1TTOA

Crystal structure of the rnase t1 variant r2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHEFRNWNGFDFSVSSPYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RNase T1
publication title Purine activity of RNase T1RV is further improved by substitution of Trp59 by tyrosine
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ttoA00
3BIRA 2RNTA 6RNTA 1GMQA 5RNTA 1BNGA 7RNTA 2KF3A 1BNIA 1LNIA 1RN1A 1TRPA 1X1YA 1I8VA 1RGEA 1YVSA 2F5MA 1BU4A 2KF4A 3RNTA 1B2SA 1BOXA 1B2UA 1AQZA 1LRAA 3GSPA 5GSPA 1T2HA 1UCJA 4GHOA 1FUTA 4HOHA 5HOHA 1BRGA 1RCKA 1T2IA 1X1UA 4HAAA 4BIRA 2ZA4A 1TRQA 3D5GA 1BGSA 3AHSA 1LOVA 1MGWA 1TTOA 1I3FA 1RMSA 1ZGXA 3WHOA 1BSBA 1PYLA 3AHWA 1BANA 1Q9EA 1I2FA 1BAOA 1B2XA 1B21A 3BU4A 1BSEA 2SARA 4J5GA 1B2ZA 1BRSA 1RGLA 1FW7A 1I3IA 3AGNA 1A2PA 1SARA 1BSCA 2RBIA 1LOYA 1HYFA 3D5IA 1BRIA 1YNVX 9RNTA 1I2EA 1RCLA 1BNFA 1FYSA 1RNBA 3DH2A 6GSPA 1RGAA 1GOUA 2KF5A 1X1WA 1C54A 1G02A 5BIRA 4RNTA 1B2MA 3URPA 1MGRA 1LOWA 4BU4A 1GMPA 1JBTA 2F5WA 1RSNA 3KCHA 3A5EA 1RHLA 3WR2A 1IYYA 1BRJA 1I0VA 3HOHA 1BNJA 1BRNL 5BU4A 1GOYA 1R4YA 2BU4A 1BIRA 1RLSA 1BSDA 1FZUA 7GSPA 1RNTA 1DETA 2KAAA 3AGOA 1B20A 8RNTA 1I70A 1BRKA 1JBRA 2F56A 1BSAA 3D4AA 3SYUA 1RN4A 1PY3A 2BIRA 2F4YA 1RGCA 2HOHA 1GOVA 1UCIA 2KF6A 1RGKA 1AY7A 1B3SA 1RDSA 1RGHA 1FUSA 1I0XA 1DE3A 1YGWA 2AADA 2GSPA 1HZ1A 1RGGA 1BRHA 1BUJA 1BVIA 1RGFA 2C4BA 1GMRA 1BNSA 3DGYA 1B27A 1UCKA 4GSPA 1BNEA 1BNRA 1RTUA 1X1XA 1I2GA 2AAEA 1GSPA 3Q3FA 1CH0A 4J5KA 1JBSA 1UCLA
chains in the Genus database with same CATH superfamily
3FGYA 1GMQA 1JB5A 3MSOA 3NBJA 4RZMA 5CXOA 1FGOA 2HMLB 1US1A 2YFJB 5IG0A 5RNTA 3MG3A 1UI7A 3F7XA 3ZFZA 1X1YA 2K0MA 4HM4B 3EHCA 3AMOB 1YVSA 2RGQA 1QVG2 2CFLA 2P09A 1BU4A 2P38A 3LMLA 3VF1A 1AVKA 1B2SA 1AQZA 2M7OA 1IQ8A 1FGRA 1OF5A 2MC8A 4ZM8A 1UCJA 2B1XB 4HOHA 1QAKA 3LTAA 4L8PA 1BRGA 4XM4A 3U1WA 1Q814 4H61A 3S28A 1K9M4 1OPYA 5FGOA 1JN5A 4O8SA 1T2IA 5CF1A 1X1UA 3WOFB 1GY7A 3X3XA 5I97A 2BNGA 1N5PA 3EF8A 2BMQB 3D5GA 1BGSA 3KE7A 1NO3A 3DGMA 3EJVA 3UB1A 1TTOA 2QEX3 3CNXA 1ZGXA 1DYUA 3SX1A 3K9MC 3LT9A 2BO9B 3JUOA 4FMAA 1A2VA 2P0MA 2BHMA 4HZBB 1MWSA 4N6OB 5AIGA 4FR9A 3CXC2 3CC73 1YVBI 1DMNA 3G6E3 4K1UA 4NREA 4R9LA 1QJGA 1KQS2 3I0YA 3AMOA 4J5GA 1B2ZA 1UI8A 3G8ZA 2KXGA 3D3LA 1DMMA 2P0XA 3K5TA 3KFQC 2Z6BA 3MPHA 2CWTA 3KSED 3S27A 3BB9A 1UGIA 4K61A 3UL5A 3Q90A 5LC7A 9RNTA 4K1VA 1AV4A 3ER7A 3S67A 1MWUA 4KT3B 1I2EA 1BNFA 2E2UA 4LYLB 1NU3A 4CDLA 2KF5A 1YIJ3 3QK9A 1ISKA 1MGRA 2UX0A 2IUJA 3JUMA 4BU4A 3FF2A 1SJWA 3H3HA 1VQL3 3JUNA 3KIIA 1N8QA 3S5CA 1K8A4 1RJOA 5M18A 3NQZA 1VQM3 2JQ5A 3CME3 3B7CA 2XF3A 3DZLA 3EN8A 5IENA 3MYTA 1YJ93 2ML5A 4CCVA 4AEQA 1QALA 4J9AA 1TP6A 5ELJA 3N54B 1VQN3 1R4YA 1N8R4 2B24B 1BSDA 3MHEA 3IJEB 1TIJA 2PNCA 3B4PA 3ALAA 3AGOA 3JUQA 3N8BA 1VQ83 1QVF2 1B20A 1WMPA 3VSYA 1BRKA 2F56A 1SQWA 3CCS3 3V98A 4N6NB 4N3VA 4X2OA 1VQ73 1RN4A 3CMA3 4N6UA 2F4YA 4O02B 3OV4A 3QRDA 5KP4A 2UGIA 5AYSC 3SVAA 4EYCA 3U97A 1YJN3 1N5HA 2OQEA 3FG1A 2CFDA 2OWPA 4EV5A 1Q824 1RGHA 1VQP3 3HX8A 1W2B2 3FKAA 1CYVA 1RRHA 2QIYA 1VQK3 1WTHA 1YGWA 1UW1A 1KD14 1U8CB 1O7WB 1ROVA 2J8XB 3UNLA 4HVNA 1BRHA 4KVHA 2C4BA 1UUVB 1GMRA 2W2CA 3LXUX 2GBWB 1UCKA 5DREA 1EG9B 4WP5A 3WOEB 1OH0A 1WMOA 3ECFA 3ROBA 1BNEA 1FGQA 1VQQA 1U5OA 4HM7B 3LZAA 3CCU3 3STDA 3HI7A 4MJDA 3X3YA 2CK3H 1WNHA 3BIRA 3WMDA 4RBNA 3EX9A 4XBXA 3X41A 1STDA 1BUQA 1BNIA 1FGMA 1TRPA 1OGXA 3OWSA 4N6MA 1IT8A 1LNHA 4KFEA 3WODG 1EEJA 1I8VA 1Q7Y4 5KP1A 2F5MA 1A90A 2KF4A 3NHXA 4IPBA 1E97A 1LOXA 1BOXA 3VGNA 1J2BA 1B2UA 1JNQA 1LRAA 2H0GA 3HIIA 2L1SA 2HMMB 1GYBA 4LMIA 1Q40A 4BTWA 5HOHA 4GHOA 5A0OB 4O2HA 2UUGC 5AIHA 2YX9A 4O3VA 4FCJA 3M8CA 5IG5A 4HAAA 2HMOB 5JPUA 1TRQA 3MG1A 1LOVA 2XEPA 3BNCA 1MGWA 1ASKA 1JB2A 2E2TA 1I3FA 2F86B 4XDWA 3T8UA 3SXXA 2WGOA 1BSBA 2V1LA 3AHWA 1YJW3 2W56B 3MKIA 1UGHI 2CH9A 1I2FA 3HK4A 3HZPA 3NV0B 4GB5A 4X2HA 1BAOA 2W6JH 4ORLA 4EBGA 1B21A 2CHCA 2CWUA 5JBSA 1W6CA 4HM2B 1W00A 4FMDA 1BSEA 3EC9A 5AEUB 2CFGA 5HGRA 3K7CA 3ZG5A 3NQYA 6STDA 3CCJ3 2E2VA 2XGLA 2XFTA 2WO0A 1I3IA 4R80A 1W6YA 1SARA 2RBIA 1HYFA 5KP3A 3B8LA 1BRIA 3D5IA 4HM1B 3CNMA 1TJDA 3MG2A 2RCDA 1W5ZA 4Q53A 1E3RA 1RNBA 1W02A 3DH2A 3NM2A 2W9PA 1C54A 4LEHA 5IF6A 2OOVC 1B2MA 3URPA 3WA2X 1LOWA 3DM8A 1S723 1GMPA 2OOVA 2F5WA 1RSNA 1GD3A 1M1K4 3NXJA 2W56A 4BL3A 1K734 3NV0A 1E3VA 1L5GB 2GBXB 1IVUA 3WR2A 1IYYA 5G2GA 3D9RA 1BRJA 3PYJA 4N6TA 2Y73A 2Y74A 1BNJA 5M19A 1BRNL 1AR0A 2R4IA 1WQLB 1OCVA 3S29A 3SOAA 1PFPA 3KSPA 2W0QA 1BIRA 1RN7A 2IA7A 4HM5B 7GSPA 1OGZA 3UL6A 2WGQA 3G16A 2W9QA 1RNTA 1DETA 4EXRA 3F8HA 3BNDA 3K63A 3N9HA 2O9UX 3G713 1EKMA 3LYGA 3D4AA 2FXTA 4OK0A 1STFI 4FMCA 2CIUA 3DGNA 2O3OA 4KFFA 3IMAB 3ZG0A 1W4NA 1JV2B 4BTXA 2C11A 2I9WA 4L8OA 4R4KA 1O7PB 1JB4A 1LQGC 2AADA 1MOLA 3D79A 3DUKA 1T5YA 1V74A 2GSPA 3DGLA 5EVHA 1IV7A 4HM0B 5AI1A 1RGGA 3DGOA 1G0TA 5BVBA 2IY2A 3F9SA 3FSDA 1RGFA 3DGYA 1B27A 5D82A 1BNRA 3CCV3 4PEJA 4HM3B 1I2GA 1TUHA 2AAEA 1GSPA 4J5KA 1IVWA 3G0KA 4XB5A 1VQ43 2LQVA 4JF8A 5G1LA 3KKGA 1YHQ3 1VQO3 5BXQA 1OUNA 3Q2PA 2OQEC 2KF3A 1LNIA 2QA43 1M9GA 1RN1A 3T8NA 1QAFA 1HKXA 1W7CA 4L7KA 4CPKA 1NJI4 1ULJB 1DVDA 1UDII 1KWIA 3SLUA 3RNTA 4FCMA 4WYKB 1PU4A 2QGUA 2CW9A 1MWRA 2KCDA 2OTJ3 2Z77A 1O7MB 3BLZA 4HM6B 1Z1SA 2CX1A 1GY6A 2RFRA 1D6UA 2H0IA 2W04A 3LH4A 5D83A 1O7GB 2ZA4A 4STDA 1Q42A 4R9KA 5IEOA 1TU5A 1OHOA 3AHSA 1MWTA 3A76A 5AYRB 5STDA 2ZL8A 1A67A 3NBBA 1RMSA 4U13A 1QMAA 1PYLA 2Z76A 1NDOB 1O7HB 1BANA 2CC3A 2RSXA 1RKYA 1JKGB 3CPOA 3Q1CA 2F98A 5AEWB 2CFKA 2SARA 3FCSB 4HZ9B 4HJLB 3CCL3 1RGLA 2SBLA 1FW7A 1OHSA 4WYKA 1IU7A 2CKFB 3X42A 3AGNA 1YI23 1A2PA 3PS8A 3CC23 3RGRA 4NPBA 3PXMA 3FH1A 2XGNA 2HMJB 3GZBA 1IVXA 1EA2A 3EN1B 3PZWA 1RCLA 1SIHA 5D81A 4BTYA 6GSPA 2OTL3 1X1WA 5LC6A 4GL6A 3CD63 1IDPA 4LZIA 4EV2A 3FG3A 5IG3A 4EC6A 1TFOA 1JBTA 4XDVA 1OF5B 4NHFA 2ZHXB 4MMYB 3FZWA 1GD4A 1Q7HA 4N6V0 1RHLA 4OUQA 3MWZA 3K0ZA 1JKGA 2GU1A 4QWTA 1I0VA 2KRTA 3HOHA 2CWVA 5IG4A 1GY5A 2R41A 2XSOB 1NB3I 4KFDA 1Y4KA 2STDA 1FGTA 1RLSA 2XFSA 5DRVA 3J7Yd 1JJ22 2GEYA 2HMNB 1SPUA 1ZS7A 3L0RA 3DY5A 1IV9A 1KSIA 1I70A 3F8XA 1S5AA 4DKIA 8RNTA 1JBRA 1IT7A 1BSAA 1JRQA 4AKYA 4WWUC 3SYUA 3V99A 1PY3A 2BIRA 1NWWA 1RGCA 3CCR3 3EB8A 3T0UA 3I563 1GOVA 2KF6A 5IEPA 1MNLA 1SIIA 5ELUA 1AY7A 4TX4A 3F14A 2HMKB 4MMXB 1FUSA 1I0XA 4ILFA 4WHAA 4I5QA 4BL2A 1FUWA 1EUIC 1OHPA 2BMOB 2YFLB 4CJNA 2FNQA 5M1AA 1BVIA 3KZTA 3LTBA 1W01A 1BNSA 3FF0A 4HKVB 4MEIA 4N6LA 2IMJA 4GSPA 3OW22 2CG1A 3GZXB 1RTUA 3I553 1CH0A 1IQYA 4I4KA 1EQKA 2P05A 2ZDJA 2RNTA 3UJMA 6RNTA 5CK6A 2WOFA 4IT7A 3JUPA 1BNGA 3GRDA 1V58A 7RNTA 3CC43 3FLJA 1FA3A 1N9EA 1K28A 4RNYA 2Q07A 1JZDA 1RGEA 1UUGB 1CQSA 3DMCA 1ZO2A 3GSPA 5GSPA 1T2HA 1FUTA 1N9JA 4JRFA 4LGQA 3LOYA 1A2KA 1DVCA 1YGEA 2CG0A 2GXFA 1RCKA 1W2ZA 2A15A 4XBYA 4H3UA 2H0HA 2F99A 1WMNA 3LTDA 3GAXA 4BIRA 3GZYB 5TGNA 1AVLA 1CEWI 3NX0A 4HBRA 2LYXA 3CCQ3 7STDA 2GU3A 3V92A 5AIIA 1KC84 1T3BA 3E99A 3KN4A 3WHOA 5CF2A 4FMBA 1NNVA 3RDEA 3B4OA 1CYUA 2BT3A 3JVCA 1Q9EA 1RRLA 1B2XA 1NB5I 3CU3A 4XBTA 3BU4A 4MMZB 2ML6A 4R1KA 2XR8B 3GWRA 3RGAA 2YFIB 1BRSA 1TFKA 2D42A 1OACA 3OWYA 1R4CA 3F40A 3SEDA 2GEXA 1BSCA 1LOYA 3CCE3 1YNVX 5EEOA 3G4S3 1M1XB 2L4VA 1YIT3 1FYSA 1DMQA 3OXAA 4RNZA 3GZRA 5CLKA 1GOUA 1RGAA 2MF7A 3EBYA 3PCRA 1O7NB 1G02A 5BIRA 1K41A 4RNTA 3TDGA 1V57A 4WFOA 1HU9A 3KCHA 3O8YA 5IW9A 1Q40B 3IPTA 3A5EA 1VQ93 5AIFA 2CFWA 1LXEA 1IK3A 2IUKA 3LT8A 5EQLA 4G1MB 5BU4A 1ZX2A 2OCTA 2W03A 2D1WA 1GOYA 2BU4A 2IYJA 1FZUA 3H51A 1D6YA 2WOHA 2XSHB 3OWUA 3PCSA 4EW5A 3WA3A 1F8NA 3EQQB 2K3DA 1IQXA 2BMRB 2KAAA 3DXOA 1ROAA 3EBTA 1UUWB 3CCM3 3EE1A 1C7HA 5IERA 3OX9A 4IIAA 3X3ZA 3LTCA 3NBRA 1IVVA 3BNBA 3BNEA 4KZ1A 3FG4A 1M904 4OVMA 2HOHA 1UCIA 2INXA 1JZOA 2JDIH 3NUVA 1RGKA 3NM7A 1B3SA 1RDSA 2FGTA 4HYZA 1VZZA 5G1KA 4HM8B 1GS3A 5FW5A 1DE3A 2XRXB 1LVNA 2PZVA 3X40A 1JN5B 1HZ1A 1BUJA 1W6GA 4LSOA 1G96A 1VQ63 1Q864 4FCZA 2XH9A 4K90B 3SOYA 8CHOA 3F7SA 2CX0A 3HIGA 3WDGB 2Z7AA 3CPW2 1VQ53 4J8TA 1LQMB 1X1XA 4AKZA 2K54A 1D6ZA 3PGBA 3Q3FA 1ULIB 1JBSA 5JPPA 2C10A 1UCLA
chains in the Genus database with same CATH topology
3BIRA 2RNTA 6RNTA 1GMQA 5RNTA 1BNGA 7RNTA 2KF3A 1BNIA 1LNIA 1RN1A 1TRPA 1X1YA 1I8VA 1RGEA 1YVSA 2F5MA 1BU4A 2KF4A 3RNTA 1B2SA 1BOXA 1B2UA 1AQZA 1LRAA 3GSPA 5GSPA 1T2HA 1UCJA 4GHOA 1FUTA 4HOHA 5HOHA 1BRGA 1RCKA 1T2IA 1X1UA 4HAAA 4BIRA 2ZA4A 1TRQA 3D5GA 1BGSA 3AHSA 1LOVA 1MGWA 1TTOA 1I3FA 1RMSA 1ZGXA 3WHOA 1BSBA 1PYLA 3AHWA 1BANA 1Q9EA 1I2FA 1BAOA 1B2XA 1B21A 3BU4A 1BSEA 2SARA 4J5GA 1B2ZA 1BRSA 1RGLA 1FW7A 1I3IA 3AGNA 1A2PA 1SARA 1BSCA 2RBIA 1LOYA 1HYFA 3D5IA 1BRIA 1YNVX 9RNTA 1I2EA 1RCLA 1BNFA 1FYSA 1RNBA 3DH2A 6GSPA 1RGAA 1GOUA 2KF5A 1X1WA 1C54A 1G02A 5BIRA 4RNTA 1B2MA 3URPA 1MGRA 1LOWA 4BU4A 1GMPA 1JBTA 2F5WA 1RSNA 3KCHA 3A5EA 1RHLA 3WR2A 1IYYA 1BRJA 1I0VA 3HOHA 1BNJA 1BRNL 5BU4A 1GOYA 1R4YA 2BU4A 1BIRA 1RLSA 1BSDA 1FZUA 7GSPA 1RNTA 1DETA 2KAAA 3AGOA 1B20A 8RNTA 1I70A 1BRKA 1JBRA 2F56A 1BSAA 3D4AA 3SYUA 1RN4A 1PY3A 2BIRA 2F4YA 1RGCA 2HOHA 1GOVA 1UCIA 2KF6A 1RGKA 1AY7A 1B3SA 1RDSA 1RGHA 1FUSA 1I0XA 1DE3A 1YGWA 2AADA 2GSPA 1HZ1A 1RGGA 1BRHA 1BUJA 1BVIA 1RGFA 2C4BA 1GMRA 1BNSA 3DGYA 1B27A 1UCKA 4GSPA 1BNEA 1BNRA 1RTUA 1X1XA 1I2GA 2AAEA 1GSPA 3Q3FA 1CH0A 4J5KA 1JBSA 1UCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIR A;  2RNT A;  6RNT A;  1GMQ A;  5RNT A;  1BNG A;  7RNT A;  2KF3 A;  1BNI A;  1LNI A;  1RN1 A;  1TRP A;  1X1Y A;  1I8V A;  1RGE A;  1YVS A;  2F5M A;  1BU4 A;  2KF4 A;  3RNT A;  1B2S A;  1BOX A;  1B2U A;  1AQZ A;  1LRA A;  3GSP A;  5GSP A;  1T2H A;  1UCJ A;  4GHO A;  1FUT A;  4HOH A;  5HOH A;  1BRG A;  1RCK A;  1T2I A;  1X1U A;  4HAA A;  4BIR A;  2ZA4 A;  1TRQ A;  3D5G A;  1BGS A;  3AHS A;  1LOV A;  1MGW A;  1TTO A;  1I3F A;  1RMS A;  1ZGX A;  3WHO A;  1BSB A;  1PYL A;  3AHW A;  1BAN A;  1Q9E A;  1I2F A;  1BAO A;  1B2X A;  1B21 A;  3BU4 A;  1BSE A;  2SAR A;  4J5G A;  1B2Z A;  1BRS A;  1RGL A;  1FW7 A;  1I3I A;  3AGN A;  1A2P A;  1SAR A;  1BSC A;  2RBI A;  1LOY A;  1HYF A;  3D5I A;  1BRI A;  1YNV X;  9RNT A;  1I2E A;  1RCL A;  1BNF A;  1FYS A;  1RNB A;  3DH2 A;  6GSP A;  1RGA A;  1GOU A;  2KF5 A;  1X1W A;  1C54 A;  1G02 A;  5BIR A;  4RNT A;  1B2M A;  3URP A;  1MGR A;  1LOW A;  4BU4 A;  1GMP A;  1JBT A;  2F5W A;  1RSN A;  3KCH A;  3A5E A;  1RHL A;  3WR2 A;  1IYY A;  1BRJ A;  1I0V A;  3HOH A;  1BNJ A;  1BRN L;  5BU4 A;  1GOY A;  1R4Y A;  2BU4 A;  1BIR A;  1RLS A;  1BSD A;  1FZU A;  7GSP A;  1RNT A;  1DET A;  2KAA A;  3AGO A;  1B20 A;  8RNT A;  1I70 A;  1BRK A;  1JBR A;  2F56 A;  1BSA A;  3D4A A;  3SYU A;  1RN4 A;  1PY3 A;  2BIR A;  2F4Y A;  1RGC A;  2HOH A;  1GOV A;  1UCI A;  2KF6 A;  1RGK A;  1AY7 A;  1B3S A;  1RDS A;  1RGH A;  1FUS A;  1I0X A;  1DE3 A;  1YGW A;  2AAD A;  2GSP A;  1HZ1 A;  1RGG A;  1BRH A;  1BUJ A;  1BVI A;  1RGF A;  2C4B A;  1GMR A;  1BNS A;  3DGY A;  1B27 A;  1UCK A;  4GSP A;  1BNE A;  1BNR A;  1RTU A;  1X1X A;  1I2G A;  2AAE A;  1GSP A;  3Q3F A;  1CH0 A;  4J5K A;  1JBS A;  1UCL A; 
#chains in the Genus database with same CATH topology
 3FGY A;  1GMQ A;  1JB5 A;  3MSO A;  3NBJ A;  4RZM A;  5CXO A;  1FGO A;  2HML B;  1US1 A;  2YFJ B;  5IG0 A;  5RNT A;  3MG3 A;  1UI7 A;  3F7X A;  3ZFZ A;  1X1Y A;  2K0M A;  4HM4 B;  3EHC A;  3AMO B;  1YVS A;  2RGQ A;  1QVG 2;  2CFL A;  2P09 A;  1BU4 A;  2P38 A;  3LML A;  3VF1 A;  1AVK A;  1B2S A;  1AQZ A;  2M7O A;  1IQ8 A;  1FGR A;  1OF5 A;  2MC8 A;  4ZM8 A;  1UCJ A;  2B1X B;  4HOH A;  1QAK A;  3LTA A;  4L8P A;  1BRG A;  4XM4 A;  3U1W A;  1Q81 4;  4H61 A;  3S28 A;  1K9M 4;  1OPY A;  5FGO A;  1JN5 A;  4O8S A;  1T2I A;  5CF1 A;  1X1U A;  3WOF B;  1GY7 A;  3X3X A;  5I97 A;  2BNG A;  1N5P A;  3EF8 A;  2BMQ B;  3D5G A;  1BGS A;  3KE7 A;  1NO3 A;  3DGM A;  3EJV A;  3UB1 A;  1TTO A;  2QEX 3;  3CNX A;  1ZGX A;  1DYU A;  3SX1 A;  3K9M C;  3LT9 A;  2BO9 B;  3JUO A;  4FMA A;  1A2V A;  2P0M A;  2BHM A;  4HZB B;  1MWS A;  4N6O B;  5AIG A;  4FR9 A;  3CXC 2;  3CC7 3;  1YVB I;  1DMN A;  3G6E 3;  4K1U A;  4NRE A;  4R9L A;  1QJG A;  1KQS 2;  3I0Y A;  3AMO A;  4J5G A;  1B2Z A;  1UI8 A;  3G8Z A;  2KXG A;  3D3L A;  1DMM A;  2P0X A;  3K5T A;  3KFQ C;  2Z6B A;  3MPH A;  2CWT A;  3KSE D;  3S27 A;  3BB9 A;  1UGI A;  4K61 A;  3UL5 A;  3Q90 A;  5LC7 A;  9RNT A;  4K1V A;  1AV4 A;  3ER7 A;  3S67 A;  1MWU A;  4KT3 B;  1I2E A;  1BNF A;  2E2U A;  4LYL B;  1NU3 A;  4CDL A;  2KF5 A;  1YIJ 3;  3QK9 A;  1ISK A;  1MGR A;  2UX0 A;  2IUJ A;  3JUM A;  4BU4 A;  3FF2 A;  1SJW A;  3H3H A;  1VQL 3;  3JUN A;  3KII A;  1N8Q A;  3S5C A;  1K8A 4;  1RJO A;  5M18 A;  3NQZ A;  1VQM 3;  2JQ5 A;  3CME 3;  3B7C A;  2XF3 A;  3DZL A;  3EN8 A;  5IEN A;  3MYT A;  1YJ9 3;  2ML5 A;  4CCV A;  4AEQ A;  1QAL A;  4J9A A;  1TP6 A;  5ELJ A;  3N54 B;  1VQN 3;  1R4Y A;  1N8R 4;  2B24 B;  1BSD A;  3MHE A;  3IJE B;  1TIJ A;  2PNC A;  3B4P A;  3ALA A;  3AGO A;  3JUQ A;  3N8B A;  1VQ8 3;  1QVF 2;  1B20 A;  1WMP A;  3VSY A;  1BRK A;  2F56 A;  1SQW A;  3CCS 3;  3V98 A;  4N6N B;  4N3V A;  4X2O A;  1VQ7 3;  1RN4 A;  3CMA 3;  4N6U A;  2F4Y A;  4O02 B;  3OV4 A;  3QRD A;  5KP4 A;  2UGI A;  5AYS C;  3SVA A;  4EYC A;  3U97 A;  1YJN 3;  1N5H A;  2OQE A;  3FG1 A;  2CFD A;  2OWP A;  4EV5 A;  1Q82 4;  1RGH A;  1VQP 3;  3HX8 A;  1W2B 2;  3FKA A;  1CYV A;  1RRH A;  2QIY A;  1VQK 3;  1WTH A;  1YGW A;  1UW1 A;  1KD1 4;  1U8C B;  1O7W B;  1ROV A;  2J8X B;  3UNL A;  4HVN A;  1BRH A;  4KVH A;  2C4B A;  1UUV B;  1GMR A;  2W2C A;  3LXU X;  2GBW B;  1UCK A;  5DRE A;  1EG9 B;  4WP5 A;  3WOE B;  1OH0 A;  1WMO A;  3ECF A;  3ROB A;  1BNE A;  1FGQ A;  1VQQ A;  1U5O A;  4HM7 B;  3LZA A;  3CCU 3;  3STD A;  3HI7 A;  4MJD A;  3X3Y A;  2CK3 H;  1WNH A;  3BIR A;  3WMD A;  4RBN A;  3EX9 A;  4XBX A;  3X41 A;  1STD A;  1BUQ A;  1BNI A;  1FGM A;  1TRP A;  1OGX A;  3OWS A;  4N6M A;  1IT8 A;  1LNH A;  4KFE A;  3WOD G;  1EEJ A;  1I8V A;  1Q7Y 4;  5KP1 A;  2F5M A;  1A90 A;  2KF4 A;  3NHX A;  4IPB A;  1E97 A;  1LOX A;  1BOX A;  3VGN A;  1J2B A;  1B2U A;  1JNQ A;  1LRA A;  2H0G A;  3HII A;  2L1S A;  2HMM B;  1GYB A;  4LMI A;  1Q40 A;  4BTW A;  5HOH A;  4GHO A;  5A0O B;  4O2H A;  2UUG C;  5AIH A;  2YX9 A;  4O3V A;  4FCJ A;  3M8C A;  5IG5 A;  4HAA A;  2HMO B;  5JPU A;  1TRQ A;  3MG1 A;  1LOV A;  2XEP A;  3BNC A;  1MGW A;  1ASK A;  1JB2 A;  2E2T A;  1I3F A;  2F86 B;  4XDW A;  3T8U A;  3SXX A;  2WGO A;  1BSB A;  2V1L A;  3AHW A;  1YJW 3;  2W56 B;  3MKI A;  1UGH I;  2CH9 A;  1I2F A;  3HK4 A;  3HZP A;  3NV0 B;  4GB5 A;  4X2H A;  1BAO A;  2W6J H;  4ORL A;  4EBG A;  1B21 A;  2CHC A;  2CWU A;  5JBS A;  1W6C A;  4HM2 B;  1W00 A;  4FMD A;  1BSE A;  3EC9 A;  5AEU B;  2CFG A;  5HGR A;  3K7C A;  3ZG5 A;  3NQY A;  6STD A;  3CCJ 3;  2E2V A;  2XGL A;  2XFT A;  2WO0 A;  1I3I A;  4R80 A;  1W6Y A;  1SAR A;  2RBI A;  1HYF A;  5KP3 A;  3B8L A;  1BRI A;  3D5I A;  4HM1 B;  3CNM A;  1TJD A;  3MG2 A;  2RCD A;  1W5Z A;  4Q53 A;  1E3R A;  1RNB A;  1W02 A;  3DH2 A;  3NM2 A;  2W9P A;  1C54 A;  4LEH A;  5IF6 A;  2OOV C;  1B2M A;  3URP A;  3WA2 X;  1LOW A;  3DM8 A;  1S72 3;  1GMP A;  2OOV A;  2F5W A;  1RSN A;  1GD3 A;  1M1K 4;  3NXJ A;  2W56 A;  4BL3 A;  1K73 4;  3NV0 A;  1E3V A;  1L5G B;  2GBX B;  1IVU A;  3WR2 A;  1IYY A;  5G2G A;  3D9R A;  1BRJ A;  3PYJ A;  4N6T A;  2Y73 A;  2Y74 A;  1BNJ A;  5M19 A;  1BRN L;  1AR0 A;  2R4I A;  1WQL B;  1OCV A;  3S29 A;  3SOA A;  1PFP A;  3KSP A;  2W0Q A;  1BIR A;  1RN7 A;  2IA7 A;  4HM5 B;  7GSP A;  1OGZ A;  3UL6 A;  2WGQ A;  3G16 A;  2W9Q A;  1RNT A;  1DET A;  4EXR A;  3F8H A;  3BND A;  3K63 A;  3N9H A;  2O9U X;  3G71 3;  1EKM A;  3LYG A;  3D4A A;  2FXT A;  4OK0 A;  1STF I;  4FMC A;  2CIU A;  3DGN A;  2O3O A;  4KFF A;  3IMA B;  3ZG0 A;  1W4N A;  1JV2 B;  4BTX A;  2C11 A;  2I9W A;  4L8O A;  4R4K A;  1O7P B;  1JB4 A;  1LQG C;  2AAD A;  1MOL A;  3D79 A;  3DUK A;  1T5Y A;  1V74 A;  2GSP A;  3DGL A;  5EVH A;  1IV7 A;  4HM0 B;  5AI1 A;  1RGG A;  3DGO A;  1G0T A;  5BVB A;  2IY2 A;  3F9S A;  3FSD A;  1RGF A;  3DGY A;  1B27 A;  5D82 A;  1BNR A;  3CCV 3;  4PEJ A;  4HM3 B;  1I2G A;  1TUH A;  2AAE A;  1GSP A;  4J5K A;  1IVW A;  3G0K A;  4XB5 A;  1VQ4 3;  2LQV A;  4JF8 A;  5G1L A;  3KKG A;  1YHQ 3;  1VQO 3;  5BXQ A;  1OUN A;  3Q2P A;  2OQE C;  2KF3 A;  1LNI A;  2QA4 3;  1M9G A;  1RN1 A;  3T8N A;  1QAF A;  1HKX A;  1W7C A;  4L7K A;  4CPK A;  1NJI 4;  1ULJ B;  1DVD A;  1UDI I;  1KWI A;  3SLU A;  3RNT A;  4FCM A;  4WYK B;  1PU4 A;  2QGU A;  2CW9 A;  1MWR A;  2KCD A;  2OTJ 3;  2Z77 A;  1O7M B;  3BLZ A;  4HM6 B;  1Z1S A;  2CX1 A;  1GY6 A;  2RFR A;  1D6U A;  2H0I A;  2W04 A;  3LH4 A;  5D83 A;  1O7G B;  2ZA4 A;  4STD A;  1Q42 A;  4R9K A;  5IEO A;  1TU5 A;  1OHO A;  3AHS A;  1MWT A;  3A76 A;  5AYR B;  5STD A;  2ZL8 A;  1A67 A;  3NBB A;  1RMS A;  4U13 A;  1QMA A;  1PYL A;  2Z76 A;  1NDO B;  1O7H B;  1BAN A;  2CC3 A;  2RSX A;  1RKY A;  1JKG B;  3CPO A;  3Q1C A;  2F98 A;  5AEW B;  2CFK A;  2SAR A;  3FCS B;  4HZ9 B;  4HJL B;  3CCL 3;  1RGL A;  2SBL A;  1FW7 A;  1OHS A;  4WYK A;  1IU7 A;  2CKF B;  3X42 A;  3AGN A;  1YI2 3;  1A2P A;  3PS8 A;  3CC2 3;  3RGR A;  4NPB A;  3PXM A;  3FH1 A;  2XGN A;  2HMJ B;  3GZB A;  1IVX A;  1EA2 A;  3EN1 B;  3PZW A;  1RCL A;  1SIH A;  5D81 A;  4BTY A;  6GSP A;  2OTL 3;  1X1W A;  5LC6 A;  4GL6 A;  3CD6 3;  1IDP A;  4LZI A;  4EV2 A;  3FG3 A;  5IG3 A;  4EC6 A;  1TFO A;  1JBT A;  4XDV A;  1OF5 B;  4NHF A;  2ZHX B;  4MMY B;  3FZW A;  1GD4 A;  1Q7H A;  4N6V 0;  1RHL A;  4OUQ A;  3MWZ A;  3K0Z A;  1JKG A;  2GU1 A;  4QWT A;  1I0V A;  2KRT A;  3HOH A;  2CWV A;  5IG4 A;  1GY5 A;  2R41 A;  2XSO B;  1NB3 I;  4KFD A;  1Y4K A;  2STD A;  1FGT A;  1RLS A;  2XFS A;  5DRV A;  3J7Y d;  1JJ2 2;  2GEY A;  2HMN B;  1SPU A;  1ZS7 A;  3L0R A;  3DY5 A;  1IV9 A;  1KSI A;  1I70 A;  3F8X A;  1S5A A;  4DKI A;  8RNT A;  1JBR A;  1IT7 A;  1BSA A;  1JRQ A;  4AKY A;  4WWU C;  3SYU A;  3V99 A;  1PY3 A;  2BIR A;  1NWW A;  1RGC A;  3CCR 3;  3EB8 A;  3T0U A;  3I56 3;  1GOV A;  2KF6 A;  5IEP A;  1MNL A;  1SII A;  5ELU A;  1AY7 A;  4TX4 A;  3F14 A;  2HMK B;  4MMX B;  1FUS A;  1I0X A;  4ILF A;  4WHA A;  4I5Q A;  4BL2 A;  1FUW A;  1EUI C;  1OHP A;  2BMO B;  2YFL B;  4CJN A;  2FNQ A;  5M1A A;  1BVI A;  3KZT A;  3LTB A;  1W01 A;  1BNS A;  3FF0 A;  4HKV B;  4MEI A;  4N6L A;  2IMJ A;  4GSP A;  3OW2 2;  2CG1 A;  3GZX B;  1RTU A;  3I55 3;  1CH0 A;  1IQY A;  4I4K A;  1EQK A;  2P05 A;  2ZDJ A;  2RNT A;  3UJM A;  6RNT A;  5CK6 A;  2WOF A;  4IT7 A;  3JUP A;  1BNG A;  3GRD A;  1V58 A;  7RNT A;  3CC4 3;  3FLJ A;  1FA3 A;  1N9E A;  1K28 A;  4RNY A;  2Q07 A;  1JZD A;  1RGE A;  1UUG B;  1CQS A;  3DMC A;  1ZO2 A;  3GSP A;  5GSP A;  1T2H A;  1FUT A;  1N9J A;  4JRF A;  4LGQ A;  3LOY A;  1A2K A;  1DVC A;  1YGE A;  2CG0 A;  2GXF A;  1RCK A;  1W2Z A;  2A15 A;  4XBY A;  4H3U A;  2H0H A;  2F99 A;  1WMN A;  3LTD A;  3GAX A;  4BIR A;  3GZY B;  5TGN A;  1AVL A;  1CEW I;  3NX0 A;  4HBR A;  2LYX A;  3CCQ 3;  7STD A;  2GU3 A;  3V92 A;  5AII A;  1KC8 4;  1T3B A;  3E99 A;  3KN4 A;  3WHO A;  5CF2 A;  4FMB A;  1NNV A;  3RDE A;  3B4O A;  1CYU A;  2BT3 A;  3JVC A;  1Q9E A;  1RRL A;  1B2X A;  1NB5 I;  3CU3 A;  4XBT A;  3BU4 A;  4MMZ B;  2ML6 A;  4R1K A;  2XR8 B;  3GWR A;  3RGA A;  2YFI B;  1BRS A;  1TFK A;  2D42 A;  1OAC A;  3OWY A;  1R4C A;  3F40 A;  3SED A;  2GEX A;  1BSC A;  1LOY A;  3CCE 3;  1YNV X;  5EEO A;  3G4S 3;  1M1X B;  2L4V A;  1YIT 3;  1FYS A;  1DMQ A;  3OXA A;  4RNZ A;  3GZR A;  5CLK A;  1GOU A;  1RGA A;  2MF7 A;  3EBY A;  3PCR A;  1O7N B;  1G02 A;  5BIR A;  1K41 A;  4RNT A;  3TDG A;  1V57 A;  4WFO A;  1HU9 A;  3KCH A;  3O8Y A;  5IW9 A;  1Q40 B;  3IPT A;  3A5E A;  1VQ9 3;  5AIF A;  2CFW A;  1LXE A;  1IK3 A;  2IUK A;  3LT8 A;  5EQL A;  4G1M B;  5BU4 A;  1ZX2 A;  2OCT A;  2W03 A;  2D1W A;  1GOY A;  2BU4 A;  2IYJ A;  1FZU A;  3H51 A;  1D6Y A;  2WOH A;  2XSH B;  3OWU A;  3PCS A;  4EW5 A;  3WA3 A;  1F8N A;  3EQQ B;  2K3D A;  1IQX A;  2BMR B;  2KAA A;  3DXO A;  1ROA A;  3EBT A;  1UUW B;  3CCM 3;  3EE1 A;  1C7H A;  5IER A;  3OX9 A;  4IIA A;  3X3Z A;  3LTC A;  3NBR A;  1IVV A;  3BNB A;  3BNE A;  4KZ1 A;  3FG4 A;  1M90 4;  4OVM A;  2HOH A;  1UCI A;  2INX A;  1JZO A;  2JDI H;  3NUV A;  1RGK A;  3NM7 A;  1B3S A;  1RDS A;  2FGT A;  4HYZ A;  1VZZ A;  5G1K A;  4HM8 B;  1GS3 A;  5FW5 A;  1DE3 A;  2XRX B;  1LVN A;  2PZV A;  3X40 A;  1JN5 B;  1HZ1 A;  1BUJ A;  1W6G A;  4LSO A;  1G96 A;  1VQ6 3;  1Q86 4;  4FCZ A;  2XH9 A;  4K90 B;  3SOY A;  8CHO A;  3F7S A;  2CX0 A;  3HIG A;  3WDG B;  2Z7A A;  3CPW 2;  1VQ5 3;  4J8T A;  1LQM B;  1X1X A;  4AKZ A;  2K54 A;  1D6Z A;  3PGB A;  3Q3F A;  1ULI B;  1JBS A;  5JPP A;  2C10 A;  1UCL A; 
#chains in the Genus database with same CATH homology
 3BIR A;  2RNT A;  6RNT A;  1GMQ A;  5RNT A;  1BNG A;  7RNT A;  2KF3 A;  1BNI A;  1LNI A;  1RN1 A;  1TRP A;  1X1Y A;  1I8V A;  1RGE A;  1YVS A;  2F5M A;  1BU4 A;  2KF4 A;  3RNT A;  1B2S A;  1BOX A;  1B2U A;  1AQZ A;  1LRA A;  3GSP A;  5GSP A;  1T2H A;  1UCJ A;  4GHO A;  1FUT A;  4HOH A;  5HOH A;  1BRG A;  1RCK A;  1T2I A;  1X1U A;  4HAA A;  4BIR A;  2ZA4 A;  1TRQ A;  3D5G A;  1BGS A;  3AHS A;  1LOV A;  1MGW A;  1TTO A;  1I3F A;  1RMS A;  1ZGX A;  3WHO A;  1BSB A;  1PYL A;  3AHW A;  1BAN A;  1Q9E A;  1I2F A;  1BAO A;  1B2X A;  1B21 A;  3BU4 A;  1BSE A;  2SAR A;  4J5G A;  1B2Z A;  1BRS A;  1RGL A;  1FW7 A;  1I3I A;  3AGN A;  1A2P A;  1SAR A;  1BSC A;  2RBI A;  1LOY A;  1HYF A;  3D5I A;  1BRI A;  1YNV X;  9RNT A;  1I2E A;  1RCL A;  1BNF A;  1FYS A;  1RNB A;  3DH2 A;  6GSP A;  1RGA A;  1GOU A;  2KF5 A;  1X1W A;  1C54 A;  1G02 A;  5BIR A;  4RNT A;  1B2M A;  3URP A;  1MGR A;  1LOW A;  4BU4 A;  1GMP A;  1JBT A;  2F5W A;  1RSN A;  3KCH A;  3A5E A;  1RHL A;  3WR2 A;  1IYY A;  1BRJ A;  1I0V A;  3HOH A;  1BNJ A;  1BRN L;  5BU4 A;  1GOY A;  1R4Y A;  2BU4 A;  1BIR A;  1RLS A;  1BSD A;  1FZU A;  7GSP A;  1RNT A;  1DET A;  2KAA A;  3AGO A;  1B20 A;  8RNT A;  1I70 A;  1BRK A;  1JBR A;  2F56 A;  1BSA A;  3D4A A;  3SYU A;  1RN4 A;  1PY3 A;  2BIR A;  2F4Y A;  1RGC A;  2HOH A;  1GOV A;  1UCI A;  2KF6 A;  1RGK A;  1AY7 A;  1B3S A;  1RDS A;  1RGH A;  1FUS A;  1I0X A;  1DE3 A;  1YGW A;  2AAD A;  2GSP A;  1HZ1 A;  1RGG A;  1BRH A;  1BUJ A;  1BVI A;  1RGF A;  2C4B A;  1GMR A;  1BNS A;  3DGY A;  1B27 A;  1UCK A;  4GSP A;  1BNE A;  1BNR A;  1RTU A;  1X1X A;  1I2G A;  2AAE A;  1GSP A;  3Q3F A;  1CH0 A;  4J5K A;  1JBS A;  1UCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...