1JBSA

Crystal structure of ribotoxin restrictocin and a 29-mer srd rna analog
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
149
structure length
149
Chain Sequence
ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords 29-mer sarcin/ricin domain RNA analog
publication title Crystal structures of restrictocin-inhibitor complexes with implications for RNA recognition and base flipping.
pubmed doi rcsb
total genus 36
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1jbsA00
1BNGA 2KF5A 1BOXA 1B2SA 1RTUA 1I70A 1RNTA 1GMPA 1CH0A 1HYFA 3URPA 1BSAA 4RNTA 3BU4A 3A5EA 1BSCA 1TRQA 2KF3A 1I2FA 1UCKA 3KCHA 1B21A 1TRPA 1RLSA 5HOHA 2KAAA 2F4YA 1I0XA 1FYSA 1YVSA 3Q3FA 4J5GA 1MGRA 1LRAA 1PY3A 1PYLA 1BANA 1UCIA 3HOHA 1JBTA 3RNTA 1BNSA 1JBRA 1BRGA 1RDSA 1DE3A 9RNTA 5RNTA 1RGKA 1X1YA 4HOHA 1BNEA 2GSPA 2SARA 1UCJA 1RGCA 1Q9EA 1TTOA 7RNTA 1RMSA 1RGEA 1IYYA 1B3SA 1BNRA 1BRIA 3AHWA 2C4BA 1RCLA 1G02A 1B2ZA 1B2UA 1BSEA 1RHLA 4HAAA 5BIRA 3WR2A 1B2XA 2F5WA 2F56A 1YGWA 2BU4A 1LOWA 5GSPA 1I0VA 2BIRA 7GSPA 1RGAA 1FUSA 1X1UA 1RGHA 1X1WA 2F5MA 1FW7A 2RNTA 1BVIA 1DETA 1GOYA 1FZUA 3BIRA 1LNIA 1RSNA 3DH2A 4BU4A 1BIRA 6RNTA 1GOVA 1BNFA 1GMQA 1LOVA 2KF4A 1BRSA 1MGWA 3AHSA 1T2HA 1A2PA 1UCLA 6GSPA 3SYUA 1RGFA 1HZ1A 8RNTA 1I2GA 1RGLA 5BU4A 1AQZA 4J5KA 1YNVX 2KF6A 1BSBA 1BU4A 1I3IA 1BSDA 1X1XA 1C54A 1RCKA 1BNJA 2HOHA 1R4YA 1I3FA 1AY7A 1BRKA 1RNBA 3WHOA 1BAOA 1B20A 1RN4A 1BRJA 1ZGXA 1LOYA 1RN1A 1RGGA 1BRHA 1GSPA 2AAEA 2ZA4A 3GSPA 4GHOA 4BIRA 2AADA 1FUTA 1B2MA 1I8VA 3AGOA 1SARA 3D5GA 4GSPA 1BRNL 1BNIA 1B27A 1I2EA 1BUJA 1JBSA 1BGSA 2RBIA 1T2IA 3D5IA 3AGNA 1GMRA 1GOUA 3DGYA 3D4AA
chains in the Genus database with same CATH superfamily
2CX1A 3FLJA 1K734 3F7XA 3H51A 5AEUB 2XEPA 3IJEB 5M19A 1Q814 1Q824 1GMPA 1CH0A 4FR9A 1A2VA 1OUNA 1US1A 3URPA 1BSAA 3RGAA 2OTJ3 3BU4A 3A5EA 1BSCA 1HKXA 1LOXA 2Z6BA 3G16A 1Q864 3CC73 1UCKA 3SLUA 1ROVA 1TRPA 5D83A 1E3VA 3T0UA 1KD14 3OWUA 3PXMA 2P05A 3ZG5A 1I0XA 1ZX2A 3F9SA 4J5GA 7STDA 1WMPA 1OGZA 1VQO3 2RCDA 4K1UA 5IG5A 2BHMA 3O8YA 5JPUA 1WQLB 3MG3A 4MEIA 1W6YA 1O7HB 5BVBA 1EA2A 1EEJA 2CHCA 1JBRA 3LOYA 4GL6A 2P38A 3UL6A 2QEX3 1BRGA 3IPTA 1D6ZA 1UGIA 1X1YA 2H0GA 3CPW2 3ECFA 5ELJA 1HU9A 4PEJA 4K61A 1A2KA 3GZRA 4XBYA 1LQMB 3D9RA 2E2TA 2RSXA 4RNZA 1RGCA 2W0QA 2LYXA 2HMOB 1TTOA 3DGNA 1NDOB 7RNTA 3DM8A 1QVF2 1RGEA 3UL5A 1M1K4 1B3SA 4BTXA 3DGOA 3NBBA 4N6OB 4MMYB 4R9KA 1G0TA 4BTYA 3CCJ3 3CCR3 3CC23 1IQ8A 3J7Yd 1UDII 1JN5A 2W9PA 5BIRA 3WR2A 2XF3A 3LMLA 4HM2B 4HYZA 4WFOA 4FMBA 2F56A 4LGQA 4XBTA 3BNBA 5LC6A 1QJGA 1W5ZA 1JV2B 4I5QA 1X1WA 2F5MA 3NM2A 4FMAA 3EF8A 1L5GB 3B4PA 3MG2A 1JJ22 2K0MA 3BIRA 4EW5A 5M1AA 3X41A 1BIRA 2K3DA 3BLZA 3NBRA 4OUQA 2P0MA 1Q40B 1LOVA 2QA43 1ZO2A 3HIIA 3NQYA 2UGIA 3FKAA 1U8CB 3JUMA 3F14A 2GBXB 1HZ1A 1RGLA 5BU4A 3FCSB 3NHXA 1YNVX 4KFFA 1X1XA 1TP6A 3K7CA 2WOHA 1C54A 1RCKA 3AMOB 2HMKB 1JKGB 3DGLA 4XDVA 1NB3I 1UUVB 2CKFB 2XSOB 3FF0A 1LQGC 5AIHA 1OH0A 3WOFB 1VQP3 5FW5A 3WHOA 1RNBA 1VQ53 2BMRB 3S29A 1TUHA 1LOYA 3DUKA 1DMMA 5HGRA 2AAEA 3LH4A 3JVCA 3U97A 1JRQA 2I9WA 3WODG 2E2UA 3T8UA 1OGXA 4GSPA 2P09A 3EJVA 3FSDA 4XDWA 3KIIA 3S67A 2CH9A 1YVBI 1BUJA 2XRXB 1T2IA 1OF5B 2CC3A 3B8LA 3I0YA 3JUPA 3L0RA 2WGOA 1UUWB 5BXQA 1O7GB 2XFSA 5IF6A 4MMXB 3X3ZA 1BNGA 2KF5A 2OCTA 1QMAA 2ZL8A 3DZLA 4KFEA 4EYCA 1RTUA 1RNTA 3LYGA 4LZIA 1RRLA 1AV4A 1GD4A 3H3HA 1E3RA 1HYFA 2D1WA 2Z7AA 2CFKA 2GU3A 4RNTA 3OWYA 3BNDA 1TRQA 3K63A 4AKZA 1IV9A 1LXEA 1W6GA 1I2FA 3KZTA 3K9MC 1C7HA 4N6LA 1MOLA 2XGLA 3KCHA 3T8NA 2W6JH 1RLSA 1S723 2CWUA 1CEWI 3JUQA 3LTBA 4N3VA 1K9M4 3WA2X 1FYSA 4BTWA 3Q3FA 4LYLB 1MGRA 1PYLA 1GY7A 2KRTA 1ULJB 3RNTA 2O9UX 2YFLB 4O02B 1VQN3 3CCU3 2Z76A 2IYJA 3N54B 5IW9A 4IIAA 4NPBA 3NV0A 4KVHA 1BNEA 3UJMA 1V57A 2O3OA 2SARA 1UCJA 1WMNA 2KCDA 3DMCA 3SOYA 1KQS2 1Q9EA 5IERA 4QWTA 4OK0A 1ASKA 1IVUA 1W7CA 2H0IA 3AHWA 2Y74A 1VQ63 1EQKA 2C4BA 4CPKA 2CFWA 1G02A 2WGQA 1B2ZA 1BSEA 1K8A4 3FG1A 1QVG2 3D3LA 4WYKB 3HZPA 5CLKA 3EC9A 1LNHA 2QIYA 1IQXA 4JRFA 3NBJA 4NREA 1DMQA 5KP1A 1W2ZA 4N6V0 4GB5A 1O7MB 1W6CA 2IUKA 1I0VA 1W4NA 1M1XB 2BIRA 7GSPA 3CMA3 3F8XA 2B24B 2J8XB 1UI7A 3DXOA 1NU3A 3GZXB 1IV7A 3CCV3 3K5TA 2WOFA 3V98A 2F98A 2OOVA 1FZUA 1LNIA 4EV2A 2Y73A 1YHQ3 3EBYA 1IVVA 3S28A 2OQEA 5IENA 1EG9B 1GMQA 1SIIA 2KF4A 1BUQA 1K41A 1BRSA 1IVWA 3QK9A 3NXJA 3CU3A 4R9LA 4HBRA 1IDPA 1SJWA 3X3XA 5TGNA 1UCLA 1KC84 1RGFA 3HK4A 3MSOA 3UNLA 3STDA 1ULIB 4O8SA 2BNGA 2KF6A 1I3IA 4ZM8A 1YJW3 1BNJA 2UUGC 3BNCA 3EB8A 4AKYA 1VQ83 5DREA 1RN7A 3PGBA 3FG4A 1DMNA 2OWPA 3ZFZA 2CIUA 2R41A 1NNVA 1QALA 1MWTA 2Q07A 3EN8A 4TX4A 3DY5A 3EN1B 4HM5B 1D6UA 4K1VA 1B2MA 2W2CA 3EBTA 1NJI4 1SARA 3GWRA 4BL3A 4WWUC 1VQ93 1BNIA 1ISKA 3G0KA 1I2EA 1NO3A 2CFDA 3RGRA 1IVXA 2RBIA 1PFPA 2W56A 1GYBA 3FGYA 1Q42A 5CK6A 2INXA 5G1KA 1N8QA 3ALAA 3D4AA 4HM0B 3D79A 4HM1B 1BOXA 5IG0A 1B2SA 3LT8A 1AVLA 1I70A 2KXGA 4RNYA 2BMOB 1FA3A 3ROBA 1WTHA 3LTAA 3B7CA 1JN5B 3VSYA 4R80A 3HX8A 1W02A 2IY2A 1V58A 2C11A 1IK3A 5EQLA 1JB5A 2CG0A 5A0OB 5AI1A 1O7WB 1IQYA 2MC8A 2CG1A 2HMNB 3WDGB 3JUOA 1FGRA 2BT3A 2F4YA 2BO9B 1AR0A 3IMAB 4G1MB 3DGMA 5EEOA 4DKIA 5D81A 1BANA 1W01A 2JQ5A 1N8R4 1JBTA 4IPBA 1OCVA 2C10A 4IT7A 4LEHA 3CCL3 1AVKA 1T5YA 3KSED 1DE3A 4KT3B 3WOEB 5RNTA 1RGKA 3MWZA 3VGNA 4HOHA 1Y4KA 1DVCA 2CX0A 1YJ93 1VQL3 5CF2A 1A90A 4OVMA 4HM8B 2FGTA 3GAXA 1TFOA 2ML5A 2ZDJA 1IYYA 4R4KA 3GZYB 5IEOA 1BRIA 1FGMA 4FMDA 3I553 3FH1A 1RCLA 2XH9A 1IT7A 5KP4A 1Q7Y4 1UGHI 4RZMA 4U13A 1YIJ3 1TIJA 4CCVA 1UW1A 2CFLA 4HAAA 5IEPA 3CCE3 2UX0A 1VQQA 2H0HA 3F7SA 2ZHXB 1RRHA 5IG4A 4ILFA 2GU1A 1W2B2 2E2VA 1YGWA 2WO0A 3NX0A 1LOWA 1T3BA 4HZ9B 1KSIA 1UI8A 4HM4B 2RFRA 3V99A 1X1UA 1RGHA 3KSPA 1DYUA 5G2GA 1FW7A 2RNTA 1A67A 1DETA 3LTCA 1FUWA 1JNQA 4CJNA 2L4VA 4L7KA 3DH2A 4R1KA 4BU4A 6RNTA 1YI23 3M8CA 1GOVA 3PYJA 4J8TA 3MKIA 5EVHA 1OHOA 2YX9A 5JPPA 5IG3A 3JUNA 2HMLB 3SVAA 1STFI 1T2HA 4H3UA 1A2PA 3OX9A 6GSPA 1EKMA 3SYUA 8RNTA 2GBWB 1I2GA 1ZS7A 2W04A 1AQZA 1RKYA 1SQWA 3NM7A 4N6MA 1BSDA 5CF1A 1VZZA 1D6YA 1RJOA 2XSHB 2PZVA 1R4YA 5I97A 1I3FA 1STDA 4K90B 3ER7A 1AY7A 4X2OA 2JDIH 2FXTA 1BAOA 3MG1A 1N5PA 3NUVA 4FCJA 1RN4A 1ZGXA 5DRVA 2HMJB 3EE1A 5AYSC 3OW22 1RN1A 5D82A 3SOAA 1BRHA 1GSPA 1MWRA 2ZA4A 3GSPA 3PCSA 2AADA 1FUTA 2LQVA 1PU4A 3CCM3 3E99A 3LZAA 1I8VA 5LC7A 3UB1A 1BRNL 3TDGA 3NV0B 4KFDA 2F86B 1KWIA 1VQ43 1FGTA 3N9HA 4HM7B 3VF1A 1JBSA 3I563 3PCRA 3G713 2P0XA 4NHFA 1GOUA 3B4OA 4XM4A 6STDA 3S5CA 1Q40A 2W03A 4O2HA 2XGNA 3HIGA 3KFQC 3PS8A 1M904 4J9AA 5AIFA 1WNHA 3HI7A 3S27A 1SIHA 3RDEA 1Q7HA 2QGUA 2PNCA 1E97A 1QAKA 1YJN3 2KF3A 2MF7A 3F40A 4N6UA 3F8HA 2CK3H 2SBLA 1EUIC 4HKVB 2HMMB 1B21A 3WMDA 1DVDA 5HOHA 1NB5I 3K0ZA 3AMOA 1JKGA 2KAAA 1Z1SA 3CCQ3 2CFGA 1MNLA 1OACA 4EV5A 3G6E3 4BL2A 2ML6A 2R4IA 1YVSA 1IT8A 4FMCA 4HM6B 4JF8A 1LRAA 1PY3A 1J2BA 2M7OA 1CYVA 3MYTA 1UCIA 2Z77A 3HOHA 1SPUA 2BMQB 4MMZB 1N9JA 5G1LA 4EC6A 1VQM3 1BNSA 4FCZA 2K54A 3X42A 1FGQA 3QRDA 4XBXA 3CPOA 1GS3A 1GY5A 1RDSA 3SX1A 1OPYA 3GRDA 5AEWB 4LSOA 1OHSA 2L1SA 9RNTA 1V74A 5AIGA 1JB4A 2GSPA 3G4S3 1OF5A 4HM3B 1UUGB 3Q90A 4Q53A 3CXC2 4I4KA 4L8OA 1FGOA 1ROAA 1TJDA 1O7NB 1YIT3 1RMSA 2OTL3 1BNRA 3CC43 2GEYA 4WP5A 4O3VA 1B2UA 1MWSA 1RHLA 3KE7A 4WHAA 2CW9A 1S5AA 4RBNA 3Q2PA 4HJLB 1O7PB 1N9EA 3KN4A 3EX9A 3EQQB 2B1XB 3N8BA 4XB5A 3GZBA 2IUJA 1VQK3 5M18A 1B2XA 2F5WA 3MPHA 4KZ1A 2BU4A 3CNMA 5FGOA 5GSPA 4CDLA 1VQ73 1RGAA 1FUSA 2F99A 2GEXA 2RGQA 1K28A 3A76A 3V92A 1BVIA 2W56B 1GOYA 2OOVC 1IU7A 1RSNA 1GD3A 4N6NB 1CQSA 1MWUA 1W00A 1GY6A 1TFKA 4AEQA 1BNFA 2OQEC 4MJDA 1YGEA 3OWSA 4EBGA 1CYUA 3BB9A 1MGWA 3OXAA 3X40A 1WMOA 3AHSA 3LXUX 3U1WA 4L8PA 8CHOA 3CD63 3SEDA 3FG3A 2IMJA 4J5KA 1BSBA 1BU4A 3BNEA 3FZWA 5AYRB 1U5OA 3LT9A 5KP3A 5STDA 2HOHA 2YFJB 3KKGA 5JBSA 2GXFA 3PZWA 1BRKA 3EHCA 1G96A 4HVNA 2FNQA 2A15A 3WA3A 2XR8B 3Q1CA 1QAFA 1B20A 3X3YA 4HZBB 1BRJA 4WYKA 1LVNA 5CXOA 1RGGA 3MHEA 2D42A 4GHOA 2W9QA 4BIRA 1N5HA 1R4CA 3ZG0A 5AIIA 1JZDA 1NWWA 2V1LA 2XFTA 3OV4A 2IA7A 2CWTA 3CCS3 1OHPA 3AGOA 3G8ZA 1M9GA 1F8NA 3CNXA 3D5GA 4H61A 4LMIA 1TU5A 2YFIB 2CWVA 1B27A 4ORLA 4X2HA 4STDA 3SXXA 3CME3 1JB2A 1BGSA 3NQZA 4N6TA 4EXRA 3LTDA 2STDA 5ELUA 3D5IA 3AGNA 1GMRA 3FF2A 1JZOA 3DGYA 4FCMA
chains in the Genus database with same CATH topology
1BNGA 2KF5A 1BOXA 1B2SA 1RTUA 1I70A 1RNTA 1GMPA 1CH0A 1HYFA 3URPA 1BSAA 4RNTA 3BU4A 3A5EA 1BSCA 1TRQA 2KF3A 1I2FA 1UCKA 3KCHA 1B21A 1TRPA 1RLSA 5HOHA 2KAAA 2F4YA 1I0XA 1FYSA 1YVSA 3Q3FA 4J5GA 1MGRA 1LRAA 1PY3A 1PYLA 1BANA 1UCIA 3HOHA 1JBTA 3RNTA 1BNSA 1JBRA 1BRGA 1RDSA 1DE3A 9RNTA 5RNTA 1RGKA 1X1YA 4HOHA 1BNEA 2GSPA 2SARA 1UCJA 1RGCA 1Q9EA 1TTOA 7RNTA 1RMSA 1RGEA 1IYYA 1B3SA 1BNRA 1BRIA 3AHWA 2C4BA 1RCLA 1G02A 1B2ZA 1B2UA 1BSEA 1RHLA 4HAAA 5BIRA 3WR2A 1B2XA 2F5WA 2F56A 1YGWA 2BU4A 1LOWA 5GSPA 1I0VA 2BIRA 7GSPA 1RGAA 1FUSA 1X1UA 1RGHA 1X1WA 2F5MA 1FW7A 2RNTA 1BVIA 1DETA 1GOYA 1FZUA 3BIRA 1LNIA 1RSNA 3DH2A 4BU4A 1BIRA 6RNTA 1GOVA 1BNFA 1GMQA 1LOVA 2KF4A 1BRSA 1MGWA 3AHSA 1T2HA 1A2PA 1UCLA 6GSPA 3SYUA 1RGFA 1HZ1A 8RNTA 1I2GA 1RGLA 5BU4A 1AQZA 4J5KA 1YNVX 2KF6A 1BSBA 1BU4A 1I3IA 1BSDA 1X1XA 1C54A 1RCKA 1BNJA 2HOHA 1R4YA 1I3FA 1AY7A 1BRKA 1RNBA 3WHOA 1BAOA 1B20A 1RN4A 1BRJA 1ZGXA 1LOYA 1RN1A 1RGGA 1BRHA 1GSPA 2AAEA 2ZA4A 3GSPA 4GHOA 4BIRA 2AADA 1FUTA 1B2MA 1I8VA 3AGOA 1SARA 3D5GA 4GSPA 1BRNL 1BNIA 1B27A 1I2EA 1BUJA 1JBSA 1BGSA 2RBIA 1T2IA 3D5IA 3AGNA 1GMRA 1GOUA 3DGYA 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNG A;  2KF5 A;  1BOX A;  1B2S A;  1RTU A;  1I70 A;  1RNT A;  1GMP A;  1CH0 A;  1HYF A;  3URP A;  1BSA A;  4RNT A;  3BU4 A;  3A5E A;  1BSC A;  1TRQ A;  2KF3 A;  1I2F A;  1UCK A;  3KCH A;  1B21 A;  1TRP A;  1RLS A;  5HOH A;  2KAA A;  2F4Y A;  1I0X A;  1FYS A;  1YVS A;  3Q3F A;  4J5G A;  1MGR A;  1LRA A;  1PY3 A;  1PYL A;  1BAN A;  1UCI A;  3HOH A;  1JBT A;  3RNT A;  1BNS A;  1JBR A;  1BRG A;  1RDS A;  1DE3 A;  9RNT A;  5RNT A;  1RGK A;  1X1Y A;  4HOH A;  1BNE A;  2GSP A;  2SAR A;  1UCJ A;  1RGC A;  1Q9E A;  1TTO A;  7RNT A;  1RMS A;  1RGE A;  1IYY A;  1B3S A;  1BNR A;  1BRI A;  3AHW A;  2C4B A;  1RCL A;  1G02 A;  1B2Z A;  1B2U A;  1BSE A;  1RHL A;  4HAA A;  5BIR A;  3WR2 A;  1B2X A;  2F5W A;  2F56 A;  1YGW A;  2BU4 A;  1LOW A;  5GSP A;  1I0V A;  2BIR A;  7GSP A;  1RGA A;  1FUS A;  1X1U A;  1RGH A;  1X1W A;  2F5M A;  1FW7 A;  2RNT A;  1BVI A;  1DET A;  1GOY A;  1FZU A;  3BIR A;  1LNI A;  1RSN A;  3DH2 A;  4BU4 A;  1BIR A;  6RNT A;  1GOV A;  1BNF A;  1GMQ A;  1LOV A;  2KF4 A;  1BRS A;  1MGW A;  3AHS A;  1T2H A;  1A2P A;  1UCL A;  6GSP A;  3SYU A;  1RGF A;  1HZ1 A;  8RNT A;  1I2G A;  1RGL A;  5BU4 A;  1AQZ A;  4J5K A;  1YNV X;  2KF6 A;  1BSB A;  1BU4 A;  1I3I A;  1BSD A;  1X1X A;  1C54 A;  1RCK A;  1BNJ A;  2HOH A;  1R4Y A;  1I3F A;  1AY7 A;  1BRK A;  1RNB A;  3WHO A;  1BAO A;  1B20 A;  1RN4 A;  1BRJ A;  1ZGX A;  1LOY A;  1RN1 A;  1RGG A;  1BRH A;  1GSP A;  2AAE A;  2ZA4 A;  3GSP A;  4GHO A;  4BIR A;  2AAD A;  1FUT A;  1B2M A;  1I8V A;  3AGO A;  1SAR A;  3D5G A;  4GSP A;  1BRN L;  1BNI A;  1B27 A;  1I2E A;  1BUJ A;  1JBS A;  1BGS A;  2RBI A;  1T2I A;  3D5I A;  3AGN A;  1GMR A;  1GOU A;  3DGY A;  3D4A A; 
#chains in the Genus database with same CATH topology
 2CX1 A;  3FLJ A;  1K73 4;  3F7X A;  3H51 A;  5AEU B;  2XEP A;  3IJE B;  5M19 A;  1Q81 4;  1Q82 4;  1GMP A;  1CH0 A;  4FR9 A;  1A2V A;  1OUN A;  1US1 A;  3URP A;  1BSA A;  3RGA A;  2OTJ 3;  3BU4 A;  3A5E A;  1BSC A;  1HKX A;  1LOX A;  2Z6B A;  3G16 A;  1Q86 4;  3CC7 3;  1UCK A;  3SLU A;  1ROV A;  1TRP A;  5D83 A;  1E3V A;  3T0U A;  1KD1 4;  3OWU A;  3PXM A;  2P05 A;  3ZG5 A;  1I0X A;  1ZX2 A;  3F9S A;  4J5G A;  7STD A;  1WMP A;  1OGZ A;  1VQO 3;  2RCD A;  4K1U A;  5IG5 A;  2BHM A;  3O8Y A;  5JPU A;  1WQL B;  3MG3 A;  4MEI A;  1W6Y A;  1O7H B;  5BVB A;  1EA2 A;  1EEJ A;  2CHC A;  1JBR A;  3LOY A;  4GL6 A;  2P38 A;  3UL6 A;  2QEX 3;  1BRG A;  3IPT A;  1D6Z A;  1UGI A;  1X1Y A;  2H0G A;  3CPW 2;  3ECF A;  5ELJ A;  1HU9 A;  4PEJ A;  4K61 A;  1A2K A;  3GZR A;  4XBY A;  1LQM B;  3D9R A;  2E2T A;  2RSX A;  4RNZ A;  1RGC A;  2W0Q A;  2LYX A;  2HMO B;  1TTO A;  3DGN A;  1NDO B;  7RNT A;  3DM8 A;  1QVF 2;  1RGE A;  3UL5 A;  1M1K 4;  1B3S A;  4BTX A;  3DGO A;  3NBB A;  4N6O B;  4MMY B;  4R9K A;  1G0T A;  4BTY A;  3CCJ 3;  3CCR 3;  3CC2 3;  1IQ8 A;  3J7Y d;  1UDI I;  1JN5 A;  2W9P A;  5BIR A;  3WR2 A;  2XF3 A;  3LML A;  4HM2 B;  4HYZ A;  4WFO A;  4FMB A;  2F56 A;  4LGQ A;  4XBT A;  3BNB A;  5LC6 A;  1QJG A;  1W5Z A;  1JV2 B;  4I5Q A;  1X1W A;  2F5M A;  3NM2 A;  4FMA A;  3EF8 A;  1L5G B;  3B4P A;  3MG2 A;  1JJ2 2;  2K0M A;  3BIR A;  4EW5 A;  5M1A A;  3X41 A;  1BIR A;  2K3D A;  3BLZ A;  3NBR A;  4OUQ A;  2P0M A;  1Q40 B;  1LOV A;  2QA4 3;  1ZO2 A;  3HII A;  3NQY A;  2UGI A;  3FKA A;  1U8C B;  3JUM A;  3F14 A;  2GBX B;  1HZ1 A;  1RGL A;  5BU4 A;  3FCS B;  3NHX A;  1YNV X;  4KFF A;  1X1X A;  1TP6 A;  3K7C A;  2WOH A;  1C54 A;  1RCK A;  3AMO B;  2HMK B;  1JKG B;  3DGL A;  4XDV A;  1NB3 I;  1UUV B;  2CKF B;  2XSO B;  3FF0 A;  1LQG C;  5AIH A;  1OH0 A;  3WOF B;  1VQP 3;  5FW5 A;  3WHO A;  1RNB A;  1VQ5 3;  2BMR B;  3S29 A;  1TUH A;  1LOY A;  3DUK A;  1DMM A;  5HGR A;  2AAE A;  3LH4 A;  3JVC A;  3U97 A;  1JRQ A;  2I9W A;  3WOD G;  2E2U A;  3T8U A;  1OGX A;  4GSP A;  2P09 A;  3EJV A;  3FSD A;  4XDW A;  3KII A;  3S67 A;  2CH9 A;  1YVB I;  1BUJ A;  2XRX B;  1T2I A;  1OF5 B;  2CC3 A;  3B8L A;  3I0Y A;  3JUP A;  3L0R A;  2WGO A;  1UUW B;  5BXQ A;  1O7G B;  2XFS A;  5IF6 A;  4MMX B;  3X3Z A;  1BNG A;  2KF5 A;  2OCT A;  1QMA A;  2ZL8 A;  3DZL A;  4KFE A;  4EYC A;  1RTU A;  1RNT A;  3LYG A;  4LZI A;  1RRL A;  1AV4 A;  1GD4 A;  3H3H A;  1E3R A;  1HYF A;  2D1W A;  2Z7A A;  2CFK A;  2GU3 A;  4RNT A;  3OWY A;  3BND A;  1TRQ A;  3K63 A;  4AKZ A;  1IV9 A;  1LXE A;  1W6G A;  1I2F A;  3KZT A;  3K9M C;  1C7H A;  4N6L A;  1MOL A;  2XGL A;  3KCH A;  3T8N A;  2W6J H;  1RLS A;  1S72 3;  2CWU A;  1CEW I;  3JUQ A;  3LTB A;  4N3V A;  1K9M 4;  3WA2 X;  1FYS A;  4BTW A;  3Q3F A;  4LYL B;  1MGR A;  1PYL A;  1GY7 A;  2KRT A;  1ULJ B;  3RNT A;  2O9U X;  2YFL B;  4O02 B;  1VQN 3;  3CCU 3;  2Z76 A;  2IYJ A;  3N54 B;  5IW9 A;  4IIA A;  4NPB A;  3NV0 A;  4KVH A;  1BNE A;  3UJM A;  1V57 A;  2O3O A;  2SAR A;  1UCJ A;  1WMN A;  2KCD A;  3DMC A;  3SOY A;  1KQS 2;  1Q9E A;  5IER A;  4QWT A;  4OK0 A;  1ASK A;  1IVU A;  1W7C A;  2H0I A;  3AHW A;  2Y74 A;  1VQ6 3;  1EQK A;  2C4B A;  4CPK A;  2CFW A;  1G02 A;  2WGQ A;  1B2Z A;  1BSE A;  1K8A 4;  3FG1 A;  1QVG 2;  3D3L A;  4WYK B;  3HZP A;  5CLK A;  3EC9 A;  1LNH A;  2QIY A;  1IQX A;  4JRF A;  3NBJ A;  4NRE A;  1DMQ A;  5KP1 A;  1W2Z A;  4N6V 0;  4GB5 A;  1O7M B;  1W6C A;  2IUK A;  1I0V A;  1W4N A;  1M1X B;  2BIR A;  7GSP A;  3CMA 3;  3F8X A;  2B24 B;  2J8X B;  1UI7 A;  3DXO A;  1NU3 A;  3GZX B;  1IV7 A;  3CCV 3;  3K5T A;  2WOF A;  3V98 A;  2F98 A;  2OOV A;  1FZU A;  1LNI A;  4EV2 A;  2Y73 A;  1YHQ 3;  3EBY A;  1IVV A;  3S28 A;  2OQE A;  5IEN A;  1EG9 B;  1GMQ A;  1SII A;  2KF4 A;  1BUQ A;  1K41 A;  1BRS A;  1IVW A;  3QK9 A;  3NXJ A;  3CU3 A;  4R9L A;  4HBR A;  1IDP A;  1SJW A;  3X3X A;  5TGN A;  1UCL A;  1KC8 4;  1RGF A;  3HK4 A;  3MSO A;  3UNL A;  3STD A;  1ULI B;  4O8S A;  2BNG A;  2KF6 A;  1I3I A;  4ZM8 A;  1YJW 3;  1BNJ A;  2UUG C;  3BNC A;  3EB8 A;  4AKY A;  1VQ8 3;  5DRE A;  1RN7 A;  3PGB A;  3FG4 A;  1DMN A;  2OWP A;  3ZFZ A;  2CIU A;  2R41 A;  1NNV A;  1QAL A;  1MWT A;  2Q07 A;  3EN8 A;  4TX4 A;  3DY5 A;  3EN1 B;  4HM5 B;  1D6U A;  4K1V A;  1B2M A;  2W2C A;  3EBT A;  1NJI 4;  1SAR A;  3GWR A;  4BL3 A;  4WWU C;  1VQ9 3;  1BNI A;  1ISK A;  3G0K A;  1I2E A;  1NO3 A;  2CFD A;  3RGR A;  1IVX A;  2RBI A;  1PFP A;  2W56 A;  1GYB A;  3FGY A;  1Q42 A;  5CK6 A;  2INX A;  5G1K A;  1N8Q A;  3ALA A;  3D4A A;  4HM0 B;  3D79 A;  4HM1 B;  1BOX A;  5IG0 A;  1B2S A;  3LT8 A;  1AVL A;  1I70 A;  2KXG A;  4RNY A;  2BMO B;  1FA3 A;  3ROB A;  1WTH A;  3LTA A;  3B7C A;  1JN5 B;  3VSY A;  4R80 A;  3HX8 A;  1W02 A;  2IY2 A;  1V58 A;  2C11 A;  1IK3 A;  5EQL A;  1JB5 A;  2CG0 A;  5A0O B;  5AI1 A;  1O7W B;  1IQY A;  2MC8 A;  2CG1 A;  2HMN B;  3WDG B;  3JUO A;  1FGR A;  2BT3 A;  2F4Y A;  2BO9 B;  1AR0 A;  3IMA B;  4G1M B;  3DGM A;  5EEO A;  4DKI A;  5D81 A;  1BAN A;  1W01 A;  2JQ5 A;  1N8R 4;  1JBT A;  4IPB A;  1OCV A;  2C10 A;  4IT7 A;  4LEH A;  3CCL 3;  1AVK A;  1T5Y A;  3KSE D;  1DE3 A;  4KT3 B;  3WOE B;  5RNT A;  1RGK A;  3MWZ A;  3VGN A;  4HOH A;  1Y4K A;  1DVC A;  2CX0 A;  1YJ9 3;  1VQL 3;  5CF2 A;  1A90 A;  4OVM A;  4HM8 B;  2FGT A;  3GAX A;  1TFO A;  2ML5 A;  2ZDJ A;  1IYY A;  4R4K A;  3GZY B;  5IEO A;  1BRI A;  1FGM A;  4FMD A;  3I55 3;  3FH1 A;  1RCL A;  2XH9 A;  1IT7 A;  5KP4 A;  1Q7Y 4;  1UGH I;  4RZM A;  4U13 A;  1YIJ 3;  1TIJ A;  4CCV A;  1UW1 A;  2CFL A;  4HAA A;  5IEP A;  3CCE 3;  2UX0 A;  1VQQ A;  2H0H A;  3F7S A;  2ZHX B;  1RRH A;  5IG4 A;  4ILF A;  2GU1 A;  1W2B 2;  2E2V A;  1YGW A;  2WO0 A;  3NX0 A;  1LOW A;  1T3B A;  4HZ9 B;  1KSI A;  1UI8 A;  4HM4 B;  2RFR A;  3V99 A;  1X1U A;  1RGH A;  3KSP A;  1DYU A;  5G2G A;  1FW7 A;  2RNT A;  1A67 A;  1DET A;  3LTC A;  1FUW A;  1JNQ A;  4CJN A;  2L4V A;  4L7K A;  3DH2 A;  4R1K A;  4BU4 A;  6RNT A;  1YI2 3;  3M8C A;  1GOV A;  3PYJ A;  4J8T A;  3MKI A;  5EVH A;  1OHO A;  2YX9 A;  5JPP A;  5IG3 A;  3JUN A;  2HML B;  3SVA A;  1STF I;  1T2H A;  4H3U A;  1A2P A;  3OX9 A;  6GSP A;  1EKM A;  3SYU A;  8RNT A;  2GBW B;  1I2G A;  1ZS7 A;  2W04 A;  1AQZ A;  1RKY A;  1SQW A;  3NM7 A;  4N6M A;  1BSD A;  5CF1 A;  1VZZ A;  1D6Y A;  1RJO A;  2XSH B;  2PZV A;  1R4Y A;  5I97 A;  1I3F A;  1STD A;  4K90 B;  3ER7 A;  1AY7 A;  4X2O A;  2JDI H;  2FXT A;  1BAO A;  3MG1 A;  1N5P A;  3NUV A;  4FCJ A;  1RN4 A;  1ZGX A;  5DRV A;  2HMJ B;  3EE1 A;  5AYS C;  3OW2 2;  1RN1 A;  5D82 A;  3SOA A;  1BRH A;  1GSP A;  1MWR A;  2ZA4 A;  3GSP A;  3PCS A;  2AAD A;  1FUT A;  2LQV A;  1PU4 A;  3CCM 3;  3E99 A;  3LZA A;  1I8V A;  5LC7 A;  3UB1 A;  1BRN L;  3TDG A;  3NV0 B;  4KFD A;  2F86 B;  1KWI A;  1VQ4 3;  1FGT A;  3N9H A;  4HM7 B;  3VF1 A;  1JBS A;  3I56 3;  3PCR A;  3G71 3;  2P0X A;  4NHF A;  1GOU A;  3B4O A;  4XM4 A;  6STD A;  3S5C A;  1Q40 A;  2W03 A;  4O2H A;  2XGN A;  3HIG A;  3KFQ C;  3PS8 A;  1M90 4;  4J9A A;  5AIF A;  1WNH A;  3HI7 A;  3S27 A;  1SIH A;  3RDE A;  1Q7H A;  2QGU A;  2PNC A;  1E97 A;  1QAK A;  1YJN 3;  2KF3 A;  2MF7 A;  3F40 A;  4N6U A;  3F8H A;  2CK3 H;  2SBL A;  1EUI C;  4HKV B;  2HMM B;  1B21 A;  3WMD A;  1DVD A;  5HOH A;  1NB5 I;  3K0Z A;  3AMO A;  1JKG A;  2KAA A;  1Z1S A;  3CCQ 3;  2CFG A;  1MNL A;  1OAC A;  4EV5 A;  3G6E 3;  4BL2 A;  2ML6 A;  2R4I A;  1YVS A;  1IT8 A;  4FMC A;  4HM6 B;  4JF8 A;  1LRA A;  1PY3 A;  1J2B A;  2M7O A;  1CYV A;  3MYT A;  1UCI A;  2Z77 A;  3HOH A;  1SPU A;  2BMQ B;  4MMZ B;  1N9J A;  5G1L A;  4EC6 A;  1VQM 3;  1BNS A;  4FCZ A;  2K54 A;  3X42 A;  1FGQ A;  3QRD A;  4XBX A;  3CPO A;  1GS3 A;  1GY5 A;  1RDS A;  3SX1 A;  1OPY A;  3GRD A;  5AEW B;  4LSO A;  1OHS A;  2L1S A;  9RNT A;  1V74 A;  5AIG A;  1JB4 A;  2GSP A;  3G4S 3;  1OF5 A;  4HM3 B;  1UUG B;  3Q90 A;  4Q53 A;  3CXC 2;  4I4K A;  4L8O A;  1FGO A;  1ROA A;  1TJD A;  1O7N B;  1YIT 3;  1RMS A;  2OTL 3;  1BNR A;  3CC4 3;  2GEY A;  4WP5 A;  4O3V A;  1B2U A;  1MWS A;  1RHL A;  3KE7 A;  4WHA A;  2CW9 A;  1S5A A;  4RBN A;  3Q2P A;  4HJL B;  1O7P B;  1N9E A;  3KN4 A;  3EX9 A;  3EQQ B;  2B1X B;  3N8B A;  4XB5 A;  3GZB A;  2IUJ A;  1VQK 3;  5M18 A;  1B2X A;  2F5W A;  3MPH A;  4KZ1 A;  2BU4 A;  3CNM A;  5FGO A;  5GSP A;  4CDL A;  1VQ7 3;  1RGA A;  1FUS A;  2F99 A;  2GEX A;  2RGQ A;  1K28 A;  3A76 A;  3V92 A;  1BVI A;  2W56 B;  1GOY A;  2OOV C;  1IU7 A;  1RSN A;  1GD3 A;  4N6N B;  1CQS A;  1MWU A;  1W00 A;  1GY6 A;  1TFK A;  4AEQ A;  1BNF A;  2OQE C;  4MJD A;  1YGE A;  3OWS A;  4EBG A;  1CYU A;  3BB9 A;  1MGW A;  3OXA A;  3X40 A;  1WMO A;  3AHS A;  3LXU X;  3U1W A;  4L8P A;  8CHO A;  3CD6 3;  3SED A;  3FG3 A;  2IMJ A;  4J5K A;  1BSB A;  1BU4 A;  3BNE A;  3FZW A;  5AYR B;  1U5O A;  3LT9 A;  5KP3 A;  5STD A;  2HOH A;  2YFJ B;  3KKG A;  5JBS A;  2GXF A;  3PZW A;  1BRK A;  3EHC A;  1G96 A;  4HVN A;  2FNQ A;  2A15 A;  3WA3 A;  2XR8 B;  3Q1C A;  1QAF A;  1B20 A;  3X3Y A;  4HZB B;  1BRJ A;  4WYK A;  1LVN A;  5CXO A;  1RGG A;  3MHE A;  2D42 A;  4GHO A;  2W9Q A;  4BIR A;  1N5H A;  1R4C A;  3ZG0 A;  5AII A;  1JZD A;  1NWW A;  2V1L A;  2XFT A;  3OV4 A;  2IA7 A;  2CWT A;  3CCS 3;  1OHP A;  3AGO A;  3G8Z A;  1M9G A;  1F8N A;  3CNX A;  3D5G A;  4H61 A;  4LMI A;  1TU5 A;  2YFI B;  2CWV A;  1B27 A;  4ORL A;  4X2H A;  4STD A;  3SXX A;  3CME 3;  1JB2 A;  1BGS A;  3NQZ A;  4N6T A;  4EXR A;  3LTD A;  2STD A;  5ELU A;  3D5I A;  3AGN A;  1GMR A;  3FF2 A;  1JZO A;  3DGY A;  4FCM A; 
#chains in the Genus database with same CATH homology
 1BNG A;  2KF5 A;  1BOX A;  1B2S A;  1RTU A;  1I70 A;  1RNT A;  1GMP A;  1CH0 A;  1HYF A;  3URP A;  1BSA A;  4RNT A;  3BU4 A;  3A5E A;  1BSC A;  1TRQ A;  2KF3 A;  1I2F A;  1UCK A;  3KCH A;  1B21 A;  1TRP A;  1RLS A;  5HOH A;  2KAA A;  2F4Y A;  1I0X A;  1FYS A;  1YVS A;  3Q3F A;  4J5G A;  1MGR A;  1LRA A;  1PY3 A;  1PYL A;  1BAN A;  1UCI A;  3HOH A;  1JBT A;  3RNT A;  1BNS A;  1JBR A;  1BRG A;  1RDS A;  1DE3 A;  9RNT A;  5RNT A;  1RGK A;  1X1Y A;  4HOH A;  1BNE A;  2GSP A;  2SAR A;  1UCJ A;  1RGC A;  1Q9E A;  1TTO A;  7RNT A;  1RMS A;  1RGE A;  1IYY A;  1B3S A;  1BNR A;  1BRI A;  3AHW A;  2C4B A;  1RCL A;  1G02 A;  1B2Z A;  1B2U A;  1BSE A;  1RHL A;  4HAA A;  5BIR A;  3WR2 A;  1B2X A;  2F5W A;  2F56 A;  1YGW A;  2BU4 A;  1LOW A;  5GSP A;  1I0V A;  2BIR A;  7GSP A;  1RGA A;  1FUS A;  1X1U A;  1RGH A;  1X1W A;  2F5M A;  1FW7 A;  2RNT A;  1BVI A;  1DET A;  1GOY A;  1FZU A;  3BIR A;  1LNI A;  1RSN A;  3DH2 A;  4BU4 A;  1BIR A;  6RNT A;  1GOV A;  1BNF A;  1GMQ A;  1LOV A;  2KF4 A;  1BRS A;  1MGW A;  3AHS A;  1T2H A;  1A2P A;  1UCL A;  6GSP A;  3SYU A;  1RGF A;  1HZ1 A;  8RNT A;  1I2G A;  1RGL A;  5BU4 A;  1AQZ A;  4J5K A;  1YNV X;  2KF6 A;  1BSB A;  1BU4 A;  1I3I A;  1BSD A;  1X1X A;  1C54 A;  1RCK A;  1BNJ A;  2HOH A;  1R4Y A;  1I3F A;  1AY7 A;  1BRK A;  1RNB A;  3WHO A;  1BAO A;  1B20 A;  1RN4 A;  1BRJ A;  1ZGX A;  1LOY A;  1RN1 A;  1RGG A;  1BRH A;  1GSP A;  2AAE A;  2ZA4 A;  3GSP A;  4GHO A;  4BIR A;  2AAD A;  1FUT A;  1B2M A;  1I8V A;  3AGO A;  1SAR A;  3D5G A;  4GSP A;  1BRN L;  1BNI A;  1B27 A;  1I2E A;  1BUJ A;  1JBS A;  1BGS A;  2RBI A;  1T2I A;  3D5I A;  3AGN A;  1GMR A;  1GOU A;  3DGY A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...