1TTOA

Crystal structure of the rnase t1 variant r2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHEFRNWNGFDFSVSSPYYEYPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNase T1
publication title Purine activity of RNase T1RV is further improved by substitution of Trp59 by tyrosine
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2004-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1ttoA00
1BU4A 4HOHA 2F56A 1LRAA 1BRHA 1I0XA 1BRKA 2RNTA 1BUJA 3AHSA 1B27A 1BRGA 1RGGA 3AGNA 4GHOA 1RGKA 1RN1A 1RGEA 2AADA 1GOVA 1RGAA 3WR2A 1I3FA 1BRSA 7RNTA 1BNEA 1X1XA 1BSCA 1BAOA 3SYUA 1TRPA 3HOHA 1RCKA 1I2FA 1RGLA 1YVSA 1HYFA 2ZA4A 3A5EA 1BNIA 4RNTA 9RNTA 3URPA 1BSAA 1JBRA 5HOHA 1HZ1A 1GMRA 1RN4A 2BIRA 1T2HA 1RGCA 1RMSA 3BIRA 1B2UA 2BU4A 1BSEA 1AQZA 1BNJA 1RGFA 1C54A 1ZGXA 1R4YA 1B21A 1PY3A 1GSPA 4GSPA 1FYSA 1PYLA 1MGWA 1X1UA 1RHLA 4J5GA 1I2GA 2KF5A 1SARA 1B2ZA 1BRNL 1GOYA 5BU4A 5BIRA 1BNFA 1UCJA 1X1WA 1A2PA 1FW7A 1BNSA 1BOXA 2F4YA 3Q3FA 2RBIA 6GSPA 2F5MA 3D5IA 2KAAA 1BSBA 1BRIA 1BNRA 1I3IA 7GSPA 1JBTA 2KF4A 1UCIA 1G02A 1RSNA 2GSPA 1LOVA 1B2XA 1LOWA 1BRJA 1BGSA 1RLSA 3D4AA 1RNTA 5RNTA 1BANA 1AY7A 1JBSA 1CH0A 4BIRA 2KF6A 1TTOA 1YGWA 1B2SA 6RNTA 1RDSA 1RNBA 1BNGA 1T2IA 3D5GA 1B3SA 1FUSA 2C4BA 1IYYA 3BU4A 1LNIA 1FZUA 4HAAA 1GOUA 1BIRA 3RNTA 1B2MA 1Q9EA 1UCKA 1X1YA 3GSPA 1I2EA 1GMQA 2KF3A 3KCHA 1I0VA 1RGHA 1TRQA 1B20A 1BVIA 1I8VA 1BSDA 1RTUA 3DH2A 1I70A 1GMPA 1DETA 1RCLA 3AHWA 1YNVX 3WHOA 4J5KA 1MGRA 1LOYA 4BU4A 2HOHA 3DGYA 8RNTA 2SARA 3AGOA 1FUTA 2AAEA 2F5WA 1UCLA 1DE3A 5GSPA
chains in the Genus database with same CATH superfamily
4KT3B 4HOHA 3OV4A 3DGLA 1IVWA 4XBXA 1B27A 2CG0A 2HMKB 1RGKA 3MPHA 1RGEA 2AADA 3NXJA 5CF2A 3X41A 3I553 1YIT3 5IENA 2CK3H 5AEUB 1FGRA 4AKYA 3TDGA 1KD14 3BNEA 1BUQA 1FGTA 3NQZA 2L1SA 1N5HA 2OTJ3 1O7WB 1TRPA 3HOHA 1RCKA 1I2FA 1A2VA 1YVSA 3A5EA 1W5ZA 3LTCA 1G0TA 4EYCA 1DMMA 3NBJA 3NM2A 4L8OA 2XR8B 1R4CA 1IDPA 2CG1A 6STDA 5M18A 4IPBA 3CCV3 1JBRA 1GMRA 1RN4A 3CCM3 1DYUA 1T2HA 5AIHA 3CC73 3CC43 3UJMA 3FCSB 2Y73A 3LZAA 2BU4A 1BSEA 1JV2B 3BB9A 3LTBA 1AQZA 1JRQA 1RJOA 5TGNA 1C54A 2RSXA 1W6CA 3DUKA 1GD4A 1FA3A 2OOVC 2FGTA 3CCE3 3CME3 1OHOA 3NQYA 1PY3A 1KQS2 1O7GB 1UUVB 1MGWA 1F8NA 3UB1A 1WMNA 1I2GA 2KF5A 3GZRA 3IJEB 1IVXA 3G0KA 2R4IA 5BXQA 1GOYA 4XDVA 1IT7A 3WOFB 2C11A 1FGQA 1E3RA 1BNFA 5AIGA 2CFLA 1VZZA 3U1WA 1FW7A 3G8ZA 1EQKA 1VQO3 3WMDA 3NUVA 3LT9A 4WHAA 2OWPA 3MYTA 4LYLB 4WFOA 4H3UA 1OGXA 1K8A4 3HX8A 3EC9A 1BNRA 4RNYA 3S5CA 1I3IA 3D79A 1JB4A 1RRLA 1VQ43 1O7HB 1UCIA 2W9PA 5D81A 4NHFA 2GSPA 4HM5B 1WTHA 1QALA 1LOVA 4N6LA 1OF5A 1LOWA 2CWTA 4HM2B 1IQ8A 3FZWA 2CFDA 3H51A 3PZWA 4N6MA 1RLSA 4HJLB 1IT8A 5AIIA 1O7MB 2RCDA 1LXEA 3EX9A 1JZDA 1BANA 1UDII 1W00A 3N8BA 1VQN3 2YX9A 1IU7A 1QAFA 3B4OA 3K9MC 1T5YA 1TTOA 1YGWA 2B1XB 6RNTA 1RDSA 1M1K4 4EXRA 4EV5A 2GBXB 3IPTA 3CPOA 3PYJA 1IYYA 3KKGA 3EB8A 3T8NA 3CCQ3 4N6V0 5IW9A 1EG9B 1OCVA 1FGOA 2BNGA 2RGQA 4FR9A 5CK6A 3X3YA 1JZOA 3V99A 3CD63 5M19A 3SOAA 3ER7A 1B2MA 1D6ZA 3F14A 1Q9EA 1GMQA 1PFPA 2KF3A 3NX0A 1J2BA 4KFFA 1EKMA 2IYJA 3GAXA 4O8SA 2UX0A 1N9EA 3X3ZA 1AR0A 1RTUA 3E99A 1RCLA 3AHWA 5IG5A 2BT3A 4J5KA 2HMJB 3HIGA 3NBBA 4BU4A 4KFDA 2I9WA 3K63A 4EV2A 2SARA 3FKAA 4I5QA 1LNHA 3AGOA 2P09A 1FUTA 1GYBA 2BMOB 1ZX2A 2OQEA 2W2CA 1CEWI 4ILFA 1L5GB 3CC23 1GD3A 2QGUA 1QJGA 2F56A 2W6JH 3DZLA 1BRKA 1S723 3JUPA 5AYSC 2W03A 4MJDA 1W02A 4XBTA 1JB2A 2XRXB 4HVNA 2GBWB 2BHMA 1BNEA 1X1XA 1NNVA 1MOLA 1NWWA 2JDIH 1BSCA 1UI7A 1SQWA 3SYUA 2ZA4A 1RGLA 3HZPA 3CNXA 4N6NB 5LC6A 1IQXA 5ELUA 3WODG 3NV0A 3MG1A 3ZG0A 1US1A 4OVMA 3Q90A 4FMDA 4RNTA 2IUJA 1NDOB 3EJVA 3CCR3 1BSAA 3G4S3 1HZ1A 4LZIA 3UL5A 1NJI4 3FLJA 4HM6B 1RMSA 1S5AA 3S27A 1B2UA 2E2VA 2O3OA 3SVAA 1WMPA 1UW1A 4DKIA 1YIJ3 1TJDA 1RGFA 1QVG2 1Q40B 3K5TA 4ORLA 1Q824 1R4YA 1A2KA 1B21A 1KSIA 2H0HA 2P38A 1N8QA 1OACA 1FYSA 2L4VA 3EQQB 1D6YA 1W2ZA 1IVVA 1DMNA 2O9UX 2INXA 2E2UA 1MWRA 1SARA 2LQVA 2ZHXB 3DY5A 3SLUA 2CFWA 3SOYA 3J7Yd 1M1XB 1GY7A 2MC8A 1X1WA 5I97A 3OWSA 5CF1A 3HK4A 2F4YA 3BLZA 5HGRA 3Q3FA 1WQLB 3WA2X 1CYUA 3PS8A 1TUHA 3ECFA 2XGNA 1JKGB 2F5MA 3EF8A 4R9LA 3RGAA 4STDA 1MNLA 1VQP3 2YFLB 1AVKA 1JN5B 1BSBA 4K1UA 4OUQA 5JBSA 1BRIA 1YHQ3 1W7CA 3GRDA 3FH1A 4FCJA 3A76A 5G2GA 2KF4A 1SIHA 2BMQB 3MSOA 1DVCA 3F40A 1NB5I 1DMQA 4MMZB 2H0GA 4R9KA 1B2XA 2STDA 4N6TA 1ULJB 1BRJA 3D9RA 2XSOB 4FMAA 5AYRB 1LOXA 3DGOA 3LTDA 4KFEA 3S67A 5JPPA 3KFQC 2WGOA 3OXAA 3GZXB 4BIRA 2PNCA 1UGHI 2PZVA 4FCZA 4WYKA 1B2SA 3QRDA 1K9M4 1T2IA 1QMAA 3D5GA 1B3SA 1U8CB 3BNDA 5IF6A 2QIYA 2K0MA 3BU4A 1GS3A 3B8LA 3STDA 1Q7HA 2XGLA 5IG3A 1QAKA 1LQMB 1Y4KA 1O7NB 2A15A 2R41A 3CNMA 2GEXA 3GSPA 4KVHA 1IVUA 3JUMA 1I2EA 2OQEC 4XDWA 3ROBA 2WGQA 5CXOA 2B24B 7STDA 2F86B 3MG2A 2CC3A 3K0ZA 1I8VA 1BSDA 2KRTA 2W04A 2XFSA 3KE7A 1I70A 4MMXB 1DETA 3FG3A 1YNVX 1NO3A 3WHOA 1MWUA 4HBRA 2HOHA 2HMLB 2GU3A 1UGIA 1IK3A 1U5OA 5KP4A 4HKVB 5GSPA 1VQL3 1OGZA 2J8XB 3DGMA 5EVHA 5IEOA 4N3VA 3SEDA 1BRHA 1I0XA 1W2B2 5AIFA 1BUJA 1BRGA 1RGGA 4GHOA 2GEYA 2WOHA 2LYXA 2F99A 1RN1A 2W56B 1V58A 3PGBA 4K90B 5AI1A 4XB5A 2FXTA 1Q814 3OX9A 5D83A 3ZG5A 1IV9A 1TFKA 2GU1A 2QA43 1MWSA 1WNHA 4EW5A 2XH9A 1JB5A 4J8TA 1KC84 4HM3B 1QVF2 1VQ73 1YJW3 3I0YA 2OCTA 3DM8A 2CX0A 1BAOA 2SBLA 5EQLA 1HYFA 1E3VA 4O3VA 3ALAA 3CCJ3 1AVLA 5G1KA 2HMNB 1EA2A 3SX1A 2UGIA 1SPUA 3BNCA 4AEQA 9RNTA 1OF5B 3URPA 5AEWB 4WP5A 4KZ1A 3PCSA 4I4KA 1FUWA 3BIRA 3G6E3 2Q07A 3AMOA 4NPBA 3DGNA 4K61A 4XM4A 1O7PB 3UL6A 1WMOA 2ZL8A 2HMMB 3RGRA 3LMLA 4N6UA 4TX4A 1N9JA 3LH4A 1X1UA 4GSPA 4CPKA 3KN4A 4LMIA 1M904 1IQYA 5M1AA 1BRNL 5IG0A 2CHCA 2CIUA 1ROVA 2XSHB 1YJ93 2CFGA 1G96A 1TFOA 5BIRA 1UCJA 2UUGC 2WOFA 3LXUX 4HM7B 4BTXA 1A2PA 3EBTA 8CHOA 3GWRA 2RBIA 4CCVA 3KIIA 3OWYA 6GSPA 2KAAA 4LEHA 3F8HA 7GSPA 1JBTA 4X2HA 1ROAA 1D6UA 1K41A 5JPUA 1G02A 2CWUA 1RSNA 4O2HA 1Q7Y4 1BGSA 4EBGA 1W01A 1RNTA 2F98A 3M8CA 1V57A 2IY2A 1YVBI 2YFJB 1W6GA 3Q1CA 4BL2A 4WWUC 4MEIA 1RRHA 4Q53A 3VGNA 4CJNA 4FMCA 2ZDJA 2XF3A 1GY6A 1RNBA 4JRFA 4HM0B 1OPYA 1NU3A 1TIJA 1FUSA 2ML5A 3LT8A 5IG4A 1VQ83 3HIIA 1LNIA 2V1LA 1FZUA 4FMBA 3EHCA 3EBYA 3CCU3 3PCRA 4R1KA 1GOUA 5KP1A 3FGYA 2BO9B 3NV0B 4EC6A 2Z77A 3SXXA 4HYZA 1ISKA 1UCKA 4IT7A 3WDGB 5ELJA 3T8UA 4HM1B 1TU5A 4L7KA 1I0VA 3N54B 2P0XA 1BVIA 2XEPA 3X3XA 2C10A 4K1VA 3VSYA 2IMJA 1ASKA 5STDA 3FSDA 5IERA 1MGRA 1LOYA 3WA3A 3DGYA 3LTAA 5EEOA 8RNTA 1YI23 2AAEA 2BMRB 1FGMA 2F5WA 3MWZA 1DE3A 3PXMA 5CLKA 4IIAA 1W4NA 5FW5A 1BU4A 4RBNA 4BTYA 2Z76A 1LRAA 2RNTA 1EEJA 4U13A 5BVBA 3AHSA 3AGNA 3ZFZA 3JUOA 4H61A 1K734 1VQQA 4JF8A 1GOVA 3F9SA 2K3DA 1RGAA 3I563 3CXC2 2Y74A 3WR2A 3OW22 1I3FA 1OUNA 1BRSA 1Q42A 7RNTA 3EE1A 3MHEA 1C7HA 2QEX3 4R4KA 3HI7A 3CCS3 2W56A 3N9HA 1CYVA 2H0IA 2P05A 2M7OA 3L0RA 2Z6BA 4PEJA 1N8R4 3RDEA 2IUKA 1BNIA 3EN8A 2IA7A 2WO0A 4RNZA 3CMA3 3DXOA 1CQSA 5G1LA 3LOYA 3NHXA 4G1MB 5HOHA 2BIRA 4X2OA 4L8PA 1RGCA 3KZTA 1VQM3 5FGOA 1OHSA 3FG4A 1JJ22 2ML6A 2W0QA 1BNJA 2KXGA 1T3BA 3G713 4BTWA 2GXFA 1VQK3 1ZGXA 2YFIB 3NM7A 4WYKB 4XBYA 1GSPA 1ULIB 2D42A 1PYLA 1VQ93 4QWTA 3FF0A 2CH9A 1RHLA 4J5GA 4NREA 1NB3I 2KCDA 1B2ZA 3S29A 2FNQA 1ZS7A 2P0MA 4GL6A 3H3HA 5BU4A 1TP6A 1A90A 1JNQA 3KSED 2OOVA 3V98A 3KSPA 5DREA 4CDLA 1Z1SA 3LYGA 1BNSA 1BOXA 4HZBB 2CWVA 3MKIA 2XFTA 3D3LA 3D5IA 3JUQA 1UUWB 5DRVA 5IEPA 2Z7AA 1LVNA 1OH0A 2W9QA 1V74A 3FF2A 1RN7A 1VQ53 2RFRA 3O8YA 1GY5A 3GZBA 4O02B 3DMCA 3BNBA 1PU4A 3IMAB 3CCL3 2JQ5A 4ZM8A 1YJN3 3S28A 1ZO2A 3D4AA 3F8XA 3B4PA 3QK9A 1VQ63 1EUIC 3VF1A 2D1WA 1YGEA 1UUGB 3X42A 5RNTA 4LSOA 4HM4B 4FCMA 4GB5A 1AY7A 1SIIA 3Q2PA 4BL3A 1DVDA 1JBSA 1CH0A 1Q40A 2KF6A 1HU9A 1STDA 2CX1A 3EN1B 3JVCA 1RKYA 2K54A 1W6YA 1BNGA 1Q864 2C4BA 4N6OB 3WOEB 2E2TA 3X40A 2MF7A 3FG1A 1MWTA 3B7CA 4R80A 5KP3A 1E97A 1AV4A 2CFKA 3CU3A 3K7CA 4HAAA 1A67A 4LGQA 1HKXA 4AKZA 1IV7A 1BIRA 5D82A 3JUNA 3OWUA 1JKGA 3RNTA 1N5PA 5LC7A 1LQGC 2CKFB 1STFI 2HMOB 1JN5A 3NBRA 1X1YA 3GZYB 4MMYB 3UNLA 3KCHA 1KWIA 4RZMA 1RGHA 1TRQA 1B20A 3CPW2 2OTL3 3DH2A 1GMPA 1M9GA 3AMOB 4HM8B 4J9AA 4OK0A 3MG3A 1SJWA 4HZ9B 3U97A 3V92A 1UI8A 5A0OB 3G16A 3T0UA 3F7XA 1K28A 1OHPA 1UCLA 3F7SA 2CW9A
chains in the Genus database with same CATH topology
1BU4A 4HOHA 2F56A 1LRAA 1BRHA 1I0XA 1BRKA 2RNTA 1BUJA 3AHSA 1B27A 1BRGA 1RGGA 3AGNA 4GHOA 1RGKA 1RN1A 1RGEA 2AADA 1GOVA 1RGAA 3WR2A 1I3FA 1BRSA 7RNTA 1BNEA 1X1XA 1BSCA 1BAOA 3SYUA 1TRPA 3HOHA 1RCKA 1I2FA 1RGLA 1YVSA 1HYFA 2ZA4A 3A5EA 1BNIA 4RNTA 9RNTA 3URPA 1BSAA 1JBRA 5HOHA 1HZ1A 1GMRA 1RN4A 2BIRA 1T2HA 1RGCA 1RMSA 3BIRA 1B2UA 2BU4A 1BSEA 1AQZA 1BNJA 1RGFA 1C54A 1ZGXA 1R4YA 1B21A 1PY3A 1GSPA 4GSPA 1FYSA 1PYLA 1MGWA 1X1UA 1RHLA 4J5GA 1I2GA 2KF5A 1SARA 1B2ZA 1BRNL 1GOYA 5BU4A 5BIRA 1BNFA 1UCJA 1X1WA 1A2PA 1FW7A 1BNSA 1BOXA 2F4YA 3Q3FA 2RBIA 6GSPA 2F5MA 3D5IA 2KAAA 1BSBA 1BRIA 1BNRA 1I3IA 7GSPA 1JBTA 2KF4A 1UCIA 1G02A 1RSNA 2GSPA 1LOVA 1B2XA 1LOWA 1BRJA 1BGSA 1RLSA 3D4AA 1RNTA 5RNTA 1BANA 1AY7A 1JBSA 1CH0A 4BIRA 2KF6A 1TTOA 1YGWA 1B2SA 6RNTA 1RDSA 1RNBA 1BNGA 1T2IA 3D5GA 1B3SA 1FUSA 2C4BA 1IYYA 3BU4A 1LNIA 1FZUA 4HAAA 1GOUA 1BIRA 3RNTA 1B2MA 1Q9EA 1UCKA 1X1YA 3GSPA 1I2EA 1GMQA 2KF3A 3KCHA 1I0VA 1RGHA 1TRQA 1B20A 1BVIA 1I8VA 1BSDA 1RTUA 3DH2A 1I70A 1GMPA 1DETA 1RCLA 3AHWA 1YNVX 3WHOA 4J5KA 1MGRA 1LOYA 4BU4A 2HOHA 3DGYA 8RNTA 2SARA 3AGOA 1FUTA 2AAEA 2F5WA 1UCLA 1DE3A 5GSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU4 A;  4HOH A;  2F56 A;  1LRA A;  1BRH A;  1I0X A;  1BRK A;  2RNT A;  1BUJ A;  3AHS A;  1B27 A;  1BRG A;  1RGG A;  3AGN A;  4GHO A;  1RGK A;  1RN1 A;  1RGE A;  2AAD A;  1GOV A;  1RGA A;  3WR2 A;  1I3F A;  1BRS A;  7RNT A;  1BNE A;  1X1X A;  1BSC A;  1BAO A;  3SYU A;  1TRP A;  3HOH A;  1RCK A;  1I2F A;  1RGL A;  1YVS A;  1HYF A;  2ZA4 A;  3A5E A;  1BNI A;  4RNT A;  9RNT A;  3URP A;  1BSA A;  1JBR A;  5HOH A;  1HZ1 A;  1GMR A;  1RN4 A;  2BIR A;  1T2H A;  1RGC A;  1RMS A;  3BIR A;  1B2U A;  2BU4 A;  1BSE A;  1AQZ A;  1BNJ A;  1RGF A;  1C54 A;  1ZGX A;  1R4Y A;  1B21 A;  1PY3 A;  1GSP A;  4GSP A;  1FYS A;  1PYL A;  1MGW A;  1X1U A;  1RHL A;  4J5G A;  1I2G A;  2KF5 A;  1SAR A;  1B2Z A;  1BRN L;  1GOY A;  5BU4 A;  5BIR A;  1BNF A;  1UCJ A;  1X1W A;  1A2P A;  1FW7 A;  1BNS A;  1BOX A;  2F4Y A;  3Q3F A;  2RBI A;  6GSP A;  2F5M A;  3D5I A;  2KAA A;  1BSB A;  1BRI A;  1BNR A;  1I3I A;  7GSP A;  1JBT A;  2KF4 A;  1UCI A;  1G02 A;  1RSN A;  2GSP A;  1LOV A;  1B2X A;  1LOW A;  1BRJ A;  1BGS A;  1RLS A;  3D4A A;  1RNT A;  5RNT A;  1BAN A;  1AY7 A;  1JBS A;  1CH0 A;  4BIR A;  2KF6 A;  1TTO A;  1YGW A;  1B2S A;  6RNT A;  1RDS A;  1RNB A;  1BNG A;  1T2I A;  3D5G A;  1B3S A;  1FUS A;  2C4B A;  1IYY A;  3BU4 A;  1LNI A;  1FZU A;  4HAA A;  1GOU A;  1BIR A;  3RNT A;  1B2M A;  1Q9E A;  1UCK A;  1X1Y A;  3GSP A;  1I2E A;  1GMQ A;  2KF3 A;  3KCH A;  1I0V A;  1RGH A;  1TRQ A;  1B20 A;  1BVI A;  1I8V A;  1BSD A;  1RTU A;  3DH2 A;  1I70 A;  1GMP A;  1DET A;  1RCL A;  3AHW A;  1YNV X;  3WHO A;  4J5K A;  1MGR A;  1LOY A;  4BU4 A;  2HOH A;  3DGY A;  8RNT A;  2SAR A;  3AGO A;  1FUT A;  2AAE A;  2F5W A;  1UCL A;  1DE3 A;  5GSP A; 
#chains in the Genus database with same CATH topology
 4KT3 B;  4HOH A;  3OV4 A;  3DGL A;  1IVW A;  4XBX A;  1B27 A;  2CG0 A;  2HMK B;  1RGK A;  3MPH A;  1RGE A;  2AAD A;  3NXJ A;  5CF2 A;  3X41 A;  3I55 3;  1YIT 3;  5IEN A;  2CK3 H;  5AEU B;  1FGR A;  4AKY A;  3TDG A;  1KD1 4;  3BNE A;  1BUQ A;  1FGT A;  3NQZ A;  2L1S A;  1N5H A;  2OTJ 3;  1O7W B;  1TRP A;  3HOH A;  1RCK A;  1I2F A;  1A2V A;  1YVS A;  3A5E A;  1W5Z A;  3LTC A;  1G0T A;  4EYC A;  1DMM A;  3NBJ A;  3NM2 A;  4L8O A;  2XR8 B;  1R4C A;  1IDP A;  2CG1 A;  6STD A;  5M18 A;  4IPB A;  3CCV 3;  1JBR A;  1GMR A;  1RN4 A;  3CCM 3;  1DYU A;  1T2H A;  5AIH A;  3CC7 3;  3CC4 3;  3UJM A;  3FCS B;  2Y73 A;  3LZA A;  2BU4 A;  1BSE A;  1JV2 B;  3BB9 A;  3LTB A;  1AQZ A;  1JRQ A;  1RJO A;  5TGN A;  1C54 A;  2RSX A;  1W6C A;  3DUK A;  1GD4 A;  1FA3 A;  2OOV C;  2FGT A;  3CCE 3;  3CME 3;  1OHO A;  3NQY A;  1PY3 A;  1KQS 2;  1O7G B;  1UUV B;  1MGW A;  1F8N A;  3UB1 A;  1WMN A;  1I2G A;  2KF5 A;  3GZR A;  3IJE B;  1IVX A;  3G0K A;  2R4I A;  5BXQ A;  1GOY A;  4XDV A;  1IT7 A;  3WOF B;  2C11 A;  1FGQ A;  1E3R A;  1BNF A;  5AIG A;  2CFL A;  1VZZ A;  3U1W A;  1FW7 A;  3G8Z A;  1EQK A;  1VQO 3;  3WMD A;  3NUV A;  3LT9 A;  4WHA A;  2OWP A;  3MYT A;  4LYL B;  4WFO A;  4H3U A;  1OGX A;  1K8A 4;  3HX8 A;  3EC9 A;  1BNR A;  4RNY A;  3S5C A;  1I3I A;  3D79 A;  1JB4 A;  1RRL A;  1VQ4 3;  1O7H B;  1UCI A;  2W9P A;  5D81 A;  4NHF A;  2GSP A;  4HM5 B;  1WTH A;  1QAL A;  1LOV A;  4N6L A;  1OF5 A;  1LOW A;  2CWT A;  4HM2 B;  1IQ8 A;  3FZW A;  2CFD A;  3H51 A;  3PZW A;  4N6M A;  1RLS A;  4HJL B;  1IT8 A;  5AII A;  1O7M B;  2RCD A;  1LXE A;  3EX9 A;  1JZD A;  1BAN A;  1UDI I;  1W00 A;  3N8B A;  1VQN 3;  2YX9 A;  1IU7 A;  1QAF A;  3B4O A;  3K9M C;  1T5Y A;  1TTO A;  1YGW A;  2B1X B;  6RNT A;  1RDS A;  1M1K 4;  4EXR A;  4EV5 A;  2GBX B;  3IPT A;  3CPO A;  3PYJ A;  1IYY A;  3KKG A;  3EB8 A;  3T8N A;  3CCQ 3;  4N6V 0;  5IW9 A;  1EG9 B;  1OCV A;  1FGO A;  2BNG A;  2RGQ A;  4FR9 A;  5CK6 A;  3X3Y A;  1JZO A;  3V99 A;  3CD6 3;  5M19 A;  3SOA A;  3ER7 A;  1B2M A;  1D6Z A;  3F14 A;  1Q9E A;  1GMQ A;  1PFP A;  2KF3 A;  3NX0 A;  1J2B A;  4KFF A;  1EKM A;  2IYJ A;  3GAX A;  4O8S A;  2UX0 A;  1N9E A;  3X3Z A;  1AR0 A;  1RTU A;  3E99 A;  1RCL A;  3AHW A;  5IG5 A;  2BT3 A;  4J5K A;  2HMJ B;  3HIG A;  3NBB A;  4BU4 A;  4KFD A;  2I9W A;  3K63 A;  4EV2 A;  2SAR A;  3FKA A;  4I5Q A;  1LNH A;  3AGO A;  2P09 A;  1FUT A;  1GYB A;  2BMO B;  1ZX2 A;  2OQE A;  2W2C A;  1CEW I;  4ILF A;  1L5G B;  3CC2 3;  1GD3 A;  2QGU A;  1QJG A;  2F56 A;  2W6J H;  3DZL A;  1BRK A;  1S72 3;  3JUP A;  5AYS C;  2W03 A;  4MJD A;  1W02 A;  4XBT A;  1JB2 A;  2XRX B;  4HVN A;  2GBW B;  2BHM A;  1BNE A;  1X1X A;  1NNV A;  1MOL A;  1NWW A;  2JDI H;  1BSC A;  1UI7 A;  1SQW A;  3SYU A;  2ZA4 A;  1RGL A;  3HZP A;  3CNX A;  4N6N B;  5LC6 A;  1IQX A;  5ELU A;  3WOD G;  3NV0 A;  3MG1 A;  3ZG0 A;  1US1 A;  4OVM A;  3Q90 A;  4FMD A;  4RNT A;  2IUJ A;  1NDO B;  3EJV A;  3CCR 3;  1BSA A;  3G4S 3;  1HZ1 A;  4LZI A;  3UL5 A;  1NJI 4;  3FLJ A;  4HM6 B;  1RMS A;  1S5A A;  3S27 A;  1B2U A;  2E2V A;  2O3O A;  3SVA A;  1WMP A;  1UW1 A;  4DKI A;  1YIJ 3;  1TJD A;  1RGF A;  1QVG 2;  1Q40 B;  3K5T A;  4ORL A;  1Q82 4;  1R4Y A;  1A2K A;  1B21 A;  1KSI A;  2H0H A;  2P38 A;  1N8Q A;  1OAC A;  1FYS A;  2L4V A;  3EQQ B;  1D6Y A;  1W2Z A;  1IVV A;  1DMN A;  2O9U X;  2INX A;  2E2U A;  1MWR A;  1SAR A;  2LQV A;  2ZHX B;  3DY5 A;  3SLU A;  2CFW A;  3SOY A;  3J7Y d;  1M1X B;  1GY7 A;  2MC8 A;  1X1W A;  5I97 A;  3OWS A;  5CF1 A;  3HK4 A;  2F4Y A;  3BLZ A;  5HGR A;  3Q3F A;  1WQL B;  3WA2 X;  1CYU A;  3PS8 A;  1TUH A;  3ECF A;  2XGN A;  1JKG B;  2F5M A;  3EF8 A;  4R9L A;  3RGA A;  4STD A;  1MNL A;  1VQP 3;  2YFL B;  1AVK A;  1JN5 B;  1BSB A;  4K1U A;  4OUQ A;  5JBS A;  1BRI A;  1YHQ 3;  1W7C A;  3GRD A;  3FH1 A;  4FCJ A;  3A76 A;  5G2G A;  2KF4 A;  1SIH A;  2BMQ B;  3MSO A;  1DVC A;  3F40 A;  1NB5 I;  1DMQ A;  4MMZ B;  2H0G A;  4R9K A;  1B2X A;  2STD A;  4N6T A;  1ULJ B;  1BRJ A;  3D9R A;  2XSO B;  4FMA A;  5AYR B;  1LOX A;  3DGO A;  3LTD A;  4KFE A;  3S67 A;  5JPP A;  3KFQ C;  2WGO A;  3OXA A;  3GZX B;  4BIR A;  2PNC A;  1UGH I;  2PZV A;  4FCZ A;  4WYK A;  1B2S A;  3QRD A;  1K9M 4;  1T2I A;  1QMA A;  3D5G A;  1B3S A;  1U8C B;  3BND A;  5IF6 A;  2QIY A;  2K0M A;  3BU4 A;  1GS3 A;  3B8L A;  3STD A;  1Q7H A;  2XGL A;  5IG3 A;  1QAK A;  1LQM B;  1Y4K A;  1O7N B;  2A15 A;  2R41 A;  3CNM A;  2GEX A;  3GSP A;  4KVH A;  1IVU A;  3JUM A;  1I2E A;  2OQE C;  4XDW A;  3ROB A;  2WGQ A;  5CXO A;  2B24 B;  7STD A;  2F86 B;  3MG2 A;  2CC3 A;  3K0Z A;  1I8V A;  1BSD A;  2KRT A;  2W04 A;  2XFS A;  3KE7 A;  1I70 A;  4MMX B;  1DET A;  3FG3 A;  1YNV X;  1NO3 A;  3WHO A;  1MWU A;  4HBR A;  2HOH A;  2HML B;  2GU3 A;  1UGI A;  1IK3 A;  1U5O A;  5KP4 A;  4HKV B;  5GSP A;  1VQL 3;  1OGZ A;  2J8X B;  3DGM A;  5EVH A;  5IEO A;  4N3V A;  3SED A;  1BRH A;  1I0X A;  1W2B 2;  5AIF A;  1BUJ A;  1BRG A;  1RGG A;  4GHO A;  2GEY A;  2WOH A;  2LYX A;  2F99 A;  1RN1 A;  2W56 B;  1V58 A;  3PGB A;  4K90 B;  5AI1 A;  4XB5 A;  2FXT A;  1Q81 4;  3OX9 A;  5D83 A;  3ZG5 A;  1IV9 A;  1TFK A;  2GU1 A;  2QA4 3;  1MWS A;  1WNH A;  4EW5 A;  2XH9 A;  1JB5 A;  4J8T A;  1KC8 4;  4HM3 B;  1QVF 2;  1VQ7 3;  1YJW 3;  3I0Y A;  2OCT A;  3DM8 A;  2CX0 A;  1BAO A;  2SBL A;  5EQL A;  1HYF A;  1E3V A;  4O3V A;  3ALA A;  3CCJ 3;  1AVL A;  5G1K A;  2HMN B;  1EA2 A;  3SX1 A;  2UGI A;  1SPU A;  3BNC A;  4AEQ A;  9RNT A;  1OF5 B;  3URP A;  5AEW B;  4WP5 A;  4KZ1 A;  3PCS A;  4I4K A;  1FUW A;  3BIR A;  3G6E 3;  2Q07 A;  3AMO A;  4NPB A;  3DGN A;  4K61 A;  4XM4 A;  1O7P B;  3UL6 A;  1WMO A;  2ZL8 A;  2HMM B;  3RGR A;  3LML A;  4N6U A;  4TX4 A;  1N9J A;  3LH4 A;  1X1U A;  4GSP A;  4CPK A;  3KN4 A;  4LMI A;  1M90 4;  1IQY A;  5M1A A;  1BRN L;  5IG0 A;  2CHC A;  2CIU A;  1ROV A;  2XSH B;  1YJ9 3;  2CFG A;  1G96 A;  1TFO A;  5BIR A;  1UCJ A;  2UUG C;  2WOF A;  3LXU X;  4HM7 B;  4BTX A;  1A2P A;  3EBT A;  8CHO A;  3GWR A;  2RBI A;  4CCV A;  3KII A;  3OWY A;  6GSP A;  2KAA A;  4LEH A;  3F8H A;  7GSP A;  1JBT A;  4X2H A;  1ROA A;  1D6U A;  1K41 A;  5JPU A;  1G02 A;  2CWU A;  1RSN A;  4O2H A;  1Q7Y 4;  1BGS A;  4EBG A;  1W01 A;  1RNT A;  2F98 A;  3M8C A;  1V57 A;  2IY2 A;  1YVB I;  2YFJ B;  1W6G A;  3Q1C A;  4BL2 A;  4WWU C;  4MEI A;  1RRH A;  4Q53 A;  3VGN A;  4CJN A;  4FMC A;  2ZDJ A;  2XF3 A;  1GY6 A;  1RNB A;  4JRF A;  4HM0 B;  1OPY A;  1NU3 A;  1TIJ A;  1FUS A;  2ML5 A;  3LT8 A;  5IG4 A;  1VQ8 3;  3HII A;  1LNI A;  2V1L A;  1FZU A;  4FMB A;  3EHC A;  3EBY A;  3CCU 3;  3PCR A;  4R1K A;  1GOU A;  5KP1 A;  3FGY A;  2BO9 B;  3NV0 B;  4EC6 A;  2Z77 A;  3SXX A;  4HYZ A;  1ISK A;  1UCK A;  4IT7 A;  3WDG B;  5ELJ A;  3T8U A;  4HM1 B;  1TU5 A;  4L7K A;  1I0V A;  3N54 B;  2P0X A;  1BVI A;  2XEP A;  3X3X A;  2C10 A;  4K1V A;  3VSY A;  2IMJ A;  1ASK A;  5STD A;  3FSD A;  5IER A;  1MGR A;  1LOY A;  3WA3 A;  3DGY A;  3LTA A;  5EEO A;  8RNT A;  1YI2 3;  2AAE A;  2BMR B;  1FGM A;  2F5W A;  3MWZ A;  1DE3 A;  3PXM A;  5CLK A;  4IIA A;  1W4N A;  5FW5 A;  1BU4 A;  4RBN A;  4BTY A;  2Z76 A;  1LRA A;  2RNT A;  1EEJ A;  4U13 A;  5BVB A;  3AHS A;  3AGN A;  3ZFZ A;  3JUO A;  4H61 A;  1K73 4;  1VQQ A;  4JF8 A;  1GOV A;  3F9S A;  2K3D A;  1RGA A;  3I56 3;  3CXC 2;  2Y74 A;  3WR2 A;  3OW2 2;  1I3F A;  1OUN A;  1BRS A;  1Q42 A;  7RNT A;  3EE1 A;  3MHE A;  1C7H A;  2QEX 3;  4R4K A;  3HI7 A;  3CCS 3;  2W56 A;  3N9H A;  1CYV A;  2H0I A;  2P05 A;  2M7O A;  3L0R A;  2Z6B A;  4PEJ A;  1N8R 4;  3RDE A;  2IUK A;  1BNI A;  3EN8 A;  2IA7 A;  2WO0 A;  4RNZ A;  3CMA 3;  3DXO A;  1CQS A;  5G1L A;  3LOY A;  3NHX A;  4G1M B;  5HOH A;  2BIR A;  4X2O A;  4L8P A;  1RGC A;  3KZT A;  1VQM 3;  5FGO A;  1OHS A;  3FG4 A;  1JJ2 2;  2ML6 A;  2W0Q A;  1BNJ A;  2KXG A;  1T3B A;  3G71 3;  4BTW A;  2GXF A;  1VQK 3;  1ZGX A;  2YFI B;  3NM7 A;  4WYK B;  4XBY A;  1GSP A;  1ULI B;  2D42 A;  1PYL A;  1VQ9 3;  4QWT A;  3FF0 A;  2CH9 A;  1RHL A;  4J5G A;  4NRE A;  1NB3 I;  2KCD A;  1B2Z A;  3S29 A;  2FNQ A;  1ZS7 A;  2P0M A;  4GL6 A;  3H3H A;  5BU4 A;  1TP6 A;  1A90 A;  1JNQ A;  3KSE D;  2OOV A;  3V98 A;  3KSP A;  5DRE A;  4CDL A;  1Z1S A;  3LYG A;  1BNS A;  1BOX A;  4HZB B;  2CWV A;  3MKI A;  2XFT A;  3D3L A;  3D5I A;  3JUQ A;  1UUW B;  5DRV A;  5IEP A;  2Z7A A;  1LVN A;  1OH0 A;  2W9Q A;  1V74 A;  3FF2 A;  1RN7 A;  1VQ5 3;  2RFR A;  3O8Y A;  1GY5 A;  3GZB A;  4O02 B;  3DMC A;  3BNB A;  1PU4 A;  3IMA B;  3CCL 3;  2JQ5 A;  4ZM8 A;  1YJN 3;  3S28 A;  1ZO2 A;  3D4A A;  3F8X A;  3B4P A;  3QK9 A;  1VQ6 3;  1EUI C;  3VF1 A;  2D1W A;  1YGE A;  1UUG B;  3X42 A;  5RNT A;  4LSO A;  4HM4 B;  4FCM A;  4GB5 A;  1AY7 A;  1SII A;  3Q2P A;  4BL3 A;  1DVD A;  1JBS A;  1CH0 A;  1Q40 A;  2KF6 A;  1HU9 A;  1STD A;  2CX1 A;  3EN1 B;  3JVC A;  1RKY A;  2K54 A;  1W6Y A;  1BNG A;  1Q86 4;  2C4B A;  4N6O B;  3WOE B;  2E2T A;  3X40 A;  2MF7 A;  3FG1 A;  1MWT A;  3B7C A;  4R80 A;  5KP3 A;  1E97 A;  1AV4 A;  2CFK A;  3CU3 A;  3K7C A;  4HAA A;  1A67 A;  4LGQ A;  1HKX A;  4AKZ A;  1IV7 A;  1BIR A;  5D82 A;  3JUN A;  3OWU A;  1JKG A;  3RNT A;  1N5P A;  5LC7 A;  1LQG C;  2CKF B;  1STF I;  2HMO B;  1JN5 A;  3NBR A;  1X1Y A;  3GZY B;  4MMY B;  3UNL A;  3KCH A;  1KWI A;  4RZM A;  1RGH A;  1TRQ A;  1B20 A;  3CPW 2;  2OTL 3;  3DH2 A;  1GMP A;  1M9G A;  3AMO B;  4HM8 B;  4J9A A;  4OK0 A;  3MG3 A;  1SJW A;  4HZ9 B;  3U97 A;  3V92 A;  1UI8 A;  5A0O B;  3G16 A;  3T0U A;  3F7X A;  1K28 A;  1OHP A;  1UCL A;  3F7S A;  2CW9 A; 
#chains in the Genus database with same CATH homology
 1BU4 A;  4HOH A;  2F56 A;  1LRA A;  1BRH A;  1I0X A;  1BRK A;  2RNT A;  1BUJ A;  3AHS A;  1B27 A;  1BRG A;  1RGG A;  3AGN A;  4GHO A;  1RGK A;  1RN1 A;  1RGE A;  2AAD A;  1GOV A;  1RGA A;  3WR2 A;  1I3F A;  1BRS A;  7RNT A;  1BNE A;  1X1X A;  1BSC A;  1BAO A;  3SYU A;  1TRP A;  3HOH A;  1RCK A;  1I2F A;  1RGL A;  1YVS A;  1HYF A;  2ZA4 A;  3A5E A;  1BNI A;  4RNT A;  9RNT A;  3URP A;  1BSA A;  1JBR A;  5HOH A;  1HZ1 A;  1GMR A;  1RN4 A;  2BIR A;  1T2H A;  1RGC A;  1RMS A;  3BIR A;  1B2U A;  2BU4 A;  1BSE A;  1AQZ A;  1BNJ A;  1RGF A;  1C54 A;  1ZGX A;  1R4Y A;  1B21 A;  1PY3 A;  1GSP A;  4GSP A;  1FYS A;  1PYL A;  1MGW A;  1X1U A;  1RHL A;  4J5G A;  1I2G A;  2KF5 A;  1SAR A;  1B2Z A;  1BRN L;  1GOY A;  5BU4 A;  5BIR A;  1BNF A;  1UCJ A;  1X1W A;  1A2P A;  1FW7 A;  1BNS A;  1BOX A;  2F4Y A;  3Q3F A;  2RBI A;  6GSP A;  2F5M A;  3D5I A;  2KAA A;  1BSB A;  1BRI A;  1BNR A;  1I3I A;  7GSP A;  1JBT A;  2KF4 A;  1UCI A;  1G02 A;  1RSN A;  2GSP A;  1LOV A;  1B2X A;  1LOW A;  1BRJ A;  1BGS A;  1RLS A;  3D4A A;  1RNT A;  5RNT A;  1BAN A;  1AY7 A;  1JBS A;  1CH0 A;  4BIR A;  2KF6 A;  1TTO A;  1YGW A;  1B2S A;  6RNT A;  1RDS A;  1RNB A;  1BNG A;  1T2I A;  3D5G A;  1B3S A;  1FUS A;  2C4B A;  1IYY A;  3BU4 A;  1LNI A;  1FZU A;  4HAA A;  1GOU A;  1BIR A;  3RNT A;  1B2M A;  1Q9E A;  1UCK A;  1X1Y A;  3GSP A;  1I2E A;  1GMQ A;  2KF3 A;  3KCH A;  1I0V A;  1RGH A;  1TRQ A;  1B20 A;  1BVI A;  1I8V A;  1BSD A;  1RTU A;  3DH2 A;  1I70 A;  1GMP A;  1DET A;  1RCL A;  3AHW A;  1YNV X;  3WHO A;  4J5K A;  1MGR A;  1LOY A;  4BU4 A;  2HOH A;  3DGY A;  8RNT A;  2SAR A;  3AGO A;  1FUT A;  2AAE A;  2F5W A;  1UCL A;  1DE3 A;  5GSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...