPP A;  1BNS A;  1TFO A;  1D6U A;  4WYK A;  3FLJ A;  2LYX A;  1I2E A;  2JDI H;  2E2U A;  1B20 A;  3GZR A;  4I5Q A;  2MF7 A;  1T2H A;  1FUW A;  1STF I;  4EW5 A;  1RHL A;  1JN5 B;  4X2O A;  1DYU A;  2IYJ A;  1MGW A;  1YVS A;  2Z7A A;  4WYK B;  2GSP A;  4EBG A;  3CCU 3;  1I8V A;  3AHS A;  1RCL A;  3AMO A;  1HYF A;  2XGL A;  4AKZ A;  5IEN A;  1D6Z A;  2W6J H;  2FNQ A;  2RGQ A;  2OOV A;  1W7C A;  1YJW 3;  3PCS A;  4AKY A;  1RN7 A;  2CIU A;  1T2I A;  3CU3 A;  1DMM A;  1LXE A;  2IMJ A;  4RNT A;  2WGO A;  3HX8 A;  3UL5 A;  3AMO B;  1RNT A;  1U5O A;  2F5W A;  3CC7 3;  5IW9 A;  4J8T A;  4JF8 A;  2FXT A;  3H51 A;  1BOX A;  3V99 A;  3K5T A;  3LZA A;  2BO9 B;  4LYL B;  2W56 A;  4XB5 A;  1GY7 A;  6GSP A;  2FGT A;  3FG3 A;  1Q9E A;  1GMQ A;  1AVK A;  3ECF A;  3IPT A;  3F9S A;  4N6U A;  4XDV A;  4H61 A;  4HM6 B;  1G02 A;  1N8R 4;  2GEX A;  1FGO A;  2MC8 A;  2BHM A;  4NPB A;  1STD A;  5CF1 A;  3KFQ C;  3SOA A;  1M9G A;  1IT8 A;  1GSP A;  1KSI A;  1EEJ A;  1S72 3;  2H0G A;  4XBX A;  3D5G A;  3DZL A;  2IUJ A;  2QEX 3;  3S29 A;  1SQW A;  3OWS A;  5KP1 A;  1W00 A;  4BTY A;  2OTL 3;  1ROV A;  4NHF A;  5IG4 A;  3MKI A;  1Z1S A;  2D1W A;  1RSN A;  3DH2 A;  3KSP A;  3CCV 3;  3KCH A;  1N9J A;  1TJD A;  2CFL A;  8RNT A;  1YHQ 3;  3KKG A;  2KF6 A;  3MYT A;  2CFD A;  1RN1 A;  1UUV B;  4LEH A;  1UGI A;  2D42 A;  3JVC A;  5AYS C;  3EB8 A;  4KFD A;  1E3R A;  5IEO A;  1LQG C;  1DVC A;  1ULI B;  1OUN A;  3NUV A;  3WOF B;  4HYZ A;  1M90 4;  1NO3 A;  4GSP A;  4H3U A;  3GRD A;  3K63 A;  1MGR A;  3NM7 A;  1B3S A;  3JUO A;  2Z77 A;  1OH0 A;  3BNC A;  3GZB A;  1QAF A;  4IT7 A;  1RKY A;  5FW5 A;  1K9M 4;  3F40 A;  1IV7 A;  1O7G B;  3WOE B;  3FKA A;  3ZG5 A;  3I55 3;  3SOY A;  4BTX A;  2YFL B;  1JRQ A;  5HOH A;  3A76 A;  4RZM A;  1QAK A;  1W01 A;  3CC4 3;  3K0Z A;  1BRJ A;  1LNH A;  3JUM A;  3LTA A;  1WMO A;  2H0I A;  1JBS A;  3CPO A;  3F14 A;  1AY7 A;  1WNH A;  2CK3 H;  3Q2P A;  4K1V A;  5D83 A;  3OWY A;  3G0K A;  3MG3 A;  1HU9 A;  5M19 A;  4WWU C;  2RCD A;  3J7Y d;  5STD A;  3EC9 A;  2W03 A;  1W6C A;  5CXO A;  1PY3 A;  1TTO A;  2C4B A;  4HM5 B;  7RNT A;  3K7C A;  5IG0 A;  3DM8 A;  3KE7 A;  2KXG A;  2R41 A;  1I0V A;  2P05 A;  1N5P A;  1L5G B;  3CCM 3;  4CJN A;  1BNF A;  3FSD A;  1R4C A;  7GSP A;  1W6G A;  2XH9 A;  1VQL 3;  3AHW A;  1W6Y A;  3CNX A;  1YGW A;  1HKX A; 
#chains in the Genus database with same CATH homology
 3EF8 A;  1OF5 A;  2WOH A;  4XDW A;  1TFK A;  3D3L A;  2CWT A;  3F8X A;  4OVM A;  1OHS A;  1JV2 B;  4BTW A;  1YJN 3;  4LSO A;  2E2V A;  4KFF A;  1UI7 A;  1OF5 B;  3T0U A;  1RRH A;  2GEY A;  3I56 3;  5JBS A;  5IF6 A;  3NQY A;  1C7H A;  1ASK A;  1JB5 A;  1JB4 A;  1FGT A;  3K9M C;  2CWU A;  2CKF B;  4XM4 A;  4N6L A;  1N5H A;  3WDG B;  3BNB A;  4J9A A;  2W9Q A;  4WP5 A;  7STD A;  3CD6 3;  1WQL B;  2OCT A;  3ALA A;  1GYB A;  3V98 A;  3S5C A;  3V92 A;  3HII A;  5LC6 A;  3LYG A;  2P09 A;  3NM2 A;  1CEW I;  4HBR A;  4R80 A;  3CCS 3;  1LVN A;  2O9U X;  5D82 A;  3Q1C A;  1QVF 2;  1OCV A;  3CCL 3;  4HM8 B;  5EEO A;  1W02 A;  2HMN B;  3T8N A;  5G2G A;  1JKG B;  4G1M B;  3H3H A;  3MPH A;  2K0M A;  4WFO A;  3RGA A;  1WMP A;  1AR0 A;  1W2Z A;  4K61 A;  3S27 A;  3CCQ 3;  3SX1 A;  4R9K A;  1NJI 4;  3B8L A;  3GAX A;  2RFR A;  2CC3 A;  1D6Y A;  1GY6 A;  3EHC A;  1IK3 A;  3FG4 A;  5TGN A;  4FMB A;  1EKM A;  3EQQ B;  4LGQ A;  2ML6 A;  4KVH A;  2P0M A;  1MOL A;  4EC6 A;  3NBR A;  3EBY A;  1YI2 3;  1IDP A;  4HM2 B;  1CYU A;  3FGY A;  5AIH A;  3DMC A;  1TIJ A;  1ULJ B;  3S67 A;  1QAL A;  1V74 A;  2M7O A;  1AVL A;  3UNL A;  5AIG A;  2CG0 A;  3U97 A;  1JB2 A;  3IJE B;  1FA3 A;  3CCJ 3;  3DGO A;  4XBT A;  1QJG A;  2INX A;  4FMA A;  1M1X B;  4HJL B;  2GU1 A;  1NWW A;  3G71 3;  4FMC A;  1IVW A;  2LQV A;  1NU3 A;  3FZW A;  1PFP A;  3LT9 A;  2W2C A;  3Q90 A;  1Q40 A;  1ZX2 A;  1VQM 3;  1RRL A;  3FF2 A;  1Q81 4;  3IMA B;  4O3V A;  3G4S 3;  1US1 A;  4OK0 A;  4AEQ A;  3UJM A;  1Q40 B;  4O2H A;  1OAC A;  3F7X A;  3RGR A;  2Y74 A;  3SXX A;  2XFS A;  1KWI A;  3MHE A;  4IIA A;  4KFE A;  3CMA 3;  1SIH A;  3CME 3;  3X3Y A;  1Y4K A;  2WGQ A;  3LXU X;  3SLU A;  1CQS A;  1GY5 A;  3PXM A;  2R4I A;  2CHC A;  2ZDJ A;  1IQ8 A;  3NXJ A;  3OWU A;  1K73 4;  3JUP A;  3LTC A;  3UB1 A;  1GS3 A;  2CFG A;  3PCR A;  3X3X A;  3ER7 A;  1E3V A;  3D9R A;  2W9P A;  2HMK B;  2CH9 A;  5FGO A;  1S5A A;  1KC8 4;  2YFI B;  5BVB A;  2BNG A;  2JQ5 A;  1A67 A;  1VQP 3;  1YVB I;  3L0R A;  2XFT A;  3NX0 A;  4L7K A;  3LML A;  1JNQ A;  2KCD A;  5IEP A;  1SJW A;  1VQ8 3;  5AII A;  5KP4 A;  2WOF A;  2HMO B;  2YX9 A;  3DXO A;  3MG1 A;  1N8Q A;  1G96 A;  3PZW A;  2P0X A;  1OPY A;  5EQL A;  2F98 A;  2XR8 B;  2YFJ B;  3EN1 B;  5CF2 A;  2UX0 A;  4Q53 A;  4EXR A;  1A2V A;  2PZV A;  4RNY A;  4MMY B;  1TUH A;  2SBL A;  4MMZ B;  2F99 A;  1VQ6 3;  3SED A;  4XBY A;  1PU4 A;  2GBX B;  2Q07 A;  1ISK A;  2XSO B;  3B4P A;  2PNC A;  1YIT 3;  2K54 A;  3EJV A;  1FGR A;  1OHP A;  1FGM A;  4LMI A;  4K1U A;  2O3O A;  2W04 A;  3WA3 A;  3HIG A;  3UL6 A;  3DGN A;  1K41 A;  1VQK 3;  4N6T A;  4HM0 B;  2C11 A;  1YJ9 3;  1OHO A;  1IV9 A;  4HM4 B;  1JKG A;  4RNZ A;  5AI1 A;  5IER A;  1ZO2 A;  1VQ9 3;  3BND A;  2I9W A;  1DVD A;  1IQX A;  3X40 A;  3EN8 A;  3NBJ A;  3BB9 A;  2RSX A;  3CXC 2;  1KQS 2;  4EYC A;  4L8O A;  4HM3 B;  5JPU A;  5KP3 A;  1DMQ A;  3EBT A;  3LTD A;  3BNE A;  1FGQ A;  1AV4 A;  2CG1 A;  4MJD A;  4O8S A;  1K8A 4;  1WTH A;  1KD1 4;  1QMA A;  1LOX A;  2Z6B A;  1IVX A;  1Q7Y 4;  2ZL8 A;  3DY5 A;  4L8P A;  2XEP A;  1T5Y A;  1TU5 A;  1NB3 I;  3F8H A;  2CFW A;  3NHX A;  1VQN 3;  1QVG 2;  3OX9 A;  4STD A;  1VQ5 3;  2BT3 A;  1UUW B;  2XRX B;  2B1X B;  3N54 B;  3MWZ A;  3PS8 A;  4R1K A;  1VQ4 3;  1Q82 4;  3VGN A;  2GBW B;  4X2H A;  1SII A;  1IVU A;  3NBB A;  5D81 A;  4MEI A;  4N6N B;  3X42 A;  3KZT A;  3QRD A;  1Q86 4;  4KZ1 A;  2P38 A;  2QIY A;  5HGR A;  1K28 A;  3FG1 A;  2IUK A;  3KII A;  4RBN A;  3VF1 A;  3CCR 3;  2KRT A;  3G16 A;  3STD A;  4NRE A;  1UW1 A;  3LH4 A;  3CC2 3;  2HML B;  5CK6 A;  3TDG A;  1BUQ A;  1W5Z A;  2CWV A;  2IA7 A;  3FCS B;  3LOY A;  1F8N A;  6STD A;  5DRE A;  1GD4 A;  3S28 A;  2W56 B;  5CLK A;  3OV4 A;  2XSH B;  1CYV A;  3G6E 3;  2QGU A;  1O7N B;  1Q42 A;  2HMJ B;  1O7W B;  2HMM B;  2WO0 A;  3HZP A;  4LZI A;  3DGM A;  3ROB A;  4EV5 A;  5AYR B;  5IG3 A;  3LT8 A;  5I97 A;  3JUN A;  1VQ7 3;  4HZB B;  3HK4 A;  2STD A;  3PYJ A;  1N9E A;  2XGN A;  4IPB A;  5AEU B;  4HM1 B;  4MMX B;  5ELJ A;  2OTJ 3;  1E97 A;  3GZX B;  3N8B A;  4U13 A;  4EV2 A;  3B4O A;  1OGX A;  2CFK A;  2Y73 A;  3KSE D;  3OW2 2;  1GD3 A;  3PGB A;  3QK9 A;  4FCZ A;  4N6V 0;  1YIJ 3;  3M8C A;  3MSO A;  2OWP A;  4FCM A;  4FR9 A;  3CCE 3;  2OQE C;  3FH1 A;  1MNL A;  3RDE A;  2QA4 3;  3X3Z A;  3U1W A;  4I4K A;  4HM7 B;  1SPU A;  5AEW B;  3EE1 A;  3FF0 A;  1EG9 B;  3F7S A;  1IQY A;  3JUQ A;  3O8Y A;  1M1K 4;  1W2B 2;  1O7P B;  2OOV C;  4FCJ A;  3GZY B;  4GB5 A;  1EQK A;  4K90 B;  4PEJ A;  4HVN A;  5DRV A;  5A0O B;  2L4V A;  3VSY A;  2A15 A;  3LTB A;  1O7H B;  1U8C B;  2V1L A;  3GWR A;  4HZ9 B;  3DGL A;  4JRF A;  3KN4 A;  4R4K A;  5IG5 A;  3B7C A;  1WMN A;  3EX9 A;  1W4N A;  3I0Y A;  2BMQ B;  3DUK A;  3NQZ A;  2W0Q A;  5ELU A;  1IU7 A;  4O02 B;  5LC7 A;  1RJO A;  4N3V A;  2GXF A;  1VQO 3;  1IT7 A;  1UI8 A;  1OGZ A;  2XF3 A;  4WHA A;  1O7M B;  1A2K A;  3BLZ A;  3HI7 A;  3X41 A;  4ZM8 A;  3SVA A;  1DMN A;  4ORL A;  1TP6 A;  2Z76 A;  3E99 A;  4HKV B;  5EVH A;  2GU3 A;  2E2T A;  4TX4 A;  3WMD A;  2ML5 A;  3NV0 A;  4R9L A;  5AIF A;  5BXQ A;  3MG2 A;  1JJ2 2;  3G8Z A;  3CPW 2;  3NV0 B;  2B24 B;  2CW9 A;  1NB5 I;  4N6O B;  1ROA A;  4N6M A;  3N9H A;  1J2B A;  3OXA A;  2C10 A;  2BMO B;  1IVV A;  4QWT A;  3T8U A;  8CHO A;  2BMR B;  3WA2 X;  1A90 A;  1NDO B;  1EA2 A;  1YGE A;  3CNM A;  4FMD A;  4CDL A;  4GL6 A;  2F86 B;  4OUQ A;  4CCV A;  1JN5 A;  3WOD G;  2OQE A;  1VZZ A;  5JPP A;  1TFO A;  1D6U A;  4WYK A;  3FLJ A;  2LYX A;  2JDI H;  2E2U A;  3GZR A;  2MF7 A;  1FUW A;  1STF I;  4X2O A;  1JN5 B;  1DYU A;  2Z7A A;  4WYK B;  4EBG A;  3CCU 3;  3AMO A;  4AKZ A;  2XGL A;  5IEN A;  1D6Z A;  2W6J H;  2FNQ A;  2RGQ A;  2OOV A;  1W7C A;  1YJW 3;  3PCS A;  4AKY A;  1RN7 A;  2CIU A;  3CU3 A;  1DMM A;  1LXE A;  2IMJ A;  2WGO A;  3HX8 A;  3UL5 A;  3AMO B;  1U5O A;  3CC7 3;  5IW9 A;  4J8T A;  4JF8 A;  2FXT A;  3H51 A;  3V99 A;  3K5T A;  3LZA A;  2BO9 B;  4XB5 A;  2W56 A;  1GY7 A;  2FGT A;  3FG3 A;  3ECF A;  1AVK A;  3IPT A;  3F9S A;  4N6U A;  4XDV A;  4H61 A;  4HM6 B;  1N8R 4;  2GEX A;  1FGO A;  2MC8 A;  2BHM A;  1STD A;  5CF1 A;  3KFQ C;  3SOA A;  1M9G A;  1IT8 A;  1KSI A;  1S72 3;  4XBX A;  3DZL A;  2IUJ A;  2QEX 3;  3S29 A;  1SQW A;  3OWS A;  5KP1 A;  1W00 A;  4BTY A;  2OTL 3;  1ROV A;  4NHF A;  5IG4 A;  3MKI A;  1Z1S A;  2D1W A;  3CCV 3;  3KSP A;  1N9J A;  2CFL A;  1YHQ 3;  3KKG A;  3MYT A;  2CFD A;  1UUV B;  4LEH A;  5AYS C;  2D42 A;  3JVC A;  3EB8 A;  4KFD A;  1E3R A;  5IEO A;  1DVC A;  1ULI B;  1OUN A;  3NUV A;  3WOF B;  4HYZ A;  1M90 4;  1NO3 A;  4H3U A;  3GRD A;  3K63 A;  3NM7 A;  3JUO A;  2Z77 A;  1OH0 A;  3BNC A;  3GZB A;  1QAF A;  4IT7 A;  1RKY A;  5FW5 A;  1K9M 4;  3F40 A;  1IV7 A;  1O7G B;  3WOE B;  3FKA A;  3I55 3;  3SOY A;  4BTX A;  2YFL B;  1JRQ A;  3A76 A;  4RZM A;  1QAK A;  1W01 A;  3CC4 3;  3K0Z A;  1LNH A;  3JUM A;  3LTA A;  1WMO A;  3CPO A;  3F14 A;  1WNH A;  2CK3 H;  3Q2P A;  4K1V A;  5D83 A;  3OWY A;  3G0K A;  3MG3 A;  1HU9 A;  4WWU C;  2RCD A;  3J7Y d;  5STD A;  3EC9 A;  2W03 A;  1W6C A;  5CXO A;  4HM5 B;  3K7C A;  5IG0 A;  3DM8 A;  3KE7 A;  2KXG A;  2P05 A;  1N5P A;  1L5G B;  3CCM 3;  3FSD A;  1R4C A;  1W6G A;  2XH9 A;  1VQL 3;  1W6Y A;  3CNX A;  1HKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...