1VQ93

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq9300
1S723 1K8A4 3CMA3 1VQM3 1YJ93 3I553 1W2B2 2QA43 3I563 3CC23 3CCR3 1VQ83 2QEX3 1Q864 3CME3 2OTJ3 1VQP3 1YJW3 1VQ93 3CCM3 1NJI4 1K9M4 1VQ43 1Q7Y4 3CPW2 1QVF2 1VQN3 3CC43 3CCV3 1Q824 1VQ63 3G713 3CCS3 3CCL3 1VQ53 3CCQ3 3CCU3 1KD14 3G6E3 1VQO3 1YIJ3 1VQK3 1YHQ3 1K734 1N8R4 1YIT3 1M1K4 3CCE3 3CCJ3 1KC84 3CD63 3OW22 1YJN3 3CC73 1KQS2 1JJ22 3G4S3 1VQ73 1Q814 1QVG2 1VQL3 1YI23 1M904 2OTL3 3CXC2
chains in the Genus database with same CATH superfamily
1BSDA 3N9HA 2FXTA 1OUNA 3WODG 3CMA3 3F9SA 2F98A 4XBXA 8RNTA 1NB5I 1AY7A 3CME3 1W01A 4IIAA 4J5KA 2JQ5A 1BUQA 3Q3FA 1T3BA 1K9M4 1UUVB 1SIHA 3NQYA 1V58A 2ML6A 3FG1A 1N5PA 4NREA 3MSOA 1Q7Y4 1MNLA 3GRDA 4KFFA 2P09A 3CCV3 2A15A 1K28A 1LOYA 4JRFA 3URPA 1FZUA 3CCL3 1YGEA 1ZS7A 2W03A 2PNCA 1BRGA 1SIIA 4HOHA 5EVHA 4L8PA 3SOAA 1TTOA 3D9RA 1OF5A 1B20A 1A2VA 4GHOA 6GSPA 2KF4A 4XDWA 4EW5A 3Q90A 3LTCA 4RBNA 1M9GA 2P05A 1BSCA 5LC7A 1YI23 2SARA 3WA2X 1JJ22 3NUVA 1UCJA 2WGQA 1BRHA 3MPHA 4BU4A 3QRDA 4LYLB 4O8SA 1A2KA 2YFIB 5AYRB 1GOVA 3T8UA 2ZL8A 3G16A 1IU7A 3K63A 3VF1A 2CX0A 3DGOA 2C11A 3T0UA 1X1WA 2CW9A 1B2ZA 3X40A 6RNTA 1RLSA 3SXXA 1B2SA 1RTUA 3RGRA 1GMQA 1UGHI 5AEUB 3KFQC 4HVNA 2CFWA 4BIRA 4TX4A 4XM4A 3F14A 3DY5A 3Q2PA 1VQ53 3AHWA 1HZ1A 3WDGB 3S29A 3SVAA 1ZO2A 3FF0A 1BNEA 3KCHA 1BANA 5EQLA 3WR2A 1FGRA 4AKYA 3G8ZA 3NM7A 1EKMA 2KXGA 3CCE3 1PU4A 1A90A 2Z77A 2OOVC 4O2HA 1GMRA 1I3IA 1FA3A 4Q53A 3DM8A 5I97A 1U5OA 4KZ1A 1UI7A 3BU4A 2OWPA 3OV4A 4STDA 2F5WA 3FG4A 3HIIA 1FGTA 1GY6A 1O7WB 1LRAA 2GXFA 1ULJB 1US1A 1DVCA 3WOFB 2CWTA 3CPW2 1UUGB 2CFLA 3F7SA 1IV7A 1Q9EA 4RNYA 3G713 5KP4A 4EXRA 1IK3A 2W6JH 4AEQA 3CCU3 1W6CA 1GD4A 5ELJA 2XRXB 3K5TA 1YGWA 4R9LA 1HU9A 4ORLA 2Z76A 3LTBA 5M1AA 5D82A 5JBSA 1B2MA 5A0OB 1BRSA 1LXEA 1HKXA 1GS3A 1TJDA 1S723 4MJDA 4JF8A 1E3VA 1DMMA 3NHXA 3NV0B 3BNCA 1WNHA 2W04A 3MG1A 1CYVA 1I3FA 2B1XB 4WYKB 3SOYA 2BMQB 1RN7A 2F86B 2BHMA 1RN4A 3BNEA 1WQLB 2IMJA 4H61A 1OHOA 2RSXA 2HMLB 1DE3A 5TGNA 1UUWB 2XFTA 1T2IA 3CCQ3 1BRNL 5KP1A 3BLZA 1OHSA 2CK3H 1T2HA 3LTAA 5G1LA 3EQQB 3EBTA 1IV9A 3CD63 1V57A 1JN5A 1GMPA 1MWRA 3RNTA 4FMAA 1RGEA 1BVIA 2ZA4A 3LOYA 5GSPA 2OTL3 1IQ8A 4XBTA 1KD14 4BTWA 3LTDA 1X1UA 1LNIA 2CFGA 4BTYA 1FGOA 1BU4A 1MWSA 2K0MA 4HZBB 5FGOA 3UL6A 3ZG5A 5CF2A 2AADA 1V74A 1TFKA 1YVSA 2E2UA 3LYGA 4HYZA 1QALA 4J8TA 4OVMA 1D6ZA 2OQEA 2W56B 1IDPA 4HM6B 3U1WA 2V1LA 3B8LA 4CJNA 1N8QA 1OGZA 2BIRA 4K1UA 3BIRA 1RHLA 3JUQA 3JUOA 1B2XA 3ROBA 1GYBA 1N9EA 2XFSA 1NWWA 1JZDA 3FZWA 1RGAA 1ZGXA 5CF1A 3QK9A 1BNIA 2W9QA 1OHPA 5FW5A 3DGMA 1UCIA 5JPUA 2BU4A 3DGNA 3EN8A 1FGQA 1FGMA 3AGOA 4AKZA 3D79A 1K8A4 1VQL3 1VZZA 2HMKB 2KF6A 4FMBA 4FCJA 1Q40B 5CXOA 1E3RA 3AHSA 1FUTA 3EB8A 1W00A 3T8NA 1WMPA 1QAKA 1W5ZA 2F4YA 1DMNA 3IMAB 2IUJA 3D3LA 3EBYA 1Y4KA 2YX9A 1STFI 1B27A 5AIHA 1YHQ3 1U8CB 1RSNA 1UCLA 2R41A 1S5AA 2Y73A 4N3VA 7RNTA 1R4CA 3DMCA 3NX0A 3OWUA 1I2FA 4O3VA 1NB3I 4OK0A 1BOXA 2CHCA 1EG9B 5G1KA 1JBSA 2CWUA 5HGRA 1IVVA 2CX1A 3VGNA 1VQ73 3EHCA 1Q814 1ROVA 1SJWA 1W6GA 1E97A 3NBJA 1NO3A 2BMOB 1TU5A 1BNSA 1M1XB 1C7HA 1LOWA 1JNQA 3ER7A 4HM2B 1QAFA 4RNZA 3OWSA 2BMRB 4N6MA 3OX9A 1IQYA 1QVF2 1VQN3 3IJEB 1VQ63 3DGLA 1PFPA 3JUPA 3KSPA 2I9WA 2QIYA 4I4KA 5AIIA 5IG0A 4EBGA 5RNTA 1TRPA 1G02A 1K734 2ML5A 1SQWA 3FLJA 1KC84 1K41A 2E2TA 5LC6A 1UDII 1WTHA 3UB1A 2GBWB 1JB5A 3CXC2 1BSEA 4R4KA 2D42A 5EEOA 1Q42A 4RNTA 8CHOA 3UNLA 1OGXA 3FSDA 3GSPA 1BGSA 3K7CA 3V92A 3X42A 4DKIA 2CWVA 1W2ZA 1W4NA 3BNDA 3FCSB 4O02B 1CYUA 1MWTA 1JRQA 2F56A 3MG3A 1RJOA 3B7CA 1G0TA 1I0VA 2GBXB 2XR8B 2AAEA 4EV2A 1RKYA 4NHFA 2IA7A 2IYJA 2CG1A 1WMOA 2INXA 1VQO3 3LT8A 5IW9A 1OCVA 1FW7A 5ELUA 2H0GA 3ZFZA 1RRHA 4ILFA 4N6LA 5AEWB 4PEJA 2RFRA 1GOYA 3X3XA 2MF7A 3MG2A 4H3UA 2GU3A 2H0HA 4KVHA 3K9MC 3PCSA 3KKGA 5G2GA 3I553 1W2B2 1RGFA 4N6V0 4LEHA 6STDA 1IVWA 1T5YA 2KAAA 1FUSA 1L5GB 1A67A 4HBRA 1LOVA 3TDGA 1RNTA 3FGYA 1BIRA 2UX0A 3BNBA 3SLUA 1I0XA 1TP6A 9RNTA 2E2VA 1ZX2A 1OH0A 2KF5A 3D5GA 3OWYA 3HIGA 4FR9A 2P0MA 4HM1B 1AR0A 1MGWA 4N6UA 3M8CA 2W2CA 4MMYB 1YIJ3 1AVLA 1I70A 1YIT3 3AMOA 1B3SA 1C54A 3GZBA 3H51A 3G0KA 3NBBA 1DVDA 4HM4B 1ASKA 3AGNA 3NQZA 3CU3A 1LQGC 1IVUA 1UI8A 4J5GA 3X41A 1UCKA 2Q07A 3EC9A 3DUKA 2W9PA 2OCTA 5D81A 1Q864 5IEPA 2OTJ3 1VQP3 3LZAA 5M18A 1JBRA 2HMJB 1VQ93 3NV0A 1AV4A 1CEWI 3KZTA 1JKGA 1IYYA 2HMOB 4WYKA 4K61A 5BIRA 2OOVA 1TFOA 3G6E3 2Y74A 3DH2A 3DZLA 5IG5A 1NU3A 1B21A 1WMNA 5IENA 2XSOB 2W0QA 4EYCA 3JVCA 1DYUA 2XEPA 3IPTA 4MMXB 5AIFA 3G4S3 3SYUA 7STDA 1KSIA 1J2BA 3PZWA 1RCLA 5JPPA 3CNXA 3WHOA 3EJVA 4N6OB 2QEX3 1BNJA 3EN1B 3S67A 2XGLA 3WMDA 3E99A 4N6TA 1JB4A 1BRJA 1ULIB 5DREA 4HJLB 4CDLA 3CCM3 4ZM8A 1EQKA 1O7PB 1BNRA 4HM3B 1BNFA 1AQZA 2LQVA 3ZG0A 1R4YA 1RGCA 2BO9B 3S5CA 3OXAA 1OF5B 4HM8B 4LMIA 1GY5A 1OACA 1N9JA 2M7OA 2W56A 3L0RA 3PS8A 3H3HA 1RCKA 4G1MB 3N54B 1GOUA 2RNTA 3F7XA 3RDEA 4HKVB 4BTXA 5BVBA 1STDA 3WA3A 3DGYA 4FCZA 1KQS2 3EF8A 2KF3A 2SBLA 4R9KA 4XDVA 1FUWA 3CNMA 2CFDA 2H0IA 2WO0A 3PXMA 2P0XA 2UGIA 5IG4A 3JUMA 2FGTA 3V99A 1O7NB 1JB2A 3NXJA 5AIGA 1A2PA 1BRKA 4RZMA 5IF6A 5CLKA 7GSPA 2B24B 3ECFA 3HOHA 3FKAA 4CCVA 1RGKA 4KFDA 4J9AA 1VQM3 1EUIC 3CC43 1Q40A 2J8XB 3MYTA 1I2EA 2HMMB 4X2OA 3GAXA 5DRVA 1BUJA 2CH9A 2IUKA 1Q7HA 4EC6A 2RCDA 3GWRA 2STDA 2CC3A 1I2GA 4WHAA 1QJGA 2GEXA 5BXQA 2BNGA 2K54A 3BB9A 1JV2B 1GD3A 3S27A 3KN4A 3SX1A 4HM0B 1PYLA 4K1VA 1D6YA 3PCRA 1BNGA 2FNQA 2L1SA 4X2HA 1FYSA 3K0ZA 4WFOA 3NBRA 1AVKA 1RGHA 4KFEA 1B2UA 1BAOA 1LOXA 5KP3A 1IT8A 3F40A 2GU1A 3NM2A 2XH9A 3UJMA 2UUGC 2C4BA 4CPKA 1Q824 2IY2A 2F99A 2Z7AA 4GSPA 2CIUA 3MWZA 4GL6A 1IVXA 1G96A 2CFKA 2OQEC 1ROAA 3HI7A 4KT3B 2LYXA 1O7GB 1SPUA 2GEYA 1VQQA 1D6UA 1KWIA 2GSPA 3JUNA 1LQMB 2YFJB 3O8YA 1X1XA 3X3ZA 1SARA 3LMLA 3FG3A 3PYJA 1F8NA 3CC73 2ZHXB 4K90B 2D1WA 4R1KA 1RGGA 4FCMA 3ALAA 1NNVA 1Z1SA 3UL5A 4XB5A 1EA2A 1VQ83 1EEJA 2P38A 5HOHA 2JDIH 3D5IA 1CQSA 4FMDA 3KE7A 1GSPA 1UGIA 4WP5A 5AYSC 3A76A 1YJW3 1YVBI 1VQ43 3B4PA 3FH1A 4FMCA 2XF3A 2HMNB 2WOFA 3AMOB 1IT7A 1TUHA 1DETA 1JN5B 1LVNA 2BT3A 2KCDA 4LZIA 3SEDA 3LXUX 1ISKA 4L8OA 1MOLA 4NPBA 1OPYA 2RBIA 2PZVA 1CH0A 3KIIA 1RGLA 4L7KA 4BL3A 1W02A 5D83A 1QVG2 3U97A 1O7MB 3I0YA 2KRTA 4HAAA 4MMZB 1X1YA 3CPOA 3MKIA 3HZPA 2O3OA 2QGUA 3KSED 3N8BA 2QA43 1JKGB 3S28A 3X3YA 5M19A 1MGRA 3VSYA 3I563 3CCR3 1NDOB 3CCS3 3Q1CA 4HM7B 3STDA 3A5EA 4GB5A 3RGAA 3F8XA 2XGNA 1W6YA 2HOHA 1RNBA 5IEOA 4U13A 1O7HB 3LH4A 4I5QA 1JBTA 2WOHA 2XSHB 4HM5B 4QWTA 4OUQA 1YNVX 1BRIA 1VQK3 1RRLA 1LNHA 3GZYB 2K3DA 1M1K4 3GZXB 1W7CA 1UW1A 3OW22 5IERA 1YJN3 1QMAA 1IQXA 3WOEB 1GY7A 1HYFA 1RDSA 3V98A 2RGQA 5IG3A 1BSAA 2O9UX 4LSOA 1M904 2F5MA 1PY3A 2CG0A 2R4IA 3B4OA 1YJ93 2L4VA 4BL2A 3EX9A 4WWUC 3CC23 1RN1A 1I8VA 1TRQA 2WGOA 3PGBA 1MWUA 2C10A 5AI1A 1N5HA 1NJI4 3F8HA 3D4AA 3DXOA 1JZOA 4IPBA 4XBYA 2MC8A 3GZRA 5BU4A 4MEIA 3J7Yd 4EV5A 4IT7A 5STDA 3HX8A 1RMSA 4LGQA 1DMQA 4HZ9B 1N8R4 3LT9A 3CCJ3 3HK4A 2Z6BA 3FF2A 4R80A 2ZDJA 3MHEA 2YFLB 2CKFB 5CK6A 3EE1A 1BSBA 4N6NB 1TIJA
chains in the Genus database with same CATH topology
3N9HA 3CMA3 2FXTA 1OUNA 3WODG 3F9SA 2F98A 4XBXA 1NB5I 3CME3 1W01A 4IIAA 2JQ5A 1BUQA 1K9M4 1UUVB 1SIHA 3NQYA 2ML6A 3FG1A 1N5PA 4NREA 3MSOA 1Q7Y4 1MNLA 3GRDA 4KFFA 2P09A 3CCV3 2A15A 1K28A 4JRFA 3CCL3 2W03A 1YGEA 2PNCA 1SIIA 5EVHA 4L8PA 3SOAA 3D9RA 1OF5A 1A2VA 4XDWA 3Q90A 3LTCA 4RBNA 1M9GA 2P05A 5LC7A 1JJ22 1YI23 3WA2X 1VQL3 3NUVA 2WGQA 3MPHA 3QRDA 4O8SA 1A2KA 2YFIB 5AYRB 3T8UA 2ZL8A 3G16A 1IU7A 3K63A 3VF1A 3DGOA 2C11A 3T0UA 3X40A 2CW9A 3SXXA 3RGRA 5AEUB 3KFQC 4HVNA 2CFWA 4TX4A 4XM4A 3F14A 3DY5A 3Q2PA 1VQ53 3WDGB 3S29A 3SVAA 1ZO2A 3FF0A 5EQLA 4AKYA 1FGRA 3G8ZA 3NM7A 1EKMA 2KXGA 3CCE3 1PU4A 1A90A 2Z77A 2OOVC 4O2HA 1FA3A 4Q53A 3DM8A 5I97A 1U5OA 4KZ1A 1UI7A 2OWPA 3OV4A 4STDA 3FG4A 3HIIA 1FGTA 1GY6A 1O7WB 2GXFA 1ULJB 1US1A 1DVCA 3WOFB 2CWTA 3CPW2 2CFLA 3F7SA 1IV7A 3G713 4RNYA 5KP4A 4EXRA 1IK3A 2W6JH 4AEQA 3CCU3 1W6CA 1GD4A 5ELJA 2XRXB 3K5TA 4R9LA 1HU9A 4ORLA 2Z76A 3LTBA 5D82A 5JBSA 5A0OB 1LXEA 1HKXA 1GS3A 1S723 4MJDA 4JF8A 1E3VA 1DMMA 3NHXA 3NV0B 3BNCA 1WNHA 2W04A 3MG1A 1CYVA 2B1XB 4WYKB 3SOYA 2BMQB 1RN7A 2F86B 2BHMA 3BNEA 1WQLB 2IMJA 4H61A 1OHOA 2RSXA 2HMLB 5TGNA 1UUWB 2XFTA 3CCQ3 5KP1A 3BLZA 1OHSA 2CK3H 3LTAA 3EQQB 3EBTA 1IV9A 3CD63 1JN5A 4FMAA 2OTL3 3LOYA 1IQ8A 4XBTA 1KD14 4BTWA 3LTDA 2CFGA 4BTYA 1VQM3 1FGOA 2K0MA 4HZBB 5FGOA 3UL6A 1FUWA 5CF2A 1V74A 1TFKA 2E2UA 4HYZA 3LYGA 4J8TA 1QALA 4OVMA 1D6ZA 2OQEA 2W56B 1IDPA 4HM6B 3U1WA 2V1LA 3B8LA 1N8QA 1OGZA 3CCS3 4K1UA 3JUQA 3JUOA 3ROBA 1GYBA 1N9EA 2XFSA 1NWWA 3FZWA 5CF1A 3QK9A 2W9QA 1OHPA 5FW5A 3DGMA 5JPUA 3DGNA 3EN8A 1FGQA 1FGMA 4AKZA 1K8A4 1VZZA 2HMKB 4FMBA 4FCJA 1Q40B 5CXOA 1E3RA 3EB8A 3T8NA 1W00A 1WMPA 1QAKA 1W5ZA 1DMNA 3IMAB 2IUJA 3D3LA 3EBYA 1Y4KA 2YX9A 1STFI 5AIHA 1YHQ3 1U8CB 4N3VA 1S5AA 2Y73A 1R4CA 3DMCA 3NX0A 3OWUA 4OK0A 4O3VA 1NB3I 2CHCA 1EG9B 2CWUA 5HGRA 1IVVA 1VQ73 3VGNA 1Q814 3EHCA 1ROVA 1SJWA 1W6GA 1E97A 3NBJA 1NO3A 2BMOB 1TU5A 1M1XB 1C7HA 1JNQA 3ER7A 4HM2B 1QAFA 4RNZA 3OWSA 2BMRB 4N6MA 3OX9A 1IQYA 1QVF2 1VQN3 3IJEB 1VQ63 3DGLA 1PFPA 3JUPA 3KSPA 2I9WA 2QIYA 4I4KA 5AIIA 5IG0A 4EBGA 1K734 2ML5A 1SQWA 3FLJA 1KC84 1K41A 2E2TA 5LC6A 1WTHA 3UB1A 2GBWB 1JB5A 3CXC2 4R4KA 2D42A 5EEOA 1Q42A 8CHOA 3UNLA 1OGXA 3FSDA 3K7CA 3V92A 3X42A 2CWVA 1W2ZA 1W4NA 3BNDA 3FCSB 4O02B 1CYUA 1JRQA 3MG3A 1RJOA 3B7CA 4EV2A 2GBXB 2XR8B 1RKYA 4NHFA 2IA7A 2CG1A 1WMOA 2INXA 1VQO3 3LT8A 5IW9A 1OCVA 5ELUA 1RRHA 4N6LA 5AEWB 4PEJA 2RFRA 3X3XA 2MF7A 3MG2A 4H3UA 2GU3A 4KVHA 3K9MC 3PCSA 3KKGA 5G2GA 3I553 1W2B2 4N6V0 4LEHA 6STDA 1IVWA 1T5YA 1A67A 1L5GB 4HBRA 3TDGA 3FGYA 2UX0A 3BNBA 3SLUA 1TP6A 2E2VA 1ZX2A 1OH0A 3OWYA 3HIGA 4FR9A 2P0MA 4HM1B 1AR0A 4N6UA 1YIJ3 3M8CA 2W2CA 4MMYB 1AVLA 1YIT3 3AMOA 3GZBA 3H51A 3G0KA 3NBBA 1DVDA 4HM4B 1ASKA 3NQZA 3CU3A 1IVUA 1UI8A 3X41A 2Q07A 3EC9A 3DUKA 2W9PA 2OCTA 5D81A 1Q864 5IEPA 2OTJ3 1VQP3 3LZAA 2HMJB 1VQ93 3NV0A 1AV4A 1CEWI 3KZTA 1JKGA 2HMOB 4WYKA 4K61A 2OOVA 1TFOA 3G6E3 2Y74A 3DZLA 5IG5A 1NU3A 5IENA 1WMNA 2XSOB 2W0QA 4EYCA 3JVCA 1DYUA 2XEPA 3IPTA 4MMXB 5AIFA 3G4S3 7STDA 1KSIA 1J2BA 3PZWA 5JPPA 3CNXA 3EJVA 4N6OB 2QEX3 3EN1B 3S67A 2XGLA 3WMDA 3E99A 4N6TA 1JB4A 1ULIB 5DREA 4HJLB 4CDLA 3CCM3 4ZM8A 1EQKA 1O7PB 4HM3B 2LQVA 2BO9B 3S5CA 3OXAA 1OF5B 4HM8B 4LMIA 1GY5A 1OACA 1N9JA 2M7OA 2W56A 3L0RA 3PS8A 3H3HA 4G1MB 3N54B 3F7XA 3RDEA 4HKVB 4BTXA 5BVBA 1STDA 3WA3A 4FCZA 1KQS2 3EF8A 2SBLA 4R9KA 4XDVA 3CNMA 2CFDA 2WO0A 3PXMA 2P0XA 5IG4A 3JUMA 2FGTA 3V99A 1O7NB 1JB2A 3NXJA 5AIGA 4RZMA 5IF6A 5CLKA 2B24B 3ECFA 3FKAA 4CCVA 4KFDA 4J9AA 3CC43 1Q40A 3MYTA 2HMMB 4X2OA 3GAXA 5DRVA 2CH9A 2IUKA 4EC6A 2RCDA 3GWRA 2STDA 2CC3A 4WHAA 1QJGA 2GEXA 5BXQA 2BNGA 2K54A 3BB9A 1JV2B 1GD3A 3S27A 3KN4A 3SX1A 4HM0B 4K1VA 1D6YA 3PCRA 2FNQA 4X2HA 3K0ZA 4WFOA 3NBRA 1AVKA 4KFEA 1LOXA 5KP3A 1IT8A 3F40A 2GU1A 3NM2A 2XH9A 3UJMA 1Q824 2F99A 2Z7AA 2CIUA 3MWZA 4GL6A 1IVXA 1G96A 2OQEC 2CFKA 1ROAA 3HI7A 2LYXA 1O7GB 1SPUA 2GEYA 1D6UA 1KWIA 3JUNA 3O8YA 2YFJB 3X3ZA 3LMLA 3CC73 3FG3A 3PYJA 1F8NA 4K90B 2D1WA 4R1KA 4FCMA 3ALAA 1Z1SA 3UL5A 4XB5A 1EA2A 1VQ83 2P38A 2JDIH 4FMDA 1CQSA 3KE7A 4WP5A 5AYSC 3A76A 1YJW3 1YVBI 1VQ43 3B4PA 3FH1A 4FMCA 2XF3A 2HMNB 2WOFA 3AMOB 1IT7A 1TUHA 1LVNA 1JN5B 2BT3A 4LZIA 2KCDA 3SEDA 3LXUX 1ISKA 4L8OA 1MOLA 1OPYA 2PZVA 3KIIA 4L7KA 1W02A 5D83A 1QVG2 3U97A 1O7MB 3I0YA 2KRTA 4MMZB 3CPOA 3MKIA 3HZPA 2O3OA 2QGUA 3KSED 3N8BA 2QA43 1JKGB 3S28A 3X3YA 3I563 3CCR3 3VSYA 1NDOB 3Q1CA 4HM7B 3STDA 4GB5A 3RGAA 3F8XA 2XGNA 1W6YA 5IEOA 4U13A 1O7HB 3LH4A 2WOHA 2XSHB 4HM5B 4QWTA 4OUQA 1VQK3 1RRLA 1LNHA 3GZYB 1M1K4 3GZXB 1W7CA 1UW1A 3OW22 5IERA 1YJN3 1QMAA 1IQXA 3WOEB 1GY7A 3V98A 2RGQA 5IG3A 2O9UX 4LSOA 1M904 2CG0A 2R4IA 3B4OA 1YJ93 2L4VA 3EX9A 4WWUC 3CC23 3PGBA 2WGOA 2C10A 5AI1A 1N5HA 1NJI4 3F8HA 3DXOA 4IPBA 4XBYA 2MC8A 3GZRA 4MEIA 3J7Yd 4EV5A 4IT7A 5STDA 3HX8A 4LGQA 1DMQA 4HZ9B 1N8R4 3LT9A 3CCJ3 3HK4A 2Z6BA 3FF2A 4R80A 2ZDJA 3MHEA 2YFLB 2CKFB 5CK6A 3EE1A 4N6NB 1TIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 3;  1K8A 4;  3CMA 3;  1VQM 3;  1YJ9 3;  3I55 3;  1W2B 2;  2QA4 3;  3I56 3;  3CC2 3;  3CCR 3;  1VQ8 3;  2QEX 3;  1Q86 4;  3CME 3;  2OTJ 3;  1VQP 3;  1YJW 3;  1VQ9 3;  3CCM 3;  1NJI 4;  1K9M 4;  1VQ4 3;  1Q7Y 4;  3CPW 2;  1QVF 2;  1VQN 3;  3CC4 3;  3CCV 3;  1Q82 4;  1VQ6 3;  3G71 3;  3CCS 3;  3CCL 3;  1VQ5 3;  3CCQ 3;  3CCU 3;  1KD1 4;  3G6E 3;  1VQO 3;  1YIJ 3;  1VQK 3;  1YHQ 3;  1K73 4;  1N8R 4;  1YIT 3;  1M1K 4;  3CCE 3;  3CCJ 3;  1KC8 4;  3CD6 3;  3OW2 2;  1YJN 3;  3CC7 3;  1KQS 2;  1JJ2 2;  3G4S 3;  1VQ7 3;  1Q81 4;  1QVG 2;  1VQL 3;  1YI2 3;  1M90 4;  2OTL 3;  3CXC 2; 
#chains in the Genus database with same CATH topology
 1BSD A;  3N9H A;  2FXT A;  1OUN A;  3WOD G;  3CMA 3;  3F9S A;  2F98 A;  4XBX A;  8RNT A;  1NB5 I;  1AY7 A;  3CME 3;  1W01 A;  4IIA A;  4J5K A;  2JQ5 A;  1BUQ A;  3Q3F A;  1T3B A;  1K9M 4;  1UUV B;  1SIH A;  3NQY A;  1V58 A;  2ML6 A;  3FG1 A;  1N5P A;  4NRE A;  3MSO A;  1Q7Y 4;  1MNL A;  3GRD A;  4KFF A;  2P09 A;  3CCV 3;  2A15 A;  1K28 A;  1LOY A;  4JRF A;  3URP A;  1FZU A;  3CCL 3;  1YGE A;  1ZS7 A;  2W03 A;  2PNC A;  1BRG A;  1SII A;  4HOH A;  5EVH A;  4L8P A;  3SOA A;  1TTO A;  3D9R A;  1OF5 A;  1B20 A;  1A2V A;  4GHO A;  6GSP A;  2KF4 A;  4XDW A;  4EW5 A;  3Q90 A;  3LTC A;  4RBN A;  1M9G A;  2P05 A;  1BSC A;  5LC7 A;  1YI2 3;  2SAR A;  3WA2 X;  1JJ2 2;  3NUV A;  1UCJ A;  2WGQ A;  1BRH A;  3MPH A;  4BU4 A;  3QRD A;  4LYL B;  4O8S A;  1A2K A;  2YFI B;  5AYR B;  1GOV A;  3T8U A;  2ZL8 A;  3G16 A;  1IU7 A;  3K63 A;  3VF1 A;  2CX0 A;  3DGO A;  2C11 A;  3T0U A;  1X1W A;  2CW9 A;  1B2Z A;  3X40 A;  6RNT A;  1RLS A;  3SXX A;  1B2S A;  1RTU A;  3RGR A;  1GMQ A;  1UGH I;  5AEU B;  3KFQ C;  4HVN A;  2CFW A;  4BIR A;  4TX4 A;  4XM4 A;  3F14 A;  3DY5 A;  3Q2P A;  1VQ5 3;  3AHW A;  1HZ1 A;  3WDG B;  3S29 A;  3SVA A;  1ZO2 A;  3FF0 A;  1BNE A;  3KCH A;  1BAN A;  5EQL A;  3WR2 A;  1FGR A;  4AKY A;  3G8Z A;  3NM7 A;  1EKM A;  2KXG A;  3CCE 3;  1PU4 A;  1A90 A;  2Z77 A;  2OOV C;  4O2H A;  1GMR A;  1I3I A;  1FA3 A;  4Q53 A;  3DM8 A;  5I97 A;  1U5O A;  4KZ1 A;  1UI7 A;  3BU4 A;  2OWP A;  3OV4 A;  4STD A;  2F5W A;  3FG4 A;  3HII A;  1FGT A;  1GY6 A;  1O7W B;  1LRA A;  2GXF A;  1ULJ B;  1US1 A;  1DVC A;  3WOF B;  2CWT A;  3CPW 2;  1UUG B;  2CFL A;  3F7S A;  1IV7 A;  1Q9E A;  4RNY A;  3G71 3;  5KP4 A;  4EXR A;  1IK3 A;  2W6J H;  4AEQ A;  3CCU 3;  1W6C A;  1GD4 A;  5ELJ A;  2XRX B;  3K5T A;  1YGW A;  4R9L A;  1HU9 A;  4ORL A;  2Z76 A;  3LTB A;  5M1A A;  5D82 A;  5JBS A;  1B2M A;  5A0O B;  1BRS A;  1LXE A;  1HKX A;  1GS3 A;  1TJD A;  1S72 3;  4MJD A;  4JF8 A;  1E3V A;  1DMM A;  3NHX A;  3NV0 B;  3BNC A;  1WNH A;  2W04 A;  3MG1 A;  1CYV A;  1I3F A;  2B1X B;  4WYK B;  3SOY A;  2BMQ B;  1RN7 A;  2F86 B;  2BHM A;  1RN4 A;  3BNE A;  1WQL B;  2IMJ A;  4H61 A;  1OHO A;  2RSX A;  2HML B;  1DE3 A;  5TGN A;  1UUW B;  2XFT A;  1T2I A;  3CCQ 3;  1BRN L;  5KP1 A;  3BLZ A;  1OHS A;  2CK3 H;  1T2H A;  3LTA A;  5G1L A;  3EQQ B;  3EBT A;  1IV9 A;  3CD6 3;  1V57 A;  1JN5 A;  1GMP A;  1MWR A;  3RNT A;  4FMA A;  1RGE A;  1BVI A;  2ZA4 A;  3LOY A;  5GSP A;  2OTL 3;  1IQ8 A;  4XBT A;  1KD1 4;  4BTW A;  3LTD A;  1X1U A;  1LNI A;  2CFG A;  4BTY A;  1FGO A;  1BU4 A;  1MWS A;  2K0M A;  4HZB B;  5FGO A;  3UL6 A;  3ZG5 A;  5CF2 A;  2AAD A;  1V74 A;  1TFK A;  1YVS A;  2E2U A;  3LYG A;  4HYZ A;  1QAL A;  4J8T A;  4OVM A;  1D6Z A;  2OQE A;  2W56 B;  1IDP A;  4HM6 B;  3U1W A;  2V1L A;  3B8L A;  4CJN A;  1N8Q A;  1OGZ A;  2BIR A;  4K1U A;  3BIR A;  1RHL A;  3JUQ A;  3JUO A;  1B2X A;  3ROB A;  1GYB A;  1N9E A;  2XFS A;  1NWW A;  1JZD A;  3FZW A;  1RGA A;  1ZGX A;  5CF1 A;  3QK9 A;  1BNI A;  2W9Q A;  1OHP A;  5FW5 A;  3DGM A;  1UCI A;  5JPU A;  2BU4 A;  3DGN A;  3EN8 A;  1FGQ A;  1FGM A;  3AGO A;  4AKZ A;  3D79 A;  1K8A 4;  1VQL 3;  1VZZ A;  2HMK B;  2KF6 A;  4FMB A;  4FCJ A;  1Q40 B;  5CXO A;  1E3R A;  3AHS A;  1FUT A;  3EB8 A;  1W00 A;  3T8N A;  1WMP A;  1QAK A;  1W5Z A;  2F4Y A;  1DMN A;  3IMA B;  2IUJ A;  3D3L A;  3EBY A;  1Y4K A;  2YX9 A;  1STF I;  1B27 A;  5AIH A;  1YHQ 3;  1U8C B;  1RSN A;  1UCL A;  2R41 A;  1S5A A;  2Y73 A;  4N3V A;  7RNT A;  1R4C A;  3DMC A;  3NX0 A;  3OWU A;  1I2F A;  4O3V A;  1NB3 I;  4OK0 A;  1BOX A;  2CHC A;  1EG9 B;  5G1K A;  1JBS A;  2CWU A;  5HGR A;  1IVV A;  2CX1 A;  3VGN A;  1VQ7 3;  3EHC A;  1Q81 4;  1ROV A;  1SJW A;  1W6G A;  1E97 A;  3NBJ A;  1NO3 A;  2BMO B;  1TU5 A;  1BNS A;  1M1X B;  1C7H A;  1LOW A;  1JNQ A;  3ER7 A;  4HM2 B;  1QAF A;  4RNZ A;  3OWS A;  2BMR B;  4N6M A;  3OX9 A;  1IQY A;  1QVF 2;  1VQN 3;  3IJE B;  1VQ6 3;  3DGL A;  1PFP A;  3JUP A;  3KSP A;  2I9W A;  2QIY A;  4I4K A;  5AII A;  5IG0 A;  4EBG A;  5RNT A;  1TRP A;  1G02 A;  1K73 4;  2ML5 A;  1SQW A;  3FLJ A;  1KC8 4;  1K41 A;  2E2T A;  5LC6 A;  1UDI I;  1WTH A;  3UB1 A;  2GBW B;  1JB5 A;  3CXC 2;  1BSE A;  4R4K A;  2D42 A;  5EEO A;  1Q42 A;  4RNT A;  8CHO A;  3UNL A;  1OGX A;  3FSD A;  3GSP A;  1BGS A;  3K7C A;  3V92 A;  3X42 A;  4DKI A;  2CWV A;  1W2Z A;  1W4N A;  3BND A;  3FCS B;  4O02 B;  1CYU A;  1MWT A;  1JRQ A;  2F56 A;  3MG3 A;  1RJO A;  3B7C A;  1G0T A;  1I0V A;  2GBX B;  2XR8 B;  2AAE A;  4EV2 A;  1RKY A;  4NHF A;  2IA7 A;  2IYJ A;  2CG1 A;  1WMO A;  2INX A;  1VQO 3;  3LT8 A;  5IW9 A;  1OCV A;  1FW7 A;  5ELU A;  2H0G A;  3ZFZ A;  1RRH A;  4ILF A;  4N6L A;  5AEW B;  4PEJ A;  2RFR A;  1GOY A;  3X3X A;  2MF7 A;  3MG2 A;  4H3U A;  2GU3 A;  2H0H A;  4KVH A;  3K9M C;  3PCS A;  3KKG A;  5G2G A;  3I55 3;  1W2B 2;  1RGF A;  4N6V 0;  4LEH A;  6STD A;  1IVW A;  1T5Y A;  2KAA A;  1FUS A;  1L5G B;  1A67 A;  4HBR A;  1LOV A;  3TDG A;  1RNT A;  3FGY A;  1BIR A;  2UX0 A;  3BNB A;  3SLU A;  1I0X A;  1TP6 A;  9RNT A;  2E2V A;  1ZX2 A;  1OH0 A;  2KF5 A;  3D5G A;  3OWY A;  3HIG A;  4FR9 A;  2P0M A;  4HM1 B;  1AR0 A;  1MGW A;  4N6U A;  3M8C A;  2W2C A;  4MMY B;  1YIJ 3;  1AVL A;  1I70 A;  1YIT 3;  3AMO A;  1B3S A;  1C54 A;  3GZB A;  3H51 A;  3G0K A;  3NBB A;  1DVD A;  4HM4 B;  1ASK A;  3AGN A;  3NQZ A;  3CU3 A;  1LQG C;  1IVU A;  1UI8 A;  4J5G A;  3X41 A;  1UCK A;  2Q07 A;  3EC9 A;  3DUK A;  2W9P A;  2OCT A;  5D81 A;  1Q86 4;  5IEP A;  2OTJ 3;  1VQP 3;  3LZA A;  5M18 A;  1JBR A;  2HMJ B;  1VQ9 3;  3NV0 A;  1AV4 A;  1CEW I;  3KZT A;  1JKG A;  1IYY A;  2HMO B;  4WYK A;  4K61 A;  5BIR A;  2OOV A;  1TFO A;  3G6E 3;  2Y74 A;  3DH2 A;  3DZL A;  5IG5 A;  1NU3 A;  1B21 A;  1WMN A;  5IEN A;  2XSO B;  2W0Q A;  4EYC A;  3JVC A;  1DYU A;  2XEP A;  3IPT A;  4MMX B;  5AIF A;  3G4S 3;  3SYU A;  7STD A;  1KSI A;  1J2B A;  3PZW A;  1RCL A;  5JPP A;  3CNX A;  3WHO A;  3EJV A;  4N6O B;  2QEX 3;  1BNJ A;  3EN1 B;  3S67 A;  2XGL A;  3WMD A;  3E99 A;  4N6T A;  1JB4 A;  1BRJ A;  1ULI B;  5DRE A;  4HJL B;  4CDL A;  3CCM 3;  4ZM8 A;  1EQK A;  1O7P B;  1BNR A;  4HM3 B;  1BNF A;  1AQZ A;  2LQV A;  3ZG0 A;  1R4Y A;  1RGC A;  2BO9 B;  3S5C A;  3OXA A;  1OF5 B;  4HM8 B;  4LMI A;  1GY5 A;  1OAC A;  1N9J A;  2M7O A;  2W56 A;  3L0R A;  3PS8 A;  3H3H A;  1RCK A;  4G1M B;  3N54 B;  1GOU A;  2RNT A;  3F7X A;  3RDE A;  4HKV B;  4BTX A;  5BVB A;  1STD A;  3WA3 A;  3DGY A;  4FCZ A;  1KQS 2;  3EF8 A;  2KF3 A;  2SBL A;  4R9K A;  4XDV A;  1FUW A;  3CNM A;  2CFD A;  2H0I A;  2WO0 A;  3PXM A;  2P0X A;  2UGI A;  5IG4 A;  3JUM A;  2FGT A;  3V99 A;  1O7N B;  1JB2 A;  3NXJ A;  5AIG A;  1A2P A;  1BRK A;  4RZM A;  5IF6 A;  5CLK A;  7GSP A;  2B24 B;  3ECF A;  3HOH A;  3FKA A;  4CCV A;  1RGK A;  4KFD A;  4J9A A;  1VQM 3;  1EUI C;  3CC4 3;  1Q40 A;  2J8X B;  3MYT A;  1I2E A;  2HMM B;  4X2O A;  3GAX A;  5DRV A;  1BUJ A;  2CH9 A;  2IUK A;  1Q7H A;  4EC6 A;  2RCD A;  3GWR A;  2STD A;  2CC3 A;  1I2G A;  4WHA A;  1QJG A;  2GEX A;  5BXQ A;  2BNG A;  2K54 A;  3BB9 A;  1JV2 B;  1GD3 A;  3S27 A;  3KN4 A;  3SX1 A;  4HM0 B;  1PYL A;  4K1V A;  1D6Y A;  3PCR A;  1BNG A;  2FNQ A;  2L1S A;  4X2H A;  1FYS A;  3K0Z A;  4WFO A;  3NBR A;  1AVK A;  1RGH A;  4KFE A;  1B2U A;  1BAO A;  1LOX A;  5KP3 A;  1IT8 A;  3F40 A;  2GU1 A;  3NM2 A;  2XH9 A;  3UJM A;  2UUG C;  2C4B A;  4CPK A;  1Q82 4;  2IY2 A;  2F99 A;  2Z7A A;  4GSP A;  2CIU A;  3MWZ A;  4GL6 A;  1IVX A;  1G96 A;  2CFK A;  2OQE C;  1ROA A;  3HI7 A;  4KT3 B;  2LYX A;  1O7G B;  1SPU A;  2GEY A;  1VQQ A;  1D6U A;  1KWI A;  2GSP A;  3JUN A;  1LQM B;  2YFJ B;  3O8Y A;  1X1X A;  3X3Z A;  1SAR A;  3LML A;  3FG3 A;  3PYJ A;  1F8N A;  3CC7 3;  2ZHX B;  4K90 B;  2D1W A;  4R1K A;  1RGG A;  4FCM A;  3ALA A;  1NNV A;  1Z1S A;  3UL5 A;  4XB5 A;  1EA2 A;  1VQ8 3;  1EEJ A;  2P38 A;  5HOH A;  2JDI H;  3D5I A;  1CQS A;  4FMD A;  3KE7 A;  1GSP A;  1UGI A;  4WP5 A;  5AYS C;  3A76 A;  1YJW 3;  1YVB I;  1VQ4 3;  3B4P A;  3FH1 A;  4FMC A;  2XF3 A;  2HMN B;  2WOF A;  3AMO B;  1IT7 A;  1TUH A;  1DET A;  1JN5 B;  1LVN A;  2BT3 A;  2KCD A;  4LZI A;  3SED A;  3LXU X;  1ISK A;  4L8O A;  1MOL A;  4NPB A;  1OPY A;  2RBI A;  2PZV A;  1CH0 A;  3KII A;  1RGL A;  4L7K A;  4BL3 A;  1W02 A;  5D83 A;  1QVG 2;  3U97 A;  1O7M B;  3I0Y A;  2KRT A;  4HAA A;  4MMZ B;  1X1Y A;  3CPO A;  3MKI A;  3HZP A;  2O3O A;  2QGU A;  3KSE D;  3N8B A;  2QA4 3;  1JKG B;  3S28 A;  3X3Y A;  5M19 A;  1MGR A;  3VSY A;  3I56 3;  3CCR 3;  1NDO B;  3CCS 3;  3Q1C A;  4HM7 B;  3STD A;  3A5E A;  4GB5 A;  3RGA A;  3F8X A;  2XGN A;  1W6Y A;  2HOH A;  1RNB A;  5IEO A;  4U13 A;  1O7H B;  3LH4 A;  4I5Q A;  1JBT A;  2WOH A;  2XSH B;  4HM5 B;  4QWT A;  4OUQ A;  1YNV X;  1BRI A;  1VQK 3;  1RRL A;  1LNH A;  3GZY B;  2K3D A;  1M1K 4;  3GZX B;  1W7C A;  1UW1 A;  3OW2 2;  5IER A;  1YJN 3;  1QMA A;  1IQX A;  3WOE B;  1GY7 A;  1HYF A;  1RDS A;  3V98 A;  2RGQ A;  5IG3 A;  1BSA A;  2O9U X;  4LSO A;  1M90 4;  2F5M A;  1PY3 A;  2CG0 A;  2R4I A;  3B4O A;  1YJ9 3;  2L4V A;  4BL2 A;  3EX9 A;  4WWU C;  3CC2 3;  1RN1 A;  1I8V A;  1TRQ A;  2WGO A;  3PGB A;  1MWU A;  2C10 A;  5AI1 A;  1N5H A;  1NJI 4;  3F8H A;  3D4A A;  3DXO A;  1JZO A;  4IPB A;  4XBY A;  2MC8 A;  3GZR A;  5BU4 A;  4MEI A;  3J7Y d;  4EV5 A;  4IT7 A;  5STD A;  3HX8 A;  1RMS A;  4LGQ A;  1DMQ A;  4HZ9 B;  1N8R 4;  3LT9 A;  3CCJ 3;  3HK4 A;  2Z6B A;  3FF2 A;  4R80 A;  2ZDJ A;  3MHE A;  2YFL B;  2CKF B;  5CK6 A;  3EE1 A;  1BSB A;  4N6N B;  1TIJ A; 
#chains in the Genus database with same CATH homology
 3N9H A;  3CMA 3;  2FXT A;  1OUN A;  3WOD G;  3F9S A;  2F98 A;  4XBX A;  1NB5 I;  3CME 3;  1W01 A;  4IIA A;  2JQ5 A;  1BUQ A;  1K9M 4;  1UUV B;  1SIH A;  3NQY A;  2ML6 A;  3FG1 A;  1N5P A;  4NRE A;  3MSO A;  1Q7Y 4;  1MNL A;  3GRD A;  4KFF A;  2P09 A;  3CCV 3;  2A15 A;  1K28 A;  4JRF A;  3CCL 3;  2W03 A;  1YGE A;  2PNC A;  1SII A;  5EVH A;  4L8P A;  3SOA A;  3D9R A;  1OF5 A;  1A2V A;  4XDW A;  3Q90 A;  3LTC A;  4RBN A;  1M9G A;  2P05 A;  5LC7 A;  1JJ2 2;  1YI2 3;  3WA2 X;  1VQL 3;  3NUV A;  2WGQ A;  3MPH A;  3QRD A;  4O8S A;  1A2K A;  2YFI B;  5AYR B;  3T8U A;  2ZL8 A;  3G16 A;  1IU7 A;  3K63 A;  3VF1 A;  3DGO A;  2C11 A;  3T0U A;  3X40 A;  2CW9 A;  3SXX A;  3RGR A;  5AEU B;  3KFQ C;  4HVN A;  2CFW A;  4TX4 A;  4XM4 A;  3F14 A;  3DY5 A;  3Q2P A;  1VQ5 3;  3WDG B;  3S29 A;  3SVA A;  1ZO2 A;  3FF0 A;  5EQL A;  4AKY A;  1FGR A;  3G8Z A;  3NM7 A;  1EKM A;  2KXG A;  3CCE 3;  1PU4 A;  1A90 A;  2Z77 A;  2OOV C;  4O2H A;  1FA3 A;  4Q53 A;  3DM8 A;  5I97 A;  1U5O A;  4KZ1 A;  1UI7 A;  2OWP A;  3OV4 A;  4STD A;  3FG4 A;  3HII A;  1FGT A;  1GY6 A;  1O7W B;  2GXF A;  1ULJ B;  1US1 A;  1DVC A;  3WOF B;  2CWT A;  3CPW 2;  2CFL A;  3F7S A;  1IV7 A;  3G71 3;  4RNY A;  5KP4 A;  4EXR A;  1IK3 A;  2W6J H;  4AEQ A;  3CCU 3;  1W6C A;  1GD4 A;  5ELJ A;  2XRX B;  3K5T A;  4R9L A;  1HU9 A;  4ORL A;  2Z76 A;  3LTB A;  5D82 A;  5JBS A;  5A0O B;  1LXE A;  1HKX A;  1GS3 A;  1S72 3;  4MJD A;  4JF8 A;  1E3V A;  1DMM A;  3NHX A;  3NV0 B;  3BNC A;  1WNH A;  2W04 A;  3MG1 A;  1CYV A;  2B1X B;  4WYK B;  3SOY A;  2BMQ B;  1RN7 A;  2F86 B;  2BHM A;  3BNE A;  1WQL B;  2IMJ A;  4H61 A;  1OHO A;  2RSX A;  2HML B;  5TGN A;  1UUW B;  2XFT A;  3CCQ 3;  5KP1 A;  3BLZ A;  1OHS A;  2CK3 H;  3LTA A;  3EQQ B;  3EBT A;  1IV9 A;  3CD6 3;  1JN5 A;  4FMA A;  2OTL 3;  3LOY A;  1IQ8 A;  4XBT A;  1KD1 4;  4BTW A;  3LTD A;  2CFG A;  4BTY A;  1VQM 3;  1FGO A;  2K0M A;  4HZB B;  5FGO A;  3UL6 A;  1FUW A;  5CF2 A;  1V74 A;  1TFK A;  2E2U A;  4HYZ A;  3LYG A;  4J8T A;  1QAL A;  4OVM A;  1D6Z A;  2OQE A;  2W56 B;  1IDP A;  4HM6 B;  3U1W A;  2V1L A;  3B8L A;  1N8Q A;  1OGZ A;  3CCS 3;  4K1U A;  3JUQ A;  3JUO A;  3ROB A;  1GYB A;  1N9E A;  2XFS A;  1NWW A;  3FZW A;  5CF1 A;  3QK9 A;  2W9Q A;  1OHP A;  5FW5 A;  3DGM A;  5JPU A;  3DGN A;  3EN8 A;  1FGQ A;  1FGM A;  4AKZ A;  1K8A 4;  1VZZ A;  2HMK B;  4FMB A;  4FCJ A;  1Q40 B;  5CXO A;  1E3R A;  3EB8 A;  3T8N A;  1W00 A;  1WMP A;  1QAK A;  1W5Z A;  1DMN A;  3IMA B;  2IUJ A;  3D3L A;  3EBY A;  1Y4K A;  2YX9 A;  1STF I;  5AIH A;  1YHQ 3;  1U8C B;  4N3V A;  1S5A A;  2Y73 A;  1R4C A;  3DMC A;  3NX0 A;  3OWU A;  4OK0 A;  4O3V A;  1NB3 I;  2CHC A;  1EG9 B;  2CWU A;  5HGR A;  1IVV A;  1VQ7 3;  3VGN A;  1Q81 4;  3EHC A;  1ROV A;  1SJW A;  1W6G A;  1E97 A;  3NBJ A;  1NO3 A;  2BMO B;  1TU5 A;  1M1X B;  1C7H A;  1JNQ A;  3ER7 A;  4HM2 B;  1QAF A;  4RNZ A;  3OWS A;  2BMR B;  4N6M A;  3OX9 A;  1IQY A;  1QVF 2;  1VQN 3;  3IJE B;  1VQ6 3;  3DGL A;  1PFP A;  3JUP A;  3KSP A;  2I9W A;  2QIY A;  4I4K A;  5AII A;  5IG0 A;  4EBG A;  1K73 4;  2ML5 A;  1SQW A;  3FLJ A;  1KC8 4;  1K41 A;  2E2T A;  5LC6 A;  1WTH A;  3UB1 A;  2GBW B;  1JB5 A;  3CXC 2;  4R4K A;  2D42 A;  5EEO A;  1Q42 A;  8CHO A;  3UNL A;  1OGX A;  3FSD A;  3K7C A;  3V92 A;  3X42 A;  2CWV A;  1W2Z A;  1W4N A;  3BND A;  3FCS B;  4O02 B;  1CYU A;  1JRQ A;  3MG3 A;  1RJO A;  3B7C A;  4EV2 A;  2GBX B;  2XR8 B;  1RKY A;  4NHF A;  2IA7 A;  2CG1 A;  1WMO A;  2INX A;  1VQO 3;  3LT8 A;  5IW9 A;  1OCV A;  5ELU A;  1RRH A;  4N6L A;  5AEW B;  4PEJ A;  2RFR A;  3X3X A;  2MF7 A;  3MG2 A;  4H3U A;  2GU3 A;  4KVH A;  3K9M C;  3PCS A;  3KKG A;  5G2G A;  3I55 3;  1W2B 2;  4N6V 0;  4LEH A;  6STD A;  1IVW A;  1T5Y A;  1A67 A;  1L5G B;  4HBR A;  3TDG A;  3FGY A;  2UX0 A;  3BNB A;  3SLU A;  1TP6 A;  2E2V A;  1ZX2 A;  1OH0 A;  3OWY A;  3HIG A;  4FR9 A;  2P0M A;  4HM1 B;  1AR0 A;  4N6U A;  1YIJ 3;  3M8C A;  2W2C A;  4MMY B;  1AVL A;  1YIT 3;  3AMO A;  3GZB A;  3H51 A;  3G0K A;  3NBB A;  1DVD A;  4HM4 B;  1ASK A;  3NQZ A;  3CU3 A;  1IVU A;  1UI8 A;  3X41 A;  2Q07 A;  3EC9 A;  3DUK A;  2W9P A;  2OCT A;  5D81 A;  1Q86 4;  5IEP A;  2OTJ 3;  1VQP 3;  3LZA A;  2HMJ B;  1VQ9 3;  3NV0 A;  1AV4 A;  1CEW I;  3KZT A;  1JKG A;  2HMO B;  4WYK A;  4K61 A;  2OOV A;  1TFO A;  3G6E 3;  2Y74 A;  3DZL A;  5IG5 A;  1NU3 A;  5IEN A;  1WMN A;  2XSO B;  2W0Q A;  4EYC A;  3JVC A;  1DYU A;  2XEP A;  3IPT A;  4MMX B;  5AIF A;  3G4S 3;  7STD A;  1KSI A;  1J2B A;  3PZW A;  5JPP A;  3CNX A;  3EJV A;  4N6O B;  2QEX 3;  3EN1 B;  3S67 A;  2XGL A;  3WMD A;  3E99 A;  4N6T A;  1JB4 A;  1ULI B;  5DRE A;  4HJL B;  4CDL A;  3CCM 3;  4ZM8 A;  1EQK A;  1O7P B;  4HM3 B;  2LQV A;  2BO9 B;  3S5C A;  3OXA A;  1OF5 B;  4HM8 B;  4LMI A;  1GY5 A;  1OAC A;  1N9J A;  2M7O A;  2W56 A;  3L0R A;  3PS8 A;  3H3H A;  4G1M B;  3N54 B;  3F7X A;  3RDE A;  4HKV B;  4BTX A;  5BVB A;  1STD A;  3WA3 A;  4FCZ A;  1KQS 2;  3EF8 A;  2SBL A;  4R9K A;  4XDV A;  3CNM A;  2CFD A;  2WO0 A;  3PXM A;  2P0X A;  5IG4 A;  3JUM A;  2FGT A;  3V99 A;  1O7N B;  1JB2 A;  3NXJ A;  5AIG A;  4RZM A;  5IF6 A;  5CLK A;  2B24 B;  3ECF A;  3FKA A;  4CCV A;  4KFD A;  4J9A A;  3CC4 3;  1Q40 A;  3MYT A;  2HMM B;  4X2O A;  3GAX A;  5DRV A;  2CH9 A;  2IUK A;  4EC6 A;  2RCD A;  3GWR A;  2STD A;  2CC3 A;  4WHA A;  1QJG A;  2GEX A;  5BXQ A;  2BNG A;  2K54 A;  3BB9 A;  1JV2 B;  1GD3 A;  3S27 A;  3KN4 A;  3SX1 A;  4HM0 B;  4K1V A;  1D6Y A;  3PCR A;  2FNQ A;  4X2H A;  3K0Z A;  4WFO A;  3NBR A;  1AVK A;  4KFE A;  1LOX A;  5KP3 A;  1IT8 A;  3F40 A;  2GU1 A;  3NM2 A;  2XH9 A;  3UJM A;  1Q82 4;  2F99 A;  2Z7A A;  2CIU A;  3MWZ A;  4GL6 A;  1IVX A;  1G96 A;  2OQE C;  2CFK A;  1ROA A;  3HI7 A;  2LYX A;  1O7G B;  1SPU A;  2GEY A;  1D6U A;  1KWI A;  3JUN A;  3O8Y A;  2YFJ B;  3X3Z A;  3LML A;  3CC7 3;  3FG3 A;  3PYJ A;  1F8N A;  4K90 B;  2D1W A;  4R1K A;  4FCM A;  3ALA A;  1Z1S A;  3UL5 A;  4XB5 A;  1EA2 A;  1VQ8 3;  2P38 A;  2JDI H;  4FMD A;  1CQS A;  3KE7 A;  4WP5 A;  5AYS C;  3A76 A;  1YJW 3;  1YVB I;  1VQ4 3;  3B4P A;  3FH1 A;  4FMC A;  2XF3 A;  2HMN B;  2WOF A;  3AMO B;  1IT7 A;  1TUH A;  1LVN A;  1JN5 B;  2BT3 A;  4LZI A;  2KCD A;  3SED A;  3LXU X;  1ISK A;  4L8O A;  1MOL A;  1OPY A;  2PZV A;  3KII A;  4L7K A;  1W02 A;  5D83 A;  1QVG 2;  3U97 A;  1O7M B;  3I0Y A;  2KRT A;  4MMZ B;  3CPO A;  3MKI A;  3HZP A;  2O3O A;  2QGU A;  3KSE D;  3N8B A;  2QA4 3;  1JKG B;  3S28 A;  3X3Y A;  3I56 3;  3CCR 3;  3VSY A;  1NDO B;  3Q1C A;  4HM7 B;  3STD A;  4GB5 A;  3RGA A;  3F8X A;  2XGN A;  1W6Y A;  5IEO A;  4U13 A;  1O7H B;  3LH4 A;  2WOH A;  2XSH B;  4HM5 B;  4QWT A;  4OUQ A;  1VQK 3;  1RRL A;  1LNH A;  3GZY B;  1M1K 4;  3GZX B;  1W7C A;  1UW1 A;  3OW2 2;  5IER A;  1YJN 3;  1QMA A;  1IQX A;  3WOE B;  1GY7 A;  3V98 A;  2RGQ A;  5IG3 A;  2O9U X;  4LSO A;  1M90 4;  2CG0 A;  2R4I A;  3B4O A;  1YJ9 3;  2L4V A;  3EX9 A;  4WWU C;  3CC2 3;  3PGB A;  2WGO A;  2C10 A;  5AI1 A;  1N5H A;  1NJI 4;  3F8H A;  3DXO A;  4IPB A;  4XBY A;  2MC8 A;  3GZR A;  4MEI A;  3J7Y d;  4EV5 A;  4IT7 A;  5STD A;  3HX8 A;  4LGQ A;  1DMQ A;  4HZ9 B;  1N8R 4;  3LT9 A;  3CCJ 3;  3HK4 A;  2Z6B A;  3FF2 A;  4R80 A;  2ZDJ A;  3MHE A;  2YFL B;  2CKF B;  5CK6 A;  3EE1 A;  4N6N B;  1TIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...