1JBSA

Crystal structure of ribotoxin restrictocin and a 29-mer srd rna analog
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 29-mer sarcin/ricin domain RNA analog
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
molecule tags Hydrolase/rna
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbsA00
1LRAA 3BU4A 1BNSA 3URPA 2RBIA 2KF5A 1B2UA 4HOHA 8RNTA 1BNRA 1I3IA 1G02A 4J5KA 1UCIA 1RHLA 1I0VA 1I2EA 3WHOA 1BIRA 1I2FA 1I3FA 1RLSA 1UCLA 1BRSA 1RCLA 1YVSA 1BRIA 4RNTA 2AADA 3Q3FA 1B2MA 2BIRA 1SARA 1GMQA 1Q9EA 1RGEA 1YGWA 1PY3A 2KF3A 1PYLA 1BNFA 4HAAA 1UCJA 1GOYA 2F4YA 6GSPA 1FUSA 5BIRA 1T2IA 1B27A 1RCKA 1BNJA 1CH0A 1FW7A 2KF4A 4J5GA 3A5EA 1BGSA 2HOHA 2F5MA 3HOHA 1B2ZA 1LOYA 1A2PA 1BRHA 3DGYA 1GMRA 4GHOA 1BNGA 1I2GA 1LNIA 3AHWA 3GSPA 1BSDA 3RNTA 1JBRA 4GSPA 3KCHA 1YNVX 2RNTA 1X1XA 2KF6A 1IYYA 1RTUA 1RNTA 4BIRA 1C54A 1GMPA 1TRPA 1HZ1A 7RNTA 3BIRA 1GOVA 1TRQA 1LOWA 1BSEA 1BAOA 3D5GA 1B2XA 3WR2A 1X1YA 1RNBA 1RMSA 1BSCA 1I70A 1B21A 1RDSA 1JBTA 1DETA 1B20A 1BU4A 9RNTA 3D5IA 2SARA 1BRKA 1BSBA 3AGNA 1T2HA 2KAAA 1R4YA 1AY7A 3DH2A 1MGWA 5RNTA 1JBSA 1B3SA 1I0XA 1AQZA 1BRNL 1BVIA 1TTOA 1MGRA 1RGAA 1BNIA 1RGFA 1RGHA 1FYSA 1RGLA 1BRJA 1HYFA 2F5WA 3SYUA 1B2SA 1LOVA 1RN1A 1BOXA 2BU4A 1X1UA 1BSAA 1RGKA 1BANA 1RGGA 3D4AA 1DE3A 2F56A 1BUJA 1RN4A 1RSNA 4BU4A 2ZA4A 1RGCA 1X1WA 3AHSA 7GSPA 1UCKA 5BU4A 1BNEA 2GSPA 2AAEA 2C4BA 1ZGXA 5HOHA 1FUTA 6RNTA 1FZUA 3AGOA 1I8VA 1BRGA 1GSPA 5GSPA 1GOUA
chains in the Genus database with same CATH superfamily
3Q90A 3I563 1IT8A 2WGOA 1QJGA 1Q40B 2UUGC 5M1AA 3CXC2 1B2UA 4FMDA 3BLZA 3STDA 4XBXA 1GYBA 3UJMA 2GEXA 1IV9A 1JV2B 5D81A 1RHLA 3KKGA 3QK9A 3TDGA 1I2EA 3DGLA 1QAKA 3MG2A 1VQ93 1FUWA 1C7HA 1I2FA 1I3FA 1RLSA 1BRSA 2BMRB 2SBLA 4MMYB 1HKXA 1BRIA 5M19A 1YIT3 4RNTA 2HMLB 4FCMA 4FCZA 2Y74A 1B2MA 2K0MA 4HZBB 5FW5A 3D79A 2B1XB 1OGXA 1Q9EA 3SX1A 2KF3A 3DXOA 1PYLA 2BO9B 1NU3A 1GD3A 3F8HA 5AIHA 1A2VA 3Q2PA 4R9KA 2PZVA 5IG3A 2FXTA 1JB2A 3OV4A 4HYZA 1MNLA 4N6MA 5G1LA 1RCKA 1TFOA 2CX0A 1K734 4L8PA 5IEPA 1AR0A 3PGBA 4N6NB 4J9AA 3RDEA 1B2ZA 2W0QA 3MHEA 2O3OA 1GD4A 1RRHA 3OX9A 3MWZA 3JUNA 4XBTA 1BSDA 5EVHA 1J2BA 1DMNA 1AVKA 1W6GA 1ZS7A 3HI7A 3KCHA 3ALAA 3NX0A 4GSPA 5IW9A 3EBTA 3PXMA 2Z6BA 1W6CA 1GMPA 2CFLA 1T5YA 5AIGA 5AEWB 3BIRA 3M8CA 3LYGA 1Q824 1O7HB 2CFKA 4AKYA 2STDA 1KC84 4K1UA 4NPBA 2D42A 3CMA3 2OQEA 5AI1A 2OWPA 3G6E3 1WMOA 3GZRA 3MSOA 3NM2A 4XM4A 1FGTA 4MEIA 3G16A 4CDLA 1B20A 1JN5A 5D82A 1M1XB 1BU4A 4EXRA 3JUMA 3DMCA 3CCS3 3AGNA 3T8UA 1UW1A 3G4S3 1Q42A 4KT3B 3NQYA 2CX1A 2XRXB 1U8CB 1B3SA 2W2CA 2Z77A 1I0XA 2QGUA 3T0UA 5JBSA 2P09A 1O7MB 4XB5A 5AYRB 1OGZA 2UX0A 2J8XB 1Q40A 3BNEA 4XDVA 1OHOA 1RGHA 1W4NA 4LEHA 4QWTA 5KP4A 1HYFA 2PNCA 4FMAA 1W01A 2F5WA 3D9RA 3LTAA 3CCE3 5IERA 2CWTA 1W7CA 1BOXA 2FNQA 2BU4A 2WOHA 3FZWA 2IUKA 3V92A 3F9SA 5D83A 3V98A 1NJI4 3WODG 3T8NA 1RGGA 1UI8A 1DE3A 2F56A 3X41A 1IQ8A 3EE1A 3LOYA 4LGQA 2OOVA 1L5GB 2CH9A 4HJLB 1LQGC 4BU4A 4OVMA 4RBNA 2W04A 3CCU3 3LTDA 3CCJ3 7GSPA 1Z1SA 3LT9A 3S27A 5IG5A 1F8NA 1ZGXA 5HOHA 1JNQA 5FGOA 5TGNA 1FUTA 3EF8A 4K61A 1D6ZA 1MOLA 3CNMA 3UL6A 3K63A 4K90B 4O2HA 5GSPA 1GOUA 5LC6A 3BU4A 5G1KA 3K9MC 3SVAA 1IVXA 5LC7A 1DVDA 1OUNA 4HOHA 3BB9A 4HM5B 8RNTA 1BNRA 1DYUA 1UUGB 1NDOB 4HVNA 4EV5A 3JUPA 2Q07A 3WHOA 4FCJA 3GZXB 5ELJA 1WMNA 3I553 2MC8A 1HU9A 5CK6A 4BL3A 3HIGA 4HM6B 3WDGB 1NWWA 1N8R4 3FG4A 1VQM3 5CXOA 3KFQC 3A76A 3KSPA 4N3VA 1GMQA 1RGEA 1YGWA 2F98A 1PY3A 3PCSA 3DUKA 3H3HA 3X3XA 4LSOA 1M904 3CD63 3S5CA 3GWRA 2GEYA 1FUSA 4L7KA 4LYLB 4IIAA 1T2IA 1RKYA 1IQYA 1QMAA 2KF4A 3A5EA 1BGSA 1E3RA 2P0XA 3ROBA 2F5MA 1RN7A 3HOHA 3X40A 1BRHA 3KSED 1A90A 1G96A 3NUVA 1BNGA 4GHOA 3OW22 2A15A 1LXEA 3GSPA 3UL5A 5STDA 3RNTA 2RFRA 1JBRA 3NBJA 4FMCA 3UB1A 2W9PA 5M18A 5A0OB 5IENA 1N5PA 1X1XA 2KF6A 1UDII 4I4KA 2P0MA 3HIIA 3NV0B 4KZ1A 4G1MB 3NQZA 1TRPA 2IYJA 3QRDA 4KFFA 7RNTA 5HGRA 2JQ5A 1VZZA 2F99A 4HM0B 1NO3A 1ROVA 3N9HA 1MWRA 1VQQA 1IV7A 1BAOA 3LTCA 4JRFA 4O8SA 2CW9A 1A67A 1IVWA 3WR2A 2HMNB 4H61A 1RNBA 1RMSA 3VF1A 4MMZB 2L1SA 1RDSA 3L0RA 3PZWA 2I9WA 2XFTA 1RJOA 4CPKA 1GY5A 2W6JH 1DETA 1WQLB 3SLUA 3X42A 1YI23 9RNTA 3D5IA 4GL6A 1TU5A 1T2HA 4N6UA 1R4YA 1AY7A 1DMQA 3WA2X 1VQ73 5RNTA 1JBSA 4HM3B 3CC23 1KD14 4BTYA 2CKFB 3FG1A 3F40A 1W5ZA 1ZO2A 3BNBA 1BRNL 1BVIA 4EC6A 2RSXA 1RGAA 1BNIA 1V74A 3FF2A 1O7NB 1FYSA 3NXJA 1BRJA 3SOYA 1EQKA 3SYUA 1RN1A 2ZDJA 3N54B 4LZIA 1O7GB 1BUQA 1IT7A 4HM8B 2M7OA 1FGOA 3DY5A 3OWYA 3D4AA 3LH4A 4FR9A 4WWUC 3BNCA 4IT7A 2CFWA 1RN4A 4MJDA 3PYJA 1RGCA 3PS8A 3NBBA 3G713 1G0TA 1K28A 1A2KA 3FKAA 4EBGA 1AVLA 5BU4A 1OACA 2GSPA 2INXA 2AAEA 2P05A 4N6LA 1FA3A 3FCSB 1OF5B 1SQWA 3UNLA 1JZOA 2F86B 3AGOA 5I97A 1GSPA 3F7XA 1LRAA 2IUJA 4EYCA 3FSDA 5BVBA 1MWSA 2OCTA 2R4IA 2CC3A 2RBIA 3H51A 4WP5A 3U1WA 2CWUA 2XF3A 3URPA 4BTXA 4EV2A 4WFOA 1W00A 5IF6A 1US1A 4J5KA 3NV0A 1VQN3 1Q864 1TFKA 5AIFA 3CC43 1FGQA 3HZPA 1UCLA 1VQK3 5KP3A 4ILFA 2AADA 3LZAA 3ZFZA 3WOFB 3D3LA 4N6V0 2QEX3 4OUQA 4KFDA 2GBWB 3JVCA 3BNDA 2W03A 5AYSC 3SOAA 5IG4A 2OTJ3 1LOXA 4RNYA 3DGMA 3MG1A 5IEOA 1RRLA 1TJDA 3CPW2 3G8ZA 2F4YA 3LTBA 4CJNA 4WYKB 1UUVB 1VQL3 2HMMB 1YGEA 3EJVA 4JF8A 2XGLA 2CG0A 4XDWA 4N6OB 4O3VA 1NB3I 3SXXA 1FW7A 2WOFA 3EQQB 3Q1CA 2K3DA 2LYXA 1OH0A 3I0YA 1ROAA 2HOHA 2YFIB 4J5GA 4X2OA 2XR8B 2XEPA 3DGYA 2E2VA 2Z76A 1QVG2 1I2GA 1W2B2 3AHWA 3GZBA 4MMXB 2CIUA 3RGRA 1LQMB 3JUOA 1GY6A 2OQEC 1PU4A 1TIJA 2R41A 5DRVA 1YNVX 2RNTA 1ASKA 2HMKB 1UI7A 1IYYA 2WO0A 3EB8A 1VQO3 3U97A 1CQSA 1GOVA 1MWUA 1W2ZA 1LNHA 1OHPA 1LOWA 1ZX2A 2IY2A 3V99A 3B4OA 1BSEA 2Y73A 1W02A 1STDA 2IA7A 1IVVA 2E2TA 1IQXA 1B2XA 2E2UA 3D5GA 2GBXB 3OWSA 3CC73 2LQVA 1BSCA 1B21A 3CU3A 3SEDA 1K8A4 1JBTA 1SPUA 4RZMA 1V58A 2BHMA 1QALA 2BNGA 5AEUB 2RGQA 1BRKA 1OF5A 2KAAA 3OWUA 2B24B 3DH2A 2CFGA 4XBYA 1M1K4 1MGWA 2RCDA 3EC9A 4FMBA 1WTHA 1O7PB 3GAXA 4R80A 4NREA 2XFSA 4CCVA 1QVF2 1VQ43 5JPUA 2MF7A 1OCVA 2HMOB 4K1VA 1JKGB 3DGOA 8CHOA 1Q814 1RGFA 1UGIA 4R1KA 5EEOA 4AEQA 1S5AA 2OOVC 4RNZA 1VQ53 3GZYB 4KVHA 5AIIA 4HM1B 2H0HA 1RGKA 2V1LA 2BMQB 2YFJB 1AV4A 3HX8A 1IVUA 3ECFA 1EA2A 1OPYA 3B7CA 3ER7A 1E97A 3X3YA 1SIHA 5IG0A 3LXUX 1N9JA 5DREA 2XSHB 3AHSA 4U13A 3K7CA 2W9QA 2XH9A 4WYKA 1NB5I 2C4BA 4HBRA 3NM7A 1D6YA 1W6YA 3B8LA 1LVNA 5ELUA 6RNTA 1KSIA 3CME3 1BRGA 3FGYA 3PCRA 4L8OA 4X2HA 7STDA 1YVBI 3JUQA 3CCR3 2UGIA 1BNSA 3MYTA 2CK3H 3IPTA 1YJW3 1Q7HA 3MPHA 2KF5A 3KIIA 3E99A 1M9GA 1PFPA 1TP6A 1VQP3 3AMOB 3KZTA 1I3IA 1G02A 1FGMA 4OK0A 1UCIA 2H0IA 1I0VA 2ML5A 1BIRA 1IDPA 3K0ZA 3ZG5A 1N5HA 1EEJA 1RCLA 1EUIC 1VQ83 1V57A 1JB5A 1YVSA 1STFI 2H0GA 2CHCA 1GY7A 2O9UX 2W56B 2Z7AA 3Q3FA 2BIRA 1JJ22 3CCM3 3FLJA 3WOEB 3FG3A 1SARA 2D1WA 2JDIH 1JRQA 2C10A 3NHXA 3OXAA 1D6UA 1BNFA 4HAAA 1UCJA 1SJWA 3S67A 2QIYA 4LMIA 3LMLA 1GOYA 3EHCA 3S29A 3VSYA 6GSPA 1Y4KA 1CYVA 5BIRA 1YJN3 1IU7A 5G2GA 1B27A 1BNJA 1CH0A 1R4CA 2GXFA 5KP1A 2ML6A 1LOYA 1A2PA 1GMRA 1JKGA 2HMJB 3X3ZA 1LNIA 2GU1A 4ORLA 3CCQ3 1JZDA 4HM4B 3CNXA 3J7Yd 4J8TA 2CFDA 3IJEB 2IMJA 4HZ9B 5CF2A 1RTUA 2KXGA 1RNTA 4BIRA 1CYUA 1C54A 5EQLA 1HZ1A 2C11A 2ZL8A 1TRQA 1VQ63 4STDA 1KWIA 4HM2B 1OHSA 3K5TA 3KN4A 3EX9A 3ZG0A 1MWTA 1IK3A 1SIIA 6STDA 3MKIA 3CCL3 3EN8A 1X1YA 2CG1A 1I70A 4GB5A 2KCDA 4EW5A 2QA43 1YJ93 1YHQ3 4O02B 1Q7Y4 2SARA 1DVCA 1JB4A 3O8YA 3DZLA 3DM8A 1BSBA 3F14A 4IPBA 4BL2A 1UGHI 1U5OA 1CEWI 4H3UA 4N6TA 1AQZA 4NHFA 2ZHXB 2FGTA 1O7WB 1EG9B 3S28A 1TTOA 1MGRA 1N8QA 1WNHA 4AKZA 2CWVA 3FF0A 2P38A 1K9M4 1RGLA 3VGNA 1S723 1N9EA 5JPPA 1EKMA 3AMOA 4HKVB 1B2SA 1LOVA 2YX9A 4HM7B 3FH1A 3F8XA 3IMAB 1GS3A 3GRDA 3LT8A 1ISKA 1X1UA 1BSAA 1YIJ3 3CPOA 3MG3A 2OTL3 4R4KA 4WHAA 1DMMA 1FGRA 1K41A 2BT3A 2BMOB 2W56A 4PEJA 3CCV3 1BANA 1QAFA 1ULJB 2L4VA 4DKIA 1BUJA 1WMPA 2K54A 1ULIB 2XSOB 3DGNA 3NBRA 1RSNA 5CLKA 4BTWA 2WGQA 1UUWB 2XGNA 2ZA4A 3EN1B 3B4PA 4Q53A 2YFLB 1X1WA 4TX4A 3HK4A 5BXQA 1UCKA 2KRTA 1JN5B 1T3BA 1BNEA 1E3VA 4I5QA 1KQS2 3F7SA 2GU3A 1NNVA 3EBYA 1TUHA 4R9LA 3N8BA 4KFEA 1FZUA 3KE7A 3RGAA 5CF1A 1I8VA 3WA3A 3WMDA 3G0KA 4ZM8A
chains in the Genus database with same CATH topology
1LRAA 3BU4A 1BNSA 3URPA 2RBIA 2KF5A 1B2UA 4HOHA 8RNTA 1BNRA 1I3IA 1G02A 4J5KA 1UCIA 1RHLA 1I0VA 1I2EA 3WHOA 1BIRA 1I2FA 1I3FA 1RLSA 1UCLA 1BRSA 1RCLA 1YVSA 1BRIA 4RNTA 2AADA 3Q3FA 1B2MA 2BIRA 1SARA 1GMQA 1Q9EA 1RGEA 1YGWA 1PY3A 2KF3A 1PYLA 1BNFA 4HAAA 1UCJA 1GOYA 2F4YA 6GSPA 1FUSA 5BIRA 1T2IA 1B27A 1RCKA 1BNJA 1CH0A 1FW7A 2KF4A 4J5GA 3A5EA 1BGSA 2HOHA 2F5MA 3HOHA 1B2ZA 1LOYA 1A2PA 1BRHA 3DGYA 1GMRA 4GHOA 1BNGA 1I2GA 1LNIA 3AHWA 3GSPA 1BSDA 3RNTA 1JBRA 4GSPA 3KCHA 1YNVX 2RNTA 1X1XA 2KF6A 1IYYA 1RTUA 1RNTA 4BIRA 1C54A 1GMPA 1TRPA 1HZ1A 7RNTA 3BIRA 1GOVA 1TRQA 1LOWA 1BSEA 1BAOA 3D5GA 1B2XA 3WR2A 1X1YA 1RNBA 1RMSA 1BSCA 1I70A 1B21A 1RDSA 1JBTA 1DETA 1B20A 1BU4A 9RNTA 3D5IA 2SARA 1BRKA 1BSBA 3AGNA 1T2HA 2KAAA 1R4YA 1AY7A 3DH2A 1MGWA 5RNTA 1JBSA 1B3SA 1I0XA 1AQZA 1BRNL 1BVIA 1TTOA 1MGRA 1RGAA 1BNIA 1RGFA 1RGHA 1FYSA 1RGLA 1BRJA 1HYFA 2F5WA 3SYUA 1B2SA 1LOVA 1RN1A 1BOXA 2BU4A 1X1UA 1BSAA 1RGKA 1BANA 1RGGA 3D4AA 1DE3A 2F56A 1BUJA 1RN4A 1RSNA 4BU4A 2ZA4A 1RGCA 1X1WA 3AHSA 7GSPA 1UCKA 5BU4A 1BNEA 2GSPA 2AAEA 2C4BA 1ZGXA 5HOHA 1FUTA 6RNTA 1FZUA 3AGOA 1I8VA 1BRGA 1GSPA 5GSPA 1GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRA A;  3BU4 A;  1BNS A;  3URP A;  2RBI A;  2KF5 A;  1B2U A;  4HOH A;  8RNT A;  1BNR A;  1I3I A;  1G02 A;  4J5K A;  1UCI A;  1RHL A;  1I0V A;  1I2E A;  3WHO A;  1BIR A;  1I2F A;  1I3F A;  1RLS A;  1UCL A;  1BRS A;  1RCL A;  1YVS A;  1BRI A;  4RNT A;  2AAD A;  3Q3F A;  1B2M A;  2BIR A;  1SAR A;  1GMQ A;  1Q9E A;  1RGE A;  1YGW A;  1PY3 A;  2KF3 A;  1PYL A;  1BNF A;  4HAA A;  1UCJ A;  1GOY A;  2F4Y A;  6GSP A;  1FUS A;  5BIR A;  1T2I A;  1B27 A;  1RCK A;  1BNJ A;  1CH0 A;  1FW7 A;  2KF4 A;  4J5G A;  3A5E A;  1BGS A;  2HOH A;  2F5M A;  3HOH A;  1B2Z A;  1LOY A;  1A2P A;  1BRH A;  3DGY A;  1GMR A;  4GHO A;  1BNG A;  1I2G A;  1LNI A;  3AHW A;  3GSP A;  1BSD A;  3RNT A;  1JBR A;  4GSP A;  3KCH A;  1YNV X;  2RNT A;  1X1X A;  2KF6 A;  1IYY A;  1RTU A;  1RNT A;  4BIR A;  1C54 A;  1GMP A;  1TRP A;  1HZ1 A;  7RNT A;  3BIR A;  1GOV A;  1TRQ A;  1LOW A;  1BSE A;  1BAO A;  3D5G A;  1B2X A;  3WR2 A;  1X1Y A;  1RNB A;  1RMS A;  1BSC A;  1I70 A;  1B21 A;  1RDS A;  1JBT A;  1DET A;  1B20 A;  1BU4 A;  9RNT A;  3D5I A;  2SAR A;  1BRK A;  1BSB A;  3AGN A;  1T2H A;  2KAA A;  1R4Y A;  1AY7 A;  3DH2 A;  1MGW A;  5RNT A;  1JBS A;  1B3S A;  1I0X A;  1AQZ A;  1BRN L;  1BVI A;  1TTO A;  1MGR A;  1RGA A;  1BNI A;  1RGF A;  1RGH A;  1FYS A;  1RGL A;  1BRJ A;  1HYF A;  2F5W A;  3SYU A;  1B2S A;  1LOV A;  1RN1 A;  1BOX A;  2BU4 A;  1X1U A;  1BSA A;  1RGK A;  1BAN A;  1RGG A;  3D4A A;  1DE3 A;  2F56 A;  1BUJ A;  1RN4 A;  1RSN A;  4BU4 A;  2ZA4 A;  1RGC A;  1X1W A;  3AHS A;  7GSP A;  1UCK A;  5BU4 A;  1BNE A;  2GSP A;  2AAE A;  2C4B A;  1ZGX A;  5HOH A;  1FUT A;  6RNT A;  1FZU A;  3AGO A;  1I8V A;  1BRG A;  1GSP A;  5GSP A;  1GOU A; 
#chains in the Genus database with same CATH topology
 3Q90 A;  3I56 3;  1IT8 A;  2WGO A;  1QJG A;  1Q40 B;  2UUG C;  5M1A A;  3CXC 2;  1B2U A;  4FMD A;  3BLZ A;  3STD A;  4XBX A;  1GYB A;  3UJM A;  2GEX A;  1IV9 A;  1JV2 B;  5D81 A;  1RHL A;  3KKG A;  3QK9 A;  3TDG A;  1I2E A;  3DGL A;  1QAK A;  3MG2 A;  1VQ9 3;  1FUW A;  1C7H A;  1I2F A;  1I3F A;  1RLS A;  1BRS A;  2BMR B;  2SBL A;  4MMY B;  1HKX A;  1BRI A;  5M19 A;  1YIT 3;  4RNT A;  2HML B;  4FCM A;  4FCZ A;  2Y74 A;  1B2M A;  2K0M A;  4HZB B;  5FW5 A;  3D79 A;  2B1X B;  1OGX A;  1Q9E A;  3SX1 A;  2KF3 A;  3DXO A;  1PYL A;  2BO9 B;  1NU3 A;  1GD3 A;  3F8H A;  5AIH A;  1A2V A;  3Q2P A;  4R9K A;  2PZV A;  5IG3 A;  2FXT A;  1JB2 A;  3OV4 A;  4HYZ A;  1MNL A;  4N6M A;  5G1L A;  1RCK A;  1TFO A;  2CX0 A;  1K73 4;  4L8P A;  5IEP A;  1AR0 A;  3PGB A;  4N6N B;  4J9A A;  3RDE A;  1B2Z A;  2W0Q A;  3MHE A;  2O3O A;  1GD4 A;  1RRH A;  3OX9 A;  3MWZ A;  3JUN A;  4XBT A;  1BSD A;  5EVH A;  1J2B A;  1DMN A;  1AVK A;  1W6G A;  1ZS7 A;  3HI7 A;  3KCH A;  3ALA A;  3NX0 A;  4GSP A;  5IW9 A;  3EBT A;  3PXM A;  2Z6B A;  1W6C A;  1GMP A;  2CFL A;  1T5Y A;  5AIG A;  5AEW B;  3BIR A;  3M8C A;  3LYG A;  1Q82 4;  1O7H B;  2CFK A;  4AKY A;  2STD A;  1KC8 4;  4K1U A;  4NPB A;  2D42 A;  3CMA 3;  2OQE A;  5AI1 A;  2OWP A;  3G6E 3;  1WMO A;  3GZR A;  3MSO A;  3NM2 A;  4XM4 A;  1FGT A;  4MEI A;  3G16 A;  4CDL A;  1B20 A;  1JN5 A;  5D82 A;  1M1X B;  1BU4 A;  4EXR A;  3JUM A;  3DMC A;  3CCS 3;  3AGN A;  3T8U A;  1UW1 A;  3G4S 3;  1Q42 A;  4KT3 B;  3NQY A;  2CX1 A;  2XRX B;  1U8C B;  1B3S A;  2W2C A;  2Z77 A;  1I0X A;  2QGU A;  3T0U A;  5JBS A;  2P09 A;  1O7M B;  4XB5 A;  5AYR B;  1OGZ A;  2UX0 A;  2J8X B;  1Q40 A;  3BNE A;  4XDV A;  1OHO A;  1RGH A;  1W4N A;  4LEH A;  4QWT A;  5KP4 A;  1HYF A;  2PNC A;  4FMA A;  1W01 A;  2F5W A;  3D9R A;  3LTA A;  3CCE 3;  5IER A;  2CWT A;  1W7C A;  1BOX A;  2FNQ A;  2BU4 A;  2WOH A;  3FZW A;  2IUK A;  3V92 A;  3F9S A;  5D83 A;  3V98 A;  1NJI 4;  3WOD G;  3T8N A;  1RGG A;  1UI8 A;  1DE3 A;  2F56 A;  3X41 A;  1IQ8 A;  3EE1 A;  3LOY A;  4LGQ A;  2OOV A;  1L5G B;  2CH9 A;  4HJL B;  1LQG C;  4BU4 A;  4OVM A;  4RBN A;  2W04 A;  3CCU 3;  3LTD A;  3CCJ 3;  7GSP A;  1Z1S A;  3LT9 A;  3S27 A;  5IG5 A;  1F8N A;  1ZGX A;  5HOH A;  1JNQ A;  5FGO A;  5TGN A;  1FUT A;  3EF8 A;  4K61 A;  1D6Z A;  1MOL A;  3CNM A;  3UL6 A;  3K63 A;  4K90 B;  4O2H A;  5GSP A;  1GOU A;  5LC6 A;  3BU4 A;  5G1K A;  3K9M C;  3SVA A;  1IVX A;  5LC7 A;  1DVD A;  1OUN A;  4HOH A;  3BB9 A;  4HM5 B;  8RNT A;  1BNR A;  1DYU A;  1UUG B;  1NDO B;  4HVN A;  4EV5 A;  3JUP A;  2Q07 A;  3WHO A;  4FCJ A;  3GZX B;  5ELJ A;  1WMN A;  3I55 3;  2MC8 A;  1HU9 A;  5CK6 A;  4BL3 A;  3HIG A;  4HM6 B;  3WDG B;  1NWW A;  1N8R 4;  3FG4 A;  1VQM 3;  5CXO A;  3KFQ C;  3A76 A;  3KSP A;  4N3V A;  1GMQ A;  1RGE A;  1YGW A;  2F98 A;  1PY3 A;  3PCS A;  3DUK A;  3H3H A;  3X3X A;  4LSO A;  1M90 4;  3CD6 3;  3S5C A;  3GWR A;  2GEY A;  1FUS A;  4L7K A;  4LYL B;  4IIA A;  1T2I A;  1RKY A;  1IQY A;  1QMA A;  2KF4 A;  3A5E A;  1BGS A;  1E3R A;  2P0X A;  3ROB A;  2F5M A;  1RN7 A;  3HOH A;  3X40 A;  1BRH A;  3KSE D;  1A90 A;  1G96 A;  3NUV A;  1BNG A;  4GHO A;  3OW2 2;  2A15 A;  1LXE A;  3GSP A;  3UL5 A;  5STD A;  3RNT A;  2RFR A;  1JBR A;  3NBJ A;  4FMC A;  3UB1 A;  2W9P A;  5M18 A;  5A0O B;  5IEN A;  1N5P A;  1X1X A;  2KF6 A;  1UDI I;  4I4K A;  2P0M A;  3HII A;  3NV0 B;  4KZ1 A;  4G1M B;  3NQZ A;  1TRP A;  2IYJ A;  3QRD A;  4KFF A;  7RNT A;  5HGR A;  2JQ5 A;  1VZZ A;  2F99 A;  4HM0 B;  1NO3 A;  1ROV A;  3N9H A;  1MWR A;  1VQQ A;  1IV7 A;  1BAO A;  3LTC A;  4JRF A;  4O8S A;  2CW9 A;  1A67 A;  1IVW A;  3WR2 A;  2HMN B;  4H61 A;  1RNB A;  1RMS A;  3VF1 A;  4MMZ B;  2L1S A;  1RDS A;  3L0R A;  3PZW A;  2I9W A;  2XFT A;  1RJO A;  4CPK A;  1GY5 A;  2W6J H;  1DET A;  1WQL B;  3SLU A;  3X42 A;  1YI2 3;  9RNT A;  3D5I A;  4GL6 A;  1TU5 A;  1T2H A;  4N6U A;  1R4Y A;  1AY7 A;  1DMQ A;  3WA2 X;  1VQ7 3;  5RNT A;  1JBS A;  4HM3 B;  3CC2 3;  1KD1 4;  4BTY A;  2CKF B;  3FG1 A;  3F40 A;  1W5Z A;  1ZO2 A;  3BNB A;  1BRN L;  1BVI A;  4EC6 A;  2RSX A;  1RGA A;  1BNI A;  1V74 A;  3FF2 A;  1O7N B;  1FYS A;  3NXJ A;  1BRJ A;  3SOY A;  1EQK A;  3SYU A;  1RN1 A;  2ZDJ A;  3N54 B;  4LZI A;  1O7G B;  1BUQ A;  1IT7 A;  4HM8 B;  2M7O A;  1FGO A;  3DY5 A;  3OWY A;  3D4A A;  3LH4 A;  4FR9 A;  4WWU C;  3BNC A;  4IT7 A;  2CFW A;  1RN4 A;  4MJD A;  3PYJ A;  1RGC A;  3PS8 A;  3NBB A;  3G71 3;  1G0T A;  1K28 A;  1A2K A;  3FKA A;  4EBG A;  1AVL A;  5BU4 A;  1OAC A;  2GSP A;  2INX A;  2AAE A;  2P05 A;  4N6L A;  1FA3 A;  3FCS B;  1OF5 B;  1SQW A;  3UNL A;  1JZO A;  2F86 B;  3AGO A;  5I97 A;  1GSP A;  3F7X A;  1LRA A;  2IUJ A;  4EYC A;  3FSD A;  5BVB A;  1MWS A;  2OCT A;  2R4I A;  2CC3 A;  2RBI A;  3H51 A;  4WP5 A;  3U1W A;  2CWU A;  2XF3 A;  3URP A;  4BTX A;  4EV2 A;  4WFO A;  1W00 A;  5IF6 A;  1US1 A;  4J5K A;  3NV0 A;  1VQN 3;  1Q86 4;  1TFK A;  5AIF A;  3CC4 3;  1FGQ A;  3HZP A;  1UCL A;  1VQK 3;  5KP3 A;  4ILF A;  2AAD A;  3LZA A;  3ZFZ A;  3WOF B;  3D3L A;  4N6V 0;  2QEX 3;  4OUQ A;  4KFD A;  2GBW B;  3JVC A;  3BND A;  2W03 A;  5AYS C;  3SOA A;  5IG4 A;  2OTJ 3;  1LOX A;  4RNY A;  3DGM A;  3MG1 A;  5IEO A;  1RRL A;  1TJD A;  3CPW 2;  3G8Z A;  2F4Y A;  3LTB A;  4CJN A;  4WYK B;  1UUV B;  1VQL 3;  2HMM B;  1YGE A;  3EJV A;  4JF8 A;  2XGL A;  2CG0 A;  4XDW A;  4N6O B;  4O3V A;  1NB3 I;  3SXX A;  1FW7 A;  2WOF A;  3EQQ B;  3Q1C A;  2K3D A;  2LYX A;  1OH0 A;  3I0Y A;  1ROA A;  2HOH A;  2YFI B;  4J5G A;  4X2O A;  2XR8 B;  2XEP A;  3DGY A;  2E2V A;  2Z76 A;  1QVG 2;  1I2G A;  1W2B 2;  3AHW A;  3GZB A;  4MMX B;  2CIU A;  3RGR A;  1LQM B;  3JUO A;  1GY6 A;  2OQE C;  1PU4 A;  1TIJ A;  2R41 A;  5DRV A;  1YNV X;  2RNT A;  1ASK A;  2HMK B;  1UI7 A;  1IYY A;  2WO0 A;  3EB8 A;  1VQO 3;  3U97 A;  1CQS A;  1GOV A;  1MWU A;  1W2Z A;  1LNH A;  1OHP A;  1LOW A;  1ZX2 A;  2IY2 A;  3V99 A;  3B4O A;  1BSE A;  2Y73 A;  1W02 A;  1STD A;  2IA7 A;  1IVV A;  2E2T A;  1IQX A;  1B2X A;  2E2U A;  3D5G A;  2GBX B;  3OWS A;  3CC7 3;  2LQV A;  1BSC A;  1B21 A;  3CU3 A;  3SED A;  1K8A 4;  1JBT A;  1SPU A;  4RZM A;  1V58 A;  2BHM A;  1QAL A;  2BNG A;  5AEU B;  2RGQ A;  1BRK A;  1OF5 A;  2KAA A;  3OWU A;  2B24 B;  3DH2 A;  2CFG A;  4XBY A;  1M1K 4;  1MGW A;  2RCD A;  3EC9 A;  4FMB A;  1WTH A;  1O7P B;  3GAX A;  4R80 A;  4NRE A;  2XFS A;  4CCV A;  1QVF 2;  1VQ4 3;  5JPU A;  2MF7 A;  1OCV A;  2HMO B;  4K1V A;  1JKG B;  3DGO A;  8CHO A;  1Q81 4;  1RGF A;  1UGI A;  4R1K A;  5EEO A;  4AEQ A;  1S5A A;  2OOV C;  4RNZ A;  1VQ5 3;  3GZY B;  4KVH A;  5AII A;  4HM1 B;  2H0H A;  1RGK A;  2V1L A;  2BMQ B;  2YFJ B;  1AV4 A;  3HX8 A;  1IVU A;  3ECF A;  1EA2 A;  1OPY A;  3B7C A;  3ER7 A;  1E97 A;  3X3Y A;  1SIH A;  5IG0 A;  3LXU X;  1N9J A;  5DRE A;  2XSH B;  3AHS A;  4U13 A;  3K7C A;  2W9Q A;  2XH9 A;  4WYK A;  1NB5 I;  2C4B A;  4HBR A;  3NM7 A;  1D6Y A;  1W6Y A;  3B8L A;  1LVN A;  5ELU A;  6RNT A;  1KSI A;  3CME 3;  1BRG A;  3FGY A;  3PCR A;  4L8O A;  4X2H A;  7STD A;  1YVB I;  3JUQ A;  3CCR 3;  2UGI A;  1BNS A;  3MYT A;  2CK3 H;  3IPT A;  1YJW 3;  1Q7H A;  3MPH A;  2KF5 A;  3KII A;  3E99 A;  1M9G A;  1PFP A;  1TP6 A;  1VQP 3;  3AMO B;  3KZT A;  1I3I A;  1G02 A;  1FGM A;  4OK0 A;  1UCI A;  2H0I A;  1I0V A;  2ML5 A;  1BIR A;  1IDP A;  3K0Z A;  3ZG5 A;  1N5H A;  1EEJ A;  1RCL A;  1EUI C;  1VQ8 3;  1V57 A;  1JB5 A;  1YVS A;  1STF I;  2H0G A;  2CHC A;  1GY7 A;  2O9U X;  2W56 B;  2Z7A A;  3Q3F A;  2BIR A;  1JJ2 2;  3CCM 3;  3FLJ A;  3WOE B;  3FG3 A;  1SAR A;  2D1W A;  2JDI H;  1JRQ A;  2C10 A;  3NHX A;  3OXA A;  1D6U A;  1BNF A;  4HAA A;  1UCJ A;  1SJW A;  3S67 A;  2QIY A;  4LMI A;  3LML A;  1GOY A;  3EHC A;  3S29 A;  3VSY A;  6GSP A;  1Y4K A;  1CYV A;  5BIR A;  1YJN 3;  1IU7 A;  5G2G A;  1B27 A;  1BNJ A;  1CH0 A;  1R4C A;  2GXF A;  5KP1 A;  2ML6 A;  1LOY A;  1A2P A;  1GMR A;  1JKG A;  2HMJ B;  3X3Z A;  1LNI A;  2GU1 A;  4ORL A;  3CCQ 3;  1JZD A;  4HM4 B;  3CNX A;  3J7Y d;  4J8T A;  2CFD A;  3IJE B;  2IMJ A;  4HZ9 B;  5CF2 A;  1RTU A;  2KXG A;  1RNT A;  4BIR A;  1CYU A;  1C54 A;  5EQL A;  1HZ1 A;  2C11 A;  2ZL8 A;  1TRQ A;  1VQ6 3;  4STD A;  1KWI A;  4HM2 B;  1OHS A;  3K5T A;  3KN4 A;  3EX9 A;  3ZG0 A;  1MWT A;  1IK3 A;  1SII A;  6STD A;  3MKI A;  3CCL 3;  3EN8 A;  1X1Y A;  2CG1 A;  1I70 A;  4GB5 A;  2KCD A;  4EW5 A;  2QA4 3;  1YJ9 3;  1YHQ 3;  4O02 B;  1Q7Y 4;  2SAR A;  1DVC A;  1JB4 A;  3O8Y A;  3DZL A;  3DM8 A;  1BSB A;  3F14 A;  4IPB A;  4BL2 A;  1UGH I;  1U5O A;  1CEW I;  4H3U A;  4N6T A;  1AQZ A;  4NHF A;  2ZHX B;  2FGT A;  1O7W B;  1EG9 B;  3S28 A;  1TTO A;  1MGR A;  1N8Q A;  1WNH A;  4AKZ A;  2CWV A;  3FF0 A;  2P38 A;  1K9M 4;  1RGL A;  3VGN A;  1S72 3;  1N9E A;  5JPP A;  1EKM A;  3AMO A;  4HKV B;  1B2S A;  1LOV A;  2YX9 A;  4HM7 B;  3FH1 A;  3F8X A;  3IMA B;  1GS3 A;  3GRD A;  3LT8 A;  1ISK A;  1X1U A;  1BSA A;  1YIJ 3;  3CPO A;  3MG3 A;  2OTL 3;  4R4K A;  4WHA A;  1DMM A;  1FGR A;  1K41 A;  2BT3 A;  2BMO B;  2W56 A;  4PEJ A;  3CCV 3;  1BAN A;  1QAF A;  1ULJ B;  2L4V A;  4DKI A;  1BUJ A;  1WMP A;  2K54 A;  1ULI B;  2XSO B;  3DGN A;  3NBR A;  1RSN A;  5CLK A;  4BTW A;  2WGQ A;  1UUW B;  2XGN A;  2ZA4 A;  3EN1 B;  3B4P A;  4Q53 A;  2YFL B;  1X1W A;  4TX4 A;  3HK4 A;  5BXQ A;  1UCK A;  2KRT A;  1JN5 B;  1T3B A;  1BNE A;  1E3V A;  4I5Q A;  1KQS 2;  3F7S A;  2GU3 A;  1NNV A;  3EBY A;  1TUH A;  4R9L A;  3N8B A;  4KFE A;  1FZU A;  3KE7 A;  3RGA A;  5CF1 A;  1I8V A;  3WA3 A;  3WMD A;  3G0K A;  4ZM8 A; 
#chains in the Genus database with same CATH homology
 1LRA A;  3BU4 A;  1BNS A;  3URP A;  2RBI A;  2KF5 A;  1B2U A;  4HOH A;  8RNT A;  1BNR A;  1I3I A;  1G02 A;  4J5K A;  1UCI A;  1RHL A;  1I0V A;  1I2E A;  3WHO A;  1BIR A;  1I2F A;  1I3F A;  1RLS A;  1UCL A;  1BRS A;  1RCL A;  1YVS A;  1BRI A;  4RNT A;  2AAD A;  3Q3F A;  1B2M A;  2BIR A;  1SAR A;  1GMQ A;  1Q9E A;  1RGE A;  1YGW A;  1PY3 A;  2KF3 A;  1PYL A;  1BNF A;  4HAA A;  1UCJ A;  1GOY A;  2F4Y A;  6GSP A;  1FUS A;  5BIR A;  1T2I A;  1B27 A;  1RCK A;  1BNJ A;  1CH0 A;  1FW7 A;  2KF4 A;  4J5G A;  3A5E A;  1BGS A;  2HOH A;  2F5M A;  3HOH A;  1B2Z A;  1LOY A;  1A2P A;  1BRH A;  3DGY A;  1GMR A;  4GHO A;  1BNG A;  1I2G A;  1LNI A;  3AHW A;  3GSP A;  1BSD A;  3RNT A;  1JBR A;  4GSP A;  3KCH A;  1YNV X;  2RNT A;  1X1X A;  2KF6 A;  1IYY A;  1RTU A;  1RNT A;  4BIR A;  1C54 A;  1GMP A;  1TRP A;  1HZ1 A;  7RNT A;  3BIR A;  1GOV A;  1TRQ A;  1LOW A;  1BSE A;  1BAO A;  3D5G A;  1B2X A;  3WR2 A;  1X1Y A;  1RNB A;  1RMS A;  1BSC A;  1I70 A;  1B21 A;  1RDS A;  1JBT A;  1DET A;  1B20 A;  1BU4 A;  9RNT A;  3D5I A;  2SAR A;  1BRK A;  1BSB A;  3AGN A;  1T2H A;  2KAA A;  1R4Y A;  1AY7 A;  3DH2 A;  1MGW A;  5RNT A;  1JBS A;  1B3S A;  1I0X A;  1AQZ A;  1BRN L;  1BVI A;  1TTO A;  1MGR A;  1RGA A;  1BNI A;  1RGF A;  1RGH A;  1FYS A;  1RGL A;  1BRJ A;  1HYF A;  2F5W A;  3SYU A;  1B2S A;  1LOV A;  1RN1 A;  1BOX A;  2BU4 A;  1X1U A;  1BSA A;  1RGK A;  1BAN A;  1RGG A;  3D4A A;  1DE3 A;  2F56 A;  1BUJ A;  1RN4 A;  1RSN A;  4BU4 A;  2ZA4 A;  1RGC A;  1X1W A;  3AHS A;  7GSP A;  1UCK A;  5BU4 A;  1BNE A;  2GSP A;  2AAE A;  2C4B A;  1ZGX A;  5HOH A;  1FUT A;  6RNT A;  1FZU A;  3AGO A;  1I8V A;  1BRG A;  1GSP A;  5GSP A;  1GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...