1JBSA

Crystal structure of ribotoxin restrictocin and a 29-mer srd rna analog
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
b'ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 29-mer sarcin/ricin domain RNA analog
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
molecule tags Hydrolase/rna
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbsA00
1BANA 1GOVA 3HOHA 1BSBA 1I70A 1BRSA 2KF3A 1CH0A 1BU4A 1BRGA 2KF4A 7GSPA 3BIRA 1UCJA 1B27A 1SARA 5BU4A 1I0VA 1RGFA 1X1XA 1LOWA 1RGEA 1T2HA 1RSNA 1BOXA 1RDSA 2BU4A 1GMPA 1MGWA 1GMQA 1DE3A 3D4AA 1FW7A 6RNTA 9RNTA 3AGNA 1DETA 3AHSA 1BIRA 4BIRA 1C54A 1RGCA 2GSPA 3BU4A 1RLSA 1B2SA 1UCLA 1X1YA 1X1WA 1YNVX 2BIRA 3DH2A 1JBTA 1PYLA 1RCKA 1BNEA 2SARA 1AY7A 1HYFA 3WR2A 3A5EA 4RNTA 1LRAA 1BNGA 1I8VA 1AQZA 2C4BA 3D5GA 3SYUA 1A2PA 2KF6A 2AAEA 2ZA4A 1BSCA 2AADA 4J5GA 1T2IA 1RNBA 2KAAA 4BU4A 1I0XA 3Q3FA 1BSDA 2F4YA 5HOHA 1BNRA 1I2GA 2F5MA 1B21A 1RHLA 1BSEA 1BRIA 1FUTA 1UCKA 1X1UA 1RGAA 1BNIA 1I3IA 1TRQA 2F5WA 2RBIA 1RN1A 1BRNL 1BUJA 1I2EA 2HOHA 4HAAA 3RNTA 3AGOA 1BNFA 1G02A 1BRKA 1GMRA 1LOYA 1B3SA 3AHWA 1JBSA 1LOVA 3D5IA 4HOHA 3URPA 1B2UA 1BNJA 3KCHA 1HZ1A 1BSAA 1B2ZA 1PY3A 1UCIA 1RCLA 3WHOA 1BNSA 1BRHA 1RMSA 1RGGA 1BVIA 1LNIA 8RNTA 1B2MA 1RGKA 1B20A 4GHOA 1YVSA 4J5KA 1JBRA 1GOUA 1TRPA 2RNTA 1RGLA 5RNTA 7RNTA 4GSPA 1IYYA 1I3FA 1TTOA 1RNTA 1Q9EA 1RTUA 1GOYA 1FZUA 1RN4A 5GSPA 3GSPA 1ZGXA 1BRJA 3DGYA 1R4YA 6GSPA 1MGRA 1FYSA 5BIRA 1BAOA 1I2FA 1B2XA 1YGWA 1GSPA 2F56A 1RGHA 2KF5A 1BGSA 1FUSA
chains in the Genus database with same CATH superfamily
1V58A 3NBJA 1W02A 1I70A 2BT3A 2YX9A 3A76A 1QMAA 3NQZA 4ZM8A 3SXXA 1BRGA 1EA2A 5ELUA 3D3LA 5DRVA 1VQ83 2KF4A 3K5TA 1BUQA 1TUHA 4O3VA 2CWTA 3I553 1N8R4 3FZWA 4LMIA 2K0MA 2W9QA 2ZL8A 1B27A 5A0OB 6STDA 3CCL3 3KE7A 5CXOA 3LT8A 2IMJA 1X1XA 1GD3A 2WOFA 2XR8B 3GZYB 2PNCA 1JKGA 2YFIB 4HZBB 3V92A 1VQP3 3N8BA 2P0MA 3F8HA 1MGWA 1IVVA 1F8NA 5JPUA 2XGLA 4HJLB 2CC3A 1K41A 1GY5A 4JF8A 1SPUA 4OVMA 2K3DA 3BNCA 3HIGA 1YHQ3 3CCR3 3HK4A 5AYRB 1DETA 3AHSA 3GZBA 1VQ43 1OUNA 2KXGA 1STFI 1TJDA 1N9EA 1OCVA 2W03A 1VQ73 4EC6A 1IVXA 3FKAA 4WHAA 4XBYA 3U1WA 3VSYA 1BNEA 3WR2A 2UX0A 4L8OA 3EHCA 4JRFA 4RNTA 1K734 1N9JA 2R4IA 3NM7A 4HM3B 3G8ZA 2IA7A 2O3OA 1A2PA 3DY5A 1UI8A 2W9PA 4IPBA 1IT7A 1WQLB 2ZA4A 1MNLA 4X2OA 3WA3A 2ML6A 3K0ZA 2WGQA 3G4S3 2GBWB 4EXRA 1A2VA 3QK9A 4BU4A 1MWSA 3MG1A 1I0XA 3EN1B 4HVNA 5HOHA 4GL6A 1GYBA 1I2GA 5CLKA 1JKGB 1UGHI 1BSEA 1BRIA 1EG9B 2L1SA 2CG0A 2HMJB 2HMMB 1DMQA 3EN8A 4FMBA 4HM0B 3CME3 1JZDA 3UL6A 1KSIA 5I97A 1GD4A 1BNIA 1I3IA 1JNQA 1WMPA 3UL5A 2CW9A 2ZDJA 3FG1A 3H51A 1BRNL 4BTWA 3ROBA 2O9UX 1EKMA 3IJEB 4K61A 1OHPA 3BNBA 2B1XB 1PFPA 1OH0A 3L0RA 3NQYA 1BNFA 3RNTA 3CMA3 1G02A 1GMRA 3NBRA 1LOYA 3NV0A 3WA2X 2P0XA 4N6NB 4LEHA 3D5IA 1W7CA 4KFDA 2STDA 5FW5A 2M7OA 2F86B 2P38A 2I9WA 1B2ZA 2BHMA 1D6YA 4LGQA 1BNSA 2CFGA 2E2UA 3IMAB 3LXUX 4X2HA 3KFQC 4U13A 3LT9A 1B20A 2RCDA 5BVBA 2CIUA 4RNYA 1HKXA 3NHXA 1CYVA 1RGLA 2MF7A 4GB5A 1FUWA 3MYTA 5RNTA 5G2GA 5JPPA 1Q824 4GSPA 1IYYA 4J8TA 3U97A 1RNTA 4KFEA 3EB8A 1RTUA 2WOHA 1ULIB 2W56A 3VF1A 1JRQA 4H3UA 1AR0A 1C7HA 2GU3A 2P05A 1T3BA 1MGRA 5CK6A 3MHEA 1YGWA 2F56A 1OF5B 2KF5A 1BGSA 3FLJA 1LQMB 1BANA 1E3VA 5IG3A 3HOHA 1Q7HA 4NREA 2KF3A 1CH0A 1BU4A 1O7HB 1IK3A 4N6LA 3FG4A 3Q2PA 1JN5B 3FGYA 3SEDA 1SJWA 1UI7A 2CG1A 3SLUA 3UNLA 3F7XA 2F99A 3F8XA 5BU4A 1Q42A 2HMKB 4HZ9B 1WTHA 3CCM3 2IUJA 3FF2A 1T2HA 3GWRA 3T8UA 5LC7A 3UB1A 1VQK3 2H0HA 4HKVB 3EBYA 2L4VA 3NUVA 2D1WA 3DMCA 3UJMA 1W4NA 3DGOA 1GMQA 2OCTA 3WOFB 1DE3A 2CFWA 1IV7A 5AIIA 1LVNA 1TIJA 2W0QA 4FMDA 4IT7A 1O7MB 1OGZA 5KP1A 1A90A 3X3XA 5IF6A 1WMOA 3SVAA 3KSPA 4XBTA 1VQL3 3LOYA 3MG3A 8CHOA 1RGCA 1LXEA 2GEYA 3BU4A 1IU7A 3LTDA 1B2SA 1X1YA 1YNVX 2SARA 2XFSA 1ULJB 2CFKA 1GS3A 1ROAA 4QWTA 3CCE3 2XSHB 1I8VA 3CC23 1VQQA 3NX0A 1YVBI 3AMOA 5IEPA 4L7KA 4EV5A 2OTJ3 2AADA 4FCJA 3NBBA 3WOEB 5AEWB 2Y73A 1T2IA 2LQVA 2KAAA 1ISKA 2K54A 1D6UA 1FA3A 5ELJA 1OHSA 2INXA 3K7CA 5IERA 1NDOB 2Q07A 3OX9A 3RGRA 4DKIA 2CKFB 1RN7A 1BNRA 3DM8A 1U8CB 4EW5A 2F5MA 1TFOA 3MG2A 1RHLA 4TX4A 3CNXA 3X3ZA 3ZG0A 1Q814 1UCKA 1FGRA 1R4CA 3LH4A 3F9SA 1NB3I 1W5ZA 1IV9A 1X1UA 2IUKA 5AYSC 3BNDA 3CPW2 1V74A 3QRDA 5G1LA 4AEQA 1FGTA 3X42A 3PS8A 2XRXB 1M1K4 1U5OA 4MMYB 3WODG 1NJI4 2HOHA 3CCQ3 4Q53A 1YI23 4XB5A 2FNQA 2BMOB 1K9M4 2Z6BA 1B3SA 2BMQB 5AIFA 4FCMA 5CF1A 1LOVA 2Z7AA 3DGMA 4HOHA 3URPA 2OTL3 3DGNA 1BNJA 1J2BA 3KCHA 3PCSA 4R9KA 1BSAA 3OWSA 3OV4A 2V1LA 3AMOB 1STDA 3B8LA 2R41A 2YFLB 2Z76A 3E99A 4IIAA 3V99A 1NB5I 2KCDA 4L8PA 4WYKA 3CU3A 4WP5A 1TFKA 2BMRB 2H0IA 1ZS7A 4I4KA 3I563 1I3FA 1LNHA 4CDLA 2W6JH 3CCS3 1FGMA 3WDGB 1GOYA 1FZUA 1UW1A 4HM2B 1Q864 1NO3A 2SBLA 5CF2A 2GU1A 3OW22 3EC9A 1KWIA 1V57A 7STDA 1YJW3 1FYSA 3FH1A 3BLZA 2MC8A 1EQKA 1IQXA 1BAOA 3PCRA 3WMDA 1RRHA 5IG5A 3JVCA 2HMNB 3D4AA 1RGHA 4HM1B 4R80A 1FUSA 1HU9A 2E2TA 3O8YA 3LYGA 4N6UA 1BSBA 1GY6A 1NWWA 1BRSA 1MOLA 3CPOA 4K90B 4ORLA 4XDWA 1AVKA 3B7CA 1QAKA 5M1AA 1A2KA 1DMMA 3BIRA 3FSDA 1JB4A 1UCJA 3KIIA 5EEOA 5M18A 1A67A 2JQ5A 4I5QA 3GZXB 4N6MA 2CX0A 1IQ8A 3EE1A 1MWRA 3F40A 3X40A 5KP4A 1M1XB 1W01A 1LOWA 1LQGC 1OGXA 1RGEA 4WYKB 4NHFA 1UGIA 3I0YA 5D81A 1IVWA 1RDSA 4OUQA 1VQM3 1ZO2A 1GMPA 3K63A 1MWUA 4FMAA 1GY7A 2P09A 3B4OA 1W6CA 2LYXA 2W04A 4FR9A 4R1KA 4O02B 3STDA 3ALAA 4PEJA 3HZPA 3LMLA 9RNTA 3BB9A 2GEXA 1WNHA 3AGNA 3FF0A 1M904 3NV0B 1EUIC 3HX8A 4RZMA 2E2VA 3T0UA 1BIRA 2HMLB 2IYJA 4H61A 3LTCA 2C10A 2ML5A 3CNMA 4HM5B 1RLSA 3DH2A 1UCLA 1YJ93 3DGLA 1JBTA 1RCKA 2C11A 3DXOA 1HYFA 1M9GA 3A5EA 5EQLA 1RJOA 3H3HA 1LRAA 1BNGA 2OOVA 3D5GA 1YJN3 3ECFA 2KF6A 3KSED 1Q40A 4J5GA 3X3YA 4HM4B 4KVHA 3S28A 1E97A 4XM4A 1VQN3 2W56B 4N6OB 3FG3A 1BSDA 2F4YA 1L5GB 3OWUA 1B21A 4BL3A 1RKYA 3KKGA 1K28A 4K1VA 5JBSA 1KD14 3EQQB 2ZHXB 3JUPA 2QA43 1E3RA 4N3VA 3G713 1RGAA 3LTBA 1TRQA 2D42A 1JB2A 2F5WA 1T5YA 1MWTA 1QALA 3S5CA 3GAXA 5AEUB 1Z1SA 3AGOA 1W2B2 1O7WB 1YIJ3 3NXJA 1JJ22 2XSOB 1DYUA 4R4KA 4WWUC 4EBGA 1JBSA 5IENA 1JV2B 1B2UA 4KT3B 4WFOA 3PZWA 4STDA 1UCIA 1RCLA 3WHOA 3RDEA 5EVHA 1RMSA 1KQS2 1FGOA 1Q40B 3S27A 8RNTA 2RGQA 2F98A 5DREA 4FCZA 2CWVA 1IVUA 1ROVA 2RNTA 3CXC2 3CCJ3 3N54B 2WGOA 3N9HA 1VQO3 3HIIA 3IPTA 7RNTA 3EF8A 1O7PB 3NM2A 1RN4A 3LZAA 3F7SA 4MMXB 3Q1CA 1BRJA 2CFDA 1W6YA 1IDPA 5AI1A 2OOVC 4RNZA 1UUVB 1ZX2A 5BIRA 1G96A 3PYJA 1UDII 2QGUA 2FXTA 4KZ1A 4EV2A 1W00A 5LC6A 1UUGB 2XF3A 1B2MA 1LOXA 1S723 1ASKA 1GOVA 3EBTA 2OQEA 3S67A 1QJGA 3JUOA 3DUKA 2Z77A 4KFFA 4RBNA 5HGRA 5TGNA 2UGIA 2XGNA 1KC84 7GSPA 1DVDA 1RRLA 3ZFZA 5IEOA 3CCU3 1N8QA 5STDA 4BTXA 2A15A 5AIHA 3X41A 1IQYA 5FGOA 4NPBA 1K8A4 5M19A 3KN4A 4BL2A 1SARA 1VZZA 1I0VA 1RGFA 3RGAA 2QIYA 1EEJA 4G1MB 3TDGA 1QVF2 1FGQA 1RSNA 2PZVA 4FMCA 4HYZA 4CPKA 3FCSB 1BOXA 2BU4A 1OACA 3SOAA 3JUMA 3MPHA 4HBRA 1NNVA 1FW7A 4CCVA 1AVLA 3GZRA 2OWPA 6RNTA 3CC43 1VQ63 3OWYA 5G1KA 1W6GA 3M8CA 1N5PA 4O8SA 4EYCA 3PXMA 3G6E3 4BIRA 5BXQA 1IT8A 1C54A 2GSPA 3J7Yd 2RFRA 2BIRA 1X1WA 1PYLA 3EX9A 1AY7A 4K1UA 3HI7A 4HM7B 1OF5A 2J8XB 1AQZA 1US1A 2C4BA 3JUQA 4LSOA 5D82A 5IG0A 3SYUA 4AKZA 5IG4A 1S5AA 2GXFA 2AAEA 1BSCA 4ILFA 1OPYA 3LTAA 2XH9A 1SQWA 1JN5A 1RNBA 4LYLB 2YFJB 3Q3FA 4MEIA 4LZIA 4N6TA 5IW9A 2B24B 1G0TA 1CYUA 1VQ53 2CK3H 3JUNA 1FUTA 1NU3A 1JZOA 2CX1A 2OQEC 5KP3A 5AIGA 2XEPA 4HM8B 3BNEA 3D79A 3G16A 1JB5A 4HM6B 3D9RA 2RBIA 3MKIA 3PGBA 1RN1A 1SIHA 1DMNA 2W2CA 1I2EA 3SOYA 3VGNA 3S29A 1BUJA 4HAAA 4MJDA 1D6ZA 3DZLA 4XDVA 2BNGA 2IY2A 1BRKA 1QAFA 1UUWB 1VQ93 4OK0A 2H0GA 3AHWA 1PU4A 1YGEA 3Q90A 2JDIH 1W2ZA 4BTYA 1HZ1A 1N5HA 1PY3A 1BRHA 1AV4A 4J9AA 1OHOA 1RGGA 2CH9A 2UUGC 1BVIA 1DVCA 1LNIA 3G0KA 2XFTA 1RGKA 3K9MC 3KZTA 4GHOA 1O7NB 1YVSA 1CEWI 3V98A 4J5KA 3MSOA 1Q7Y4 1QVG2 1JBRA 1GOUA 3SX1A 4N6V0 1TRPA 1WMNA 1SIIA 3CCV3 3B4PA 3T8NA 1TTOA 2CHCA 1TU5A 1Q9EA 3ER7A 5D83A 1TP6A 4O2HA 3GSPA 5GSPA 1ZGXA 1Y4KA 2KRTA 3CD63 3DGYA 3OXAA 2GBXB 1CQSA 2Y74A 4MMZB 3CC73 1R4YA 2BO9B 3EJVA 3GRDA 3ZG5A 2CWUA 2HMOB 2RSXA 4R9LA 4CJNA 6GSPA 1YIT3 1O7GB 2FGTA 4XBXA 2WO0A 1I2FA 1B2XA 3F14A 1GSPA 4AKYA 3MWZA 2CFLA 2QEX3
chains in the Genus database with same CATH topology
1BANA 1GOVA 3HOHA 1BSBA 1I70A 1BRSA 2KF3A 1CH0A 1BU4A 1BRGA 2KF4A 7GSPA 3BIRA 1UCJA 1B27A 1SARA 5BU4A 1I0VA 1RGFA 1X1XA 1LOWA 1RGEA 1T2HA 1RSNA 1BOXA 1RDSA 2BU4A 1GMPA 1MGWA 1GMQA 1DE3A 3D4AA 1FW7A 6RNTA 9RNTA 3AGNA 1DETA 3AHSA 1BIRA 4BIRA 1C54A 1RGCA 2GSPA 3BU4A 1RLSA 1B2SA 1UCLA 1X1YA 1X1WA 1YNVX 2BIRA 3DH2A 1JBTA 1PYLA 1RCKA 1BNEA 2SARA 1AY7A 1HYFA 3WR2A 3A5EA 4RNTA 1LRAA 1BNGA 1I8VA 1AQZA 2C4BA 3D5GA 3SYUA 1A2PA 2KF6A 2AAEA 2ZA4A 1BSCA 2AADA 4J5GA 1T2IA 1RNBA 2KAAA 4BU4A 1I0XA 3Q3FA 1BSDA 2F4YA 5HOHA 1BNRA 1I2GA 2F5MA 1B21A 1RHLA 1BSEA 1BRIA 1FUTA 1UCKA 1X1UA 1RGAA 1BNIA 1I3IA 1TRQA 2F5WA 2RBIA 1RN1A 1BRNL 1BUJA 1I2EA 2HOHA 4HAAA 3RNTA 3AGOA 1BNFA 1G02A 1BRKA 1GMRA 1LOYA 1B3SA 3AHWA 1JBSA 1LOVA 3D5IA 4HOHA 3URPA 1B2UA 1BNJA 3KCHA 1HZ1A 1BSAA 1B2ZA 1PY3A 1UCIA 1RCLA 3WHOA 1BNSA 1BRHA 1RMSA 1RGGA 1BVIA 1LNIA 8RNTA 1B2MA 1RGKA 1B20A 4GHOA 1YVSA 4J5KA 1JBRA 1GOUA 1TRPA 2RNTA 1RGLA 5RNTA 7RNTA 4GSPA 1IYYA 1I3FA 1TTOA 1RNTA 1Q9EA 1RTUA 1GOYA 1FZUA 1RN4A 5GSPA 3GSPA 1ZGXA 1BRJA 3DGYA 1R4YA 6GSPA 1MGRA 1FYSA 5BIRA 1BAOA 1I2FA 1B2XA 1YGWA 1GSPA 2F56A 1RGHA 2KF5A 1BGSA 1FUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAN A;  1GOV A;  3HOH A;  1BSB A;  1I70 A;  1BRS A;  2KF3 A;  1CH0 A;  1BU4 A;  1BRG A;  2KF4 A;  7GSP A;  3BIR A;  1UCJ A;  1B27 A;  1SAR A;  5BU4 A;  1I0V A;  1RGF A;  1X1X A;  1LOW A;  1RGE A;  1T2H A;  1RSN A;  1BOX A;  1RDS A;  2BU4 A;  1GMP A;  1MGW A;  1GMQ A;  1DE3 A;  3D4A A;  1FW7 A;  6RNT A;  9RNT A;  3AGN A;  1DET A;  3AHS A;  1BIR A;  4BIR A;  1C54 A;  1RGC A;  2GSP A;  3BU4 A;  1RLS A;  1B2S A;  1UCL A;  1X1Y A;  1X1W A;  1YNV X;  2BIR A;  3DH2 A;  1JBT A;  1PYL A;  1RCK A;  1BNE A;  2SAR A;  1AY7 A;  1HYF A;  3WR2 A;  3A5E A;  4RNT A;  1LRA A;  1BNG A;  1I8V A;  1AQZ A;  2C4B A;  3D5G A;  3SYU A;  1A2P A;  2KF6 A;  2AAE A;  2ZA4 A;  1BSC A;  2AAD A;  4J5G A;  1T2I A;  1RNB A;  2KAA A;  4BU4 A;  1I0X A;  3Q3F A;  1BSD A;  2F4Y A;  5HOH A;  1BNR A;  1I2G A;  2F5M A;  1B21 A;  1RHL A;  1BSE A;  1BRI A;  1FUT A;  1UCK A;  1X1U A;  1RGA A;  1BNI A;  1I3I A;  1TRQ A;  2F5W A;  2RBI A;  1RN1 A;  1BRN L;  1BUJ A;  1I2E A;  2HOH A;  4HAA A;  3RNT A;  3AGO A;  1BNF A;  1G02 A;  1BRK A;  1GMR A;  1LOY A;  1B3S A;  3AHW A;  1JBS A;  1LOV A;  3D5I A;  4HOH A;  3URP A;  1B2U A;  1BNJ A;  3KCH A;  1HZ1 A;  1BSA A;  1B2Z A;  1PY3 A;  1UCI A;  1RCL A;  3WHO A;  1BNS A;  1BRH A;  1RMS A;  1RGG A;  1BVI A;  1LNI A;  8RNT A;  1B2M A;  1RGK A;  1B20 A;  4GHO A;  1YVS A;  4J5K A;  1JBR A;  1GOU A;  1TRP A;  2RNT A;  1RGL A;  5RNT A;  7RNT A;  4GSP A;  1IYY A;  1I3F A;  1TTO A;  1RNT A;  1Q9E A;  1RTU A;  1GOY A;  1FZU A;  1RN4 A;  5GSP A;  3GSP A;  1ZGX A;  1BRJ A;  3DGY A;  1R4Y A;  6GSP A;  1MGR A;  1FYS A;  5BIR A;  1BAO A;  1I2F A;  1B2X A;  1YGW A;  1GSP A;  2F56 A;  1RGH A;  2KF5 A;  1BGS A;  1FUS A; 
#chains in the Genus database with same CATH topology
 1V58 A;  3NBJ A;  1W02 A;  1I70 A;  2BT3 A;  2YX9 A;  3A76 A;  1QMA A;  3NQZ A;  4ZM8 A;  3SXX A;  1BRG A;  1EA2 A;  5ELU A;  3D3L A;  5DRV A;  1VQ8 3;  2KF4 A;  3K5T A;  1BUQ A;  1TUH A;  4O3V A;  2CWT A;  3I55 3;  1N8R 4;  3FZW A;  4LMI A;  2K0M A;  2W9Q A;  2ZL8 A;  1B27 A;  5A0O B;  6STD A;  3CCL 3;  3KE7 A;  5CXO A;  3LT8 A;  2IMJ A;  1X1X A;  1GD3 A;  2WOF A;  2XR8 B;  3GZY B;  2PNC A;  1JKG A;  2YFI B;  4HZB B;  3V92 A;  1VQP 3;  3N8B A;  2P0M A;  3F8H A;  1MGW A;  1IVV A;  1F8N A;  5JPU A;  2XGL A;  4HJL B;  2CC3 A;  1K41 A;  1GY5 A;  4JF8 A;  1SPU A;  4OVM A;  2K3D A;  3BNC A;  3HIG A;  1YHQ 3;  3CCR 3;  3HK4 A;  5AYR B;  1DET A;  3AHS A;  3GZB A;  1VQ4 3;  1OUN A;  2KXG A;  1STF I;  1TJD A;  1N9E A;  1OCV A;  2W03 A;  1VQ7 3;  4EC6 A;  1IVX A;  3FKA A;  4WHA A;  4XBY A;  3U1W A;  3VSY A;  1BNE A;  3WR2 A;  2UX0 A;  4L8O A;  3EHC A;  4JRF A;  4RNT A;  1K73 4;  1N9J A;  2R4I A;  3NM7 A;  4HM3 B;  3G8Z A;  2IA7 A;  2O3O A;  1A2P A;  3DY5 A;  1UI8 A;  2W9P A;  4IPB A;  1IT7 A;  1WQL B;  2ZA4 A;  1MNL A;  4X2O A;  3WA3 A;  2ML6 A;  3K0Z A;  2WGQ A;  3G4S 3;  2GBW B;  4EXR A;  1A2V A;  3QK9 A;  4BU4 A;  1MWS A;  3MG1 A;  1I0X A;  3EN1 B;  4HVN A;  5HOH A;  4GL6 A;  1GYB A;  1I2G A;  5CLK A;  1JKG B;  1UGH I;  1BSE A;  1BRI A;  1EG9 B;  2L1S A;  2CG0 A;  2HMJ B;  2HMM B;  1DMQ A;  3EN8 A;  4FMB A;  4HM0 B;  3CME 3;  1JZD A;  3UL6 A;  1KSI A;  5I97 A;  1GD4 A;  1BNI A;  1I3I A;  1JNQ A;  1WMP A;  3UL5 A;  2CW9 A;  2ZDJ A;  3FG1 A;  3H51 A;  1BRN L;  4BTW A;  3ROB A;  2O9U X;  1EKM A;  3IJE B;  4K61 A;  1OHP A;  3BNB A;  2B1X B;  1PFP A;  1OH0 A;  3L0R A;  3NQY A;  1BNF A;  3RNT A;  3CMA 3;  1G02 A;  1GMR A;  3NBR A;  1LOY A;  3NV0 A;  3WA2 X;  2P0X A;  4N6N B;  4LEH A;  3D5I A;  1W7C A;  4KFD A;  2STD A;  5FW5 A;  2M7O A;  2F86 B;  2P38 A;  2I9W A;  1B2Z A;  2BHM A;  1D6Y A;  4LGQ A;  1BNS A;  2CFG A;  2E2U A;  3IMA B;  3LXU X;  4X2H A;  3KFQ C;  4U13 A;  3LT9 A;  1B20 A;  2RCD A;  5BVB A;  2CIU A;  4RNY A;  1HKX A;  3NHX A;  1CYV A;  1RGL A;  2MF7 A;  4GB5 A;  1FUW A;  3MYT A;  5RNT A;  5G2G A;  5JPP A;  1Q82 4;  4GSP A;  1IYY A;  4J8T A;  3U97 A;  1RNT A;  4KFE A;  3EB8 A;  1RTU A;  2WOH A;  1ULI B;  2W56 A;  3VF1 A;  1JRQ A;  4H3U A;  1AR0 A;  1C7H A;  2GU3 A;  2P05 A;  1T3B A;  1MGR A;  5CK6 A;  3MHE A;  1YGW A;  2F56 A;  1OF5 B;  2KF5 A;  1BGS A;  3FLJ A;  1LQM B;  1BAN A;  1E3V A;  5IG3 A;  3HOH A;  1Q7H A;  4NRE A;  2KF3 A;  1CH0 A;  1BU4 A;  1O7H B;  1IK3 A;  4N6L A;  3FG4 A;  3Q2P A;  1JN5 B;  3FGY A;  3SED A;  1SJW A;  1UI7 A;  2CG1 A;  3SLU A;  3UNL A;  3F7X A;  2F99 A;  3F8X A;  5BU4 A;  1Q42 A;  2HMK B;  4HZ9 B;  1WTH A;  3CCM 3;  2IUJ A;  3FF2 A;  1T2H A;  3GWR A;  3T8U A;  5LC7 A;  3UB1 A;  1VQK 3;  2H0H A;  4HKV B;  3EBY A;  2L4V A;  3NUV A;  2D1W A;  3DMC A;  3UJM A;  1W4N A;  3DGO A;  1GMQ A;  2OCT A;  3WOF B;  1DE3 A;  2CFW A;  1IV7 A;  5AII A;  1LVN A;  1TIJ A;  2W0Q A;  4FMD A;  4IT7 A;  1O7M B;  1OGZ A;  5KP1 A;  1A90 A;  3X3X A;  5IF6 A;  1WMO A;  3SVA A;  3KSP A;  4XBT A;  1VQL 3;  3LOY A;  3MG3 A;  8CHO A;  1RGC A;  1LXE A;  2GEY A;  3BU4 A;  1IU7 A;  3LTD A;  1B2S A;  1X1Y A;  1YNV X;  2SAR A;  2XFS A;  1ULJ B;  2CFK A;  1GS3 A;  1ROA A;  4QWT A;  3CCE 3;  2XSH B;  1I8V A;  3CC2 3;  1VQQ A;  3NX0 A;  1YVB I;  3AMO A;  5IEP A;  4L7K A;  4EV5 A;  2OTJ 3;  2AAD A;  4FCJ A;  3NBB A;  3WOE B;  5AEW B;  2Y73 A;  1T2I A;  2LQV A;  2KAA A;  1ISK A;  2K54 A;  1D6U A;  1FA3 A;  5ELJ A;  1OHS A;  2INX A;  3K7C A;  5IER A;  1NDO B;  2Q07 A;  3OX9 A;  3RGR A;  4DKI A;  2CKF B;  1RN7 A;  1BNR A;  3DM8 A;  1U8C B;  4EW5 A;  2F5M A;  1TFO A;  3MG2 A;  1RHL A;  4TX4 A;  3CNX A;  3X3Z A;  3ZG0 A;  1Q81 4;  1UCK A;  1FGR A;  1R4C A;  3LH4 A;  3F9S A;  1NB3 I;  1W5Z A;  1IV9 A;  1X1U A;  2IUK A;  5AYS C;  3BND A;  3CPW 2;  1V74 A;  3QRD A;  5G1L A;  4AEQ A;  1FGT A;  3X42 A;  3PS8 A;  2XRX B;  1M1K 4;  1U5O A;  4MMY B;  3WOD G;  1NJI 4;  2HOH A;  3CCQ 3;  4Q53 A;  1YI2 3;  4XB5 A;  2FNQ A;  2BMO B;  1K9M 4;  2Z6B A;  1B3S A;  2BMQ B;  5AIF A;  4FCM A;  5CF1 A;  1LOV A;  2Z7A A;  3DGM A;  4HOH A;  3URP A;  2OTL 3;  3DGN A;  1BNJ A;  1J2B A;  3KCH A;  3PCS A;  4R9K A;  1BSA A;  3OWS A;  3OV4 A;  2V1L A;  3AMO B;  1STD A;  3B8L A;  2R41 A;  2YFL B;  2Z76 A;  3E99 A;  4IIA A;  3V99 A;  1NB5 I;  2KCD A;  4L8P A;  4WYK A;  3CU3 A;  4WP5 A;  1TFK A;  2BMR B;  2H0I A;  1ZS7 A;  4I4K A;  3I56 3;  1I3F A;  1LNH A;  4CDL A;  2W6J H;  3CCS 3;  1FGM A;  3WDG B;  1GOY A;  1FZU A;  1UW1 A;  4HM2 B;  1Q86 4;  1NO3 A;  2SBL A;  5CF2 A;  2GU1 A;  3OW2 2;  3EC9 A;  1KWI A;  1V57 A;  7STD A;  1YJW 3;  1FYS A;  3FH1 A;  3BLZ A;  2MC8 A;  1EQK A;  1IQX A;  1BAO A;  3PCR A;  3WMD A;  1RRH A;  5IG5 A;  3JVC A;  2HMN B;  3D4A A;  1RGH A;  4HM1 B;  4R80 A;  1FUS A;  1HU9 A;  2E2T A;  3O8Y A;  3LYG A;  4N6U A;  1BSB A;  1GY6 A;  1NWW A;  1BRS A;  1MOL A;  3CPO A;  4K90 B;  4ORL A;  4XDW A;  1AVK A;  3B7C A;  1QAK A;  5M1A A;  1A2K A;  1DMM A;  3BIR A;  3FSD A;  1JB4 A;  1UCJ A;  3KII A;  5EEO A;  5M18 A;  1A67 A;  2JQ5 A;  4I5Q A;  3GZX B;  4N6M A;  2CX0 A;  1IQ8 A;  3EE1 A;  1MWR A;  3F40 A;  3X40 A;  5KP4 A;  1M1X B;  1W01 A;  1LOW A;  1LQG C;  1OGX A;  1RGE A;  4WYK B;  4NHF A;  1UGI A;  3I0Y A;  5D81 A;  1IVW A;  1RDS A;  4OUQ A;  1VQM 3;  1ZO2 A;  1GMP A;  3K63 A;  1MWU A;  4FMA A;  1GY7 A;  2P09 A;  3B4O A;  1W6C A;  2LYX A;  2W04 A;  4FR9 A;  4R1K A;  4O02 B;  3STD A;  3ALA A;  4PEJ A;  3HZP A;  3LML A;  9RNT A;  3BB9 A;  2GEX A;  1WNH A;  3AGN A;  3FF0 A;  1M90 4;  3NV0 B;  1EUI C;  3HX8 A;  4RZM A;  2E2V A;  3T0U A;  1BIR A;  2HML B;  2IYJ A;  4H61 A;  3LTC A;  2C10 A;  2ML5 A;  3CNM A;  4HM5 B;  1RLS A;  3DH2 A;  1UCL A;  1YJ9 3;  3DGL A;  1JBT A;  1RCK A;  2C11 A;  3DXO A;  1HYF A;  1M9G A;  3A5E A;  5EQL A;  1RJO A;  3H3H A;  1LRA A;  1BNG A;  2OOV A;  3D5G A;  1YJN 3;  3ECF A;  2KF6 A;  3KSE D;  1Q40 A;  4J5G A;  3X3Y A;  4HM4 B;  4KVH A;  3S28 A;  1E97 A;  4XM4 A;  1VQN 3;  2W56 B;  4N6O B;  3FG3 A;  1BSD A;  2F4Y A;  1L5G B;  3OWU A;  1B21 A;  4BL3 A;  1RKY A;  3KKG A;  1K28 A;  4K1V A;  5JBS A;  1KD1 4;  3EQQ B;  2ZHX B;  3JUP A;  2QA4 3;  1E3R A;  4N3V A;  3G71 3;  1RGA A;  3LTB A;  1TRQ A;  2D42 A;  1JB2 A;  2F5W A;  1T5Y A;  1MWT A;  1QAL A;  3S5C A;  3GAX A;  5AEU B;  1Z1S A;  3AGO A;  1W2B 2;  1O7W B;  1YIJ 3;  3NXJ A;  1JJ2 2;  2XSO B;  1DYU A;  4R4K A;  4WWU C;  4EBG A;  1JBS A;  5IEN A;  1JV2 B;  1B2U A;  4KT3 B;  4WFO A;  3PZW A;  4STD A;  1UCI A;  1RCL A;  3WHO A;  3RDE A;  5EVH A;  1RMS A;  1KQS 2;  1FGO A;  1Q40 B;  3S27 A;  8RNT A;  2RGQ A;  2F98 A;  5DRE A;  4FCZ A;  2CWV A;  1IVU A;  1ROV A;  2RNT A;  3CXC 2;  3CCJ 3;  3N54 B;  2WGO A;  3N9H A;  1VQO 3;  3HII A;  3IPT A;  7RNT A;  3EF8 A;  1O7P B;  3NM2 A;  1RN4 A;  3LZA A;  3F7S A;  4MMX B;  3Q1C A;  1BRJ A;  2CFD A;  1W6Y A;  1IDP A;  5AI1 A;  2OOV C;  4RNZ A;  1UUV B;  1ZX2 A;  5BIR A;  1G96 A;  3PYJ A;  1UDI I;  2QGU A;  2FXT A;  4KZ1 A;  4EV2 A;  1W00 A;  5LC6 A;  1UUG B;  2XF3 A;  1B2M A;  1LOX A;  1S72 3;  1ASK A;  1GOV A;  3EBT A;  2OQE A;  3S67 A;  1QJG A;  3JUO A;  3DUK A;  2Z77 A;  4KFF A;  4RBN A;  5HGR A;  5TGN A;  2UGI A;  2XGN A;  1KC8 4;  7GSP A;  1DVD A;  1RRL A;  3ZFZ A;  5IEO A;  3CCU 3;  1N8Q A;  5STD A;  4BTX A;  2A15 A;  5AIH A;  3X41 A;  1IQY A;  5FGO A;  4NPB A;  1K8A 4;  5M19 A;  3KN4 A;  4BL2 A;  1SAR A;  1VZZ A;  1I0V A;  1RGF A;  3RGA A;  2QIY A;  1EEJ A;  4G1M B;  3TDG A;  1QVF 2;  1FGQ A;  1RSN A;  2PZV A;  4FMC A;  4HYZ A;  4CPK A;  3FCS B;  1BOX A;  2BU4 A;  1OAC A;  3SOA A;  3JUM A;  3MPH A;  4HBR A;  1NNV A;  1FW7 A;  4CCV A;  1AVL A;  3GZR A;  2OWP A;  6RNT A;  3CC4 3;  1VQ6 3;  3OWY A;  5G1K A;  1W6G A;  3M8C A;  1N5P A;  4O8S A;  4EYC A;  3PXM A;  3G6E 3;  4BIR A;  5BXQ A;  1IT8 A;  1C54 A;  2GSP A;  3J7Y d;  2RFR A;  2BIR A;  1X1W A;  1PYL A;  3EX9 A;  1AY7 A;  4K1U A;  3HI7 A;  4HM7 B;  1OF5 A;  2J8X B;  1AQZ A;  1US1 A;  2C4B A;  3JUQ A;  4LSO A;  5D82 A;  5IG0 A;  3SYU A;  4AKZ A;  5IG4 A;  1S5A A;  2GXF A;  2AAE A;  1BSC A;  4ILF A;  1OPY A;  3LTA A;  2XH9 A;  1SQW A;  1JN5 A;  1RNB A;  4LYL B;  2YFJ B;  3Q3F A;  4MEI A;  4LZI A;  4N6T A;  5IW9 A;  2B24 B;  1G0T A;  1CYU A;  1VQ5 3;  2CK3 H;  3JUN A;  1FUT A;  1NU3 A;  1JZO A;  2CX1 A;  2OQE C;  5KP3 A;  5AIG A;  2XEP A;  4HM8 B;  3BNE A;  3D79 A;  3G16 A;  1JB5 A;  4HM6 B;  3D9R A;  2RBI A;  3MKI A;  3PGB A;  1RN1 A;  1SIH A;  1DMN A;  2W2C A;  1I2E A;  3SOY A;  3VGN A;  3S29 A;  1BUJ A;  4HAA A;  4MJD A;  1D6Z A;  3DZL A;  4XDV A;  2BNG A;  2IY2 A;  1BRK A;  1QAF A;  1UUW B;  1VQ9 3;  4OK0 A;  2H0G A;  3AHW A;  1PU4 A;  1YGE A;  3Q90 A;  2JDI H;  1W2Z A;  4BTY A;  1HZ1 A;  1N5H A;  1PY3 A;  1BRH A;  1AV4 A;  4J9A A;  1OHO A;  1RGG A;  2CH9 A;  2UUG C;  1BVI A;  1DVC A;  1LNI A;  3G0K A;  2XFT A;  1RGK A;  3K9M C;  3KZT A;  4GHO A;  1O7N B;  1YVS A;  1CEW I;  3V98 A;  4J5K A;  3MSO A;  1Q7Y 4;  1QVG 2;  1JBR A;  1GOU A;  3SX1 A;  4N6V 0;  1TRP A;  1WMN A;  1SII A;  3CCV 3;  3B4P A;  3T8N A;  1TTO A;  2CHC A;  1TU5 A;  1Q9E A;  3ER7 A;  5D83 A;  1TP6 A;  4O2H A;  3GSP A;  5GSP A;  1ZGX A;  1Y4K A;  2KRT A;  3CD6 3;  3DGY A;  3OXA A;  2GBX B;  1CQS A;  2Y74 A;  4MMZ B;  3CC7 3;  1R4Y A;  2BO9 B;  3EJV A;  3GRD A;  3ZG5 A;  2CWU A;  2HMO B;  2RSX A;  4R9L A;  4CJN A;  6GSP A;  1YIT 3;  1O7G B;  2FGT A;  4XBX A;  2WO0 A;  1I2F A;  1B2X A;  3F14 A;  1GSP A;  4AKY A;  3MWZ A;  2CFL A;  2QEX 3; 
#chains in the Genus database with same CATH homology
 1BAN A;  1GOV A;  3HOH A;  1BSB A;  1I70 A;  1BRS A;  2KF3 A;  1CH0 A;  1BU4 A;  1BRG A;  2KF4 A;  7GSP A;  3BIR A;  1UCJ A;  1B27 A;  1SAR A;  5BU4 A;  1I0V A;  1RGF A;  1X1X A;  1LOW A;  1RGE A;  1T2H A;  1RSN A;  1BOX A;  1RDS A;  2BU4 A;  1GMP A;  1MGW A;  1GMQ A;  1DE3 A;  3D4A A;  1FW7 A;  6RNT A;  9RNT A;  3AGN A;  1DET A;  3AHS A;  1BIR A;  4BIR A;  1C54 A;  1RGC A;  2GSP A;  3BU4 A;  1RLS A;  1B2S A;  1UCL A;  1X1Y A;  1X1W A;  1YNV X;  2BIR A;  3DH2 A;  1JBT A;  1PYL A;  1RCK A;  1BNE A;  2SAR A;  1AY7 A;  1HYF A;  3WR2 A;  3A5E A;  4RNT A;  1LRA A;  1BNG A;  1I8V A;  1AQZ A;  2C4B A;  3D5G A;  3SYU A;  1A2P A;  2KF6 A;  2AAE A;  2ZA4 A;  1BSC A;  2AAD A;  4J5G A;  1T2I A;  1RNB A;  2KAA A;  4BU4 A;  1I0X A;  3Q3F A;  1BSD A;  2F4Y A;  5HOH A;  1BNR A;  1I2G A;  2F5M A;  1B21 A;  1RHL A;  1BSE A;  1BRI A;  1FUT A;  1UCK A;  1X1U A;  1RGA A;  1BNI A;  1I3I A;  1TRQ A;  2F5W A;  2RBI A;  1RN1 A;  1BRN L;  1BUJ A;  1I2E A;  2HOH A;  4HAA A;  3RNT A;  3AGO A;  1BNF A;  1G02 A;  1BRK A;  1GMR A;  1LOY A;  1B3S A;  3AHW A;  1JBS A;  1LOV A;  3D5I A;  4HOH A;  3URP A;  1B2U A;  1BNJ A;  3KCH A;  1HZ1 A;  1BSA A;  1B2Z A;  1PY3 A;  1UCI A;  1RCL A;  3WHO A;  1BNS A;  1BRH A;  1RMS A;  1RGG A;  1BVI A;  1LNI A;  8RNT A;  1B2M A;  1RGK A;  1B20 A;  4GHO A;  1YVS A;  4J5K A;  1JBR A;  1GOU A;  1TRP A;  2RNT A;  1RGL A;  5RNT A;  7RNT A;  4GSP A;  1IYY A;  1I3F A;  1TTO A;  1RNT A;  1Q9E A;  1RTU A;  1GOY A;  1FZU A;  1RN4 A;  5GSP A;  3GSP A;  1ZGX A;  1BRJ A;  3DGY A;  1R4Y A;  6GSP A;  1MGR A;  1FYS A;  5BIR A;  1BAO A;  1I2F A;  1B2X A;  1YGW A;  1GSP A;  2F56 A;  1RGH A;  2KF5 A;  1BGS A;  1FUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...