1VQ93

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vq9300
1YJN3 3CME3 3CC23 3CCE3 3G713 1VQK3 1VQN3 1VQ63 3I553 3CCM3 3CCS3 1M1K4 1Q824 1W2B2 1VQO3 1M904 2OTJ3 3CCV3 3CMA3 3CCJ3 1YJ93 1VQ93 3CCQ3 1YIT3 1VQL3 3G4S3 3CCL3 2QA43 1NJI4 1K734 1KD14 3CD63 1KC84 1S723 1VQ43 1Q7Y4 1K8A4 3CC43 1YIJ3 2QEX3 1K9M4 3CCU3 1YHQ3 1N8R4 1VQM3 1VQ53 3CC73 3CCR3 3CPW2 1QVG2 3CXC2 1VQP3 1VQ73 1JJ22 3I563 3OW22 1KQS2 3G6E3 1VQ83 2OTL3 1QVF2 1YI23 1Q814 1YJW3 1Q864
chains in the Genus database with same CATH superfamily
4FCZA 4K61A 2CWTA 2K0MA 3WOFB 5FGOA 3I553 1OHSA 1YNVX 4KFDA 3UB1A 3KCHA 5ELJA 1WMNA 3GZBA 1LXEA 4HM6B 5RNTA 4MEIA 3HZPA 1IVVA 1FGOA 1B20A 1BNSA 1TFKA 1TTOA 2BO9B 4N6MA 3S67A 5AYRB 1VQ93 4FR9A 3CCQ3 1Q40A 4MJDA 2YFJB 2KRTA 3X3YA 3HX8A 3EBYA 2XFSA 1I0XA 2RNTA 4CJNA 4NPBA 1GYBA 1JBRA 5AYSC 1B2SA 4R4KA 1FW7A 1QVG2 3SEDA 1RMSA 1SIIA 4FCJA 2OTL3 2CG1A 5D83A 1YGEA 2E2VA 2KXGA 3SOAA 5IG0A 2CG0A 3SVAA 1I70A 1O7PB 4NREA 3KN4A 3B4PA 3CC23 1B2MA 3A76A 4HYZA 2STDA 5ELUA 1SIHA 2KF6A 1PY3A 1ZX2A 2GEYA 4AEQA 1BSBA 2KCDA 1OF5B 2CWVA 3RGRA 3JUOA 2W56A 2ML5A 1OGXA 1RGFA 2JQ5A 4EC6A 1T5YA 3IMAB 2Q07A 4XBTA 1KC84 1TRQA 2FXTA 5BU4A 1AVLA 1AV4A 4HM7B 4KVHA 3CCU3 1X1XA 1BNGA 1K28A 3DM8A 1Q7HA 2ML6A 3SYUA 3AGNA 1NWWA 1DMQA 3G8ZA 2FNQA 4LYLB 2B1XB 3MPHA 4N6V0 5HOHA 3JUMA 3FKAA 5KP3A 3WDGB 1VQK3 5IF6A 3PXMA 4ILFA 2F4YA 3F8HA 1BU4A 3T8NA 2XFTA 2KAAA 1LOWA 2HMLB 3BNCA 3GZRA 3PYJA 1IK3A 3CCM3 1G96A 3NXJA 4X2OA 1E3VA 4OUQA 1AY7A 2XSOB 3JUQA 1LOXA 1RGLA 3B4OA 3WOEB 4STDA 3I0YA 4BL3A 1K734 3MYTA 4N6NB 3D79A 3OWSA 1SQWA 4LZIA 3VF1A 5A0OB 1W6CA 1YIJ3 3LTAA 3EJVA 3FH1A 1MGRA 3K5TA 4XBYA 4EW5A 4K1UA 4HBRA 1VQ53 2SARA 4N6LA 1JB5A 1BRKA 5CLKA 3OV4A 2WO0A 3N8BA 3RGAA 4PEJA 3URPA 1GSPA 3G713 1W02A 2B24B 3NBBA 2W56B 1TUHA 2IY2A 3K7CA 5I97A 3BB9A 2KF5A 1CQSA 1QJGA 1W5ZA 2RCDA 1FZUA 1FUSA 3FG3A 3LTBA 4GSPA 4JF8A 5HGRA 3ZFZA 1I0VA 3CCJ3 3EB8A 2XF3A 2KF3A 1YIT3 5JPPA 3CCL3 1CEWI 1BRIA 2ZL8A 3CD63 2GEXA 3ZG0A 4IIAA 4HZBB 1C54A 3K0ZA 1UI7A 3NBRA 1LQGC 3V92A 1AQZA 5M1AA 1JN5B 2RBIA 2CFDA 3DY5A 1TJDA 1RHLA 1BUQA 3FSDA 5LC6A 1BNEA 3VSYA 1ISKA 3ECFA 1NB3I 1GY7A 4WP5A 1TFOA 1Y4KA 3MKIA 3CCS3 1GMQA 1Q824 1JV2B 2CX0A 4RNZA 2GBXB 4AKYA 3PS8A 3JUNA 1MWSA 3HI7A 1I3FA 1MWUA 5BXQA 1JRQA 5D81A 1RRHA 3NM7A 1U8CB 4L7KA 4QWTA 2P38A 1BRSA 1OF5A 2C4BA 1BGSA 2CHCA 2K54A 2PZVA 1MNLA 8RNTA 3WA3A 2UGIA 1OHPA 3F7XA 5AIFA 2WGOA 1DVCA 1ZGXA 4MMYB 2BNGA 3NBJA 3D4AA 3Q1CA 2L4VA 3T8UA 5AEWB 1U5OA 3DGNA 1MWTA 3EBTA 2CFLA 5IW9A 1D6YA 2WGQA 5CF2A 3PGBA 3DH2A 2P0XA 1Z1SA 4O8SA 3HIIA 1A2VA 2OCTA 2F99A 3QK9A 1JKGB 3TDGA 2XSHB 1X1YA 2KF4A 2BIRA 3QRDA 1HZ1A 1IQ8A 3F7SA 2D1WA 4XDVA 2OTJ3 3FF0A 1GOYA 1UDII 1W01A 1RNBA 1JNQA 1DYUA 4K90B 2BT3A 2W9PA 4XB5A 5CK6A 3ALAA 4GHOA 4BTYA 1VQL3 1LRAA 3BU4A 4N6OB 1NJI4 3LMLA 3KFQC 2AAEA 2YX9A 3CPOA 1GOUA 1CH0A 1BAOA 4OVMA 1JZOA 1EG9B 2HOHA 3DGYA 3K9MC 1M1XB 3Q3FA 4HM5B 5IG5A 3CC73 1IDPA 2OQEA 3PZWA 4HM1B 3GAXA 1VQ83 1A90A 2FGTA 1OGZA 1G02A 1UW1A 2ZA4A 3BNDA 4KZ1A 3OW22 1GD4A 1UI8A 3N54B 2XGNA 3BIRA 3STDA 1UCJA 4U13A 3KSED 3O8YA 1LQMB 4L8OA 1D6UA 2F98A 4OK0A 2W03A 1FGMA 1N9EA 4L8PA 2CFKA 5IEOA 4EV2A 2OOVC 3V99A 3CNXA 1BNIA 3LZAA 1W6GA 1BRHA 2GU1A 1IV7A 5AEUB 3NV0B 1RCLA 2Z6BA 1OPYA 1WNHA 1ZO2A 3GWRA 3BNEA 3D9RA 1JJ22 4MMXB 5FW5A 5JBSA 3B7CA 3B8LA 1HYFA 2GSPA 1QVF2 2IA7A 2XH9A 4I4KA 3OWUA 1ULIB 1O7NB 1JN5A 4EXRA 1W2ZA 4HM2B 4R9KA 3DGLA 1IVWA 1T2HA 1LVNA 5AIHA 4BIRA 2QIYA 4EBGA 4FMBA 1ROAA 4R1KA 1UUVB 1NB5I 1J2BA 3CCV3 2BU4A 2XRXB 1BSCA 2P0MA 2ZDJA 3T0UA 1SJWA 1FUTA 1A2KA 4Q53A 2XR8B 4XDWA 3D3LA 1RGKA 3PCRA 3X40A 1S723 3OX9A 2OQEC 3EF8A 4O3VA 1IQXA 1RCKA 5LC7A 2QEX3 2R4IA 3CCR3 1ASKA 2ZHXB 7STDA 2WOHA 3MWZA 2RFRA 2H0GA 3UL5A 1NDOB 3EN1B 4R80A 3GZXB 3KIIA 1D6ZA 2CIUA 3CME3 3ROBA 2XEPA 4HAAA 9RNTA 3NUVA 3V98A 1M1K4 3Q90A 3X42A 1FGRA 3X41A 3X3XA 3BLZA 5JPUA 3DZLA 1KWIA 1TP6A 2AADA 4HKVB 1Q9EA 5CF1A 1JKGA 1DMNA 1LNHA 4ZM8A 5STDA 1JBSA 5G2GA 2GU3A 2C10A 1BRJA 3Q2PA 7GSPA 3L0RA 4N3VA 4WYKA 3KSPA 3CC43 2F5MA 3MG2A 4GB5A 2LQVA 4LSOA 2WOFA 3AMOB 1K41A 3SLUA 7RNTA 2YFLB 3ZG5A 1CYUA 4RBNA 3I563 6STDA 2BMQB 3VGNA 5G1KA 2IMJA 2BMOB 2GXFA 2P09A 1RKYA 5TGNA 1FYSA 2UX0A 3CCE3 3EQQB 2E2TA 1RTUA 1BVIA 1I2FA 1OACA 1W4NA 3JUPA 4BTWA 3H51A 3EC9A 1TIJA 5IG4A 3U97A 4H61A 1RDSA 1W2B2 3CMA3 1QMAA 1RNTA 1IYYA 4I5QA 3KKGA 2LYXA 2BHMA 1RGHA 4O2HA 4HM3B 1UUWB 1RGCA 1Q42A 4CCVA 5CXOA 4HVNA 3UJMA 3H3HA 1K9M4 2CX1A 3DMCA 1IVXA 2Y74A 1PFPA 1V57A 2CC3A 4KT3B 5AI1A 1RN1A 1W7CA 3RDEA 3NM2A 1DE3A 3NV0A 1JZDA 1BSAA 1B2XA 1QAKA 3AHWA 1X1UA 2MF7A 1Q814 2OWPA 1V58A 1QALA 4FCMA 4MMZB 4RNTA 1YJN3 3F8XA 1W6YA 3KE7A 5DRVA 2R41A 3WA2X 3F9SA 1YVBI 1IVUA 5G1LA 1GOVA 4LEHA 1F8NA 3KZTA 3MG1A 3K63A 1NU3A 4WYKB 1R4CA 2Z76A 1V74A 1OUNA 3LT9A 3LTCA 3S29A 4EV5A 3S28A 1O7MB 5BIRA 1GS3A 1BNFA 4WWUC 3EE1A 1IT7A 1GMPA 1GD3A 5KP1A 1KD14 3OWYA 2XGLA 3BNBA 1EUIC 1N8R4 1JB2A 3IPTA 3SOYA 2CFGA 1O7WB 1VQP3 1AVKA 4JRFA 1BIRA 3G0KA 2L1SA 1BRGA 5D82A 4R9LA 1BNRA 8CHOA 2E2UA 3F40A 2INXA 2IUJA 4NHFA 3OXAA 3U1WA 1BSEA 1Q864 3S5CA 5EVHA 4HM0B 1OHOA 1STDA 3JVCA 2M7OA 2JDIH 3MG3A 1BOXA 3FLJA 3GRDA 3FCSB 1NNVA 1PYLA 4XM4A 4K1VA 1ULJB 1STFI 4LGQA 3LXUX 5M18A 1BUJA 4HM4B 2H0HA 3LH4A 3NX0A 2HMJB 1I2EA 1OCVA 1VQ43 4EYCA 1Q7Y4 1GMRA 2I9WA 3LOYA 3DXOA 1UCKA 4X2HA 4DKIA 1LNIA 1VQM3 2F86B 5EQLA 3CPW2 1PU4A 2HMKB 3M8CA 5IERA 1RN4A 1DETA 5AIGA 3AMOA 1RGGA 1BANA 1AR0A 1EKMA 4J8TA 3MHEA 1UCIA 3EN8A 1FUWA 2RGQA 6RNTA 1UUGB 1RSNA 1RGEA 2YFIB 1MWRA 1LOYA 3ER7A 4WHAA 3HOHA 1YJ93 3DGMA 2RSXA 2W9QA 3RNTA 2QA43 2W6JH 2CKFB 1N8QA 5IENA 1FGTA 1LOVA 3PCSA 4CDLA 2UUGC 1BRNL 1MGWA 1I3IA 1GY6A 1O7HB 1VQN3 1BNJA 1IU7A 1M9GA 2HMNB 4BU4A 3N9HA 2F5WA 5M19A 3CXC2 1A2PA 1R4YA 2IUKA 1N5PA 4KFFA 2CW9A 3FF2A 3X3ZA 1YJW3 2O3OA 4WFOA 2HMMB 3GZYB 2IYJA 1QAFA 1ZS7A 2CH9A 3AGOA 1Q40B 2W04A 1WQLB 4HOHA 4BTXA 1IV9A 1L5GB 3CNMA 1HU9A 1M904 3GSPA 1UGHI 1B27A 1HKXA 1YVSA 1JBTA 3NQYA 2P05A 1W00A 2QGUA 5DREA 2F56A 3NQZA 4BL2A 3FG4A 1E3RA 1T2IA 3SXXA 1FGQA 1RGAA 2Y73A 4N6UA 1SARA 3DUKA 3S27A 4FMCA 4H3UA 1BSDA 1OH0A 1KQS2 1SPUA 2C11A 1EQKA 4FMAA 4RZMA 5IG3A 1YGWA 3D5GA 4KFEA 4IPBA 3WMDA 1RLSA 1TU5A 4ORLA 1I2GA 1N5HA 1WMPA 1VQ63 1E97A 4IT7A 1ROVA 4J9AA 3G16A 5EEOA 1B3SA 3WR2A 4J5KA 2H0IA 1VQQA 1NO3A 3E99A 3DGOA 1A67A 3A5EA 3G4S3 6GSPA 3LT8A 4HM8B 4XBXA 1IT8A 3EX9A 2CFWA 1B2ZA 3UNLA 3AHSA 1TRPA 3EHCA 4AKZA 1YHQ3 1G0TA 2V1LA 1FA3A 2W2CA 2CWUA 3D5IA 3HK4A 1KSIA 3FGYA 4HJLB 1O7GB 2GBWB 2A15A 2PNCA 4LMIA 3G6E3 2CK3H 1EEJA 1YI23 5KP4A 4G1MB 3IJEB 4TX4A 3J7Yd 3FG1A 4J5GA 5AIIA 5BVBA 1DMMA 2K3DA 1MOLA 1B21A 1JB4A 3CU3A 1VQO3 1WMOA 4N6TA 1S5AA 2O9UX 1B2UA 1VZZA 2W0QA 3FZWA 1C7HA 4FMDA 2BMRB 2Z77A 1DVDA 4GL6A 1IQYA 5IEPA 1T3BA 2OOVA 1X1WA 1RN7A 3LYGA 3MSOA 1CYVA 3F14A 1K8A4 3HIGA 3WODG 3NHXA 2D42A 4HZ9B 3WHOA 1EA2A 1N9JA 4O02B 2HMOB 2Z7AA 3SX1A 1VQ73 1US1A 1UCLA 1GY5A 1I8VA 1RRLA 1UGIA 3UL6A 4RNYA 2J8XB 2MC8A 5GSPA 4CPKA 3LTDA 2SBLA 1RJOA 1WTHA
chains in the Genus database with same CATH topology
4FCZA 4K61A 2CWTA 2K0MA 3WOFB 5FGOA 3I553 1OHSA 4KFDA 3UB1A 5ELJA 1WMNA 3GZBA 1LXEA 4HM6B 4MEIA 3HZPA 1IVVA 1FGOA 1TFKA 2BO9B 4N6MA 3S67A 5AYRB 1VQ93 4FR9A 3CCQ3 1Q40A 4MJDA 2YFJB 2KRTA 3X3YA 3HX8A 3EBYA 2XFSA 1GYBA 5AYSC 4R4KA 1QVG2 3SEDA 1SIIA 4FCJA 2OTL3 2CG1A 5D83A 1YGEA 2E2VA 2KXGA 3SOAA 5IG0A 2CG0A 3SVAA 1O7PB 4NREA 3KN4A 3B4PA 3CC23 3A76A 4HYZA 2STDA 5ELUA 1SIHA 1ZX2A 2GEYA 4AEQA 2KCDA 1OF5B 2CWVA 3RGRA 3JUOA 2W56A 2ML5A 1OGXA 2JQ5A 4EC6A 1T5YA 3IMAB 2Q07A 4XBTA 1KC84 2FXTA 1AVLA 1AV4A 4HM7B 4KVHA 3CCU3 1K28A 3DM8A 2ML6A 1NWWA 1DMQA 3G8ZA 2FNQA 4N6V0 2B1XB 3MPHA 3JUMA 3FKAA 5KP3A 3WDGB 1VQK3 5IF6A 3PXMA 3F8HA 3T8NA 2XFTA 3BNCA 3CCM3 2HMLB 3GZRA 3PYJA 1IK3A 1G96A 3NXJA 4X2OA 1E3VA 4OUQA 2XSOB 3JUQA 1LOXA 3B4OA 3WOEB 4STDA 3I0YA 1K734 3MYTA 4N6NB 3OWSA 4LZIA 1SQWA 3VF1A 5A0OB 1YIJ3 1W6CA 3LTAA 3EJVA 3FH1A 3K5TA 4XBYA 4K1UA 4HBRA 1VQ53 4N6LA 1JB5A 5CLKA 3OV4A 2WO0A 3N8BA 3RGAA 4PEJA 3G713 1W02A 2B24B 3NBBA 2W56B 1TUHA 3K7CA 5I97A 3BB9A 1CQSA 1QJGA 1W5ZA 2RCDA 3LTBA 4JF8A 3FG3A 5HGRA 3CCJ3 3EB8A 2XF3A 1YIT3 5JPPA 3CCL3 1CEWI 2ZL8A 3CD63 2GEXA 4IIAA 4HZBB 3K0ZA 1UI7A 3NBRA 3V92A 1JN5B 3DY5A 2CFDA 1BUQA 3FSDA 5LC6A 3VSYA 1ISKA 3ECFA 1NB3I 1GY7A 4WP5A 1TFOA 1Y4KA 3MKIA 3CCS3 1Q824 1JV2B 4RNZA 2GBXB 4AKYA 3PS8A 3JUNA 3HI7A 5BXQA 1JRQA 5D81A 1RRHA 3NM7A 1U8CB 4L7KA 4QWTA 2P38A 1OF5A 2CHCA 2K54A 3WA3A 2PZVA 1MNLA 3F7XA 1OHPA 5AIFA 2WGOA 1DVCA 4MMYB 2BNGA 3NBJA 3Q1CA 3T8UA 2L4VA 5AEWB 1U5OA 3DGNA 3EBTA 2CFLA 5IW9A 1D6YA 2WGQA 5CF2A 3PGBA 2P0XA 1Z1SA 4O8SA 3HIIA 1A2VA 2OCTA 2F99A 3QK9A 1JKGB 3TDGA 2XSHB 3QRDA 1IQ8A 3F7SA 2D1WA 4XDVA 2OTJ3 3FF0A 1W01A 1JNQA 1DYUA 4K90B 2BT3A 2W9PA 4XB5A 5CK6A 3ALAA 4BTYA 1VQL3 4N6OB 1NJI4 3LMLA 3KFQC 2YX9A 3CPOA 4OVMA 5IG5A 1EG9B 3CC73 3K9MC 1M1XB 4HM5B 1IDPA 2OQEA 3PZWA 4HM1B 3GAXA 1VQ83 1A90A 2FGTA 1OGZA 4KZ1A 1UW1A 3BNDA 3OW22 1GD4A 1UI8A 3N54B 2XGNA 3STDA 4U13A 3KSED 3O8YA 4L8OA 1D6UA 2F98A 4OK0A 2W03A 1FGMA 1N9EA 4L8PA 2CFKA 5IEOA 4EV2A 2OOVC 3V99A 3CNXA 3LZAA 1W6GA 2GU1A 1IV7A 5AEUB 3NV0B 2Z6BA 1OPYA 1WNHA 1ZO2A 3GWRA 3BNEA 3D9RA 1JJ22 4MMXB 5FW5A 5JBSA 3B7CA 3B8LA 1QVF2 2IA7A 2XH9A 4I4KA 3OWUA 1ULIB 1O7NB 1JN5A 4EXRA 1W2ZA 4HM2B 4R9KA 3DGLA 1IVWA 5AIHA 1LVNA 4EBGA 2QIYA 4FMBA 1ROAA 4R1KA 1UUVB 1NB5I 1J2BA 3CCV3 2XRXB 2P0MA 2ZDJA 3T0UA 1SJWA 1A2KA 4Q53A 2XR8B 4XDWA 3D3LA 3PCRA 3X40A 1S723 3OX9A 2OQEC 3EF8A 4O3VA 1IQXA 5LC7A 2QEX3 2R4IA 3CCR3 1ASKA 7STDA 2WOHA 3MWZA 2RFRA 3UL5A 1NDOB 3EN1B 4R80A 3GZXB 3KIIA 1D6ZA 2CIUA 3CME3 3ROBA 2XEPA 3NUVA 3V98A 1M1K4 3Q90A 3X42A 1FGRA 3X41A 3X3XA 3BLZA 5JPUA 3DZLA 1KWIA 1TP6A 4HKVB 5CF1A 1JKGA 1DMNA 1LNHA 4ZM8A 5STDA 5G2GA 2GU3A 2C10A 3Q2PA 3L0RA 4N3VA 4WYKA 3KSPA 3CC43 3MG2A 4GB5A 2LQVA 4LSOA 2WOFA 3AMOB 1K41A 3SLUA 2YFLB 1CYUA 4RBNA 3I563 6STDA 2BMQB 3VGNA 2IMJA 2BMOB 2GXFA 2P09A 1RKYA 5TGNA 2UX0A 3CCE3 3EQQB 2E2TA 1VQN3 1OACA 3JUPA 1W4NA 4BTWA 5IG4A 3H51A 3EC9A 1TIJA 3U97A 4H61A 1W2B2 3CMA3 1QMAA 3KKGA 2LYXA 2BHMA 4O2HA 4HM3B 1UUWB 1Q42A 4CCVA 5CXOA 4HVNA 3UJMA 3H3HA 1K9M4 3DMCA 1IVXA 2Y74A 1PFPA 5AI1A 2CC3A 3RDEA 1W7CA 3NM2A 3NV0A 1QAKA 1Q814 2MF7A 2OWPA 1QALA 4FCMA 4MMZB 1YJN3 3F8XA 1W6YA 3KE7A 5DRVA 3WA2X 3F9SA 1YVBI 1IVUA 4LEHA 1F8NA 3KZTA 3MG1A 3K63A 1NU3A 4WYKB 1R4CA 2Z76A 1V74A 1OUNA 3LT9A 3LTCA 3S29A 4EV5A 3S28A 1O7MB 1GS3A 4WWUC 3EE1A 1IT7A 5KP1A 1GD3A 1KD14 3OWYA 2XGLA 3BNBA 1N8R4 1JB2A 3IPTA 3SOYA 2CFGA 1O7WB 1VQP3 1AVKA 4JRFA 3G0KA 5D82A 4R9LA 8CHOA 2E2UA 3F40A 2INXA 2IUJA 4NHFA 3OXAA 3U1WA 1Q864 3S5CA 5EVHA 4HM0B 1OHOA 1STDA 3JVCA 2M7OA 2JDIH 3MG3A 3FLJA 3GRDA 3FCSB 4XM4A 4K1VA 1ULJB 1STFI 4LGQA 3LXUX 4HM4B 3LH4A 3NX0A 2HMJB 1OCVA 1VQ43 4EYCA 1Q7Y4 2I9WA 3LOYA 3DXOA 4X2HA 1VQM3 2F86B 5EQLA 3CPW2 1PU4A 2HMKB 3M8CA 5IERA 5AIGA 3AMOA 1AR0A 1EKMA 4J8TA 3MHEA 1FUWA 3EN8A 2RGQA 2YFIB 3ER7A 4WHAA 1YJ93 3DGMA 2RSXA 2W9QA 2QA43 2W6JH 2CKFB 1N8QA 5IENA 1FGTA 3PCSA 4CDLA 1O7HB 1GY6A 1IU7A 1M9GA 2HMNB 3N9HA 3CXC2 2IUKA 1N5PA 4KFFA 2CW9A 3FF2A 3X3ZA 1YJW3 2O3OA 4WFOA 2HMMB 3GZYB 1QAFA 2CH9A 1Q40B 2W04A 1WQLB 4BTXA 1IV9A 1L5GB 3CNMA 1HU9A 1M904 1HKXA 3NQYA 2P05A 1W00A 2QGUA 5DREA 3NQZA 3FG4A 1E3RA 3SXXA 1FGQA 2Y73A 4N6UA 3DUKA 3S27A 4FMCA 4H3UA 1OH0A 1KQS2 1SPUA 2C11A 1EQKA 4FMAA 4RZMA 5IG3A 4KFEA 4IPBA 3WMDA 1TU5A 4ORLA 1N5HA 1WMPA 1VQ63 1E97A 4IT7A 1ROVA 4J9AA 3G16A 5EEOA 1NO3A 3E99A 3DGOA 1A67A 3G4S3 3LT8A 4HM8B 4XBXA 1IT8A 3EX9A 2CFWA 3UNLA 3EHCA 4AKZA 1YHQ3 1FA3A 2V1LA 2W2CA 2CWUA 3HK4A 1KSIA 3FGYA 4HJLB 1O7GB 2GBWB 2A15A 2PNCA 4LMIA 3G6E3 2CK3H 1YI23 5KP4A 4G1MB 3IJEB 4TX4A 3J7Yd 3FG1A 5AIIA 5BVBA 1DMMA 1MOLA 1JB4A 3CU3A 1VQO3 1WMOA 4N6TA 1S5AA 2O9UX 1VZZA 2W0QA 3FZWA 1C7HA 4FMDA 2BMRB 2Z77A 1DVDA 4GL6A 1IQYA 5IEPA 2OOVA 1RN7A 3LYGA 3MSOA 1CYVA 3F14A 1K8A4 3HIGA 3WODG 3NHXA 2D42A 4HZ9B 1EA2A 1N9JA 4O02B 2HMOB 2Z7AA 3SX1A 1VQ73 1US1A 1GY5A 1RRLA 3UL6A 4RNYA 2MC8A 3LTDA 2SBLA 1RJOA 1WTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN 3;  3CME 3;  3CC2 3;  3CCE 3;  3G71 3;  1VQK 3;  1VQN 3;  1VQ6 3;  3I55 3;  3CCM 3;  3CCS 3;  1M1K 4;  1Q82 4;  1W2B 2;  1VQO 3;  1M90 4;  2OTJ 3;  3CCV 3;  3CMA 3;  3CCJ 3;  1YJ9 3;  1VQ9 3;  3CCQ 3;  1YIT 3;  1VQL 3;  3G4S 3;  3CCL 3;  2QA4 3;  1NJI 4;  1K73 4;  1KD1 4;  3CD6 3;  1KC8 4;  1S72 3;  1VQ4 3;  1Q7Y 4;  1K8A 4;  3CC4 3;  1YIJ 3;  2QEX 3;  1K9M 4;  3CCU 3;  1YHQ 3;  1N8R 4;  1VQM 3;  1VQ5 3;  3CC7 3;  3CCR 3;  3CPW 2;  1QVG 2;  3CXC 2;  1VQP 3;  1VQ7 3;  1JJ2 2;  3I56 3;  3OW2 2;  1KQS 2;  3G6E 3;  1VQ8 3;  2OTL 3;  1QVF 2;  1YI2 3;  1Q81 4;  1YJW 3;  1Q86 4; 
#chains in the Genus database with same CATH topology
 4FCZ A;  4K61 A;  2CWT A;  2K0M A;  3WOF B;  5FGO A;  3I55 3;  1OHS A;  1YNV X;  4KFD A;  3UB1 A;  3KCH A;  5ELJ A;  1WMN A;  3GZB A;  1LXE A;  4HM6 B;  5RNT A;  4MEI A;  3HZP A;  1IVV A;  1FGO A;  1B20 A;  1BNS A;  1TFK A;  1TTO A;  2BO9 B;  4N6M A;  3S67 A;  5AYR B;  1VQ9 3;  4FR9 A;  3CCQ 3;  1Q40 A;  4MJD A;  2YFJ B;  2KRT A;  3X3Y A;  3HX8 A;  3EBY A;  2XFS A;  1I0X A;  2RNT A;  4CJN A;  4NPB A;  1GYB A;  1JBR A;  5AYS C;  1B2S A;  4R4K A;  1FW7 A;  1QVG 2;  3SED A;  1RMS A;  1SII A;  4FCJ A;  2OTL 3;  2CG1 A;  5D83 A;  1YGE A;  2E2V A;  2KXG A;  3SOA A;  5IG0 A;  2CG0 A;  3SVA A;  1I70 A;  1O7P B;  4NRE A;  3KN4 A;  3B4P A;  3CC2 3;  1B2M A;  3A76 A;  4HYZ A;  2STD A;  5ELU A;  1SIH A;  2KF6 A;  1PY3 A;  1ZX2 A;  2GEY A;  4AEQ A;  1BSB A;  2KCD A;  1OF5 B;  2CWV A;  3RGR A;  3JUO A;  2W56 A;  2ML5 A;  1OGX A;  1RGF A;  2JQ5 A;  4EC6 A;  1T5Y A;  3IMA B;  2Q07 A;  4XBT A;  1KC8 4;  1TRQ A;  2FXT A;  5BU4 A;  1AVL A;  1AV4 A;  4HM7 B;  4KVH A;  3CCU 3;  1X1X A;  1BNG A;  1K28 A;  3DM8 A;  1Q7H A;  2ML6 A;  3SYU A;  3AGN A;  1NWW A;  1DMQ A;  3G8Z A;  2FNQ A;  4LYL B;  2B1X B;  3MPH A;  4N6V 0;  5HOH A;  3JUM A;  3FKA A;  5KP3 A;  3WDG B;  1VQK 3;  5IF6 A;  3PXM A;  4ILF A;  2F4Y A;  3F8H A;  1BU4 A;  3T8N A;  2XFT A;  2KAA A;  1LOW A;  2HML B;  3BNC A;  3GZR A;  3PYJ A;  1IK3 A;  3CCM 3;  1G96 A;  3NXJ A;  4X2O A;  1E3V A;  4OUQ A;  1AY7 A;  2XSO B;  3JUQ A;  1LOX A;  1RGL A;  3B4O A;  3WOE B;  4STD A;  3I0Y A;  4BL3 A;  1K73 4;  3MYT A;  4N6N B;  3D79 A;  3OWS A;  1SQW A;  4LZI A;  3VF1 A;  5A0O B;  1W6C A;  1YIJ 3;  3LTA A;  3EJV A;  3FH1 A;  1MGR A;  3K5T A;  4XBY A;  4EW5 A;  4K1U A;  4HBR A;  1VQ5 3;  2SAR A;  4N6L A;  1JB5 A;  1BRK A;  5CLK A;  3OV4 A;  2WO0 A;  3N8B A;  3RGA A;  4PEJ A;  3URP A;  1GSP A;  3G71 3;  1W02 A;  2B24 B;  3NBB A;  2W56 B;  1TUH A;  2IY2 A;  3K7C A;  5I97 A;  3BB9 A;  2KF5 A;  1CQS A;  1QJG A;  1W5Z A;  2RCD A;  1FZU A;  1FUS A;  3FG3 A;  3LTB A;  4GSP A;  4JF8 A;  5HGR A;  3ZFZ A;  1I0V A;  3CCJ 3;  3EB8 A;  2XF3 A;  2KF3 A;  1YIT 3;  5JPP A;  3CCL 3;  1CEW I;  1BRI A;  2ZL8 A;  3CD6 3;  2GEX A;  3ZG0 A;  4IIA A;  4HZB B;  1C54 A;  3K0Z A;  1UI7 A;  3NBR A;  1LQG C;  3V92 A;  1AQZ A;  5M1A A;  1JN5 B;  2RBI A;  2CFD A;  3DY5 A;  1TJD A;  1RHL A;  1BUQ A;  3FSD A;  5LC6 A;  1BNE A;  3VSY A;  1ISK A;  3ECF A;  1NB3 I;  1GY7 A;  4WP5 A;  1TFO A;  1Y4K A;  3MKI A;  3CCS 3;  1GMQ A;  1Q82 4;  1JV2 B;  2CX0 A;  4RNZ A;  2GBX B;  4AKY A;  3PS8 A;  3JUN A;  1MWS A;  3HI7 A;  1I3F A;  1MWU A;  5BXQ A;  1JRQ A;  5D81 A;  1RRH A;  3NM7 A;  1U8C B;  4L7K A;  4QWT A;  2P38 A;  1BRS A;  1OF5 A;  2C4B A;  1BGS A;  2CHC A;  2K54 A;  2PZV A;  1MNL A;  8RNT A;  3WA3 A;  2UGI A;  1OHP A;  3F7X A;  5AIF A;  2WGO A;  1DVC A;  1ZGX A;  4MMY B;  2BNG A;  3NBJ A;  3D4A A;  3Q1C A;  2L4V A;  3T8U A;  5AEW B;  1U5O A;  3DGN A;  1MWT A;  3EBT A;  2CFL A;  5IW9 A;  1D6Y A;  2WGQ A;  5CF2 A;  3PGB A;  3DH2 A;  2P0X A;  1Z1S A;  4O8S A;  3HII A;  1A2V A;  2OCT A;  2F99 A;  3QK9 A;  1JKG B;  3TDG A;  2XSH B;  1X1Y A;  2KF4 A;  2BIR A;  3QRD A;  1HZ1 A;  1IQ8 A;  3F7S A;  2D1W A;  4XDV A;  2OTJ 3;  3FF0 A;  1GOY A;  1UDI I;  1W01 A;  1RNB A;  1JNQ A;  1DYU A;  4K90 B;  2BT3 A;  2W9P A;  4XB5 A;  5CK6 A;  3ALA A;  4GHO A;  4BTY A;  1VQL 3;  1LRA A;  3BU4 A;  4N6O B;  1NJI 4;  3LML A;  3KFQ C;  2AAE A;  2YX9 A;  3CPO A;  1GOU A;  1CH0 A;  1BAO A;  4OVM A;  1JZO A;  1EG9 B;  2HOH A;  3DGY A;  3K9M C;  1M1X B;  3Q3F A;  4HM5 B;  5IG5 A;  3CC7 3;  1IDP A;  2OQE A;  3PZW A;  4HM1 B;  3GAX A;  1VQ8 3;  1A90 A;  2FGT A;  1OGZ A;  1G02 A;  1UW1 A;  2ZA4 A;  3BND A;  4KZ1 A;  3OW2 2;  1GD4 A;  1UI8 A;  3N54 B;  2XGN A;  3BIR A;  3STD A;  1UCJ A;  4U13 A;  3KSE D;  3O8Y A;  1LQM B;  4L8O A;  1D6U A;  2F98 A;  4OK0 A;  2W03 A;  1FGM A;  1N9E A;  4L8P A;  2CFK A;  5IEO A;  4EV2 A;  2OOV C;  3V99 A;  3CNX A;  1BNI A;  3LZA A;  1W6G A;  1BRH A;  2GU1 A;  1IV7 A;  5AEU B;  3NV0 B;  1RCL A;  2Z6B A;  1OPY A;  1WNH A;  1ZO2 A;  3GWR A;  3BNE A;  3D9R A;  1JJ2 2;  4MMX B;  5FW5 A;  5JBS A;  3B7C A;  3B8L A;  1HYF A;  2GSP A;  1QVF 2;  2IA7 A;  2XH9 A;  4I4K A;  3OWU A;  1ULI B;  1O7N B;  1JN5 A;  4EXR A;  1W2Z A;  4HM2 B;  4R9K A;  3DGL A;  1IVW A;  1T2H A;  1LVN A;  5AIH A;  4BIR A;  2QIY A;  4EBG A;  4FMB A;  1ROA A;  4R1K A;  1UUV B;  1NB5 I;  1J2B A;  3CCV 3;  2BU4 A;  2XRX B;  1BSC A;  2P0M A;  2ZDJ A;  3T0U A;  1SJW A;  1FUT A;  1A2K A;  4Q53 A;  2XR8 B;  4XDW A;  3D3L A;  1RGK A;  3PCR A;  3X40 A;  1S72 3;  3OX9 A;  2OQE C;  3EF8 A;  4O3V A;  1IQX A;  1RCK A;  5LC7 A;  2QEX 3;  2R4I A;  3CCR 3;  1ASK A;  2ZHX B;  7STD A;  2WOH A;  3MWZ A;  2RFR A;  2H0G A;  3UL5 A;  1NDO B;  3EN1 B;  4R80 A;  3GZX B;  3KII A;  1D6Z A;  2CIU A;  3CME 3;  3ROB A;  2XEP A;  4HAA A;  9RNT A;  3NUV A;  3V98 A;  1M1K 4;  3Q90 A;  3X42 A;  1FGR A;  3X41 A;  3X3X A;  3BLZ A;  5JPU A;  3DZL A;  1KWI A;  1TP6 A;  2AAD A;  4HKV B;  1Q9E A;  5CF1 A;  1JKG A;  1DMN A;  1LNH A;  4ZM8 A;  5STD A;  1JBS A;  5G2G A;  2GU3 A;  2C10 A;  1BRJ A;  3Q2P A;  7GSP A;  3L0R A;  4N3V A;  4WYK A;  3KSP A;  3CC4 3;  2F5M A;  3MG2 A;  4GB5 A;  2LQV A;  4LSO A;  2WOF A;  3AMO B;  1K41 A;  3SLU A;  7RNT A;  2YFL B;  3ZG5 A;  1CYU A;  4RBN A;  3I56 3;  6STD A;  2BMQ B;  3VGN A;  5G1K A;  2IMJ A;  2BMO B;  2GXF A;  2P09 A;  1RKY A;  5TGN A;  1FYS A;  2UX0 A;  3CCE 3;  3EQQ B;  2E2T A;  1RTU A;  1BVI A;  1I2F A;  1OAC A;  1W4N A;  3JUP A;  4BTW A;  3H51 A;  3EC9 A;  1TIJ A;  5IG4 A;  3U97 A;  4H61 A;  1RDS A;  1W2B 2;  3CMA 3;  1QMA A;  1RNT A;  1IYY A;  4I5Q A;  3KKG A;  2LYX A;  2BHM A;  1RGH A;  4O2H A;  4HM3 B;  1UUW B;  1RGC A;  1Q42 A;  4CCV A;  5CXO A;  4HVN A;  3UJM A;  3H3H A;  1K9M 4;  2CX1 A;  3DMC A;  1IVX A;  2Y74 A;  1PFP A;  1V57 A;  2CC3 A;  4KT3 B;  5AI1 A;  1RN1 A;  1W7C A;  3RDE A;  3NM2 A;  1DE3 A;  3NV0 A;  1JZD A;  1BSA A;  1B2X A;  1QAK A;  3AHW A;  1X1U A;  2MF7 A;  1Q81 4;  2OWP A;  1V58 A;  1QAL A;  4FCM A;  4MMZ B;  4RNT A;  1YJN 3;  3F8X A;  1W6Y A;  3KE7 A;  5DRV A;  2R41 A;  3WA2 X;  3F9S A;  1YVB I;  1IVU A;  5G1L A;  1GOV A;  4LEH A;  1F8N A;  3KZT A;  3MG1 A;  3K63 A;  1NU3 A;  4WYK B;  1R4C A;  2Z76 A;  1V74 A;  1OUN A;  3LT9 A;  3LTC A;  3S29 A;  4EV5 A;  3S28 A;  1O7M B;  5BIR A;  1GS3 A;  1BNF A;  4WWU C;  3EE1 A;  1IT7 A;  1GMP A;  1GD3 A;  5KP1 A;  1KD1 4;  3OWY A;  2XGL A;  3BNB A;  1EUI C;  1N8R 4;  1JB2 A;  3IPT A;  3SOY A;  2CFG A;  1O7W B;  1VQP 3;  1AVK A;  4JRF A;  1BIR A;  3G0K A;  2L1S A;  1BRG A;  5D82 A;  4R9L A;  1BNR A;  8CHO A;  2E2U A;  3F40 A;  2INX A;  2IUJ A;  4NHF A;  3OXA A;  3U1W A;  1BSE A;  1Q86 4;  3S5C A;  5EVH A;  4HM0 B;  1OHO A;  1STD A;  3JVC A;  2M7O A;  2JDI H;  3MG3 A;  1BOX A;  3FLJ A;  3GRD A;  3FCS B;  1NNV A;  1PYL A;  4XM4 A;  4K1V A;  1ULJ B;  1STF I;  4LGQ A;  3LXU X;  5M18 A;  1BUJ A;  4HM4 B;  2H0H A;  3LH4 A;  3NX0 A;  2HMJ B;  1I2E A;  1OCV A;  1VQ4 3;  4EYC A;  1Q7Y 4;  1GMR A;  2I9W A;  3LOY A;  3DXO A;  1UCK A;  4X2H A;  4DKI A;  1LNI A;  1VQM 3;  2F86 B;  5EQL A;  3CPW 2;  1PU4 A;  2HMK B;  3M8C A;  5IER A;  1RN4 A;  1DET A;  5AIG A;  3AMO A;  1RGG A;  1BAN A;  1AR0 A;  1EKM A;  4J8T A;  3MHE A;  1UCI A;  3EN8 A;  1FUW A;  2RGQ A;  6RNT A;  1UUG B;  1RSN A;  1RGE A;  2YFI B;  1MWR A;  1LOY A;  3ER7 A;  4WHA A;  3HOH A;  1YJ9 3;  3DGM A;  2RSX A;  2W9Q A;  3RNT A;  2QA4 3;  2W6J H;  2CKF B;  1N8Q A;  5IEN A;  1FGT A;  1LOV A;  3PCS A;  4CDL A;  2UUG C;  1BRN L;  1MGW A;  1I3I A;  1GY6 A;  1O7H B;  1VQN 3;  1BNJ A;  1IU7 A;  1M9G A;  2HMN B;  4BU4 A;  3N9H A;  2F5W A;  5M19 A;  3CXC 2;  1A2P A;  1R4Y A;  2IUK A;  1N5P A;  4KFF A;  2CW9 A;  3FF2 A;  3X3Z A;  1YJW 3;  2O3O A;  4WFO A;  2HMM B;  3GZY B;  2IYJ A;  1QAF A;  1ZS7 A;  2CH9 A;  3AGO A;  1Q40 B;  2W04 A;  1WQL B;  4HOH A;  4BTX A;  1IV9 A;  1L5G B;  3CNM A;  1HU9 A;  1M90 4;  3GSP A;  1UGH I;  1B27 A;  1HKX A;  1YVS A;  1JBT A;  3NQY A;  2P05 A;  1W00 A;  2QGU A;  5DRE A;  2F56 A;  3NQZ A;  4BL2 A;  3FG4 A;  1E3R A;  1T2I A;  3SXX A;  1FGQ A;  1RGA A;  2Y73 A;  4N6U A;  1SAR A;  3DUK A;  3S27 A;  4FMC A;  4H3U A;  1BSD A;  1OH0 A;  1KQS 2;  1SPU A;  2C11 A;  1EQK A;  4FMA A;  4RZM A;  5IG3 A;  1YGW A;  3D5G A;  4KFE A;  4IPB A;  3WMD A;  1RLS A;  1TU5 A;  4ORL A;  1I2G A;  1N5H A;  1WMP A;  1VQ6 3;  1E97 A;  4IT7 A;  1ROV A;  4J9A A;  3G16 A;  5EEO A;  1B3S A;  3WR2 A;  4J5K A;  2H0I A;  1VQQ A;  1NO3 A;  3E99 A;  3DGO A;  1A67 A;  3A5E A;  3G4S 3;  6GSP A;  3LT8 A;  4HM8 B;  4XBX A;  1IT8 A;  3EX9 A;  2CFW A;  1B2Z A;  3UNL A;  3AHS A;  1TRP A;  3EHC A;  4AKZ A;  1YHQ 3;  1G0T A;  2V1L A;  1FA3 A;  2W2C A;  2CWU A;  3D5I A;  3HK4 A;  1KSI A;  3FGY A;  4HJL B;  1O7G B;  2GBW B;  2A15 A;  2PNC A;  4LMI A;  3G6E 3;  2CK3 H;  1EEJ A;  1YI2 3;  5KP4 A;  4G1M B;  3IJE B;  4TX4 A;  3J7Y d;  3FG1 A;  4J5G A;  5AII A;  5BVB A;  1DMM A;  2K3D A;  1MOL A;  1B21 A;  1JB4 A;  3CU3 A;  1VQO 3;  1WMO A;  4N6T A;  1S5A A;  2O9U X;  1B2U A;  1VZZ A;  2W0Q A;  3FZW A;  1C7H A;  4FMD A;  2BMR B;  2Z77 A;  1DVD A;  4GL6 A;  1IQY A;  5IEP A;  1T3B A;  2OOV A;  1X1W A;  1RN7 A;  3LYG A;  3MSO A;  1CYV A;  3F14 A;  1K8A 4;  3HIG A;  3WOD G;  3NHX A;  2D42 A;  4HZ9 B;  3WHO A;  1EA2 A;  1N9J A;  4O02 B;  2HMO B;  2Z7A A;  3SX1 A;  1VQ7 3;  1US1 A;  1UCL A;  1GY5 A;  1I8V A;  1RRL A;  1UGI A;  3UL6 A;  4RNY A;  2J8X B;  2MC8 A;  5GSP A;  4CPK A;  3LTD A;  2SBL A;  1RJO A;  1WTH A; 
#chains in the Genus database with same CATH homology
 4FCZ A;  4K61 A;  2CWT A;  2K0M A;  3WOF B;  5FGO A;  3I55 3;  1OHS A;  4KFD A;  3UB1 A;  5ELJ A;  1WMN A;  3GZB A;  1LXE A;  4HM6 B;  4MEI A;  3HZP A;  1IVV A;  1FGO A;  1TFK A;  2BO9 B;  4N6M A;  3S67 A;  5AYR B;  1VQ9 3;  4FR9 A;  3CCQ 3;  1Q40 A;  4MJD A;  2YFJ B;  2KRT A;  3X3Y A;  3HX8 A;  3EBY A;  2XFS A;  1GYB A;  5AYS C;  4R4K A;  1QVG 2;  3SED A;  1SII A;  4FCJ A;  2OTL 3;  2CG1 A;  5D83 A;  1YGE A;  2E2V A;  2KXG A;  3SOA A;  5IG0 A;  2CG0 A;  3SVA A;  1O7P B;  4NRE A;  3KN4 A;  3B4P A;  3CC2 3;  3A76 A;  4HYZ A;  2STD A;  5ELU A;  1SIH A;  1ZX2 A;  2GEY A;  4AEQ A;  2KCD A;  1OF5 B;  2CWV A;  3RGR A;  3JUO A;  2W56 A;  2ML5 A;  1OGX A;  2JQ5 A;  4EC6 A;  1T5Y A;  3IMA B;  2Q07 A;  4XBT A;  1KC8 4;  2FXT A;  1AVL A;  1AV4 A;  4HM7 B;  4KVH A;  3CCU 3;  1K28 A;  3DM8 A;  2ML6 A;  1NWW A;  1DMQ A;  3G8Z A;  2FNQ A;  4N6V 0;  2B1X B;  3MPH A;  3JUM A;  3FKA A;  5KP3 A;  3WDG B;  1VQK 3;  5IF6 A;  3PXM A;  3F8H A;  3T8N A;  2XFT A;  3BNC A;  3CCM 3;  2HML B;  3GZR A;  3PYJ A;  1IK3 A;  1G96 A;  3NXJ A;  4X2O A;  1E3V A;  4OUQ A;  2XSO B;  3JUQ A;  1LOX A;  3B4O A;  3WOE B;  4STD A;  3I0Y A;  1K73 4;  3MYT A;  4N6N B;  3OWS A;  4LZI A;  1SQW A;  3VF1 A;  5A0O B;  1YIJ 3;  1W6C A;  3LTA A;  3EJV A;  3FH1 A;  3K5T A;  4XBY A;  4K1U A;  4HBR A;  1VQ5 3;  4N6L A;  1JB5 A;  5CLK A;  3OV4 A;  2WO0 A;  3N8B A;  3RGA A;  4PEJ A;  3G71 3;  1W02 A;  2B24 B;  3NBB A;  2W56 B;  1TUH A;  3K7C A;  5I97 A;  3BB9 A;  1CQS A;  1QJG A;  1W5Z A;  2RCD A;  3LTB A;  4JF8 A;  3FG3 A;  5HGR A;  3CCJ 3;  3EB8 A;  2XF3 A;  1YIT 3;  5JPP A;  3CCL 3;  1CEW I;  2ZL8 A;  3CD6 3;  2GEX A;  4IIA A;  4HZB B;  3K0Z A;  1UI7 A;  3NBR A;  3V92 A;  1JN5 B;  3DY5 A;  2CFD A;  1BUQ A;  3FSD A;  5LC6 A;  3VSY A;  1ISK A;  3ECF A;  1NB3 I;  1GY7 A;  4WP5 A;  1TFO A;  1Y4K A;  3MKI A;  3CCS 3;  1Q82 4;  1JV2 B;  4RNZ A;  2GBX B;  4AKY A;  3PS8 A;  3JUN A;  3HI7 A;  5BXQ A;  1JRQ A;  5D81 A;  1RRH A;  3NM7 A;  1U8C B;  4L7K A;  4QWT A;  2P38 A;  1OF5 A;  2CHC A;  2K54 A;  3WA3 A;  2PZV A;  1MNL A;  3F7X A;  1OHP A;  5AIF A;  2WGO A;  1DVC A;  4MMY B;  2BNG A;  3NBJ A;  3Q1C A;  3T8U A;  2L4V A;  5AEW B;  1U5O A;  3DGN A;  3EBT A;  2CFL A;  5IW9 A;  1D6Y A;  2WGQ A;  5CF2 A;  3PGB A;  2P0X A;  1Z1S A;  4O8S A;  3HII A;  1A2V A;  2OCT A;  2F99 A;  3QK9 A;  1JKG B;  3TDG A;  2XSH B;  3QRD A;  1IQ8 A;  3F7S A;  2D1W A;  4XDV A;  2OTJ 3;  3FF0 A;  1W01 A;  1JNQ A;  1DYU A;  4K90 B;  2BT3 A;  2W9P A;  4XB5 A;  5CK6 A;  3ALA A;  4BTY A;  1VQL 3;  4N6O B;  1NJI 4;  3LML A;  3KFQ C;  2YX9 A;  3CPO A;  4OVM A;  5IG5 A;  1EG9 B;  3CC7 3;  3K9M C;  1M1X B;  4HM5 B;  1IDP A;  2OQE A;  3PZW A;  4HM1 B;  3GAX A;  1VQ8 3;  1A90 A;  2FGT A;  1OGZ A;  4KZ1 A;  1UW1 A;  3BND A;  3OW2 2;  1GD4 A;  1UI8 A;  3N54 B;  2XGN A;  3STD A;  4U13 A;  3KSE D;  3O8Y A;  4L8O A;  1D6U A;  2F98 A;  4OK0 A;  2W03 A;  1FGM A;  1N9E A;  4L8P A;  2CFK A;  5IEO A;  4EV2 A;  2OOV C;  3V99 A;  3CNX A;  3LZA A;  1W6G A;  2GU1 A;  1IV7 A;  5AEU B;  3NV0 B;  2Z6B A;  1OPY A;  1WNH A;  1ZO2 A;  3GWR A;  3BNE A;  3D9R A;  1JJ2 2;  4MMX B;  5FW5 A;  5JBS A;  3B7C A;  3B8L A;  1QVF 2;  2IA7 A;  2XH9 A;  4I4K A;  3OWU A;  1ULI B;  1O7N B;  1JN5 A;  4EXR A;  1W2Z A;  4HM2 B;  4R9K A;  3DGL A;  1IVW A;  5AIH A;  1LVN A;  4EBG A;  2QIY A;  4FMB A;  1ROA A;  4R1K A;  1UUV B;  1NB5 I;  1J2B A;  3CCV 3;  2XRX B;  2P0M A;  2ZDJ A;  3T0U A;  1SJW A;  1A2K A;  4Q53 A;  2XR8 B;  4XDW A;  3D3L A;  3PCR A;  3X40 A;  1S72 3;  3OX9 A;  2OQE C;  3EF8 A;  4O3V A;  1IQX A;  5LC7 A;  2QEX 3;  2R4I A;  3CCR 3;  1ASK A;  7STD A;  2WOH A;  3MWZ A;  2RFR A;  3UL5 A;  1NDO B;  3EN1 B;  4R80 A;  3GZX B;  3KII A;  1D6Z A;  2CIU A;  3CME 3;  3ROB A;  2XEP A;  3NUV A;  3V98 A;  1M1K 4;  3Q90 A;  3X42 A;  1FGR A;  3X41 A;  3X3X A;  3BLZ A;  5JPU A;  3DZL A;  1KWI A;  1TP6 A;  4HKV B;  5CF1 A;  1JKG A;  1DMN A;  1LNH A;  4ZM8 A;  5STD A;  5G2G A;  2GU3 A;  2C10 A;  3Q2P A;  3L0R A;  4N3V A;  4WYK A;  3KSP A;  3CC4 3;  3MG2 A;  4GB5 A;  2LQV A;  4LSO A;  2WOF A;  3AMO B;  1K41 A;  3SLU A;  2YFL B;  1CYU A;  4RBN A;  3I56 3;  6STD A;  2BMQ B;  3VGN A;  2IMJ A;  2BMO B;  2GXF A;  2P09 A;  1RKY A;  5TGN A;  2UX0 A;  3CCE 3;  3EQQ B;  2E2T A;  1VQN 3;  1OAC A;  3JUP A;  1W4N A;  4BTW A;  5IG4 A;  3H51 A;  3EC9 A;  1TIJ A;  3U97 A;  4H61 A;  1W2B 2;  3CMA 3;  1QMA A;  3KKG A;  2LYX A;  2BHM A;  4O2H A;  4HM3 B;  1UUW B;  1Q42 A;  4CCV A;  5CXO A;  4HVN A;  3UJM A;  3H3H A;  1K9M 4;  3DMC A;  1IVX A;  2Y74 A;  1PFP A;  5AI1 A;  2CC3 A;  3RDE A;  1W7C A;  3NM2 A;  3NV0 A;  1QAK A;  1Q81 4;  2MF7 A;  2OWP A;  1QAL A;  4FCM A;  4MMZ B;  1YJN 3;  3F8X A;  1W6Y A;  3KE7 A;  5DRV A;  3WA2 X;  3F9S A;  1YVB I;  1IVU A;  4LEH A;  1F8N A;  3KZT A;  3MG1 A;  3K63 A;  1NU3 A;  4WYK B;  1R4C A;  2Z76 A;  1V74 A;  1OUN A;  3LT9 A;  3LTC A;  3S29 A;  4EV5 A;  3S28 A;  1O7M B;  1GS3 A;  4WWU C;  3EE1 A;  1IT7 A;  5KP1 A;  1GD3 A;  1KD1 4;  3OWY A;  2XGL A;  3BNB A;  1N8R 4;  1JB2 A;  3IPT A;  3SOY A;  2CFG A;  1O7W B;  1VQP 3;  1AVK A;  4JRF A;  3G0K A;  5D82 A;  4R9L A;  8CHO A;  2E2U A;  3F40 A;  2INX A;  2IUJ A;  4NHF A;  3OXA A;  3U1W A;  1Q86 4;  3S5C A;  5EVH A;  4HM0 B;  1OHO A;  1STD A;  3JVC A;  2M7O A;  2JDI H;  3MG3 A;  3FLJ A;  3GRD A;  3FCS B;  4XM4 A;  4K1V A;  1ULJ B;  1STF I;  4LGQ A;  3LXU X;  4HM4 B;  3LH4 A;  3NX0 A;  2HMJ B;  1OCV A;  1VQ4 3;  4EYC A;  1Q7Y 4;  2I9W A;  3LOY A;  3DXO A;  4X2H A;  1VQM 3;  2F86 B;  5EQL A;  3CPW 2;  1PU4 A;  2HMK B;  3M8C A;  5IER A;  5AIG A;  3AMO A;  1AR0 A;  1EKM A;  4J8T A;  3MHE A;  1FUW A;  3EN8 A;  2RGQ A;  2YFI B;  3ER7 A;  4WHA A;  1YJ9 3;  3DGM A;  2RSX A;  2W9Q A;  2QA4 3;  2W6J H;  2CKF B;  1N8Q A;  5IEN A;  1FGT A;  3PCS A;  4CDL A;  1O7H B;  1GY6 A;  1IU7 A;  1M9G A;  2HMN B;  3N9H A;  3CXC 2;  2IUK A;  1N5P A;  4KFF A;  2CW9 A;  3FF2 A;  3X3Z A;  1YJW 3;  2O3O A;  4WFO A;  2HMM B;  3GZY B;  1QAF A;  2CH9 A;  1Q40 B;  2W04 A;  1WQL B;  4BTX A;  1IV9 A;  1L5G B;  3CNM A;  1HU9 A;  1M90 4;  1HKX A;  3NQY A;  2P05 A;  1W00 A;  2QGU A;  5DRE A;  3NQZ A;  3FG4 A;  1E3R A;  3SXX A;  1FGQ A;  2Y73 A;  4N6U A;  3DUK A;  3S27 A;  4FMC A;  4H3U A;  1OH0 A;  1KQS 2;  1SPU A;  2C11 A;  1EQK A;  4FMA A;  4RZM A;  5IG3 A;  4KFE A;  4IPB A;  3WMD A;  1TU5 A;  4ORL A;  1N5H A;  1WMP A;  1VQ6 3;  1E97 A;  4IT7 A;  1ROV A;  4J9A A;  3G16 A;  5EEO A;  1NO3 A;  3E99 A;  3DGO A;  1A67 A;  3G4S 3;  3LT8 A;  4HM8 B;  4XBX A;  1IT8 A;  3EX9 A;  2CFW A;  3UNL A;  3EHC A;  4AKZ A;  1YHQ 3;  1FA3 A;  2V1L A;  2W2C A;  2CWU A;  3HK4 A;  1KSI A;  3FGY A;  4HJL B;  1O7G B;  2GBW B;  2A15 A;  2PNC A;  4LMI A;  3G6E 3;  2CK3 H;  1YI2 3;  5KP4 A;  4G1M B;  3IJE B;  4TX4 A;  3J7Y d;  3FG1 A;  5AII A;  5BVB A;  1DMM A;  1MOL A;  1JB4 A;  3CU3 A;  1VQO 3;  1WMO A;  4N6T A;  1S5A A;  2O9U X;  1VZZ A;  2W0Q A;  3FZW A;  1C7H A;  4FMD A;  2BMR B;  2Z77 A;  1DVD A;  4GL6 A;  1IQY A;  5IEP A;  2OOV A;  1RN7 A;  3LYG A;  3MSO A;  1CYV A;  3F14 A;  1K8A 4;  3HIG A;  3WOD G;  3NHX A;  2D42 A;  4HZ9 B;  1EA2 A;  1N9J A;  4O02 B;  2HMO B;  2Z7A A;  3SX1 A;  1VQ7 3;  1US1 A;  1GY5 A;  1RRL A;  3UL6 A;  4RNY A;  2MC8 A;  3LTD A;  2SBL A;  1RJO A;  1WTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...