1TTOA

Crystal structure of the rnase t1 variant r2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHEFRNWNGFDFSVSSPYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNase T1
publication title Purine activity of RNase T1RV is further improved by substitution of Trp59 by tyrosine
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ttoA00
1Q9EA 1RGFA 1RMSA 3KCHA 1TRQA 1DETA 1I3IA 1TRPA 3WHOA 1RGHA 1YNVX 4J5GA 1JBRA 1RGEA 1LRAA 1GOYA 7GSPA 1BSEA 1BIRA 1I2FA 1BRNL 1FUTA 1GMPA 1LOVA 2AAEA 2GSPA 1RSNA 1I70A 1X1WA 1I8VA 3URPA 1B2SA 1RTUA 1PY3A 1G02A 9RNTA 2AADA 5RNTA 1MGRA 1X1XA 5HOHA 1RN1A 2KF5A 3SYUA 1IYYA 1BRKA 1BSBA 3AHWA 1GMRA 1SARA 1YGWA 3A5EA 1DE3A 3RNTA 3D4AA 1BRHA 2F5MA 1A2PA 1HYFA 1RNTA 1HZ1A 1B2XA 1BNEA 1MGWA 1RCLA 2BU4A 1BRIA 3AHSA 4BU4A 2HOHA 4GHOA 1RGAA 1BRGA 1GOVA 1GMQA 1YVSA 2F4YA 3BU4A 1T2HA 4HAAA 3GSPA 1UCIA 1T2IA 3DH2A 1BRJA 1FUSA 1AQZA 2F56A 1PYLA 1BNJA 1RLSA 1TTOA 2RNTA 1LOYA 1BOXA 2C4BA 1JBTA 5BIRA 1I2GA 2KF4A 1BNIA 3Q3FA 4HOHA 1FZUA 1RDSA 1X1UA 1BU4A 4RNTA 1BUJA 1GOUA 1X1YA 5GSPA 2KF3A 1GSPA 1LOWA 1LNIA 3D5IA 3DGYA 1RGKA 1RCKA 1UCJA 4GSPA 1BNFA 1I3FA 1BNRA 1B2ZA 1I2EA 1BVIA 1BSCA 1BGSA 3AGOA 5BU4A 1B20A 3D5GA 1B3SA 2KF6A 1RGCA 1BAOA 1I0XA 1ZGXA 1C54A 2ZA4A 4BIRA 1JBSA 3HOHA 1BNSA 1FYSA 8RNTA 2BIRA 1I0VA 1B2UA 1UCKA 1BRSA 1RGGA 1RGLA 1RNBA 2RBIA 1AY7A 1RN4A 2F5WA 1BANA 1UCLA 2KAAA 1R4YA 3AGNA 1CH0A 1B2MA 1RHLA 1B21A 1FW7A 1B27A 3BIRA 7RNTA 6RNTA 1BSAA 2SARA 1BNGA 4J5KA 1BSDA 6GSPA 3WR2A
chains in the Genus database with same CATH superfamily
1JB2A 4JRFA 4WYKA 4N6OB 1E3VA 4STDA 3CCU3 3FG1A 1VQM3 2L4VA 5BXQA 4LEHA 5G1LA 2CX0A 1DYUA 3T0UA 2LQVA 1NB3I 1RRHA 3D79A 1NO3A 2OTL3 1JNQA 3EQQB 4KZ1A 1YNVX 1G96A 3GZRA 1QAKA 3BNEA 1DMQA 5JPUA 1LNHA 4FCJA 1KWIA 1V57A 3S67A 2GSPA 3NV0B 2FNQA 1N8R4 3DGLA 4NPBA 2CFDA 3FSDA 3LT9A 3GRDA 3ZFZA 5IG3A 3URPA 5EQLA 5LC6A 4HM8B 1UUVB 3F40A 1MGRA 1VQ83 3H3HA 3CC23 2MC8A 3ALAA 2H0HA 3BNDA 1HU9A 2PNCA 3PCSA 3T8NA 3WA2X 3DGNA 3AHWA 3LXUX 1WTHA 3A5EA 3B8LA 3X3YA 4N6NB 5IEPA 5DREA 1ROVA 4K1UA 5I97A 3FH1A 1A2PA 3UL6A 3KE7A 1RNTA 1O7PB 1B2XA 1OHOA 3F8HA 3HI7A 4X2OA 3F9SA 3KSPA 1RGAA 1RJOA 1GOVA 1JKGA 4R1KA 4EXRA 2HMKB 2F4YA 3SX1A 1PU4A 2I9WA 3EBYA 4HZBB 2ZL8A 3QRDA 1ZS7A 5IEOA 2KRTA 1FUSA 3NQYA 5IG4A 1LQMB 4ORLA 1WNHA 1PYLA 1O7NB 1QJGA 1TTOA 3LZAA 1FA3A 2XGNA 2CG0A 1VZZA 2GBXB 3PCRA 5BIRA 1I2GA 1CEWI 4HOHA 4Q53A 4O3VA 1FZUA 3U1WA 2IA7A 1W01A 3OX9A 1D6UA 3BLZA 4EYCA 2GXFA 3JUNA 3J7Yd 2KF3A 1YJ93 3B4OA 4R4KA 1LOWA 1UDII 3S5CA 1VQ53 3DGOA 1VQP3 4FMDA 1NDOB 3HZPA 2P0XA 2P05A 2P0MA 3FKAA 3EE1A 2C11A 3MKIA 4LMIA 5D82A 1OHPA 3HIIA 3OWSA 2O9UX 4OVMA 1Q7HA 2IUJA 3LTAA 3O8YA 3JUQA 1UUGB 2CHCA 1BVIA 1Q40B 1W6YA 3NBBA 4L7KA 3E99A 4CCVA 3WA3A 3B7CA 1B20A 1KD14 2CWVA 1BAOA 4HVNA 1C54A 1MWUA 4CJNA 2CX1A 4GL6A 2ZA4A 4BIRA 6STDA 2WGQA 1L5GB 3WODG 5STDA 8RNTA 2OTJ3 3NBJA 1NNVA 3S27A 2C10A 3FCSB 1OGXA 4RNZA 3CC73 1SJWA 1EG9B 3CMA3 4EBGA 1Q824 1DVCA 1FGMA 1LQGC 2IMJA 3RGAA 1VQ93 4HBRA 2OQEA 4I4KA 5JPPA 3K5TA 3VSYA 4O2HA 3AGNA 3GZBA 1RN7A 1F8NA 4BL3A 3CCL3 4N6V0 1N5PA 3NV0A 1B27A 7RNTA 1JN5B 2CWTA 3BNBA 1BSAA 1ASKA 4QWTA 3V92A 1Q9EA 2FGTA 8CHOA 1YHQ3 5CK6A 1Y4KA 1LVNA 1W02A 3Q1CA 2W56B 5CLKA 3X3XA 1RGFA 2XR8B 2ZHXB 3FLJA 5A0OB 1OACA 1TRQA 1I3IA 3N54B 5KP4A 1CQSA 1IQYA 5FW5A 3DM8A 3KZTA 3NHXA 5M1AA 1K9M4 3HX8A 1RGEA 1JBRA 1GOYA 1BIRA 3NM7A 1I2FA 4KFEA 1FUTA 4KFDA 3ROBA 2AAEA 5AIHA 2CFWA 1J2BA 1X1WA 4CDLA 4HM3B 3AMOB 5BVBA 3KFQC 4EV2A 3OWUA 1S5AA 1PY3A 1G02A 3ECFA 4O02B 1UGIA 3CCV3 3CPW2 4LYLB 3WOFB 5LC7A 2KF5A 3CNMA 2V1LA 4RZMA 3M8CA 1BRKA 1BSBA 3G6E3 3OXAA 3NBRA 1GD4A 1SARA 1U5OA 1YGWA 2P38A 5AIIA 3RNTA 1VQK3 4AKZA 1DMNA 2F5MA 4N3VA 5CXOA 5DRVA 3SOYA 5TGNA 4EC6A 2BU4A 1W5ZA 3EHCA 3GZYB 2BHMA 4BU4A 2W9PA 2CFLA 2XGLA 4O8SA 1BRGA 1G0TA 2RGQA 4JF8A 1JV2B 2CKFB 2JQ5A 3EC9A 3EN1B 1YVSA 4K1VA 2HMOB 5AYSC 2CC3A 1N9EA 2W9QA 3BU4A 2YX9A 4K90B 3KN4A 1EUIC 1QAFA 3DH2A 4L8OA 2B1XB 1Q40A 3SOAA 1GY5A 2GEXA 2L1SA 3KIIA 2RNTA 4FMBA 1A2KA 4H3UA 4FMCA 1KSIA 2W2CA 3JUPA 1O7GB 1RDSA 5IENA 2ML5A 4HM2B 2GEYA 3I553 1AR0A 1O7MB 1QALA 4HM0B 4HM4B 1GOUA 5IW9A 3G713 2R4IA 5GSPA 3CCQ3 2CW9A 1MWSA 2RFRA 2CG1A 2M7OA 4HM1B 1IK3A 5G2GA 2QEX3 3D5IA 1EQKA 3FF0A 3MWZA 4AKYA 1ZO2A 4N6LA 3NUVA 1BNRA 1TFKA 2CH9A 2UUGC 4FMAA 1BSCA 2W6JH 1AVLA 4XBXA 1CYUA 1YI23 1B3SA 1RGCA 1FGTA 3KKGA 1VQN3 1IV9A 1JN5A 2OOVA 1TFOA 5JBSA 1BNSA 1FYSA 3MHEA 1KC84 1V58A 1IQ8A 5IERA 1RGGA 1T5YA 5AYRB 2W56A 1VQ43 1UGHI 1NJI4 3VF1A 2F98A 1RGLA 3FG4A 5FGOA 2F86B 1RNBA 3GZXB 2RBIA 1AY7A 1RN4A 5G1KA 1DVDA 1OF5B 1R4YA 2XEPA 2WOFA 1B2MA 1Q814 3F8XA 3PS8A 1YVBI 4LSOA 1QMAA 3D9RA 3I563 6RNTA 3CCM3 3CCS3 3U97A 1BNGA 3AMOA 3WOEB 4HM6B 1BSDA 4HZ9B 1WMOA 1YIT3 1HKXA 1IVVA 3DXOA 5HGRA 5CF1A 1M1K4 3CC43 3S28A 3H51A 2ML6A 1K28A 1RMSA 3KCHA 1FUWA 1DETA 4FCZA 2OCTA 3ZG5A 4H61A 1D6ZA 3MG1A 4NREA 1W6GA 1NWWA 4XB5A 1LRAA 1BSEA 2IUKA 2O3OA 7STDA 1BRNL 1SIHA 2INXA 4KVHA 4G1MB 1LOVA 3FG3A 4N6UA 2ZDJA 1AV4A 3Q2PA 2WGOA 1IVWA 1RSNA 1SQWA 1I8VA 4L8PA 3DGMA 3G16A 1A2VA 2IYJA 4OK0A 1B2SA 1RTUA 2WO0A 2E2VA 4MMXB 2QA43 2AADA 4HM5B 5RNTA 3GAXA 3MPHA 1M904 1IQXA 5HOHA 3QK9A 4J8TA 3CNXA 3SYUA 1IYYA 2BMQB 2CK3H 1LOXA 1N9JA 2CIUA 5D81A 4XBYA 2J8XB 1GMRA 4XDVA 3X41A 5D83A 1NB5I 1IT8A 4CPKA 3D4AA 2RSXA 1WMPA 1HYFA 3CU3A 1YIJ3 2BNGA 2Y73A 3WMDA 3BNCA 2YFLB 1ROAA 1HZ1A 1RCLA 1Q7Y4 1M9GA 1MGWA 1OUNA 3UB1A 1BRIA 1V74A 2XH9A 2F99A 2UX0A 1IDPA 4GHOA 3SXXA 1GMQA 3L0RA 3X42A 3CME3 5AEWB 1UUWB 3A76A 1US1A 2BMRB 1CYVA 3MG2A 2HMLB 1T2HA 2K54A 4IT7A 1IV7A 4FCMA 3GSPA 3CD63 4RBNA 2P09A 1BRJA 1JRQA 2BMOB 2F56A 3KSED 4EV5A 1IU7A 4KFFA 1TU5A 1BNJA 1RLSA 4XM4A 1LOYA 1BOXA 1GY7A 2YFJB 3EBTA 1TIJA 2C4BA 2UGIA 1IVUA 1JB4A 1N8QA 2KF4A 1BNIA 3K7CA 3LYGA 3Q3FA 1VQ63 1RKYA 1Q42A 4HKVB 1X1UA 4N6MA 1TJDA 1BU4A 3F7XA 2LYXA 3OWYA 4R9LA 4RNTA 2MF7A 4XDWA 3RGRA 1EKMA 1SIIA 1X1YA 3NXJA 4K61A 1TP6A 2BT3A 2OQEC 1GSPA 3K0ZA 1LNIA 3IMAB 4WFOA 1VQQA 4I5QA 1OGZA 1RGKA 1RCKA 1UCJA 2KXGA 1E3RA 3ER7A 5EVHA 1I3FA 1W2ZA 2XFTA 3JUOA 1IT7A 1OF5A 2A15A 1B2ZA 1I2EA 1K41A 1M1XB 1MWTA 1STFI 2BO9B 2STDA 1MWRA 3MSOA 1PFPA 4LZIA 3LT8A 5BU4A 3D5GA 2JDIH 3PYJA 3IJEB 3N8BA 1I0XA 1ZGXA 3LTCA 1YGEA 1JBSA 5M19A 3HOHA 1JB5A 2QIYA 2K3DA 4BL2A 3OW22 2W04A 2GU3A 2BIRA 2QGUA 1I0VA 1B2UA 1UCKA 2CWUA 2D42A 2GBWB 2E2TA 3G0KA 1UW1A 3G8ZA 2E2UA 2FXTA 3X40A 5KP1A 1W00A 1ISKA 3GWRA 1VQL3 3B4PA 1JJ22 1GYBA 4HYZA 4WWUC 1UCLA 3UNLA 5ELJA 4IPBA 3SEDA 2KAAA 1K734 1W6CA 3NQZA 1CH0A 4HM7B 1W2B2 3Q90A 1OHSA 1D6YA 4R9KA 3K63A 1OCVA 1WMNA 3IPTA 3SVAA 3CXC2 1VQ73 4X2HA 5M18A 5IG0A 3WR2A 1VQO3 2H0GA 3VGNA 1A90A 1SPUA 3F14A 4KT3B 1KQS2 1NU3A 1MNLA 2Q07A 1O7WB 4NHFA 1TRPA 4RNYA 3WHOA 1RGHA 3S29A 1YJW3 4J5GA 4EW5A 4OUQA 3DZLA 7GSPA 5AEUB 3CCJ3 3JUMA 3LOYA 2B24B 2Z77A 1GMPA 1FGOA 2XF3A 3D3LA 1I70A 1QVG2 4ILFA 2Y74A 2HMNB 1GD3A 9RNTA 3N9HA 4WYKB 2XSHB 4GB5A 1C7HA 2Z6BA 3OV4A 1X1XA 2W0QA 1EA2A 4N6TA 4MEIA 1T3BA 1RN1A 3PXMA 4U13A 1OPYA 2K0MA 4WP5A 1UI7A 3T8UA 3BB9A 5AIFA 4R80A 5AI1A 1DE3A 2RCDA 2YFIB 1BRHA 1W4NA 1JZOA 3HIGA 4IIAA 4WHAA 3LH4A 3EF8A 3EB8A 4LGQA 2WOHA 2OWPA 1BNEA 1JZDA 3FZWA 4HJLB 3EX9A 3AHSA 2HOHA 1ZX2A 4FR9A 4BTYA 4J9AA 1GS3A 3PGBA 4TX4A 1R4CA 3LTBA 3HK4A 1Z1SA 4DKIA 1RRLA 1TUHA 1UI8A 3CPOA 4HAAA 5ELUA 1UCIA 1T2IA 1A67A 4AEQA 1AQZA 2OOVC 1LXEA 1JBTA 3MYTA 3DMCA 2GU1A 3EJVA 1U8CB 3EN8A 3V98A 2Z76A 4XBTA 4MMYB 1BUJA 4MMZB 3RDEA 3MG3A 3FGYA 3WDGB 1JKGB 4ZM8A 1GY6A 1OH0A 2XRXB 2XFSA 5EEOA 1BUQA 3DGYA 2R41A 2H0IA 1K8A4 1FGQA 2SBLA 3CCR3 3V99A 4GSPA 4MJDA 1BNFA 4PEJA 3AGOA 1BGSA 2KF6A 2CFKA 3UJMA 1YJN3 5IG5A 1E97A 1EEJA 2XSOB 3DUKA 1ULIB 2D1WA 1N5HA 2HMJB 1IVXA 1MOLA 2IY2A 3NX0A 5AIGA 3ZG0A 4BTWA 3LMLA 4BTXA 1Q864 3X3ZA 1FGRA 2HMMB 1S723 2PZVA 1BRSA 2Z7AA 3NM2A 3UL5A 5IF6A 1AVKA 1STDA 3DY5A 2KCDA 3FF2A 3I0YA 1DMMA 3K9MC 1ULJB 1O7HB 2W03A 3CCE3 1WQLB 2F5WA 1W7CA 1BANA 3PZWA 3TDGA 3SLUA 1RHLA 1B21A 3LTDA 5KP3A 1FW7A 5CF2A 3BIRA 3G4S3 2SARA 4J5KA 3STDA 1QVF2 2CFGA 3JVCA 6GSPA 3F7SA
chains in the Genus database with same CATH topology
1Q9EA 1RGFA 1RMSA 3KCHA 1TRQA 1DETA 1I3IA 1TRPA 3WHOA 1RGHA 1YNVX 4J5GA 1JBRA 1RGEA 1LRAA 1GOYA 7GSPA 1BSEA 1BIRA 1I2FA 1BRNL 1FUTA 1GMPA 1LOVA 2AAEA 2GSPA 1RSNA 1I70A 1X1WA 1I8VA 3URPA 1B2SA 1RTUA 1PY3A 1G02A 9RNTA 2AADA 5RNTA 1MGRA 1X1XA 5HOHA 1RN1A 2KF5A 3SYUA 1IYYA 1BRKA 1BSBA 3AHWA 1GMRA 1SARA 1YGWA 3A5EA 1DE3A 3RNTA 3D4AA 1BRHA 2F5MA 1A2PA 1HYFA 1RNTA 1HZ1A 1B2XA 1BNEA 1MGWA 1RCLA 2BU4A 1BRIA 3AHSA 4BU4A 2HOHA 4GHOA 1RGAA 1BRGA 1GOVA 1GMQA 1YVSA 2F4YA 3BU4A 1T2HA 4HAAA 3GSPA 1UCIA 1T2IA 3DH2A 1BRJA 1FUSA 1AQZA 2F56A 1PYLA 1BNJA 1RLSA 1TTOA 2RNTA 1LOYA 1BOXA 2C4BA 1JBTA 5BIRA 1I2GA 2KF4A 1BNIA 3Q3FA 4HOHA 1FZUA 1RDSA 1X1UA 1BU4A 4RNTA 1BUJA 1GOUA 1X1YA 5GSPA 2KF3A 1GSPA 1LOWA 1LNIA 3D5IA 3DGYA 1RGKA 1RCKA 1UCJA 4GSPA 1BNFA 1I3FA 1BNRA 1B2ZA 1I2EA 1BVIA 1BSCA 1BGSA 3AGOA 5BU4A 1B20A 3D5GA 1B3SA 2KF6A 1RGCA 1BAOA 1I0XA 1ZGXA 1C54A 2ZA4A 4BIRA 1JBSA 3HOHA 1BNSA 1FYSA 8RNTA 2BIRA 1I0VA 1B2UA 1UCKA 1BRSA 1RGGA 1RGLA 1RNBA 2RBIA 1AY7A 1RN4A 2F5WA 1BANA 1UCLA 2KAAA 1R4YA 3AGNA 1CH0A 1B2MA 1RHLA 1B21A 1FW7A 1B27A 3BIRA 7RNTA 6RNTA 1BSAA 2SARA 1BNGA 4J5KA 1BSDA 6GSPA 3WR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9E A;  1RGF A;  1RMS A;  3KCH A;  1TRQ A;  1DET A;  1I3I A;  1TRP A;  3WHO A;  1RGH A;  1YNV X;  4J5G A;  1JBR A;  1RGE A;  1LRA A;  1GOY A;  7GSP A;  1BSE A;  1BIR A;  1I2F A;  1BRN L;  1FUT A;  1GMP A;  1LOV A;  2AAE A;  2GSP A;  1RSN A;  1I70 A;  1X1W A;  1I8V A;  3URP A;  1B2S A;  1RTU A;  1PY3 A;  1G02 A;  9RNT A;  2AAD A;  5RNT A;  1MGR A;  1X1X A;  5HOH A;  1RN1 A;  2KF5 A;  3SYU A;  1IYY A;  1BRK A;  1BSB A;  3AHW A;  1GMR A;  1SAR A;  1YGW A;  3A5E A;  1DE3 A;  3RNT A;  3D4A A;  1BRH A;  2F5M A;  1A2P A;  1HYF A;  1RNT A;  1HZ1 A;  1B2X A;  1BNE A;  1MGW A;  1RCL A;  2BU4 A;  1BRI A;  3AHS A;  4BU4 A;  2HOH A;  4GHO A;  1RGA A;  1BRG A;  1GOV A;  1GMQ A;  1YVS A;  2F4Y A;  3BU4 A;  1T2H A;  4HAA A;  3GSP A;  1UCI A;  1T2I A;  3DH2 A;  1BRJ A;  1FUS A;  1AQZ A;  2F56 A;  1PYL A;  1BNJ A;  1RLS A;  1TTO A;  2RNT A;  1LOY A;  1BOX A;  2C4B A;  1JBT A;  5BIR A;  1I2G A;  2KF4 A;  1BNI A;  3Q3F A;  4HOH A;  1FZU A;  1RDS A;  1X1U A;  1BU4 A;  4RNT A;  1BUJ A;  1GOU A;  1X1Y A;  5GSP A;  2KF3 A;  1GSP A;  1LOW A;  1LNI A;  3D5I A;  3DGY A;  1RGK A;  1RCK A;  1UCJ A;  4GSP A;  1BNF A;  1I3F A;  1BNR A;  1B2Z A;  1I2E A;  1BVI A;  1BSC A;  1BGS A;  3AGO A;  5BU4 A;  1B20 A;  3D5G A;  1B3S A;  2KF6 A;  1RGC A;  1BAO A;  1I0X A;  1ZGX A;  1C54 A;  2ZA4 A;  4BIR A;  1JBS A;  3HOH A;  1BNS A;  1FYS A;  8RNT A;  2BIR A;  1I0V A;  1B2U A;  1UCK A;  1BRS A;  1RGG A;  1RGL A;  1RNB A;  2RBI A;  1AY7 A;  1RN4 A;  2F5W A;  1BAN A;  1UCL A;  2KAA A;  1R4Y A;  3AGN A;  1CH0 A;  1B2M A;  1RHL A;  1B21 A;  1FW7 A;  1B27 A;  3BIR A;  7RNT A;  6RNT A;  1BSA A;  2SAR A;  1BNG A;  4J5K A;  1BSD A;  6GSP A;  3WR2 A; 
#chains in the Genus database with same CATH topology
 1JB2 A;  4JRF A;  4WYK A;  4N6O B;  1E3V A;  4STD A;  3CCU 3;  3FG1 A;  1VQM 3;  2L4V A;  5BXQ A;  4LEH A;  5G1L A;  2CX0 A;  1DYU A;  3T0U A;  2LQV A;  1NB3 I;  1RRH A;  3D79 A;  1NO3 A;  2OTL 3;  1JNQ A;  3EQQ B;  4KZ1 A;  1YNV X;  1G96 A;  3GZR A;  1QAK A;  3BNE A;  1DMQ A;  5JPU A;  1LNH A;  4FCJ A;  1KWI A;  1V57 A;  3S67 A;  2GSP A;  3NV0 B;  2FNQ A;  1N8R 4;  3DGL A;  4NPB A;  2CFD A;  3FSD A;  3LT9 A;  3GRD A;  3ZFZ A;  5IG3 A;  3URP A;  5EQL A;  5LC6 A;  4HM8 B;  1UUV B;  3F40 A;  1MGR A;  1VQ8 3;  3H3H A;  3CC2 3;  2MC8 A;  3ALA A;  2H0H A;  3BND A;  1HU9 A;  2PNC A;  3PCS A;  3T8N A;  3WA2 X;  3DGN A;  3AHW A;  3LXU X;  1WTH A;  3A5E A;  3B8L A;  3X3Y A;  4N6N B;  5IEP A;  5DRE A;  1ROV A;  4K1U A;  5I97 A;  3FH1 A;  1A2P A;  3UL6 A;  3KE7 A;  1RNT A;  1O7P B;  1B2X A;  1OHO A;  3F8H A;  3HI7 A;  4X2O A;  3F9S A;  3KSP A;  1RGA A;  1RJO A;  1GOV A;  1JKG A;  4R1K A;  4EXR A;  2HMK B;  2F4Y A;  3SX1 A;  1PU4 A;  2I9W A;  3EBY A;  4HZB B;  2ZL8 A;  3QRD A;  1ZS7 A;  5IEO A;  2KRT A;  1FUS A;  3NQY A;  5IG4 A;  1LQM B;  4ORL A;  1WNH A;  1PYL A;  1O7N B;  1QJG A;  1TTO A;  3LZA A;  1FA3 A;  2XGN A;  2CG0 A;  1VZZ A;  2GBX B;  3PCR A;  5BIR A;  1I2G A;  1CEW I;  4HOH A;  4Q53 A;  4O3V A;  1FZU A;  3U1W A;  2IA7 A;  1W01 A;  3OX9 A;  1D6U A;  3BLZ A;  4EYC A;  2GXF A;  3JUN A;  3J7Y d;  2KF3 A;  1YJ9 3;  3B4O A;  4R4K A;  1LOW A;  1UDI I;  3S5C A;  1VQ5 3;  3DGO A;  1VQP 3;  4FMD A;  1NDO B;  3HZP A;  2P0X A;  2P05 A;  2P0M A;  3FKA A;  3EE1 A;  2C11 A;  3MKI A;  4LMI A;  5D82 A;  1OHP A;  3HII A;  3OWS A;  2O9U X;  4OVM A;  1Q7H A;  2IUJ A;  3LTA A;  3O8Y A;  3JUQ A;  1UUG B;  2CHC A;  1BVI A;  1Q40 B;  1W6Y A;  3NBB A;  4L7K A;  3E99 A;  4CCV A;  3WA3 A;  3B7C A;  1B20 A;  1KD1 4;  2CWV A;  1BAO A;  4HVN A;  1C54 A;  1MWU A;  4CJN A;  2CX1 A;  4GL6 A;  2ZA4 A;  4BIR A;  6STD A;  2WGQ A;  1L5G B;  3WOD G;  5STD A;  8RNT A;  2OTJ 3;  3NBJ A;  1NNV A;  3S27 A;  2C10 A;  3FCS B;  1OGX A;  4RNZ A;  3CC7 3;  1SJW A;  1EG9 B;  3CMA 3;  4EBG A;  1Q82 4;  1DVC A;  1FGM A;  1LQG C;  2IMJ A;  3RGA A;  1VQ9 3;  4HBR A;  2OQE A;  4I4K A;  5JPP A;  3K5T A;  3VSY A;  4O2H A;  3AGN A;  3GZB A;  1RN7 A;  1F8N A;  4BL3 A;  3CCL 3;  4N6V 0;  1N5P A;  3NV0 A;  1B27 A;  7RNT A;  1JN5 B;  2CWT A;  3BNB A;  1BSA A;  1ASK A;  4QWT A;  3V92 A;  1Q9E A;  2FGT A;  8CHO A;  1YHQ 3;  5CK6 A;  1Y4K A;  1LVN A;  1W02 A;  3Q1C A;  2W56 B;  5CLK A;  3X3X A;  1RGF A;  2XR8 B;  2ZHX B;  3FLJ A;  5A0O B;  1OAC A;  1TRQ A;  1I3I A;  3N54 B;  5KP4 A;  1CQS A;  1IQY A;  5FW5 A;  3DM8 A;  3KZT A;  3NHX A;  5M1A A;  1K9M 4;  3HX8 A;  1RGE A;  1JBR A;  1GOY A;  1BIR A;  3NM7 A;  1I2F A;  4KFE A;  1FUT A;  4KFD A;  3ROB A;  2AAE A;  5AIH A;  2CFW A;  1J2B A;  1X1W A;  4CDL A;  4HM3 B;  3AMO B;  5BVB A;  3KFQ C;  4EV2 A;  3OWU A;  1S5A A;  1PY3 A;  1G02 A;  3ECF A;  4O02 B;  1UGI A;  3CCV 3;  3CPW 2;  4LYL B;  3WOF B;  5LC7 A;  2KF5 A;  3CNM A;  2V1L A;  4RZM A;  3M8C A;  1BRK A;  1BSB A;  3G6E 3;  3OXA A;  3NBR A;  1GD4 A;  1SAR A;  1U5O A;  1YGW A;  2P38 A;  5AII A;  3RNT A;  1VQK 3;  4AKZ A;  1DMN A;  2F5M A;  4N3V A;  5CXO A;  5DRV A;  3SOY A;  5TGN A;  4EC6 A;  2BU4 A;  1W5Z A;  3EHC A;  3GZY B;  2BHM A;  4BU4 A;  2W9P A;  2CFL A;  2XGL A;  4O8S A;  1BRG A;  1G0T A;  2RGQ A;  4JF8 A;  1JV2 B;  2CKF B;  2JQ5 A;  3EC9 A;  3EN1 B;  1YVS A;  4K1V A;  2HMO B;  5AYS C;  2CC3 A;  1N9E A;  2W9Q A;  3BU4 A;  2YX9 A;  4K90 B;  3KN4 A;  1EUI C;  1QAF A;  3DH2 A;  4L8O A;  2B1X B;  1Q40 A;  3SOA A;  1GY5 A;  2GEX A;  2L1S A;  3KII A;  2RNT A;  4FMB A;  1A2K A;  4H3U A;  4FMC A;  1KSI A;  2W2C A;  3JUP A;  1O7G B;  1RDS A;  5IEN A;  2ML5 A;  4HM2 B;  2GEY A;  3I55 3;  1AR0 A;  1O7M B;  1QAL A;  4HM0 B;  4HM4 B;  1GOU A;  5IW9 A;  3G71 3;  2R4I A;  5GSP A;  3CCQ 3;  2CW9 A;  1MWS A;  2RFR A;  2CG1 A;  2M7O A;  4HM1 B;  1IK3 A;  5G2G A;  2QEX 3;  3D5I A;  1EQK A;  3FF0 A;  3MWZ A;  4AKY A;  1ZO2 A;  4N6L A;  3NUV A;  1BNR A;  1TFK A;  2CH9 A;  2UUG C;  4FMA A;  1BSC A;  2W6J H;  1AVL A;  4XBX A;  1CYU A;  1YI2 3;  1B3S A;  1RGC A;  1FGT A;  3KKG A;  1VQN 3;  1IV9 A;  1JN5 A;  2OOV A;  1TFO A;  5JBS A;  1BNS A;  1FYS A;  3MHE A;  1KC8 4;  1V58 A;  1IQ8 A;  5IER A;  1RGG A;  1T5Y A;  5AYR B;  2W56 A;  1VQ4 3;  1UGH I;  1NJI 4;  3VF1 A;  2F98 A;  1RGL A;  3FG4 A;  5FGO A;  2F86 B;  1RNB A;  3GZX B;  2RBI A;  1AY7 A;  1RN4 A;  5G1K A;  1DVD A;  1OF5 B;  1R4Y A;  2XEP A;  2WOF A;  1B2M A;  1Q81 4;  3F8X A;  3PS8 A;  1YVB I;  4LSO A;  1QMA A;  3D9R A;  3I56 3;  6RNT A;  3CCM 3;  3CCS 3;  3U97 A;  1BNG A;  3AMO A;  3WOE B;  4HM6 B;  1BSD A;  4HZ9 B;  1WMO A;  1YIT 3;  1HKX A;  1IVV A;  3DXO A;  5HGR A;  5CF1 A;  1M1K 4;  3CC4 3;  3S28 A;  3H51 A;  2ML6 A;  1K28 A;  1RMS A;  3KCH A;  1FUW A;  1DET A;  4FCZ A;  2OCT A;  3ZG5 A;  4H61 A;  1D6Z A;  3MG1 A;  4NRE A;  1W6G A;  1NWW A;  4XB5 A;  1LRA A;  1BSE A;  2IUK A;  2O3O A;  7STD A;  1BRN L;  1SIH A;  2INX A;  4KVH A;  4G1M B;  1LOV A;  3FG3 A;  4N6U A;  2ZDJ A;  1AV4 A;  3Q2P A;  2WGO A;  1IVW A;  1RSN A;  1SQW A;  1I8V A;  4L8P A;  3DGM A;  3G16 A;  1A2V A;  2IYJ A;  4OK0 A;  1B2S A;  1RTU A;  2WO0 A;  2E2V A;  4MMX B;  2QA4 3;  2AAD A;  4HM5 B;  5RNT A;  3GAX A;  3MPH A;  1M90 4;  1IQX A;  5HOH A;  3QK9 A;  4J8T A;  3CNX A;  3SYU A;  1IYY A;  2BMQ B;  2CK3 H;  1LOX A;  1N9J A;  2CIU A;  5D81 A;  4XBY A;  2J8X B;  1GMR A;  4XDV A;  3X41 A;  5D83 A;  1NB5 I;  1IT8 A;  4CPK A;  3D4A A;  2RSX A;  1WMP A;  1HYF A;  3CU3 A;  1YIJ 3;  2BNG A;  2Y73 A;  3WMD A;  3BNC A;  2YFL B;  1ROA A;  1HZ1 A;  1RCL A;  1Q7Y 4;  1M9G A;  1MGW A;  1OUN A;  3UB1 A;  1BRI A;  1V74 A;  2XH9 A;  2F99 A;  2UX0 A;  1IDP A;  4GHO A;  3SXX A;  1GMQ A;  3L0R A;  3X42 A;  3CME 3;  5AEW B;  1UUW B;  3A76 A;  1US1 A;  2BMR B;  1CYV A;  3MG2 A;  2HML B;  1T2H A;  2K54 A;  4IT7 A;  1IV7 A;  4FCM A;  3GSP A;  3CD6 3;  4RBN A;  2P09 A;  1BRJ A;  1JRQ A;  2BMO B;  2F56 A;  3KSE D;  4EV5 A;  1IU7 A;  4KFF A;  1TU5 A;  1BNJ A;  1RLS A;  4XM4 A;  1LOY A;  1BOX A;  1GY7 A;  2YFJ B;  3EBT A;  1TIJ A;  2C4B A;  2UGI A;  1IVU A;  1JB4 A;  1N8Q A;  2KF4 A;  1BNI A;  3K7C A;  3LYG A;  3Q3F A;  1VQ6 3;  1RKY A;  1Q42 A;  4HKV B;  1X1U A;  4N6M A;  1TJD A;  1BU4 A;  3F7X A;  2LYX A;  3OWY A;  4R9L A;  4RNT A;  2MF7 A;  4XDW A;  3RGR A;  1EKM A;  1SII A;  1X1Y A;  3NXJ A;  4K61 A;  1TP6 A;  2BT3 A;  2OQE C;  1GSP A;  3K0Z A;  1LNI A;  3IMA B;  4WFO A;  1VQQ A;  4I5Q A;  1OGZ A;  1RGK A;  1RCK A;  1UCJ A;  2KXG A;  1E3R A;  3ER7 A;  5EVH A;  1I3F A;  1W2Z A;  2XFT A;  3JUO A;  1IT7 A;  1OF5 A;  2A15 A;  1B2Z A;  1I2E A;  1K41 A;  1M1X B;  1MWT A;  1STF I;  2BO9 B;  2STD A;  1MWR A;  3MSO A;  1PFP A;  4LZI A;  3LT8 A;  5BU4 A;  3D5G A;  2JDI H;  3PYJ A;  3IJE B;  3N8B A;  1I0X A;  1ZGX A;  3LTC A;  1YGE A;  1JBS A;  5M19 A;  3HOH A;  1JB5 A;  2QIY A;  2K3D A;  4BL2 A;  3OW2 2;  2W04 A;  2GU3 A;  2BIR A;  2QGU A;  1I0V A;  1B2U A;  1UCK A;  2CWU A;  2D42 A;  2GBW B;  2E2T A;  3G0K A;  1UW1 A;  3G8Z A;  2E2U A;  2FXT A;  3X40 A;  5KP1 A;  1W00 A;  1ISK A;  3GWR A;  1VQL 3;  3B4P A;  1JJ2 2;  1GYB A;  4HYZ A;  4WWU C;  1UCL A;  3UNL A;  5ELJ A;  4IPB A;  3SED A;  2KAA A;  1K73 4;  1W6C A;  3NQZ A;  1CH0 A;  4HM7 B;  1W2B 2;  3Q90 A;  1OHS A;  1D6Y A;  4R9K A;  3K63 A;  1OCV A;  1WMN A;  3IPT A;  3SVA A;  3CXC 2;  1VQ7 3;  4X2H A;  5M18 A;  5IG0 A;  3WR2 A;  1VQO 3;  2H0G A;  3VGN A;  1A90 A;  1SPU A;  3F14 A;  4KT3 B;  1KQS 2;  1NU3 A;  1MNL A;  2Q07 A;  1O7W B;  4NHF A;  1TRP A;  4RNY A;  3WHO A;  1RGH A;  3S29 A;  1YJW 3;  4J5G A;  4EW5 A;  4OUQ A;  3DZL A;  7GSP A;  5AEU B;  3CCJ 3;  3JUM A;  3LOY A;  2B24 B;  2Z77 A;  1GMP A;  1FGO A;  2XF3 A;  3D3L A;  1I70 A;  1QVG 2;  4ILF A;  2Y74 A;  2HMN B;  1GD3 A;  9RNT A;  3N9H A;  4WYK B;  2XSH B;  4GB5 A;  1C7H A;  2Z6B A;  3OV4 A;  1X1X A;  2W0Q A;  1EA2 A;  4N6T A;  4MEI A;  1T3B A;  1RN1 A;  3PXM A;  4U13 A;  1OPY A;  2K0M A;  4WP5 A;  1UI7 A;  3T8U A;  3BB9 A;  5AIF A;  4R80 A;  5AI1 A;  1DE3 A;  2RCD A;  2YFI B;  1BRH A;  1W4N A;  1JZO A;  3HIG A;  4IIA A;  4WHA A;  3LH4 A;  3EF8 A;  3EB8 A;  4LGQ A;  2WOH A;  2OWP A;  1BNE A;  1JZD A;  3FZW A;  4HJL B;  3EX9 A;  3AHS A;  2HOH A;  1ZX2 A;  4FR9 A;  4BTY A;  4J9A A;  1GS3 A;  3PGB A;  4TX4 A;  1R4C A;  3LTB A;  3HK4 A;  1Z1S A;  4DKI A;  1RRL A;  1TUH A;  1UI8 A;  3CPO A;  4HAA A;  5ELU A;  1UCI A;  1T2I A;  1A67 A;  4AEQ A;  1AQZ A;  2OOV C;  1LXE A;  1JBT A;  3MYT A;  3DMC A;  2GU1 A;  3EJV A;  1U8C B;  3EN8 A;  3V98 A;  2Z76 A;  4XBT A;  4MMY B;  1BUJ A;  4MMZ B;  3RDE A;  3MG3 A;  3FGY A;  3WDG B;  1JKG B;  4ZM8 A;  1GY6 A;  1OH0 A;  2XRX B;  2XFS A;  5EEO A;  1BUQ A;  3DGY A;  2R41 A;  2H0I A;  1K8A 4;  1FGQ A;  2SBL A;  3CCR 3;  3V99 A;  4GSP A;  4MJD A;  1BNF A;  4PEJ A;  3AGO A;  1BGS A;  2KF6 A;  2CFK A;  3UJM A;  1YJN 3;  5IG5 A;  1E97 A;  1EEJ A;  2XSO B;  3DUK A;  1ULI B;  2D1W A;  1N5H A;  2HMJ B;  1IVX A;  1MOL A;  2IY2 A;  3NX0 A;  5AIG A;  3ZG0 A;  4BTW A;  3LML A;  4BTX A;  1Q86 4;  3X3Z A;  1FGR A;  2HMM B;  1S72 3;  2PZV A;  1BRS A;  2Z7A A;  3NM2 A;  3UL5 A;  5IF6 A;  1AVK A;  1STD A;  3DY5 A;  2KCD A;  3FF2 A;  3I0Y A;  1DMM A;  3K9M C;  1ULJ B;  1O7H B;  2W03 A;  3CCE 3;  1WQL B;  2F5W A;  1W7C A;  1BAN A;  3PZW A;  3TDG A;  3SLU A;  1RHL A;  1B21 A;  3LTD A;  5KP3 A;  1FW7 A;  5CF2 A;  3BIR A;  3G4S 3;  2SAR A;  4J5K A;  3STD A;  1QVF 2;  2CFG A;  3JVC A;  6GSP A;  3F7S A; 
#chains in the Genus database with same CATH homology
 1Q9E A;  1RGF A;  1RMS A;  3KCH A;  1TRQ A;  1DET A;  1I3I A;  1TRP A;  3WHO A;  1RGH A;  1YNV X;  4J5G A;  1JBR A;  1RGE A;  1LRA A;  1GOY A;  7GSP A;  1BSE A;  1BIR A;  1I2F A;  1BRN L;  1FUT A;  1GMP A;  1LOV A;  2AAE A;  2GSP A;  1RSN A;  1I70 A;  1X1W A;  1I8V A;  3URP A;  1B2S A;  1RTU A;  1PY3 A;  1G02 A;  9RNT A;  2AAD A;  5RNT A;  1MGR A;  1X1X A;  5HOH A;  1RN1 A;  2KF5 A;  3SYU A;  1IYY A;  1BRK A;  1BSB A;  3AHW A;  1GMR A;  1SAR A;  1YGW A;  3A5E A;  1DE3 A;  3RNT A;  3D4A A;  1BRH A;  2F5M A;  1A2P A;  1HYF A;  1RNT A;  1HZ1 A;  1B2X A;  1BNE A;  1MGW A;  1RCL A;  2BU4 A;  1BRI A;  3AHS A;  4BU4 A;  2HOH A;  4GHO A;  1RGA A;  1BRG A;  1GOV A;  1GMQ A;  1YVS A;  2F4Y A;  3BU4 A;  1T2H A;  4HAA A;  3GSP A;  1UCI A;  1T2I A;  3DH2 A;  1BRJ A;  1FUS A;  1AQZ A;  2F56 A;  1PYL A;  1BNJ A;  1RLS A;  1TTO A;  2RNT A;  1LOY A;  1BOX A;  2C4B A;  1JBT A;  5BIR A;  1I2G A;  2KF4 A;  1BNI A;  3Q3F A;  4HOH A;  1FZU A;  1RDS A;  1X1U A;  1BU4 A;  4RNT A;  1BUJ A;  1GOU A;  1X1Y A;  5GSP A;  2KF3 A;  1GSP A;  1LOW A;  1LNI A;  3D5I A;  3DGY A;  1RGK A;  1RCK A;  1UCJ A;  4GSP A;  1BNF A;  1I3F A;  1BNR A;  1B2Z A;  1I2E A;  1BVI A;  1BSC A;  1BGS A;  3AGO A;  5BU4 A;  1B20 A;  3D5G A;  1B3S A;  2KF6 A;  1RGC A;  1BAO A;  1I0X A;  1ZGX A;  1C54 A;  2ZA4 A;  4BIR A;  1JBS A;  3HOH A;  1BNS A;  1FYS A;  8RNT A;  2BIR A;  1I0V A;  1B2U A;  1UCK A;  1BRS A;  1RGG A;  1RGL A;  1RNB A;  2RBI A;  1AY7 A;  1RN4 A;  2F5W A;  1BAN A;  1UCL A;  2KAA A;  1R4Y A;  3AGN A;  1CH0 A;  1B2M A;  1RHL A;  1B21 A;  1FW7 A;  1B27 A;  3BIR A;  7RNT A;  6RNT A;  1BSA A;  2SAR A;  1BNG A;  4J5K A;  1BSD A;  6GSP A;  3WR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...