5KP4A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to 19-nortestosterone
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp4A00
3IPTA 3JUPA 3F9SA 2K54A 5TGNA 3NV0A 3E99A 3FLJA 3MYTA 4HM6B 2A15A 2IMJA 3F7XA 1OF5B 3MG2A 3KSPA 2RFRA 5AEUB 3EJVA 1O7WB 5JPPA 4X2OA 1ULJB 3HX8A 3MG3A 4OVMA 4HM2B 5AIFA 2XSHB 1EA2A 4HZ9B 1E3VA 1O7GB 3EC9A 3K0ZA 2BMRB 4MJDA 3UJMA 4HM8B 1BUQA 3FKAA 4XBYA 3DUKA 4STDA 4WWUC 4I4KA 1JN5B 3DZLA 5AI1A 3K7CA 4H3UA 1OHPA 3KZTA 4R1KA 1TP6A 3EBYA 2YFJB 5DREA 3ROBA 3KKGA 3T8UA 1O7MB 1OPYA 5D81A 5KP4A 3JUOA 3MSOA 1JB5A 4HJLB 1VZZA 1OCVA 3OX9A 2F86B 1UUVB 4FCJA 1QJGA 5IG3A 4WP5A 1W01A 2PZVA 5HGRA 3NV0B 3DM8A 3S5CA 3SOYA 3WMDA 3B8LA 4XBXA 3HZPA 4K1VA 1GYBA 1GY6A 3B7CA 1C7HA 5CXOA 4FCMA 1E97A 2OWPA 3CNMA 2BNGA 5IG0A 5KP1A 1CQSA 2XR8B 2W2CA 1OUNA 3D9RA 3KE7A 4R9KA 1DMMA 2XRXB 3BLZA 7STDA 4LGQA 5IERA 1O7HB 1DMNA 5FW5A 1OHSA 4XB5A 4R9LA 2XSOB 4HM3B 1O7NB 3DMCA 1Q40A 3MHEA 5IENA 2Z77A 3VSYA 5D83A 3DXOA 4HM5B 1NWWA 4CDLA 3FF0A 2QGUA 3GZRA 4OUQA 4HZBB 3F7SA 2HMNB 3F8XA 3JUQA 3GZYB 3G8ZA 3GZXB 4L8PA 4HM4B 6STDA 2INXA 3F14A 4RZMA 1WQLB 3NM2A 3I0YA 5IEPA 1GS3A 3NHXA 1W00A 2B1XB 3OWUA 2QIYA 3FH1A 3OWSA 5AEWB 5DRVA 1OGZA 2GEXA 2HMMB 4WYKB 2CKFB 1OH0A 3EHCA 1QMAA 1W6YA 5STDA 3MKIA 2HMKB 2I9WA 3GZBA 5BXQA 3FSDA 3EBTA 4L7KA 3RGRA 1ULIB 5AIHA 3LZAA 3H3HA 2R4IA 1Q40B 4K1UA 5JPUA 2HMOB 2BMOB 3F8HA 1EG9B 1OHOA 1E3RA 1TUHA 2RCDA 3H51A 3CPOA 3FF2A 5EVHA 3OXAA 3RGAA 4Q53A 2F99A 1S5AA 1K41A 3EF8A 1W02A 5IG5A 5D82A 4WYKA 2GEYA 5BVBA 4U13A 3EQQB 4J9AA 4ORLA 3G16A 3FZWA 4HM7B 4J8TA 3JUNA 1AR0A 1JB4A 4GB5A 2Z7AA 4HM0B 1Z1SA 2RGQA 2YFIB 2Z76A 2JQ5A 2GXFA 1OGXA 5IF6A 1JKGA 1SJWA 2CHCA 1GY7A 2B24B 3UNLA 3F40A 3MG1A 5G2GA 1NU3A 5AIGA 8CHOA 3BB9A 4HM1B 3OV4A 2BMQB 4LEHA 3VGNA 5IEOA 3T8NA 3NUVA 3EN8A 3CU3A 4HVNA 1JB2A 1STDA 3EN1B 1A2KA 1Q42A 5CF1A 2GBXB 3NXJA 4IIAA 1GY5A 4N3VA 2HMJB 1OF5A 3JUMA 4PEJA 1DMQA 3GWRA 4LMIA 3SEDA 2UX0A 2YFLB 4L8OA 3G0KA 3HK4A 3LYGA 1HKXA 1NDOB 1IDPA 1O7PB 4KVHA 5CK6A 1ISKA 2GBWB 1ZO2A 1JKGB 4XDVA 3ECFA 3M8CA 3B4PA 2HMLB 4XBTA 4X2HA 1JN5A 2STDA 1U5OA 5CLKA 1ZX2A 1UUWB 5KP3A 3STDA 3SOAA 5IG4A 3CNXA 4XM4A 4XDWA 2F98A 3ER7A 5AIIA 3OWYA 3NBRA 3GRDA 3B4OA 3Q90A 3A76A 4HKVB 3EX9A 3FGYA 5CF2A 1ASKA
chains in the Genus database with same CATH superfamily
3IPTA 4ZM8A 3JUPA 3F9SA 1UCKA 1CH0A 1D6YA 3S28A 2GSPA 1RGGA 2K54A 3NV0A 1AV4A 5TGNA 2CG0A 1GMPA 3E99A 3FLJA 3MYTA 1WMNA 3DY5A 3NBBA 3WOEB 4HM6B 3EE1A 1IVWA 2A15A 1Q7HA 2IMJA 3BU4A 3F7XA 1OF5B 3I553 1ZGXA 1B21A 2H0HA 2SBLA 3KSPA 3MG2A 1RGAA 5G1KA 3AGNA 1IU7A 2RFRA 4O3VA 5AEUB 2CH9A 3SXXA 4WFOA 3CCV3 2YX9A 3EJVA 3NX0A 1O7WB 1RJOA 5JPPA 1K9M4 2UUGC 4X2OA 1ULJB 4HBRA 3HX8A 1CYVA 2KCDA 3MG3A 3CCR3 6RNTA 4OVMA 4HM2B 2CFWA 2P0MA 3LXUX 5AIFA 2XSHB 1RRHA 4DKIA 1BNRA 1UCJA 1VQ43 1EA2A 4HZ9B 1Q814 1E3VA 1BIRA 1W7CA 4ILFA 1O7GB 3EC9A 3K0ZA 1JBRA 2CWVA 2BMRB 2QA43 4MJDA 3UJMA 2BHMA 4HM8B 1BUQA 4BIRA 1KWIA 1ROVA 3FKAA 3U1WA 3O8YA 2CIUA 1QAFA 1K8A4 4XBYA 1VQ83 1BNEA 1LVNA 3DUKA 3AMOA 1LOYA 3D5GA 4STDA 4WWUC 1LNIA 2ZDJA 4I4KA 3G4S3 1JN5B 4R4KA 3DZLA 2W04A 2IA7A 5AI1A 4I5QA 4CCVA 1IVVA 1VQN3 3K7CA 1IV7A 4H3UA 3LTCA 1OHPA 1KC84 1Y4KA 2ZL8A 3PXMA 3WHOA 4EBGA 4AKZA 1IVUA 1AY7A 2AADA 1GD4A 3FG1A 3KZTA 4R1KA 1N8R4 1TP6A 3DGYA 3EBYA 4AEQA 4RBNA 3PGBA 1R4CA 1RGCA 1UCIA 2YFJB 5DREA 4QWTA 3ROBA 2KXGA 2D42A 3KKGA 2ML6A 4TX4A 3T8UA 1O7MB 1OPYA 3PYJA 5D81A 7GSPA 5KP4A 3JUOA 1TTOA 2M7OA 3MSOA 1JB5A 3AHSA 2W03A 4KFEA 4HJLB 2KF6A 1L5GB 1VZZA 2V1LA 1VQ93 1OCVA 2OTJ3 3CMA3 1BRSA 4LSOA 1YI23 3OX9A 3RDEA 1MGRA 1BRHA 2F86B 1UUVB 2OOVC 4FCJA 2OTL3 2W9QA 1AVKA 1BNSA 1QJGA 5IG3A 4WP5A 1W01A 2PZVA 5HGRA 3V92A 3VF1A 2XGNA 3AHWA 3BNDA 3WR2A 1TFOA 3LT9A 3NQYA 2W6JH 3NV0B 1S723 1N9EA 1RCKA 3DM8A 1I70A 3LT8A 1EEJA 3S5CA 2KF4A 1W5ZA 4NREA 2IY2A 3SOYA 1RCLA 3B8LA 4XBXA 1MWUA 5AYSC 4LZIA 2O3OA 3WMDA 3HZPA 1TIJA 1UCLA 4K1VA 1GYBA 1GY6A 3B7CA 1NB5I 4N6OB 3D79A 1QVG2 1YIJ3 1C7HA 1AQZA 1BNFA 2JDIH 5FGOA 1I3IA 5CXOA 4FCMA 5G1LA 1G0TA 3MWZA 3X3YA 1E97A 1T2HA 1FUSA 4HOHA 4HYZA 2BT3A 2CK3H 2LQVA 1RNTA 1B2SA 2OWPA 2BNGA 3CNMA 4IPBA 5IG0A 5KP1A 1UGIA 4BL3A 1MGWA 3QK9A 2CWTA 1CQSA 1PYLA 3WA3A 1BSBA 3TDGA 2XR8B 2BU4A 4BTWA 2W2CA 1WMPA 4MMZB 1OUNA 3D9RA 1BRKA 9RNTA 2OCTA 1VQL3 4K61A 3DGOA 3KE7A 1WTHA 1T2IA 3FG4A 1LRAA 1FW7A 2RSXA 4R9KA 2PNCA 2C11A 1YJ93 1DMMA 1SPUA 5EQLA 1LXEA 2XRXB 3BLZA 4HAAA 1I2FA 2F5MA 4IT7A 7STDA 2CFGA 4RNYA 5A0OB 4LGQA 5IERA 1O7HB 1DMNA 6GSPA 1T5YA 1MWSA 5FW5A 4CPKA 1RNBA 1IQ8A 3CCJ3 1OACA 1OHSA 1WMOA 1YVSA 1AVLA 2OOVA 1YGEA 4GHOA 3MPHA 2FXTA 1CEWI 3K5TA 4R9LA 2XSOB 4XB5A 4HM3B 1O7NB 1W6CA 3DMCA 4MMXB 1NNVA 1BRGA 1BVIA 1Q40A 2E2UA 3MHEA 4FMBA 5IENA 3S29A 2Z77A 2BO9B 1NB3I 1GMRA 3VSYA 5D83A 2CC3A 2CWUA 3Q3FA 1X1YA 4EW5A 1SIHA 2Q07A 3DXOA 3L0RA 1DETA 3SVAA 3IJEB 1TRPA 4HM5B 1NWWA 2F4YA 1BOXA 2XF3A 3SLUA 1JNQA 3FG3A 4CDLA 1B2UA 1W2B2 3FF0A 2SARA 1B2ZA 3NQZA 3X41A 2C10A 2QGUA 1BAOA 3GZRA 4OUQA 1FGQA 1SIIA 3NM7A 1RKYA 4HZBB 1JV2B 1LOXA 2HMNB 1BSAA 3F7SA 3F8XA 3JUQA 4NPBA 3GZYB 1Q864 3G8ZA 3GSPA 3GZXB 4L8PA 2K3DA 2CX0A 4HM4B 4N6V0 6STDA 2INXA 3F14A 2RBIA 1BSCA 1HYFA 4RZMA 1WNHA 1PU4A 1X1UA 1GSPA 3LTBA 2XEPA 1VQK3 1C54A 2KF3A 1LOWA 1WQLB 3I0YA 3NM2A 3Q2PA 3T0UA 2WOHA 3DGMA 3CPW2 4N6LA 4NHFA 1RGHA 5IEPA 1GS3A 2CFDA 3HI7A 1HU9A 5AYRB 3ZFZA 1FA3A 1IV9A 3NHXA 1MOLA 1W00A 4BTXA 3U97A 3FCSB 4G1MB 2CFLA 4FMAA 1BGSA 2B1XB 3OWUA 2J8XB 2QIYA 4N6MA 1RN7A 1HZ1A 1RGLA 1TFKA 2P38A 3CCS3 1VQ53 1RGFA 3FH1A 3OWSA 5AEWB 5DRVA 1OGZA 4J5GA 2GEXA 4EYCA 3N54B 2FNQA 1VQQA 1G02A 1US1A 2FGTA 2K0MA 2HMMB 4RNTA 2CFKA 1N9JA 2CKFB 4WYKB 4GSPA 4BL2A 1OH0A 3EHCA 1A90A 1QMAA 1W6YA 5STDA 4K90B 3MKIA 2HMKB 2AAEA 1IQYA 1K734 1IQXA 2I9WA 3GZBA 3RNTA 3DGNA 5BXQA 3FSDA 3S67A 3URPA 3CXC2 3HIGA 3V99A 3EBTA 4L7KA 3RGRA 1KD14 2ML5A 1EUIC 1ULIB 3PS8A 5AIHA 1M904 3LZAA 1V58A 3HOHA 3X40A 1BU4A 3H3HA 3BNBA 2R4IA 1N8QA 3IMAB 1Q40B 4EXRA 1TJDA 1QVF2 3WA2X 4K1UA 1IK3A 3PCSA 3CC23 1SARA 4MMYB 5JPUA 3CCM3 1R4YA 2E2TA 3WDGB 1FZUA 1GD3A 3KFQC 2HMOB 1A67A 1I0XA 1UI8A 2BMOB 2XH9A 1BNGA 1NO3A 2H0IA 3F8HA 1EG9B 1BRIA 2MC8A 1OHOA 1UW1A 1FYSA 2ZA4A 3G6E3 1UDII 1E3RA 1TUHA 2RCDA 3H51A 3CPOA 3FF2A 5EVHA 2W9PA 1Q9EA 2D1WA 3OXAA 3RGAA 4Q53A 1YHQ3 2F99A 1S5AA 1K41A 3EF8A 3WOFB 1W02A 2GU1A 1UGHI 1YNVX 1FGRA 3QRDA 3CCU3 1FGMA 3K63A 1EKMA 4BTYA 5IG5A 1RN1A 4WHAA 3A5EA 5D82A 4WYKA 1RSNA 2GEYA 3KIIA 5BVBA 4U13A 1VQO3 1M1XB 3BIRA 3EQQB 4J9AA 1X1WA 4ORLA 3G16A 3OW22 3FZWA 1U8CB 3D3LA 4N6TA 3PCRA 1MNLA 4BU4A 4KFDA 1IT7A 3CME3 2GU3A 1GOUA 1F8NA 4HM7B 4J8TA 1BSDA 3JUNA 3N8BA 1AR0A 3AGOA 5RNTA 1JB4A 4GB5A 2Z7AA 4HM0B 3BNCA 3SYUA 1I8VA 4EC6A 1RDSA 1Z1SA 3HIIA 2RGQA 1BRJA 2P05A 1N5HA 2YFIB 2Z76A 4O2HA 2JQ5A 1JBTA 2GXFA 4FMCA 2OQEC 2Z6BA 2KAAA 3D4AA 1B2XA 2IUJA 1OGXA 2Y73A 5IF6A 1JKGA 1VQ63 1CYUA 1YGWA 1SJWA 1D6UA 2CHCA 1V57A 3BNEA 4FMDA 1RN4A 1GY7A 7RNTA 1FGOA 2IUKA 1B3SA 2B24B 4O8SA 3UNLA 2ZHXB 3F40A 3MG1A 5M18A 1BSEA 1IT8A 1VQM3 1GOYA 1YIT3 5IW9A 5G2GA 1NU3A 1TRQA 5AIGA 2P09A 1TU5A 3UB1A 1FGTA 5BU4A 8CHOA 1A2PA 2WGOA 3KN4A 4JRFA 3CC73 1JRQA 1W6GA 4RNZA 3BB9A 3JVCA 4HM1B 2L4VA 1DYUA 1LQMB 3OV4A 2BMQB 3UL6A 1EQKA 1Q7Y4 2F56A 3LTDA 1FUTA 4LEHA 3VGNA 1W2ZA 2QEX3 5IEOA 1BANA 1LQGC 1RTUA 2W0QA 3T8NA 2XFSA 1B2MA 3G713 1DVCA 3NUVA 1W4NA 3EN8A 3LOYA 4JF8A 2L1SA 1V74A 1MWTA 1KQS2 3CU3A 4HVNA 1QAKA 1RRLA 1RGKA 1X1XA 1VQP3 4EV2A 1JB2A 1STDA 5JBSA 3EN1B 1JBSA 3DH2A 4N6UA 1MWRA 2WGQA 1B20A 1A2KA 1Q42A 2BIRA 3LTAA 1RLSA 3DGLA 5CF1A 1NJI4 1ZS7A 1T3BA 1YVBI 4OK0A 2GBXB 4FCZA 3N9HA 4N6NB 2OQEA 3SX1A 5ELJA 5EEOA 3NXJA 4FR9A 4IIAA 3X3XA 3WODG 1LOVA 2WO0A 1GY5A 4N3VA 4CJNA 1UI7A 5HOHA 5LC6A 2H0GA 3EB8A 1A2VA 2HMJB 1PFPA 1OF5A 3GAXA 4O02B 5M1AA 3ZG0A 1I0VA 1GOVA 2W56B 3JUMA 1RMSA 1D6ZA 4PEJA 3X42A 1DMQA 3K9MC 2KRTA 3GWRA 2RNTA 3I563 3V98A 4LMIA 3SEDA 3CCQ3 2UX0A 1IYYA 2YFLB 2KF5A 4L8OA 2IYJA 3G0KA 3HK4A 2XFTA 2CX1A 3LYGA 1HKXA 2LYXA 1NDOB 1IDPA 1O7PB 4KVHA 5CK6A 3UL5A 2GBWB 1ZO2A 1JKGB 5M19A 1Q824 1ISKA 2UGIA 1BNIA 1G96A 2R41A 1I3FA 4KFFA 3J7Yd 4XDVA 2CG1A 2MF7A 3ECFA 3M8CA 3CCL3 3B4PA 2P0XA 3CC43 5BIRA 1KSIA 1RGEA 2C4BA 1JZOA 2WOFA 1DE3A 2HMLB 4XBTA 4H61A 1J2BA 4X2HA 5ELUA 4LYLB 1JN5A 2STDA 1STFI 1U5OA 2Y74A 3KSED 1IVXA 5CLKA 4KT3B 2XGLA 5I97A 1B27A 1M1K4 1ZX2A 1UUWB 5KP3A 2E2VA 5LC7A 3STDA 1BNJA 1LNHA 1M9GA 4J5KA 2HOHA 3Q1CA 3NBJA 3SOAA 1BUJA 5IG4A 3CNXA 1I2EA 4XM4A 4XDWA 2F98A 1JJ22 1YJW3 3ALAA 3ER7A 4AKYA 1PY3A 1QALA 3PZWA 5AIIA 3OWYA 3S27A 4MEIA 3X3ZA 3CD63 2W56A 3KCHA 4R80A 3NBRA 3GRDA 4KZ1A 3B4OA 3LH4A 3CCE3 1SQWA 3ZG5A 1I2GA 2CW9A 3Q90A 1BRNL 2F5WA 5GSPA 2O9UX 4EV5A 1ROAA 3AMOB 1JZDA 3D5IA 3A76A 1UUGB 3EX9A 3FGYA 4HKVB 4GL6A 5CF2A 1N5PA 1VQ73 1FUWA 1GMQA 1ASKA 1DVDA 3LMLA 1YJN3 8RNTA 1RHLA 1K28A
chains in the Genus database with same CATH topology
3IPTA 4ZM8A 3JUPA 3F9SA 1D6YA 3S28A 2K54A 5TGNA 3NV0A 1AV4A 2CG0A 3E99A 3FLJA 3MYTA 1WMNA 3DY5A 3NBBA 3WOEB 4HM6B 3EE1A 1IVWA 2A15A 2IMJA 3F7XA 1OF5B 3I553 3MG2A 2SBLA 3KSPA 1IU7A 2RFRA 4O3VA 5AEUB 2CH9A 3SXXA 4WFOA 3CCV3 2YX9A 3EJVA 3NX0A 1O7WB 1RJOA 5JPPA 1K9M4 4X2OA 1ULJB 4HBRA 3HX8A 1CYVA 2KCDA 3MG3A 3CCR3 4OVMA 4HM2B 2CFWA 2P0MA 3LXUX 5AIFA 2XSHB 1RRHA 1VQ43 1EA2A 4HZ9B 1Q814 1E3VA 1W7CA 1O7GB 3EC9A 3K0ZA 2CWVA 2BMRB 2QA43 4MJDA 3UJMA 2BHMA 4HM8B 1BUQA 1KWIA 1ROVA 3FKAA 3U1WA 3O8YA 2CIUA 1QAFA 1K8A4 4XBYA 1VQ83 1LVNA 3DUKA 3AMOA 4STDA 4WWUC 2ZDJA 4I4KA 3G4S3 1JN5B 4R4KA 3DZLA 2W04A 2IA7A 5AI1A 4CCVA 1IVVA 1VQN3 3K7CA 1IV7A 4H3UA 3LTCA 1OHPA 1KC84 1Y4KA 2ZL8A 3PXMA 4EBGA 4AKZA 1IVUA 3FG1A 3KZTA 1GD4A 4R1KA 1N8R4 1TP6A 4AEQA 3EBYA 4RBNA 3PGBA 1R4CA 2YFJB 5DREA 4QWTA 3ROBA 2KXGA 2D42A 3KKGA 2ML6A 4TX4A 3T8UA 1O7MB 1OPYA 3PYJA 5D81A 5KP4A 3JUOA 2M7OA 3MSOA 1JB5A 2W03A 4KFEA 4HJLB 1L5GB 1VZZA 2V1LA 1VQ93 1OCVA 2OTJ3 3CMA3 4LSOA 1YI23 3OX9A 3RDEA 2F86B 1UUVB 2OOVC 4FCJA 2OTL3 2W9QA 1AVKA 1QJGA 5IG3A 4WP5A 1W01A 2PZVA 5HGRA 3V92A 3VF1A 2XGNA 3BNDA 1TFOA 3LT9A 3NQYA 2W6JH 3NV0B 1S723 1N9EA 3DM8A 3LT8A 3S5CA 1W5ZA 4NREA 3SOYA 3WMDA 3B8LA 4XBXA 5AYSC 4LZIA 2O3OA 3HZPA 1TIJA 4K1VA 1GYBA 1GY6A 3B7CA 1NB5I 4N6OB 1QVG2 1YIJ3 1C7HA 2JDIH 5FGOA 5CXOA 4FCMA 3MWZA 3X3YA 1E97A 4HYZA 2LQVA 2CK3H 2OWPA 2BT3A 3CNMA 4IPBA 2BNGA 5IG0A 5KP1A 3QK9A 2CWTA 1CQSA 3WA3A 3TDGA 2XR8B 4BTWA 2W2CA 1WMPA 4MMZB 1OUNA 3D9RA 2OCTA 1VQL3 4K61A 3DGOA 3KE7A 1WTHA 3FG4A 2RSXA 4R9KA 2PNCA 2C11A 1YJ93 1DMMA 1SPUA 5EQLA 1LXEA 2XRXB 3BLZA 7STDA 4IT7A 2CFGA 4RNYA 5A0OB 4LGQA 5IERA 1O7HB 1DMNA 1T5YA 5FW5A 1IQ8A 3CCJ3 1OACA 1OHSA 1WMOA 2OOVA 1AVLA 1YGEA 3MPHA 2FXTA 1CEWI 3K5TA 4R9LA 2XSOB 4XB5A 4HM3B 1O7NB 1W6CA 3DMCA 4MMXB 1Q40A 2E2UA 3MHEA 4FMBA 5IENA 3S29A 2Z77A 2BO9B 1NB3I 3VSYA 5D83A 2CC3A 2CWUA 1SIHA 2Q07A 3DXOA 3L0RA 3SVAA 3IJEB 4HM5B 1NWWA 3SLUA 2XF3A 1JNQA 3FG3A 4CDLA 1W2B2 3FF0A 3NQZA 3X41A 2C10A 2QGUA 3GZRA 4OUQA 1FGQA 1SIIA 3NM7A 1RKYA 4HZBB 1JV2B 1LOXA 2HMNB 3F7SA 3F8XA 3JUQA 3GZYB 1Q864 3G8ZA 3GZXB 4L8PA 4HM4B 4N6V0 6STDA 2INXA 3F14A 4RZMA 1WNHA 1PU4A 3LTBA 2XEPA 1VQK3 1WQLB 3NM2A 3I0YA 3Q2PA 3T0UA 3CPW2 2WOHA 3DGMA 4N6LA 4NHFA 5IEPA 1GS3A 2CFDA 3HI7A 1HU9A 5AYRB 1FA3A 1IV9A 3NHXA 1MOLA 1W00A 4BTXA 3U97A 3FCSB 4G1MB 2CFLA 4FMAA 2B1XB 3OWUA 2QIYA 4N6MA 1RN7A 1TFKA 2P38A 3CCS3 1VQ53 3FH1A 3OWSA 5AEWB 5DRVA 1OGZA 2GEXA 4EYCA 3N54B 2FNQA 1US1A 2FGTA 2K0MA 2HMMB 4WYKB 2CFKA 1N9JA 2CKFB 1A90A 1OH0A 3EHCA 1QMAA 1W6YA 5STDA 4K90B 3MKIA 2HMKB 1IQYA 1K734 1IQXA 2I9WA 3GZBA 3DGNA 5BXQA 3FSDA 3S67A 3CXC2 3HIGA 3V99A 3EBTA 4L7KA 3RGRA 1KD14 2ML5A 1M904 1ULIB 3PS8A 5AIHA 3LZAA 3X40A 3H3HA 3BNBA 2R4IA 1N8QA 3IMAB 1Q40B 4EXRA 1QVF2 3WA2X 4K1UA 1IK3A 3PCSA 3CC23 4MMYB 5JPUA 3CCM3 2E2TA 3WDGB 1GD3A 3KFQC 2HMOB 1A67A 1UI8A 2BMOB 2XH9A 1NO3A 3F8HA 1EG9B 2MC8A 1OHOA 1UW1A 3G6E3 1E3RA 1TUHA 2RCDA 3H51A 3CPOA 3FF2A 5EVHA 2W9PA 2D1WA 3OXAA 3RGAA 4Q53A 1YHQ3 2F99A 1S5AA 1K41A 3EF8A 3WOFB 1W02A 2GU1A 1FGRA 3QRDA 3CCU3 1FGMA 3K63A 1EKMA 4BTYA 5IG5A 4WHAA 5D82A 4WYKA 2GEYA 3KIIA 5BVBA 4U13A 1VQO3 1M1XB 3EQQB 4J9AA 3OW22 4ORLA 3G16A 3FZWA 1U8CB 3D3LA 4N6TA 3PCRA 1MNLA 4KFDA 1IT7A 3CME3 2GU3A 1F8NA 4HM7B 4J8TA 3JUNA 3N8BA 1AR0A 1JB4A 4GB5A 2Z7AA 4HM0B 3BNCA 4EC6A 1Z1SA 3HIIA 2RGQA 2YFIB 1N5HA 2P05A 2Z76A 4O2HA 2JQ5A 2GXFA 4FMCA 2OQEC 2Z6BA 2IUJA 1OGXA 2Y73A 5IF6A 1JKGA 1VQ63 1CYUA 1SJWA 1D6UA 2CHCA 3BNEA 4FMDA 1GY7A 1FGOA 2IUKA 2B24B 4O8SA 3UNLA 3F40A 3MG1A 1IT8A 1VQM3 1YIT3 5IW9A 5G2GA 1NU3A 5AIGA 1TU5A 2P09A 3UB1A 1FGTA 8CHOA 3KN4A 2WGOA 4JRFA 3CC73 1JRQA 1W6GA 4RNZA 3BB9A 3JVCA 4HM1B 2L4VA 1DYUA 3OV4A 2BMQB 3UL6A 1EQKA 1Q7Y4 3LTDA 4LEHA 3VGNA 1W2ZA 2QEX3 5IEOA 2W0QA 3T8NA 2XFSA 3G713 1DVCA 3NUVA 1W4NA 3EN8A 3LOYA 4JF8A 1V74A 1KQS2 3CU3A 4HVNA 1QAKA 1RRLA 1VQP3 4EV2A 1JB2A 1STDA 5JBSA 3EN1B 4N6UA 2WGQA 1A2KA 1Q42A 3LTAA 1NJI4 3DGLA 5CF1A 4OK0A 1YVBI 2GBXB 4FCZA 3N9HA 4N6NB 2OQEA 3SX1A 5ELJA 5EEOA 3NXJA 4FR9A 4IIAA 3X3XA 3WODG 2WO0A 1GY5A 4N3VA 1UI7A 5LC6A 3EB8A 1A2VA 2HMJB 1PFPA 1OF5A 3GAXA 4O02B 2W56B 3JUMA 1D6ZA 4PEJA 3X42A 1DMQA 3K9MC 2KRTA 3GWRA 3I563 3V98A 4LMIA 3SEDA 3CCQ3 2UX0A 2YFLB 4L8OA 3G0KA 3HK4A 2XFTA 3LYGA 1HKXA 2LYXA 1NDOB 1IDPA 1O7PB 4KVHA 5CK6A 3UL5A 2GBWB 1ZO2A 1JKGB 1Q824 1ISKA 1G96A 4KFFA 3J7Yd 4XDVA 2CG1A 2MF7A 3ECFA 3M8CA 3CCL3 3B4PA 2P0XA 3CC43 1KSIA 2WOFA 2HMLB 4XBTA 4H61A 1J2BA 4X2HA 5ELUA 1JN5A 2STDA 1STFI 1U5OA 2Y74A 3KSED 1IVXA 5CLKA 5I97A 2XGLA 1M1K4 1ZX2A 1UUWB 5KP3A 2E2VA 5LC7A 3STDA 1LNHA 1M9GA 3Q1CA 3NBJA 3SOAA 5IG4A 3CNXA 4XM4A 4XDWA 2F98A 1JJ22 1YJW3 3ALAA 3ER7A 4AKYA 1QALA 3PZWA 5AIIA 3OWYA 3S27A 4MEIA 3X3ZA 3CD63 2W56A 4R80A 3NBRA 3GRDA 4KZ1A 3B4OA 3LH4A 3CCE3 1SQWA 2CW9A 3Q90A 4EV5A 2O9UX 1ROAA 3AMOB 3A76A 4HKVB 3EX9A 3FGYA 5CF2A 4GL6A 1VQ73 1N5PA 1FUWA 1ASKA 1DVDA 3LMLA 1YJN3 1K28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPT A;  3JUP A;  3F9S A;  2K54 A;  5TGN A;  3NV0 A;  3E99 A;  3FLJ A;  3MYT A;  4HM6 B;  2A15 A;  2IMJ A;  3F7X A;  1OF5 B;  3MG2 A;  3KSP A;  2RFR A;  5AEU B;  3EJV A;  1O7W B;  5JPP A;  4X2O A;  1ULJ B;  3HX8 A;  3MG3 A;  4OVM A;  4HM2 B;  5AIF A;  2XSH B;  1EA2 A;  4HZ9 B;  1E3V A;  1O7G B;  3EC9 A;  3K0Z A;  2BMR B;  4MJD A;  3UJM A;  4HM8 B;  1BUQ A;  3FKA A;  4XBY A;  3DUK A;  4STD A;  4WWU C;  4I4K A;  1JN5 B;  3DZL A;  5AI1 A;  3K7C A;  4H3U A;  1OHP A;  3KZT A;  4R1K A;  1TP6 A;  3EBY A;  2YFJ B;  5DRE A;  3ROB A;  3KKG A;  3T8U A;  1O7M B;  1OPY A;  5D81 A;  5KP4 A;  3JUO A;  3MSO A;  1JB5 A;  4HJL B;  1VZZ A;  1OCV A;  3OX9 A;  2F86 B;  1UUV B;  4FCJ A;  1QJG A;  5IG3 A;  4WP5 A;  1W01 A;  2PZV A;  5HGR A;  3NV0 B;  3DM8 A;  3S5C A;  3SOY A;  3WMD A;  3B8L A;  4XBX A;  3HZP A;  4K1V A;  1GYB A;  1GY6 A;  3B7C A;  1C7H A;  5CXO A;  4FCM A;  1E97 A;  2OWP A;  3CNM A;  2BNG A;  5IG0 A;  5KP1 A;  1CQS A;  2XR8 B;  2W2C A;  1OUN A;  3D9R A;  3KE7 A;  4R9K A;  1DMM A;  2XRX B;  3BLZ A;  7STD A;  4LGQ A;  5IER A;  1O7H B;  1DMN A;  5FW5 A;  1OHS A;  4XB5 A;  4R9L A;  2XSO B;  4HM3 B;  1O7N B;  3DMC A;  1Q40 A;  3MHE A;  5IEN A;  2Z77 A;  3VSY A;  5D83 A;  3DXO A;  4HM5 B;  1NWW A;  4CDL A;  3FF0 A;  2QGU A;  3GZR A;  4OUQ A;  4HZB B;  3F7S A;  2HMN B;  3F8X A;  3JUQ A;  3GZY B;  3G8Z A;  3GZX B;  4L8P A;  4HM4 B;  6STD A;  2INX A;  3F14 A;  4RZM A;  1WQL B;  3NM2 A;  3I0Y A;  5IEP A;  1GS3 A;  3NHX A;  1W00 A;  2B1X B;  3OWU A;  2QIY A;  3FH1 A;  3OWS A;  5AEW B;  5DRV A;  1OGZ A;  2GEX A;  2HMM B;  4WYK B;  2CKF B;  1OH0 A;  3EHC A;  1QMA A;  1W6Y A;  5STD A;  3MKI A;  2HMK B;  2I9W A;  3GZB A;  5BXQ A;  3FSD A;  3EBT A;  4L7K A;  3RGR A;  1ULI B;  5AIH A;  3LZA A;  3H3H A;  2R4I A;  1Q40 B;  4K1U A;  5JPU A;  2HMO B;  2BMO B;  3F8H A;  1EG9 B;  1OHO A;  1E3R A;  1TUH A;  2RCD A;  3H51 A;  3CPO A;  3FF2 A;  5EVH A;  3OXA A;  3RGA A;  4Q53 A;  2F99 A;  1S5A A;  1K41 A;  3EF8 A;  1W02 A;  5IG5 A;  5D82 A;  4WYK A;  2GEY A;  5BVB A;  4U13 A;  3EQQ B;  4J9A A;  4ORL A;  3G16 A;  3FZW A;  4HM7 B;  4J8T A;  3JUN A;  1AR0 A;  1JB4 A;  4GB5 A;  2Z7A A;  4HM0 B;  1Z1S A;  2RGQ A;  2YFI B;  2Z76 A;  2JQ5 A;  2GXF A;  1OGX A;  5IF6 A;  1JKG A;  1SJW A;  2CHC A;  1GY7 A;  2B24 B;  3UNL A;  3F40 A;  3MG1 A;  5G2G A;  1NU3 A;  5AIG A;  8CHO A;  3BB9 A;  4HM1 B;  3OV4 A;  2BMQ B;  4LEH A;  3VGN A;  5IEO A;  3T8N A;  3NUV A;  3EN8 A;  3CU3 A;  4HVN A;  1JB2 A;  1STD A;  3EN1 B;  1A2K A;  1Q42 A;  5CF1 A;  2GBX B;  3NXJ A;  4IIA A;  1GY5 A;  4N3V A;  2HMJ B;  1OF5 A;  3JUM A;  4PEJ A;  1DMQ A;  3GWR A;  4LMI A;  3SED A;  2UX0 A;  2YFL B;  4L8O A;  3G0K A;  3HK4 A;  3LYG A;  1HKX A;  1NDO B;  1IDP A;  1O7P B;  4KVH A;  5CK6 A;  1ISK A;  2GBW B;  1ZO2 A;  1JKG B;  4XDV A;  3ECF A;  3M8C A;  3B4P A;  2HML B;  4XBT A;  4X2H A;  1JN5 A;  2STD A;  1U5O A;  5CLK A;  1ZX2 A;  1UUW B;  5KP3 A;  3STD A;  3SOA A;  5IG4 A;  3CNX A;  4XM4 A;  4XDW A;  2F98 A;  3ER7 A;  5AII A;  3OWY A;  3NBR A;  3GRD A;  3B4O A;  3Q90 A;  3A76 A;  4HKV B;  3EX9 A;  3FGY A;  5CF2 A;  1ASK A; 
#chains in the Genus database with same CATH topology
 3IPT A;  4ZM8 A;  3JUP A;  3F9S A;  1UCK A;  1CH0 A;  1D6Y A;  3S28 A;  2GSP A;  1RGG A;  2K54 A;  3NV0 A;  1AV4 A;  5TGN A;  2CG0 A;  1GMP A;  3E99 A;  3FLJ A;  3MYT A;  1WMN A;  3DY5 A;  3NBB A;  3WOE B;  4HM6 B;  3EE1 A;  1IVW A;  2A15 A;  1Q7H A;  2IMJ A;  3BU4 A;  3F7X A;  1OF5 B;  3I55 3;  1ZGX A;  1B21 A;  2H0H A;  2SBL A;  3KSP A;  3MG2 A;  1RGA A;  5G1K A;  3AGN A;  1IU7 A;  2RFR A;  4O3V A;  5AEU B;  2CH9 A;  3SXX A;  4WFO A;  3CCV 3;  2YX9 A;  3EJV A;  3NX0 A;  1O7W B;  1RJO A;  5JPP A;  1K9M 4;  2UUG C;  4X2O A;  1ULJ B;  4HBR A;  3HX8 A;  1CYV A;  2KCD A;  3MG3 A;  3CCR 3;  6RNT A;  4OVM A;  4HM2 B;  2CFW A;  2P0M A;  3LXU X;  5AIF A;  2XSH B;  1RRH A;  4DKI A;  1BNR A;  1UCJ A;  1VQ4 3;  1EA2 A;  4HZ9 B;  1Q81 4;  1E3V A;  1BIR A;  1W7C A;  4ILF A;  1O7G B;  3EC9 A;  3K0Z A;  1JBR A;  2CWV A;  2BMR B;  2QA4 3;  4MJD A;  3UJM A;  2BHM A;  4HM8 B;  1BUQ A;  4BIR A;  1KWI A;  1ROV A;  3FKA A;  3U1W A;  3O8Y A;  2CIU A;  1QAF A;  1K8A 4;  4XBY A;  1VQ8 3;  1BNE A;  1LVN A;  3DUK A;  3AMO A;  1LOY A;  3D5G A;  4STD A;  4WWU C;  1LNI A;  2ZDJ A;  4I4K A;  3G4S 3;  1JN5 B;  4R4K A;  3DZL A;  2W04 A;  2IA7 A;  5AI1 A;  4I5Q A;  4CCV A;  1IVV A;  1VQN 3;  3K7C A;  1IV7 A;  4H3U A;  3LTC A;  1OHP A;  1KC8 4;  1Y4K A;  2ZL8 A;  3PXM A;  3WHO A;  4EBG A;  4AKZ A;  1IVU A;  1AY7 A;  2AAD A;  1GD4 A;  3FG1 A;  3KZT A;  4R1K A;  1N8R 4;  1TP6 A;  3DGY A;  3EBY A;  4AEQ A;  4RBN A;  3PGB A;  1R4C A;  1RGC A;  1UCI A;  2YFJ B;  5DRE A;  4QWT A;  3ROB A;  2KXG A;  2D42 A;  3KKG A;  2ML6 A;  4TX4 A;  3T8U A;  1O7M B;  1OPY A;  3PYJ A;  5D81 A;  7GSP A;  5KP4 A;  3JUO A;  1TTO A;  2M7O A;  3MSO A;  1JB5 A;  3AHS A;  2W03 A;  4KFE A;  4HJL B;  2KF6 A;  1L5G B;  1VZZ A;  2V1L A;  1VQ9 3;  1OCV A;  2OTJ 3;  3CMA 3;  1BRS A;  4LSO A;  1YI2 3;  3OX9 A;  3RDE A;  1MGR A;  1BRH A;  2F86 B;  1UUV B;  2OOV C;  4FCJ A;  2OTL 3;  2W9Q A;  1AVK A;  1BNS A;  1QJG A;  5IG3 A;  4WP5 A;  1W01 A;  2PZV A;  5HGR A;  3V92 A;  3VF1 A;  2XGN A;  3AHW A;  3BND A;  3WR2 A;  1TFO A;  3LT9 A;  3NQY A;  2W6J H;  3NV0 B;  1S72 3;  1N9E A;  1RCK A;  3DM8 A;  1I70 A;  3LT8 A;  1EEJ A;  3S5C A;  2KF4 A;  1W5Z A;  4NRE A;  2IY2 A;  3SOY A;  1RCL A;  3B8L A;  4XBX A;  1MWU A;  5AYS C;  4LZI A;  2O3O A;  3WMD A;  3HZP A;  1TIJ A;  1UCL A;  4K1V A;  1GYB A;  1GY6 A;  3B7C A;  1NB5 I;  4N6O B;  3D79 A;  1QVG 2;  1YIJ 3;  1C7H A;  1AQZ A;  1BNF A;  2JDI H;  5FGO A;  1I3I A;  5CXO A;  4FCM A;  5G1L A;  1G0T A;  3MWZ A;  3X3Y A;  1E97 A;  1T2H A;  1FUS A;  4HOH A;  4HYZ A;  2BT3 A;  2CK3 H;  2LQV A;  1RNT A;  1B2S A;  2OWP A;  2BNG A;  3CNM A;  4IPB A;  5IG0 A;  5KP1 A;  1UGI A;  4BL3 A;  1MGW A;  3QK9 A;  2CWT A;  1CQS A;  1PYL A;  3WA3 A;  1BSB A;  3TDG A;  2XR8 B;  2BU4 A;  4BTW A;  2W2C A;  1WMP A;  4MMZ B;  1OUN A;  3D9R A;  1BRK A;  9RNT A;  2OCT A;  1VQL 3;  4K61 A;  3DGO A;  3KE7 A;  1WTH A;  1T2I A;  3FG4 A;  1LRA A;  1FW7 A;  2RSX A;  4R9K A;  2PNC A;  2C11 A;  1YJ9 3;  1DMM A;  1SPU A;  5EQL A;  1LXE A;  2XRX B;  3BLZ A;  4HAA A;  1I2F A;  2F5M A;  4IT7 A;  7STD A;  2CFG A;  4RNY A;  5A0O B;  4LGQ A;  5IER A;  1O7H B;  1DMN A;  6GSP A;  1T5Y A;  1MWS A;  5FW5 A;  4CPK A;  1RNB A;  1IQ8 A;  3CCJ 3;  1OAC A;  1OHS A;  1WMO A;  1YVS A;  1AVL A;  2OOV A;  1YGE A;  4GHO A;  3MPH A;  2FXT A;  1CEW I;  3K5T A;  4R9L A;  2XSO B;  4XB5 A;  4HM3 B;  1O7N B;  1W6C A;  3DMC A;  4MMX B;  1NNV A;  1BRG A;  1BVI A;  1Q40 A;  2E2U A;  3MHE A;  4FMB A;  5IEN A;  3S29 A;  2Z77 A;  2BO9 B;  1NB3 I;  1GMR A;  3VSY A;  5D83 A;  2CC3 A;  2CWU A;  3Q3F A;  1X1Y A;  4EW5 A;  1SIH A;  2Q07 A;  3DXO A;  3L0R A;  1DET A;  3SVA A;  3IJE B;  1TRP A;  4HM5 B;  1NWW A;  2F4Y A;  1BOX A;  2XF3 A;  3SLU A;  1JNQ A;  3FG3 A;  4CDL A;  1B2U A;  1W2B 2;  3FF0 A;  2SAR A;  1B2Z A;  3NQZ A;  3X41 A;  2C10 A;  2QGU A;  1BAO A;  3GZR A;  4OUQ A;  1FGQ A;  1SII A;  3NM7 A;  1RKY A;  4HZB B;  1JV2 B;  1LOX A;  2HMN B;  1BSA A;  3F7S A;  3F8X A;  3JUQ A;  4NPB A;  3GZY B;  1Q86 4;  3G8Z A;  3GSP A;  3GZX B;  4L8P A;  2K3D A;  2CX0 A;  4HM4 B;  4N6V 0;  6STD A;  2INX A;  3F14 A;  2RBI A;  1BSC A;  1HYF A;  4RZM A;  1WNH A;  1PU4 A;  1X1U A;  1GSP A;  3LTB A;  2XEP A;  1VQK 3;  1C54 A;  2KF3 A;  1LOW A;  1WQL B;  3I0Y A;  3NM2 A;  3Q2P A;  3T0U A;  2WOH A;  3DGM A;  3CPW 2;  4N6L A;  4NHF A;  1RGH A;  5IEP A;  1GS3 A;  2CFD A;  3HI7 A;  1HU9 A;  5AYR B;  3ZFZ A;  1FA3 A;  1IV9 A;  3NHX A;  1MOL A;  1W00 A;  4BTX A;  3U97 A;  3FCS B;  4G1M B;  2CFL A;  4FMA A;  1BGS A;  2B1X B;  3OWU A;  2J8X B;  2QIY A;  4N6M A;  1RN7 A;  1HZ1 A;  1RGL A;  1TFK A;  2P38 A;  3CCS 3;  1VQ5 3;  1RGF A;  3FH1 A;  3OWS A;  5AEW B;  5DRV A;  1OGZ A;  4J5G A;  2GEX A;  4EYC A;  3N54 B;  2FNQ A;  1VQQ A;  1G02 A;  1US1 A;  2FGT A;  2K0M A;  2HMM B;  4RNT A;  2CFK A;  1N9J A;  2CKF B;  4WYK B;  4GSP A;  4BL2 A;  1OH0 A;  3EHC A;  1A90 A;  1QMA A;  1W6Y A;  5STD A;  4K90 B;  3MKI A;  2HMK B;  2AAE A;  1IQY A;  1K73 4;  1IQX A;  2I9W A;  3GZB A;  3RNT A;  3DGN A;  5BXQ A;  3FSD A;  3S67 A;  3URP A;  3CXC 2;  3HIG A;  3V99 A;  3EBT A;  4L7K A;  3RGR A;  1KD1 4;  2ML5 A;  1EUI C;  1ULI B;  3PS8 A;  5AIH A;  1M90 4;  3LZA A;  1V58 A;  3HOH A;  3X40 A;  1BU4 A;  3H3H A;  3BNB A;  2R4I A;  1N8Q A;  3IMA B;  1Q40 B;  4EXR A;  1TJD A;  1QVF 2;  3WA2 X;  4K1U A;  1IK3 A;  3PCS A;  3CC2 3;  1SAR A;  4MMY B;  5JPU A;  3CCM 3;  1R4Y A;  2E2T A;  3WDG B;  1FZU A;  1GD3 A;  3KFQ C;  2HMO B;  1A67 A;  1I0X A;  1UI8 A;  2BMO B;  2XH9 A;  1BNG A;  1NO3 A;  2H0I A;  3F8H A;  1EG9 B;  1BRI A;  2MC8 A;  1OHO A;  1UW1 A;  1FYS A;  2ZA4 A;  3G6E 3;  1UDI I;  1E3R A;  1TUH A;  2RCD A;  3H51 A;  3CPO A;  3FF2 A;  5EVH A;  2W9P A;  1Q9E A;  2D1W A;  3OXA A;  3RGA A;  4Q53 A;  1YHQ 3;  2F99 A;  1S5A A;  1K41 A;  3EF8 A;  3WOF B;  1W02 A;  2GU1 A;  1UGH I;  1YNV X;  1FGR A;  3QRD A;  3CCU 3;  1FGM A;  3K63 A;  1EKM A;  4BTY A;  5IG5 A;  1RN1 A;  4WHA A;  3A5E A;  5D82 A;  4WYK A;  1RSN A;  2GEY A;  3KII A;  5BVB A;  4U13 A;  1VQO 3;  1M1X B;  3BIR A;  3EQQ B;  4J9A A;  1X1W A;  4ORL A;  3G16 A;  3OW2 2;  3FZW A;  1U8C B;  3D3L A;  4N6T A;  3PCR A;  1MNL A;  4BU4 A;  4KFD A;  1IT7 A;  3CME 3;  2GU3 A;  1GOU A;  1F8N A;  4HM7 B;  4J8T A;  1BSD A;  3JUN A;  3N8B A;  1AR0 A;  3AGO A;  5RNT A;  1JB4 A;  4GB5 A;  2Z7A A;  4HM0 B;  3BNC A;  3SYU A;  1I8V A;  4EC6 A;  1RDS A;  1Z1S A;  3HII A;  2RGQ A;  1BRJ A;  2P05 A;  1N5H A;  2YFI B;  2Z76 A;  4O2H A;  2JQ5 A;  1JBT A;  2GXF A;  4FMC A;  2OQE C;  2Z6B A;  2KAA A;  3D4A A;  1B2X A;  2IUJ A;  1OGX A;  2Y73 A;  5IF6 A;  1JKG A;  1VQ6 3;  1CYU A;  1YGW A;  1SJW A;  1D6U A;  2CHC A;  1V57 A;  3BNE A;  4FMD A;  1RN4 A;  1GY7 A;  7RNT A;  1FGO A;  2IUK A;  1B3S A;  2B24 B;  4O8S A;  3UNL A;  2ZHX B;  3F40 A;  3MG1 A;  5M18 A;  1BSE A;  1IT8 A;  1VQM 3;  1GOY A;  1YIT 3;  5IW9 A;  5G2G A;  1NU3 A;  1TRQ A;  5AIG A;  2P09 A;  1TU5 A;  3UB1 A;  1FGT A;  5BU4 A;  8CHO A;  1A2P A;  2WGO A;  3KN4 A;  4JRF A;  3CC7 3;  1JRQ A;  1W6G A;  4RNZ A;  3BB9 A;  3JVC A;  4HM1 B;  2L4V A;  1DYU A;  1LQM B;  3OV4 A;  2BMQ B;  3UL6 A;  1EQK A;  1Q7Y 4;  2F56 A;  3LTD A;  1FUT A;  4LEH A;  3VGN A;  1W2Z A;  2QEX 3;  5IEO A;  1BAN A;  1LQG C;  1RTU A;  2W0Q A;  3T8N A;  2XFS A;  1B2M A;  3G71 3;  1DVC A;  3NUV A;  1W4N A;  3EN8 A;  3LOY A;  4JF8 A;  2L1S A;  1V74 A;  1MWT A;  1KQS 2;  3CU3 A;  4HVN A;  1QAK A;  1RRL A;  1RGK A;  1X1X A;  1VQP 3;  4EV2 A;  1JB2 A;  1STD A;  5JBS A;  3EN1 B;  1JBS A;  3DH2 A;  4N6U A;  1MWR A;  2WGQ A;  1B20 A;  1A2K A;  1Q42 A;  2BIR A;  3LTA A;  1RLS A;  3DGL A;  5CF1 A;  1NJI 4;  1ZS7 A;  1T3B A;  1YVB I;  4OK0 A;  2GBX B;  4FCZ A;  3N9H A;  4N6N B;  2OQE A;  3SX1 A;  5ELJ A;  5EEO A;  3NXJ A;  4FR9 A;  4IIA A;  3X3X A;  3WOD G;  1LOV A;  2WO0 A;  1GY5 A;  4N3V A;  4CJN A;  1UI7 A;  5HOH A;  5LC6 A;  2H0G A;  3EB8 A;  1A2V A;  2HMJ B;  1PFP A;  1OF5 A;  3GAX A;  4O02 B;  5M1A A;  3ZG0 A;  1I0V A;  1GOV A;  2W56 B;  3JUM A;  1RMS A;  1D6Z A;  4PEJ A;  3X42 A;  1DMQ A;  3K9M C;  2KRT A;  3GWR A;  2RNT A;  3I56 3;  3V98 A;  4LMI A;  3SED A;  3CCQ 3;  2UX0 A;  1IYY A;  2YFL B;  2KF5 A;  4L8O A;  2IYJ A;  3G0K A;  3HK4 A;  2XFT A;  2CX1 A;  3LYG A;  1HKX A;  2LYX A;  1NDO B;  1IDP A;  1O7P B;  4KVH A;  5CK6 A;  3UL5 A;  2GBW B;  1ZO2 A;  1JKG B;  5M19 A;  1Q82 4;  1ISK A;  2UGI A;  1BNI A;  1G96 A;  2R41 A;  1I3F A;  4KFF A;  3J7Y d;  4XDV A;  2CG1 A;  2MF7 A;  3ECF A;  3M8C A;  3CCL 3;  3B4P A;  2P0X A;  3CC4 3;  5BIR A;  1KSI A;  1RGE A;  2C4B A;  1JZO A;  2WOF A;  1DE3 A;  2HML B;  4XBT A;  4H61 A;  1J2B A;  4X2H A;  5ELU A;  4LYL B;  1JN5 A;  2STD A;  1STF I;  1U5O A;  2Y74 A;  3KSE D;  1IVX A;  5CLK A;  4KT3 B;  2XGL A;  5I97 A;  1B27 A;  1M1K 4;  1ZX2 A;  1UUW B;  5KP3 A;  2E2V A;  5LC7 A;  3STD A;  1BNJ A;  1LNH A;  1M9G A;  4J5K A;  2HOH A;  3Q1C A;  3NBJ A;  3SOA A;  1BUJ A;  5IG4 A;  3CNX A;  1I2E A;  4XM4 A;  4XDW A;  2F98 A;  1JJ2 2;  1YJW 3;  3ALA A;  3ER7 A;  4AKY A;  1PY3 A;  1QAL A;  3PZW A;  5AII A;  3OWY A;  3S27 A;  4MEI A;  3X3Z A;  3CD6 3;  2W56 A;  3KCH A;  4R80 A;  3NBR A;  3GRD A;  4KZ1 A;  3B4O A;  3LH4 A;  3CCE 3;  1SQW A;  3ZG5 A;  1I2G A;  2CW9 A;  3Q90 A;  1BRN L;  2F5W A;  5GSP A;  2O9U X;  4EV5 A;  1ROA A;  3AMO B;  1JZD A;  3D5I A;  3A76 A;  1UUG B;  3EX9 A;  3FGY A;  4HKV B;  4GL6 A;  5CF2 A;  1N5P A;  1VQ7 3;  1FUW A;  1GMQ A;  1ASK A;  1DVD A;  3LML A;  1YJN 3;  8RNT A;  1RHL A;  1K28 A; 
#chains in the Genus database with same CATH homology
 3IPT A;  4ZM8 A;  3JUP A;  3F9S A;  1D6Y A;  3S28 A;  2K54 A;  5TGN A;  3NV0 A;  1AV4 A;  2CG0 A;  3E99 A;  3FLJ A;  3MYT A;  1WMN A;  3DY5 A;  3NBB A;  3WOE B;  4HM6 B;  3EE1 A;  1IVW A;  2A15 A;  2IMJ A;  3F7X A;  1OF5 B;  3I55 3;  3MG2 A;  2SBL A;  3KSP A;  1IU7 A;  2RFR A;  4O3V A;  5AEU B;  2CH9 A;  3SXX A;  4WFO A;  3CCV 3;  2YX9 A;  3EJV A;  3NX0 A;  1O7W B;  1RJO A;  5JPP A;  1K9M 4;  4X2O A;  1ULJ B;  4HBR A;  3HX8 A;  1CYV A;  2KCD A;  3MG3 A;  3CCR 3;  4OVM A;  4HM2 B;  2CFW A;  2P0M A;  3LXU X;  5AIF A;  2XSH B;  1RRH A;  1VQ4 3;  1EA2 A;  4HZ9 B;  1Q81 4;  1E3V A;  1W7C A;  1O7G B;  3EC9 A;  3K0Z A;  2CWV A;  2BMR B;  2QA4 3;  4MJD A;  3UJM A;  2BHM A;  4HM8 B;  1BUQ A;  1KWI A;  1ROV A;  3FKA A;  3U1W A;  3O8Y A;  2CIU A;  1QAF A;  1K8A 4;  4XBY A;  1VQ8 3;  1LVN A;  3DUK A;  3AMO A;  4STD A;  4WWU C;  2ZDJ A;  4I4K A;  3G4S 3;  1JN5 B;  4R4K A;  3DZL A;  2W04 A;  2IA7 A;  5AI1 A;  4CCV A;  1IVV A;  1VQN 3;  3K7C A;  1IV7 A;  4H3U A;  3LTC A;  1OHP A;  1KC8 4;  1Y4K A;  2ZL8 A;  3PXM A;  4EBG A;  4AKZ A;  1IVU A;  3FG1 A;  3KZT A;  1GD4 A;  4R1K A;  1N8R 4;  1TP6 A;  4AEQ A;  3EBY A;  4RBN A;  3PGB A;  1R4C A;  2YFJ B;  5DRE A;  4QWT A;  3ROB A;  2KXG A;  2D42 A;  3KKG A;  2ML6 A;  4TX4 A;  3T8U A;  1O7M B;  1OPY A;  3PYJ A;  5D81 A;  5KP4 A;  3JUO A;  2M7O A;  3MSO A;  1JB5 A;  2W03 A;  4KFE A;  4HJL B;  1L5G B;  1VZZ A;  2V1L A;  1VQ9 3;  1OCV A;  2OTJ 3;  3CMA 3;  4LSO A;  1YI2 3;  3OX9 A;  3RDE A;  2F86 B;  1UUV B;  2OOV C;  4FCJ A;  2OTL 3;  2W9Q A;  1AVK A;  1QJG A;  5IG3 A;  4WP5 A;  1W01 A;  2PZV A;  5HGR A;  3V92 A;  3VF1 A;  2XGN A;  3BND A;  1TFO A;  3LT9 A;  3NQY A;  2W6J H;  3NV0 B;  1S72 3;  1N9E A;  3DM8 A;  3LT8 A;  3S5C A;  1W5Z A;  4NRE A;  3SOY A;  3WMD A;  3B8L A;  4XBX A;  5AYS C;  4LZI A;  2O3O A;  3HZP A;  1TIJ A;  4K1V A;  1GYB A;  1GY6 A;  3B7C A;  1NB5 I;  4N6O B;  1QVG 2;  1YIJ 3;  1C7H A;  2JDI H;  5FGO A;  5CXO A;  4FCM A;  3MWZ A;  3X3Y A;  1E97 A;  4HYZ A;  2LQV A;  2CK3 H;  2OWP A;  2BT3 A;  3CNM A;  4IPB A;  2BNG A;  5IG0 A;  5KP1 A;  3QK9 A;  2CWT A;  1CQS A;  3WA3 A;  3TDG A;  2XR8 B;  4BTW A;  2W2C A;  1WMP A;  4MMZ B;  1OUN A;  3D9R A;  2OCT A;  1VQL 3;  4K61 A;  3DGO A;  3KE7 A;  1WTH A;  3FG4 A;  2RSX A;  4R9K A;  2PNC A;  2C11 A;  1YJ9 3;  1DMM A;  1SPU A;  5EQL A;  1LXE A;  2XRX B;  3BLZ A;  7STD A;  4IT7 A;  2CFG A;  4RNY A;  5A0O B;  4LGQ A;  5IER A;  1O7H B;  1DMN A;  1T5Y A;  5FW5 A;  1IQ8 A;  3CCJ 3;  1OAC A;  1OHS A;  1WMO A;  2OOV A;  1AVL A;  1YGE A;  3MPH A;  2FXT A;  1CEW I;  3K5T A;  4R9L A;  2XSO B;  4XB5 A;  4HM3 B;  1O7N B;  1W6C A;  3DMC A;  4MMX B;  1Q40 A;  2E2U A;  3MHE A;  4FMB A;  5IEN A;  3S29 A;  2Z77 A;  2BO9 B;  1NB3 I;  3VSY A;  5D83 A;  2CC3 A;  2CWU A;  1SIH A;  2Q07 A;  3DXO A;  3L0R A;  3SVA A;  3IJE B;  4HM5 B;  1NWW A;  3SLU A;  2XF3 A;  1JNQ A;  3FG3 A;  4CDL A;  1W2B 2;  3FF0 A;  3NQZ A;  3X41 A;  2C10 A;  2QGU A;  3GZR A;  4OUQ A;  1FGQ A;  1SII A;  3NM7 A;  1RKY A;  4HZB B;  1JV2 B;  1LOX A;  2HMN B;  3F7S A;  3F8X A;  3JUQ A;  3GZY B;  1Q86 4;  3G8Z A;  3GZX B;  4L8P A;  4HM4 B;  4N6V 0;  6STD A;  2INX A;  3F14 A;  4RZM A;  1WNH A;  1PU4 A;  3LTB A;  2XEP A;  1VQK 3;  1WQL B;  3NM2 A;  3I0Y A;  3Q2P A;  3T0U A;  3CPW 2;  2WOH A;  3DGM A;  4N6L A;  4NHF A;  5IEP A;  1GS3 A;  2CFD A;  3HI7 A;  1HU9 A;  5AYR B;  1FA3 A;  1IV9 A;  3NHX A;  1MOL A;  1W00 A;  4BTX A;  3U97 A;  3FCS B;  4G1M B;  2CFL A;  4FMA A;  2B1X B;  3OWU A;  2QIY A;  4N6M A;  1RN7 A;  1TFK A;  2P38 A;  3CCS 3;  1VQ5 3;  3FH1 A;  3OWS A;  5AEW B;  5DRV A;  1OGZ A;  2GEX A;  4EYC A;  3N54 B;  2FNQ A;  1US1 A;  2FGT A;  2K0M A;  2HMM B;  4WYK B;  2CFK A;  1N9J A;  2CKF B;  1A90 A;  1OH0 A;  3EHC A;  1QMA A;  1W6Y A;  5STD A;  4K90 B;  3MKI A;  2HMK B;  1IQY A;  1K73 4;  1IQX A;  2I9W A;  3GZB A;  3DGN A;  5BXQ A;  3FSD A;  3S67 A;  3CXC 2;  3HIG A;  3V99 A;  3EBT A;  4L7K A;  3RGR A;  1KD1 4;  2ML5 A;  1M90 4;  1ULI B;  3PS8 A;  5AIH A;  3LZA A;  3X40 A;  3H3H A;  3BNB A;  2R4I A;  1N8Q A;  3IMA B;  1Q40 B;  4EXR A;  1QVF 2;  3WA2 X;  4K1U A;  1IK3 A;  3PCS A;  3CC2 3;  4MMY B;  5JPU A;  3CCM 3;  2E2T A;  3WDG B;  1GD3 A;  3KFQ C;  2HMO B;  1A67 A;  1UI8 A;  2BMO B;  2XH9 A;  1NO3 A;  3F8H A;  1EG9 B;  2MC8 A;  1OHO A;  1UW1 A;  3G6E 3;  1E3R A;  1TUH A;  2RCD A;  3H51 A;  3CPO A;  3FF2 A;  5EVH A;  2W9P A;  2D1W A;  3OXA A;  3RGA A;  4Q53 A;  1YHQ 3;  2F99 A;  1S5A A;  1K41 A;  3EF8 A;  3WOF B;  1W02 A;  2GU1 A;  1FGR A;  3QRD A;  3CCU 3;  1FGM A;  3K63 A;  1EKM A;  4BTY A;  5IG5 A;  4WHA A;  5D82 A;  4WYK A;  2GEY A;  3KII A;  5BVB A;  4U13 A;  1VQO 3;  1M1X B;  3EQQ B;  4J9A A;  3OW2 2;  4ORL A;  3G16 A;  3FZW A;  1U8C B;  3D3L A;  4N6T A;  3PCR A;  1MNL A;  4KFD A;  1IT7 A;  3CME 3;  2GU3 A;  1F8N A;  4HM7 B;  4J8T A;  3JUN A;  3N8B A;  1AR0 A;  1JB4 A;  4GB5 A;  2Z7A A;  4HM0 B;  3BNC A;  4EC6 A;  1Z1S A;  3HII A;  2RGQ A;  2YFI B;  1N5H A;  2P05 A;  2Z76 A;  4O2H A;  2JQ5 A;  2GXF A;  4FMC A;  2OQE C;  2Z6B A;  2IUJ A;  1OGX A;  2Y73 A;  5IF6 A;  1JKG A;  1VQ6 3;  1CYU A;  1SJW A;  1D6U A;  2CHC A;  3BNE A;  4FMD A;  1GY7 A;  1FGO A;  2IUK A;  2B24 B;  4O8S A;  3UNL A;  3F40 A;  3MG1 A;  1IT8 A;  1VQM 3;  1YIT 3;  5IW9 A;  5G2G A;  1NU3 A;  5AIG A;  1TU5 A;  2P09 A;  3UB1 A;  1FGT A;  8CHO A;  3KN4 A;  2WGO A;  4JRF A;  3CC7 3;  1JRQ A;  1W6G A;  4RNZ A;  3BB9 A;  3JVC A;  4HM1 B;  2L4V A;  1DYU A;  3OV4 A;  2BMQ B;  3UL6 A;  1EQK A;  1Q7Y 4;  3LTD A;  4LEH A;  3VGN A;  1W2Z A;  2QEX 3;  5IEO A;  2W0Q A;  3T8N A;  2XFS A;  3G71 3;  1DVC A;  3NUV A;  1W4N A;  3EN8 A;  3LOY A;  4JF8 A;  1V74 A;  1KQS 2;  3CU3 A;  4HVN A;  1QAK A;  1RRL A;  1VQP 3;  4EV2 A;  1JB2 A;  1STD A;  5JBS A;  3EN1 B;  4N6U A;  2WGQ A;  1A2K A;  1Q42 A;  3LTA A;  1NJI 4;  3DGL A;  5CF1 A;  4OK0 A;  1YVB I;  2GBX B;  4FCZ A;  3N9H A;  4N6N B;  2OQE A;  3SX1 A;  5ELJ A;  5EEO A;  3NXJ A;  4FR9 A;  4IIA A;  3X3X A;  3WOD G;  2WO0 A;  1GY5 A;  4N3V A;  1UI7 A;  5LC6 A;  3EB8 A;  1A2V A;  2HMJ B;  1PFP A;  1OF5 A;  3GAX A;  4O02 B;  2W56 B;  3JUM A;  1D6Z A;  4PEJ A;  3X42 A;  1DMQ A;  3K9M C;  2KRT A;  3GWR A;  3I56 3;  3V98 A;  4LMI A;  3SED A;  3CCQ 3;  2UX0 A;  2YFL B;  4L8O A;  3G0K A;  3HK4 A;  2XFT A;  3LYG A;  1HKX A;  2LYX A;  1NDO B;  1IDP A;  1O7P B;  4KVH A;  5CK6 A;  3UL5 A;  2GBW B;  1ZO2 A;  1JKG B;  1Q82 4;  1ISK A;  1G96 A;  4KFF A;  3J7Y d;  4XDV A;  2CG1 A;  2MF7 A;  3ECF A;  3M8C A;  3CCL 3;  3B4P A;  2P0X A;  3CC4 3;  1KSI A;  2WOF A;  2HML B;  4XBT A;  4H61 A;  1J2B A;  4X2H A;  5ELU A;  1JN5 A;  2STD A;  1STF I;  1U5O A;  2Y74 A;  3KSE D;  1IVX A;  5CLK A;  5I97 A;  2XGL A;  1M1K 4;  1ZX2 A;  1UUW B;  5KP3 A;  2E2V A;  5LC7 A;  3STD A;  1LNH A;  1M9G A;  3Q1C A;  3NBJ A;  3SOA A;  5IG4 A;  3CNX A;  4XM4 A;  4XDW A;  2F98 A;  1JJ2 2;  1YJW 3;  3ALA A;  3ER7 A;  4AKY A;  1QAL A;  3PZW A;  5AII A;  3OWY A;  3S27 A;  4MEI A;  3X3Z A;  3CD6 3;  2W56 A;  4R80 A;  3NBR A;  3GRD A;  4KZ1 A;  3B4O A;  3LH4 A;  3CCE 3;  1SQW A;  2CW9 A;  3Q90 A;  4EV5 A;  2O9U X;  1ROA A;  3AMO B;  3A76 A;  4HKV B;  3EX9 A;  3FGY A;  5CF2 A;  4GL6 A;  1VQ7 3;  1N5P A;  1FUW A;  1ASK A;  1DVD A;  3LML A;  1YJN 3;  1K28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...