5KP4A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to 19-nortestosterone
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp4A00
2GEYA 5BVBA 3MHEA 4L8OA 3FF2A 2BMRB 3VGNA 1O7NB 1O7GB 1OPYA 2R4IA 1JN5B 4RZMA 4FCMA 3D9RA 2HMKB 5STDA 3F7XA 3LZAA 5AI1A 1TUHA 4LEHA 3FGYA 3IPTA 3OXAA 5D81A 3MG3A 4XBTA 1JN5A 2F99A 3DM8A 1OF5B 5BXQA 1SJWA 3GRDA 5JPUA 1GS3A 5CF1A 1Q40B 2F98A 4HM4B 1OF5A 3OX9A 3GZYB 2YFJB 4ORLA 3KKGA 2HMJB 5AEWB 3NXJA 1Q40A 4XBYA 5FW5A 3K7CA 1JB2A 1DMNA 2Z7AA 1JB4A 4Q53A 3F9SA 4XDVA 2Z76A 3EC9A 1W00A 2XSHB 3DZLA 3ECFA 8CHOA 1O7WB 4OVMA 3UJMA 3MG2A 1ULIB 2BMOB 3T8UA 5CF2A 4IIAA 1O7MB 5IF6A 3HZPA 4HM3B 3B4PA 1JB5A 4XDWA 3EN8A 4MJDA 3JUMA 3G0KA 3ROBA 5EVHA 3DMCA 3DXOA 5KP4A 2B1XB 3JUPA 1DMMA 1BUQA 3EX9A 2HMMB 4GB5A 4CDLA 5CLKA 1NWWA 5IEOA 3ER7A 1W6YA 4HM8B 2INXA 3FLJA 2I9WA 2OWPA 2YFIB 4LGQA 2B24B 1C7HA 4HZBB 1STDA 2QIYA 3G8ZA 3MSOA 1GY6A 5AIHA 1HKXA 3CU3A 3SOAA 5IERA 4OUQA 2BNGA 1NDOB 1VZZA 3OWSA 2JQ5A 5AEUB 4I4KA 4WWUC 5G2GA 1S5AA 1E3RA 4HVNA 3OWYA 1IDPA 1CQSA 3WMDA 4HM6B 2CHCA 4X2OA 1E97A 4R1KA 5DRVA 3SEDA 1Q42A 3G16A 1OCVA 2A15A 1TP6A 4HM2B 4N3VA 1GYBA 2PZVA 4HM5B 7STDA 3BLZA 5DREA 3NM2A 1OHOA 2HMNB 3NBRA 1DMQA 2HMLB 3STDA 3NV0B 3H3HA 3F8XA 3FSDA 3EN1B 5IG4A 3M8CA 3JUOA 4PEJA 5CXOA 3Q90A 1ULJB 1GY5A 1K41A 3HX8A 3EQQB 3NV0A 2GBWB 1OUNA 4WP5A 3S5CA 3SOYA 5D83A 3MYTA 4HKVB 1QMAA 2RFRA 3EBTA 2CKFB 5TGNA 2STDA 4HM0B 3NUVA 4XB5A 3OWUA 5IEPA 3KE7A 1AR0A 4HM7B 1GY7A 4KVHA 3K0ZA 4STDA 3JUNA 3CNMA 4FCJA 3BB9A 5KP1A 3A76A 5AIFA 1UUVB 3EJVA 1OHPA 3B4OA 1JKGB 3I0YA 4H3UA 3JUQA 5CK6A 1W02A 1OH0A 5IG0A 3UNLA 1A2KA 2QGUA 3B8LA 2RCDA 3MG1A 1O7HB 5IG3A 1ZO2A 1JKGA 4HZ9B 3VSYA 3GZRA 2IMJA 3F8HA 1Z1SA 3NHXA 3RGRA 5JPPA 2Z77A 4K1VA 2HMOB 4L7KA 2GXFA 3E99A 4XBXA 2W2CA 3RGAA 2YFLB 3CNXA 3GZXB 5AIGA 3F40A 1OHSA 4J8TA 3DUKA 2GEXA 1WQLB 1U5OA 1ZX2A 3GZBA 3FH1A 4R9KA 3KZTA 6STDA 1OGXA 2K54A 4J9AA 3OV4A 4XM4A 3FZWA 3T8NA 3FF0A 4X2HA 2XR8B 3F7SA 2BMQB 2UX0A 3FKAA 5AIIA 1QJGA 3EHCA 3EF8A 1ASKA 3F14A 1E3VA 1EG9B 5KP3A 3B7CA 5HGRA 3H51A 1ISKA 3GWRA 2XRXB 1EA2A 3HK4A 4K1UA 2GBXB 4LMIA 3CPOA 4WYKB 1O7PB 4HM1B 3KSPA 3MKIA 5IG5A 4R9LA 2F86B 1OGZA 4U13A 3LYGA 1UUWB 5IENA 1NU3A 4WYKA 1W01A 5D82A 4HJLB 2RGQA 2XSOB 3EBYA 4L8PA
chains in the Genus database with same CATH superfamily
1IVVA 2GEYA 5BVBA 1JRQA 1IQ8A 2IUJA 1RRLA 1YIT3 3D5IA 3MHEA 2ZA4A 4L8OA 2FGTA 3FF2A 2BMRB 2MF7A 2CG1A 5KP4A 3U97A 3LT8A 1ZS7A 3VGNA 1JBTA 1X1YA 1AVLA 1RGEA 1V74A 1O7NB 1O7GB 1TRPA 1OPYA 2R4IA 2FXTA 3A5EA 1JN5B 1N5PA 3KN4A 4RZMA 4FMDA 4MEIA 4FCMA 1FYSA 3D9RA 3UL5A 1YHQ3 2KF3A 2UUGC 3D79A 2HMKB 4BL3A 5STDA 3CCQ3 2WO0A 3HI7A 2CWVA 3F7XA 3PYJA 1RN4A 3LZAA 5AI1A 1TUHA 2BU4A 5AYSC 4LEHA 3FGYA 3X40A 3JVCA 3IPTA 2IYJA 3OXAA 5D81A 1G02A 3MG3A 5A0OB 3CCV3 1B27A 4XBTA 1W2B2 1D6YA 2W9PA 1JN5A 2F99A 3VF1A 1FUWA 3DM8A 1G0TA 1LNHA 1OF5B 5BXQA 3G713 1SJWA 3GRDA 1HZ1A 3AGOA 5I97A 1MWTA 3WOEB 1UI8A 1MWRA 1RJOA 1W5ZA 1YIJ3 1QVF2 1RLSA 1UUGB 5JPUA 1GS3A 5CF1A 1Q40B 2E2VA 2F98A 4N6V0 1M1K4 4CJNA 4O02B 4LYLB 5M1AA 1Q7Y4 2W03A 4HM4B 3CCU3 1I8VA 1RMSA 1RCKA 1OF5A 3OX9A 3GZYB 2ML6A 4AEQA 4ZM8A 3CCM3 1S723 2XH9A 1RRHA 3CCR3 2YFJB 4ORLA 2Q07A 1IYYA 4EYCA 1RGKA 3KKGA 4NHFA 1FGMA 1I0VA 1VQ53 2HMJB 5AEWB 1FZUA 1BNJA 3DGLA 3NXJA 1Q40A 2ZL8A 4J5KA 4XBYA 3T0UA 1OACA 2WOFA 3SXXA 1FA3A 5FW5A 3K7CA 3L0RA 1B21A 6RNTA 1JB2A 4MMXB 4TX4A 4EV2A 3GSPA 1DMNA 2F5WA 2CW9A 2P05A 2W04A 5G1KA 1GD4A 1AV4A 2ZHXB 2Z7AA 1JB4A 1LOWA 2D42A 2OCTA 2KCDA 2AAEA 1BRSA 2KF4A 3F9SA 4Q53A 1TTOA 2Z76A 3EC9A 4XDVA 6GSPA 1JNQA 1W00A 3LH4A 2XSHB 1IU7A 1WMNA 1ROAA 4O8SA 4RBNA 4AKYA 1L5GB 3DZLA 2CWUA 1FGRA 4N6LA 3ECFA 3WA2X 1BNSA 8CHOA 1O7WB 2CC3A 4AKZA 4N6MA 1RGHA 3DH2A 1BNFA 2W9QA 5ELUA 4OVMA 2BT3A 1BSAA 3UJMA 4CPKA 1B2ZA 5BIRA 1A67A 3MG2A 3LTAA 1ULIB 1UGIA 4BU4A 3CPW2 1D6ZA 2BMOB 4H61A 4R4KA 1FGTA 3T8UA 5CF2A 4IIAA 1O7MB 2P0MA 5IF6A 3HZPA 2CX1A 1M904 2C11A 1TIJA 2XFSA 1KD14 1Q814 4HM3B 1IQYA 2WOHA 3B4PA 1JB5A 1Q824 4XDWA 3EN8A 4MJDA 2C4BA 3JUMA 1IVUA 3G0KA 3ROBA 1M1XB 5EVHA 1IV7A 1IT7A 1YVBI 3DMCA 4FMCA 3DXOA 4LSOA 2XF3A 2B1XB 2CFGA 3GAXA 3JUPA 3Q1CA 2KAAA 4GSPA 4EBGA 1DMMA 5ELJA 1US1A 1BUQA 3WR2A 3HOHA 1FUSA 1N9EA 3EX9A 2HMMB 1I0XA 1SIIA 1LRAA 3PS8A 4FR9A 4GB5A 4R80A 1LOYA 3KCHA 4GL6A 1BSEA 4CDLA 5CLKA 1JBRA 5M18A 1NWWA 2CFKA 5IEOA 5RNTA 3ER7A 4KFDA 1WTHA 1BGSA 1EKMA 1W6YA 2MC8A 3N9HA 1RDSA 1T3BA 1Q864 1VQK3 3UL6A 4HM8B 1RHLA 1A2PA 2INXA 3FLJA 4NREA 4KT3B 8RNTA 1TU5A 2I9WA 2OWPA 1V57A 1MGRA 3EE1A 1BNIA 2KRTA 2YFIB 3LT9A 1PY3A 4LGQA 3CCJ3 1K9M4 3BNCA 1U8CB 1K734 2Y73A 3PXMA 2B24B 2QA43 1C7HA 2E2TA 2XGLA 1AQZA 4HZBB 2BIRA 1STDA 3SLUA 2QIYA 3G8ZA 3MSOA 1GOYA 1GY6A 1GOVA 1UCKA 2RNTA 1SQWA 3BIRA 4BTWA 2CFWA 4O2HA 2CX0A 5AIHA 2BHMA 1HKXA 3CU3A 3WOFB 3K63A 1W7CA 3DGYA 3SOAA 5IERA 2J8XB 4OUQA 1CH0A 2BNGA 1NDOB 3G4S3 1VZZA 3KIIA 2JQ5A 3OWSA 1FGOA 4RNYA 5AEUB 2Z6BA 1YI23 4QWTA 3RNTA 4I4KA 2BO9B 4N6UA 4WWUC 2OOVA 3Q3FA 3KSED 3AHSA 5G2GA 2GU1A 1S5AA 1E3RA 3D4AA 4JF8A 4HVNA 2PNCA 3OWYA 1CYUA 1IDPA 1EUIC 3LTBA 1CQSA 3WMDA 1DETA 4HM6B 2CHCA 4FMBA 2KXGA 1PFPA 4CCVA 1BRHA 3QK9A 4X2OA 1E97A 4R1KA 1CEWI 2AADA 3QRDA 1DYUA 2F56A 4EV5A 5DRVA 1Q7HA 3LTCA 3SEDA 1VQ73 1RNBA 1UGHI 1Q42A 1RN7A 3G16A 1NJI4 1OCVA 4N6OB 1IV9A 1ROVA 2L4VA 1B2SA 1SARA 3CD63 3NX0A 3WODG 2OTL3 1F8NA 2A15A 1DVCA 1TP6A 5IW9A 2HOHA 4RNTA 1BNRA 1KWIA 1W2ZA 4HM2B 2KF6A 3PCRA 4N3VA 1BRIA 4HBRA 1GYBA 1UDII 4GHOA 5AYRB 3V98A 2PZVA 4HM5B 1N8R4 3FG3A 2Y74A 7STDA 1LQGC 2CFLA 4J5GA 2K3DA 4O3VA 3CCE3 4HAAA 5JBSA 3NBBA 3BLZA 1PU4A 1R4YA 1BSBA 1NNVA 2ZDJA 3NM2A 5DREA 3ZG0A 1WMOA 1Y4KA 1OHOA 2SBLA 4EXRA 2HMNB 2P09A 4JRFA 3RDEA 3NBRA 3V92A 3CMA3 1C54A 3BNDA 1YGWA 1DMQA 3FCSB 1A2VA 3SX1A 1I2EA 2HMLB 3STDA 3IJEB 4BL2A 1K28A 1A90A 3NV0B 4OK0A 3H3HA 7RNTA 1YJ93 2E2UA 1VQL3 3AHWA 2L1SA 3F8XA 4RNZA 5EQLA 3FSDA 1TJDA 3EN1B 3CCS3 1W6GA 5IG4A 1W4NA 2WGQA 3JUOA 3M8CA 4PEJA 5CXOA 1I2GA 3Q90A 1BAOA 1ULJB 4BTXA 3J7Yd 1GY5A 4KFFA 1LVNA 1K41A 1UW1A 4WHAA 3HX8A 3EQQB 1HYFA 1MOLA 3NV0A 2GBWB 1OUNA 3MPHA 4WP5A 1KQS2 1BU4A 1V58A 3S5CA 2M7OA 2D1WA 2R41A 4I5QA 3EB8A 1W6CA 1N5HA 3SOYA 4FMAA 3LTDA 1KC84 3SYUA 5D83A 1MGWA 1LQMB 3MYTA 4HKVB 1QMAA 1GMRA 2RBIA 2RFRA 2H0HA 1QAKA 3EBTA 4NPBA 2XEPA 2CKFB 5TGNA 3HIGA 2GSPA 9RNTA 2STDA 4HM0B 3NUVA 4XB5A 2W0QA 1SPUA 1JZDA 3OWUA 5IEPA 4HOHA 1NB3I 3KE7A 1BSCA 3FG1A 1GD3A 1FGQA 1AR0A 4HM7B 1IVXA 1GY7A 4KVHA 3K0ZA 4MMZB 2GU3A 4STDA 3JUNA 2KF5A 3NM7A 2CIUA 1RGLA 1TFKA 3DY5A 3S67A 1QVG2 3CNMA 2K0MA 1WMPA 5BU4A 3PZWA 1JJ22 1BRJA 3WDGB 1RSNA 4FCJA 3WHOA 3BB9A 5KP1A 3A76A 3N8BA 1BUJA 5AIFA 1UUVB 1JZOA 2XGNA 3EJVA 4IPBA 3D3LA 1YNVX 1OHPA 2CK3H 3BNBA 1UI7A 1ZGXA 3X3ZA 1TRQA 3B4OA 1AVKA 1JKGB 3I0YA 4H3UA 3D5GA 3X42A 2JDIH 1LNIA 1RGAA 2FNQA 3FG4A 2IUKA 3JUQA 3DGNA 4N6NB 5CK6A 1W02A 1OH0A 5IG0A 3URPA 1T5YA 3UNLA 1DE3A 1EEJA 1X1XA 1A2KA 2QGUA 1HU9A 3N54B 3B8LA 3U1WA 2RCDA 1M9GA 1NO3A 1B3SA 1O7HB 1X1UA 3AGNA 3MG1A 5IG3A 4K61A 1J2BA 4EW5A 1RN1A 1BNGA 1JKGA 1ZO2A 1LOVA 1EQKA 3DGOA 3O8YA 4HZ9B 3VSYA 2LQVA 2P38A 1T2HA 2CWTA 1SIHA 2ML5A 3GZRA 3CCL3 5HOHA 1YGEA 4K90B 2F5MA 3CC73 2IMJA 3F8HA 1GSPA 1RTUA 1Z1SA 4N6TA 2CH9A 3NHXA 4HYZA 3RGRA 4G1MB 1RNTA 5JPPA 3CC23 2Z77A 3NBJA 3OW22 3S29A 4BTYA 4EC6A 1VQP3 3AMOB 4K1VA 2HMOB 3PCSA 1PYLA 1QALA 1VQ93 1D6UA 4L7KA 1GMPA 3WA3A 1VQ83 2GXFA 3E99A 1LOXA 4XBXA 2W2CA 3RGAA 1B20A 1FUTA 1QAFA 2YFLB 3CNXA 4LZIA 3PGBA 4WFOA 3S27A 3GZXB 5AIGA 3K9MC 3F40A 1NB5I 1OHSA 5GSPA 4J8TA 1RCLA 2OOVC 3DUKA 2GEXA 3AMOA 2LYXA 2V1LA 3LOYA 1B2MA 1WQLB 1U5OA 1ZX2A 3GZBA 2YX9A 1N8QA 1B2UA 3ZG5A 1VQ63 1KSIA 3FH1A 1R4CA 3IMAB 4R9KA 3I563 1BOXA 1I3FA 2OQEA 3KZTA 6STDA 3I553 2F4YA 1OGXA 7GSPA 2K54A 1I3IA 3HIIA 2O3OA 3K5TA 3OV4A 4J9AA 4XM4A 3TDGA 3FZWA 1AY7A 3UB1A 5FGOA 2OTJ3 1BRGA 2O9UX 1BNEA 3T8NA 3FF0A 1I70A 4X2HA 2XR8B 3F7SA 2BMQB 2CFDA 2H0GA 2UX0A 1I2FA 3FKAA 1K8A4 1RKYA 1LXEA 1QJGA 1MWSA 5AIIA 1IT8A 5G1LA 3EHCA 2XFTA 3DGMA 3EF8A 1ASKA 3Q2PA 3F14A 1RGCA 1UCJA 1E3VA 1EG9B 1STFI 3CC43 3ZFZA 5KP3A 1G96A 3X41A 1DVDA 2IY2A 3SVAA 4BIRA 2C10A 3B7CA 3X3XA 3G6E3 1GOUA 1VQQA 1BRKA 1IK3A 1MNLA 3NQYA 4KFEA 4FCZA 5LC6A 1T2IA 3ALAA 5HGRA 3H51A 3X3YA 1CYVA 1MWUA 1VQN3 4MMYB 3LXUX 1ISKA 3GWRA 2XRXB 1EA2A 2W56B 3HK4A 4K1UA 2GBXB 1UCLA 3CXC2 1VQO3 1BVIA 2WGOA 3CPOA 4LMIA 4WYKB 3BNEA 1FW7A 1O7PB 3V99A 4HM1B 3S28A 3KFQC 2H0IA 3KSPA 1BIRA 2IA7A 2OQEC 4DKIA 3CME3 3MKIA 1YJW3 1IQXA 1N9JA 1TFOA 4ILFA 4R9LA 5IG5A 2F86B 2P0XA 1GMQA 1RGFA 1OGZA 4KZ1A 1RGGA 2W6JH 4U13A 3LYGA 2QEX3 1UUWB 1JV2B 2W56A 3NQZA 4IT7A 1NU3A 1UCIA 5IENA 3LMLA 4WYKA 1YVSA 1W01A 1BANA 2SARA 3MWZA 5D82A 1VQM3 1YJN3 1VQ43 5LC7A 2UGIA 4HJLB 1Q9EA 1WNHA 2CG0A 5EEOA 1BSDA 2RGQA 3BU4A 2XSOB 1JBSA 1BRNL 1X1WA 2RSXA 1B2XA 1IVWA 3EBYA 5M19A 4L8PA
chains in the Genus database with same CATH topology
1IVVA 2GEYA 5BVBA 1JRQA 1IQ8A 2IUJA 1RRLA 1YIT3 3MHEA 4L8OA 2FGTA 3FF2A 2BMRB 2MF7A 2CG1A 3U97A 3LT8A 3VGNA 1AVLA 1V74A 1O7NB 1O7GB 1OPYA 2R4IA 2FXTA 1JN5B 1N5PA 3KN4A 4RZMA 4FMDA 4MEIA 4FCMA 3D9RA 3UL5A 1YHQ3 2HMKB 5STDA 3CCQ3 2WO0A 3HI7A 2CWVA 3F7XA 3PYJA 3LZAA 5AI1A 1TUHA 5AYSC 4LEHA 3FGYA 3X40A 3JVCA 3IPTA 3OXAA 5D81A 3MG3A 5A0OB 3CCV3 4XBTA 1W2B2 1D6YA 2W9PA 1JN5A 2F99A 3VF1A 1FUWA 3DM8A 1LNHA 1OF5B 5BXQA 3G713 1SJWA 3GRDA 5I97A 3WOEB 1UI8A 1RJOA 1W5ZA 1YIJ3 1QVF2 5JPUA 1GS3A 5CF1A 1Q40B 2E2VA 2F98A 4N6V0 1M1K4 4O02B 1Q7Y4 2W03A 4HM4B 3CCU3 1OF5A 3OX9A 3GZYB 2ML6A 4AEQA 4ZM8A 3CCM3 1S723 2XH9A 1RRHA 3CCR3 2YFJB 4ORLA 2Q07A 4EYCA 3KKGA 4NHFA 1FGMA 1VQ53 2HMJB 5AEWB 3DGLA 3NXJA 1Q40A 2ZL8A 4XBYA 3T0UA 1OACA 2WOFA 3SXXA 1FA3A 5FW5A 3K7CA 3L0RA 1JB2A 4MMXB 4TX4A 4EV2A 1DMNA 2CW9A 2P05A 2W04A 1GD4A 1AV4A 2Z7AA 1JB4A 2D42A 2OCTA 2KCDA 4Q53A 3F9SA 4XDVA 2Z76A 3EC9A 1JNQA 1W00A 3LH4A 2XSHB 1IU7A 1WMNA 1ROAA 4O8SA 4RBNA 4AKYA 1L5GB 3DZLA 2CWUA 1FGRA 4N6LA 3ECFA 3WA2X 8CHOA 1O7WB 2CC3A 4AKZA 4N6MA 2W9QA 5ELUA 4OVMA 2BT3A 3UJMA 1A67A 3MG2A 3LTAA 1ULIB 3CPW2 1D6ZA 2BMOB 4H61A 4R4KA 1FGTA 3T8UA 5CF2A 4IIAA 1O7MB 2P0MA 5IF6A 3HZPA 1M904 2C11A 1TIJA 2XFSA 1KD14 1Q814 4HM3B 1IQYA 2WOHA 3B4PA 1JB5A 1Q824 4XDWA 3EN8A 4MJDA 3JUMA 1IVUA 3G0KA 3ROBA 1M1XB 5EVHA 1IV7A 1IT7A 1YVBI 3DMCA 4FMCA 3DXOA 4LSOA 2XF3A 2B1XB 2CFGA 3GAXA 3JUPA 3Q1CA 4EBGA 5KP4A 1DMMA 5ELJA 1US1A 1BUQA 1N9EA 3EX9A 3PS8A 2HMMB 1SIIA 4FR9A 4GB5A 4R80A 4GL6A 4CDLA 5CLKA 1NWWA 2CFKA 5IEOA 3ER7A 4KFDA 1WTHA 1EKMA 2MC8A 1W6YA 3N9HA 1Q864 1VQK3 3UL6A 4HM8B 4NREA 2INXA 3FLJA 1TU5A 2I9WA 2OWPA 3EE1A 2KRTA 2YFIB 3LT9A 4LGQA 3CCJ3 1K9M4 3BNCA 1U8CB 1K734 2Y73A 3PXMA 2B24B 2QA43 1C7HA 2E2TA 2XGLA 4HZBB 3SLUA 1STDA 2QIYA 3G8ZA 3MSOA 1GY6A 4BTWA 1SQWA 2CFWA 4O2HA 5AIHA 2BHMA 1HKXA 3CU3A 3WOFB 3K63A 1W7CA 3SOAA 5IERA 4OUQA 2BNGA 1NDOB 3G4S3 1VZZA 3KIIA 2JQ5A 3OWSA 1FGOA 4RNYA 5AEUB 2Z6BA 1YI23 4QWTA 4I4KA 2BO9B 4N6UA 4WWUC 2OOVA 3KSED 5G2GA 2GU1A 1S5AA 1E3RA 4JF8A 4HVNA 2PNCA 3OWYA 1CYUA 1IDPA 3LTBA 1CQSA 3WMDA 4HM6B 2CHCA 4FMBA 2KXGA 1PFPA 4CCVA 3QK9A 4X2OA 1E97A 4R1KA 1CEWI 3QRDA 1DYUA 4EV5A 5DRVA 3LTCA 3SEDA 1VQ73 1Q42A 1RN7A 3G16A 1NJI4 1OCVA 4N6OB 1IV9A 1ROVA 2L4VA 3CD63 3NX0A 3WODG 2OTL3 1F8NA 2A15A 1DVCA 1TP6A 5IW9A 1KWIA 1W2ZA 4HM2B 3PCRA 4N3VA 4HBRA 1GYBA 5AYRB 3V98A 2PZVA 4HM5B 1N8R4 3FG3A 2Y74A 7STDA 2CFLA 4O3VA 3CCE3 5JBSA 3NBBA 3BLZA 1PU4A 5DREA 2ZDJA 3NM2A 1WMOA 1Y4KA 1OHOA 2SBLA 4EXRA 2HMNB 2P09A 4JRFA 3RDEA 3NBRA 3V92A 3CMA3 3BNDA 1DMQA 3FCSB 1A2VA 3SX1A 2HMLB 3STDA 3IJEB 1K28A 1A90A 3NV0B 4OK0A 3H3HA 1YJ93 2E2UA 1VQL3 3F8XA 5EQLA 4RNZA 3FSDA 3EN1B 3CCS3 1W6GA 5IG4A 1W4NA 2WGQA 3JUOA 3M8CA 4PEJA 5CXOA 3Q90A 1ULJB 4BTXA 3J7Yd 1GY5A 4KFFA 1LVNA 1K41A 1UW1A 4WHAA 3HX8A 3EQQB 1MOLA 3NV0A 2GBWB 1OUNA 3MPHA 4WP5A 1KQS2 3S5CA 2M7OA 2D1WA 3EB8A 1W6CA 1N5HA 3SOYA 4FMAA 3LTDA 1KC84 5D83A 3MYTA 4HKVB 1QMAA 2RFRA 1QAKA 3EBTA 2XEPA 2CKFB 5TGNA 3HIGA 2STDA 4HM0B 3NUVA 4XB5A 2W0QA 1SPUA 3OWUA 5IEPA 1NB3I 3KE7A 3FG1A 1GD3A 1FGQA 1AR0A 4HM7B 1IVXA 1GY7A 4KVHA 3K0ZA 4MMZB 2GU3A 4STDA 3JUNA 3NM7A 2CIUA 1TFKA 3DY5A 3S67A 1QVG2 3CNMA 2K0MA 1WMPA 3PZWA 1JJ22 3WDGB 4FCJA 3BB9A 5KP1A 3A76A 3N8BA 5AIFA 1UUVB 2XGNA 3EJVA 4IPBA 3D3LA 1OHPA 2CK3H 3BNBA 1UI7A 3X3ZA 3B4OA 1JKGB 1AVKA 3I0YA 4H3UA 3X42A 2JDIH 2FNQA 3FG4A 2IUKA 3JUQA 3DGNA 4N6NB 5CK6A 1W02A 1OH0A 5IG0A 3UNLA 1T5YA 1A2KA 2QGUA 1HU9A 3N54B 3B8LA 3U1WA 2RCDA 1M9GA 1NO3A 1O7HB 3MG1A 5IG3A 1VQ43 1J2BA 4K61A 1ZO2A 1JKGA 1EQKA 3DGOA 3O8YA 4HZ9B 3VSYA 2LQVA 2P38A 2CWTA 2ML5A 1SIHA 3GZRA 3CCL3 1YGEA 4K90B 3CC73 2IMJA 3F8HA 1Z1SA 4N6TA 2CH9A 3NHXA 4HYZA 3RGRA 4G1MB 5JPPA 3CC23 2Z77A 3NBJA 3OW22 3S29A 4BTYA 4EC6A 1VQP3 3AMOB 4K1VA 2HMOB 3PCSA 1QALA 1VQ93 1D6UA 4L7KA 3WA3A 1VQ83 2GXFA 3E99A 1LOXA 4XBXA 2W2CA 3RGAA 1QAFA 2YFLB 3CNXA 4LZIA 3PGBA 4WFOA 3S27A 3GZXB 5AIGA 3K9MC 3F40A 1NB5I 1OHSA 4J8TA 2OOVC 3DUKA 2GEXA 3AMOA 2LYXA 2V1LA 3LOYA 1WQLB 1U5OA 1ZX2A 3GZBA 2YX9A 1N8QA 1VQ63 1KSIA 3FH1A 1R4CA 3IMAB 4R9KA 3I563 2OQEA 3KZTA 6STDA 3I553 1OGXA 2K54A 3HIIA 2O3OA 3K5TA 3OV4A 4J9AA 4XM4A 3TDGA 3FZWA 3UB1A 5FGOA 2OTJ3 2O9UX 3T8NA 3FF0A 4X2HA 2XR8B 3F7SA 2BMQB 2CFDA 2UX0A 3FKAA 1K8A4 1RKYA 1LXEA 1QJGA 5AIIA 1IT8A 3EHCA 2XFTA 3DGMA 3EF8A 1ASKA 3Q2PA 3F14A 1E3VA 1EG9B 1STFI 3CC43 5KP3A 1G96A 3X41A 1DVDA 3SVAA 2C10A 3B7CA 3X3XA 3G6E3 1IK3A 1MNLA 3NQYA 4KFEA 4FCZA 5LC6A 3ALAA 5HGRA 3H51A 3X3YA 1CYVA 1VQN3 4MMYB 3LXUX 1ISKA 3GWRA 2XRXB 1EA2A 2W56B 3HK4A 4K1UA 2GBXB 3CXC2 1VQO3 4LMIA 2WGOA 3CPOA 4WYKB 3BNEA 1O7PB 3V99A 4HM1B 3S28A 3KFQC 3KSPA 2IA7A 2OQEC 3CME3 3MKIA 1YJW3 1IQXA 1N9JA 1TFOA 5IG5A 4R9LA 2F86B 2P0XA 1OGZA 4KZ1A 2W6JH 4U13A 2QEX3 3LYGA 1JV2B 1UUWB 2W56A 3NQZA 4IT7A 1NU3A 5IENA 3LMLA 4WYKA 1W01A 3MWZA 1VQM3 5D82A 1YJN3 5LC7A 4HJLB 1WNHA 2CG0A 5EEOA 2RGQA 2XSOB 2RSXA 1IVWA 3EBYA 4L8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GEY A;  5BVB A;  3MHE A;  4L8O A;  3FF2 A;  2BMR B;  3VGN A;  1O7N B;  1O7G B;  1OPY A;  2R4I A;  1JN5 B;  4RZM A;  4FCM A;  3D9R A;  2HMK B;  5STD A;  3F7X A;  3LZA A;  5AI1 A;  1TUH A;  4LEH A;  3FGY A;  3IPT A;  3OXA A;  5D81 A;  3MG3 A;  4XBT A;  1JN5 A;  2F99 A;  3DM8 A;  1OF5 B;  5BXQ A;  1SJW A;  3GRD A;  5JPU A;  1GS3 A;  5CF1 A;  1Q40 B;  2F98 A;  4HM4 B;  1OF5 A;  3OX9 A;  3GZY B;  2YFJ B;  4ORL A;  3KKG A;  2HMJ B;  5AEW B;  3NXJ A;  1Q40 A;  4XBY A;  5FW5 A;  3K7C A;  1JB2 A;  1DMN A;  2Z7A A;  1JB4 A;  4Q53 A;  3F9S A;  4XDV A;  2Z76 A;  3EC9 A;  1W00 A;  2XSH B;  3DZL A;  3ECF A;  8CHO A;  1O7W B;  4OVM A;  3UJM A;  3MG2 A;  1ULI B;  2BMO B;  3T8U A;  5CF2 A;  4IIA A;  1O7M B;  5IF6 A;  3HZP A;  4HM3 B;  3B4P A;  1JB5 A;  4XDW A;  3EN8 A;  4MJD A;  3JUM A;  3G0K A;  3ROB A;  5EVH A;  3DMC A;  3DXO A;  5KP4 A;  2B1X B;  3JUP A;  1DMM A;  1BUQ A;  3EX9 A;  2HMM B;  4GB5 A;  4CDL A;  5CLK A;  1NWW A;  5IEO A;  3ER7 A;  1W6Y A;  4HM8 B;  2INX A;  3FLJ A;  2I9W A;  2OWP A;  2YFI B;  4LGQ A;  2B24 B;  1C7H A;  4HZB B;  1STD A;  2QIY A;  3G8Z A;  3MSO A;  1GY6 A;  5AIH A;  1HKX A;  3CU3 A;  3SOA A;  5IER A;  4OUQ A;  2BNG A;  1NDO B;  1VZZ A;  3OWS A;  2JQ5 A;  5AEU B;  4I4K A;  4WWU C;  5G2G A;  1S5A A;  1E3R A;  4HVN A;  3OWY A;  1IDP A;  1CQS A;  3WMD A;  4HM6 B;  2CHC A;  4X2O A;  1E97 A;  4R1K A;  5DRV A;  3SED A;  1Q42 A;  3G16 A;  1OCV A;  2A15 A;  1TP6 A;  4HM2 B;  4N3V A;  1GYB A;  2PZV A;  4HM5 B;  7STD A;  3BLZ A;  5DRE A;  3NM2 A;  1OHO A;  2HMN B;  3NBR A;  1DMQ A;  2HML B;  3STD A;  3NV0 B;  3H3H A;  3F8X A;  3FSD A;  3EN1 B;  5IG4 A;  3M8C A;  3JUO A;  4PEJ A;  5CXO A;  3Q90 A;  1ULJ B;  1GY5 A;  1K41 A;  3HX8 A;  3EQQ B;  3NV0 A;  2GBW B;  1OUN A;  4WP5 A;  3S5C A;  3SOY A;  5D83 A;  3MYT A;  4HKV B;  1QMA A;  2RFR A;  3EBT A;  2CKF B;  5TGN A;  2STD A;  4HM0 B;  3NUV A;  4XB5 A;  3OWU A;  5IEP A;  3KE7 A;  1AR0 A;  4HM7 B;  1GY7 A;  4KVH A;  3K0Z A;  4STD A;  3JUN A;  3CNM A;  4FCJ A;  3BB9 A;  5KP1 A;  3A76 A;  5AIF A;  1UUV B;  3EJV A;  1OHP A;  3B4O A;  1JKG B;  3I0Y A;  4H3U A;  3JUQ A;  5CK6 A;  1W02 A;  1OH0 A;  5IG0 A;  3UNL A;  1A2K A;  2QGU A;  3B8L A;  2RCD A;  3MG1 A;  1O7H B;  5IG3 A;  1ZO2 A;  1JKG A;  4HZ9 B;  3VSY A;  3GZR A;  2IMJ A;  3F8H A;  1Z1S A;  3NHX A;  3RGR A;  5JPP A;  2Z77 A;  4K1V A;  2HMO B;  4L7K A;  2GXF A;  3E99 A;  4XBX A;  2W2C A;  3RGA A;  2YFL B;  3CNX A;  3GZX B;  5AIG A;  3F40 A;  1OHS A;  4J8T A;  3DUK A;  2GEX A;  1WQL B;  1U5O A;  1ZX2 A;  3GZB A;  3FH1 A;  4R9K A;  3KZT A;  6STD A;  1OGX A;  2K54 A;  4J9A A;  3OV4 A;  4XM4 A;  3FZW A;  3T8N A;  3FF0 A;  4X2H A;  2XR8 B;  3F7S A;  2BMQ B;  2UX0 A;  3FKA A;  5AII A;  1QJG A;  3EHC A;  3EF8 A;  1ASK A;  3F14 A;  1E3V A;  1EG9 B;  5KP3 A;  3B7C A;  5HGR A;  3H51 A;  1ISK A;  3GWR A;  2XRX B;  1EA2 A;  3HK4 A;  4K1U A;  2GBX B;  4LMI A;  3CPO A;  4WYK B;  1O7P B;  4HM1 B;  3KSP A;  3MKI A;  5IG5 A;  4R9L A;  2F86 B;  1OGZ A;  4U13 A;  3LYG A;  1UUW B;  5IEN A;  1NU3 A;  4WYK A;  1W01 A;  5D82 A;  4HJL B;  2RGQ A;  2XSO B;  3EBY A;  4L8P A; 
#chains in the Genus database with same CATH topology
 1IVV A;  2GEY A;  5BVB A;  1JRQ A;  1IQ8 A;  2IUJ A;  1RRL A;  1YIT 3;  3D5I A;  3MHE A;  2ZA4 A;  4L8O A;  2FGT A;  3FF2 A;  2BMR B;  2MF7 A;  2CG1 A;  5KP4 A;  3U97 A;  3LT8 A;  1ZS7 A;  3VGN A;  1JBT A;  1X1Y A;  1AVL A;  1RGE A;  1V74 A;  1O7N B;  1O7G B;  1TRP A;  1OPY A;  2R4I A;  2FXT A;  3A5E A;  1JN5 B;  1N5P A;  3KN4 A;  4RZM A;  4FMD A;  4MEI A;  4FCM A;  1FYS A;  3D9R A;  3UL5 A;  1YHQ 3;  2KF3 A;  2UUG C;  3D79 A;  2HMK B;  4BL3 A;  5STD A;  3CCQ 3;  2WO0 A;  3HI7 A;  2CWV A;  3F7X A;  3PYJ A;  1RN4 A;  3LZA A;  5AI1 A;  1TUH A;  2BU4 A;  5AYS C;  4LEH A;  3FGY A;  3X40 A;  3JVC A;  3IPT A;  2IYJ A;  3OXA A;  5D81 A;  1G02 A;  3MG3 A;  5A0O B;  3CCV 3;  1B27 A;  4XBT A;  1W2B 2;  1D6Y A;  2W9P A;  1JN5 A;  2F99 A;  3VF1 A;  1FUW A;  3DM8 A;  1G0T A;  1LNH A;  1OF5 B;  5BXQ A;  3G71 3;  1SJW A;  3GRD A;  1HZ1 A;  3AGO A;  5I97 A;  1MWT A;  3WOE B;  1UI8 A;  1MWR A;  1RJO A;  1W5Z A;  1YIJ 3;  1QVF 2;  1RLS A;  1UUG B;  5JPU A;  1GS3 A;  5CF1 A;  1Q40 B;  2E2V A;  2F98 A;  4N6V 0;  1M1K 4;  4CJN A;  4O02 B;  4LYL B;  5M1A A;  1Q7Y 4;  2W03 A;  4HM4 B;  3CCU 3;  1I8V A;  1RMS A;  1RCK A;  1OF5 A;  3OX9 A;  3GZY B;  2ML6 A;  4AEQ A;  4ZM8 A;  3CCM 3;  1S72 3;  2XH9 A;  1RRH A;  3CCR 3;  2YFJ B;  4ORL A;  2Q07 A;  1IYY A;  4EYC A;  1RGK A;  3KKG A;  4NHF A;  1FGM A;  1I0V A;  1VQ5 3;  2HMJ B;  5AEW B;  1FZU A;  1BNJ A;  3DGL A;  3NXJ A;  1Q40 A;  2ZL8 A;  4J5K A;  4XBY A;  3T0U A;  1OAC A;  2WOF A;  3SXX A;  1FA3 A;  5FW5 A;  3K7C A;  3L0R A;  1B21 A;  6RNT A;  1JB2 A;  4MMX B;  4TX4 A;  4EV2 A;  3GSP A;  1DMN A;  2F5W A;  2CW9 A;  2P05 A;  2W04 A;  5G1K A;  1GD4 A;  1AV4 A;  2ZHX B;  2Z7A A;  1JB4 A;  1LOW A;  2D42 A;  2OCT A;  2KCD A;  2AAE A;  1BRS A;  2KF4 A;  3F9S A;  4Q53 A;  1TTO A;  2Z76 A;  3EC9 A;  4XDV A;  6GSP A;  1JNQ A;  1W00 A;  3LH4 A;  2XSH B;  1IU7 A;  1WMN A;  1ROA A;  4O8S A;  4RBN A;  4AKY A;  1L5G B;  3DZL A;  2CWU A;  1FGR A;  4N6L A;  3ECF A;  3WA2 X;  1BNS A;  8CHO A;  1O7W B;  2CC3 A;  4AKZ A;  4N6M A;  1RGH A;  3DH2 A;  1BNF A;  2W9Q A;  5ELU A;  4OVM A;  2BT3 A;  1BSA A;  3UJM A;  4CPK A;  1B2Z A;  5BIR A;  1A67 A;  3MG2 A;  3LTA A;  1ULI B;  1UGI A;  4BU4 A;  3CPW 2;  1D6Z A;  2BMO B;  4H61 A;  4R4K A;  1FGT A;  3T8U A;  5CF2 A;  4IIA A;  1O7M B;  2P0M A;  5IF6 A;  3HZP A;  2CX1 A;  1M90 4;  2C11 A;  1TIJ A;  2XFS A;  1KD1 4;  1Q81 4;  4HM3 B;  1IQY A;  2WOH A;  3B4P A;  1JB5 A;  1Q82 4;  4XDW A;  3EN8 A;  4MJD A;  2C4B A;  3JUM A;  1IVU A;  3G0K A;  3ROB A;  1M1X B;  5EVH A;  1IV7 A;  1IT7 A;  1YVB I;  3DMC A;  4FMC A;  3DXO A;  4LSO A;  2XF3 A;  2B1X B;  2CFG A;  3GAX A;  3JUP A;  3Q1C A;  2KAA A;  4GSP A;  4EBG A;  1DMM A;  5ELJ A;  1US1 A;  1BUQ A;  3WR2 A;  3HOH A;  1FUS A;  1N9E A;  3EX9 A;  2HMM B;  1I0X A;  1SII A;  1LRA A;  3PS8 A;  4FR9 A;  4GB5 A;  4R80 A;  1LOY A;  3KCH A;  4GL6 A;  1BSE A;  4CDL A;  5CLK A;  1JBR A;  5M18 A;  1NWW A;  2CFK A;  5IEO A;  5RNT A;  3ER7 A;  4KFD A;  1WTH A;  1BGS A;  1EKM A;  1W6Y A;  2MC8 A;  3N9H A;  1RDS A;  1T3B A;  1Q86 4;  1VQK 3;  3UL6 A;  4HM8 B;  1RHL A;  1A2P A;  2INX A;  3FLJ A;  4NRE A;  4KT3 B;  8RNT A;  1TU5 A;  2I9W A;  2OWP A;  1V57 A;  1MGR A;  3EE1 A;  1BNI A;  2KRT A;  2YFI B;  3LT9 A;  1PY3 A;  4LGQ A;  3CCJ 3;  1K9M 4;  3BNC A;  1U8C B;  1K73 4;  2Y73 A;  3PXM A;  2B24 B;  2QA4 3;  1C7H A;  2E2T A;  2XGL A;  1AQZ A;  4HZB B;  2BIR A;  1STD A;  3SLU A;  2QIY A;  3G8Z A;  3MSO A;  1GOY A;  1GY6 A;  1GOV A;  1UCK A;  2RNT A;  1SQW A;  3BIR A;  4BTW A;  2CFW A;  4O2H A;  2CX0 A;  5AIH A;  2BHM A;  1HKX A;  3CU3 A;  3WOF B;  3K63 A;  1W7C A;  3DGY A;  3SOA A;  5IER A;  2J8X B;  4OUQ A;  1CH0 A;  2BNG A;  1NDO B;  3G4S 3;  1VZZ A;  3KII A;  2JQ5 A;  3OWS A;  1FGO A;  4RNY A;  5AEU B;  2Z6B A;  1YI2 3;  4QWT A;  3RNT A;  4I4K A;  2BO9 B;  4N6U A;  4WWU C;  2OOV A;  3Q3F A;  3KSE D;  3AHS A;  5G2G A;  2GU1 A;  1S5A A;  1E3R A;  3D4A A;  4JF8 A;  4HVN A;  2PNC A;  3OWY A;  1CYU A;  1IDP A;  1EUI C;  3LTB A;  1CQS A;  3WMD A;  1DET A;  4HM6 B;  2CHC A;  4FMB A;  2KXG A;  1PFP A;  4CCV A;  1BRH A;  3QK9 A;  4X2O A;  1E97 A;  4R1K A;  1CEW I;  2AAD A;  3QRD A;  1DYU A;  2F56 A;  4EV5 A;  5DRV A;  1Q7H A;  3LTC A;  3SED A;  1VQ7 3;  1RNB A;  1UGH I;  1Q42 A;  1RN7 A;  3G16 A;  1NJI 4;  1OCV A;  4N6O B;  1IV9 A;  1ROV A;  2L4V A;  1B2S A;  1SAR A;  3CD6 3;  3NX0 A;  3WOD G;  2OTL 3;  1F8N A;  2A15 A;  1DVC A;  1TP6 A;  5IW9 A;  2HOH A;  4RNT A;  1BNR A;  1KWI A;  1W2Z A;  4HM2 B;  2KF6 A;  3PCR A;  4N3V A;  1BRI A;  4HBR A;  1GYB A;  1UDI I;  4GHO A;  5AYR B;  3V98 A;  2PZV A;  4HM5 B;  1N8R 4;  3FG3 A;  2Y74 A;  7STD A;  1LQG C;  2CFL A;  4J5G A;  2K3D A;  4O3V A;  3CCE 3;  4HAA A;  5JBS A;  3NBB A;  3BLZ A;  1PU4 A;  1R4Y A;  1BSB A;  1NNV A;  2ZDJ A;  3NM2 A;  5DRE A;  3ZG0 A;  1WMO A;  1Y4K A;  1OHO A;  2SBL A;  4EXR A;  2HMN B;  2P09 A;  4JRF A;  3RDE A;  3NBR A;  3V92 A;  3CMA 3;  1C54 A;  3BND A;  1YGW A;  1DMQ A;  3FCS B;  1A2V A;  3SX1 A;  1I2E A;  2HML B;  3STD A;  3IJE B;  4BL2 A;  1K28 A;  1A90 A;  3NV0 B;  4OK0 A;  3H3H A;  7RNT A;  1YJ9 3;  2E2U A;  1VQL 3;  3AHW A;  2L1S A;  3F8X A;  4RNZ A;  5EQL A;  3FSD A;  1TJD A;  3EN1 B;  3CCS 3;  1W6G A;  5IG4 A;  1W4N A;  2WGQ A;  3JUO A;  3M8C A;  4PEJ A;  5CXO A;  1I2G A;  3Q90 A;  1BAO A;  1ULJ B;  4BTX A;  3J7Y d;  1GY5 A;  4KFF A;  1LVN A;  1K41 A;  1UW1 A;  4WHA A;  3HX8 A;  3EQQ B;  1HYF A;  1MOL A;  3NV0 A;  2GBW B;  1OUN A;  3MPH A;  4WP5 A;  1KQS 2;  1BU4 A;  1V58 A;  3S5C A;  2M7O A;  2D1W A;  2R41 A;  4I5Q A;  3EB8 A;  1W6C A;  1N5H A;  3SOY A;  4FMA A;  3LTD A;  1KC8 4;  3SYU A;  5D83 A;  1MGW A;  1LQM B;  3MYT A;  4HKV B;  1QMA A;  1GMR A;  2RBI A;  2RFR A;  2H0H A;  1QAK A;  3EBT A;  4NPB A;  2XEP A;  2CKF B;  5TGN A;  3HIG A;  2GSP A;  9RNT A;  2STD A;  4HM0 B;  3NUV A;  4XB5 A;  2W0Q A;  1SPU A;  1JZD A;  3OWU A;  5IEP A;  4HOH A;  1NB3 I;  3KE7 A;  1BSC A;  3FG1 A;  1GD3 A;  1FGQ A;  1AR0 A;  4HM7 B;  1IVX A;  1GY7 A;  4KVH A;  3K0Z A;  4MMZ B;  2GU3 A;  4STD A;  3JUN A;  2KF5 A;  3NM7 A;  2CIU A;  1RGL A;  1TFK A;  3DY5 A;  3S67 A;  1QVG 2;  3CNM A;  2K0M A;  1WMP A;  5BU4 A;  3PZW A;  1JJ2 2;  1BRJ A;  3WDG B;  1RSN A;  4FCJ A;  3WHO A;  3BB9 A;  5KP1 A;  3A76 A;  3N8B A;  1BUJ A;  5AIF A;  1UUV B;  1JZO A;  2XGN A;  3EJV A;  4IPB A;  3D3L A;  1YNV X;  1OHP A;  2CK3 H;  3BNB A;  1UI7 A;  1ZGX A;  3X3Z A;  1TRQ A;  3B4O A;  1AVK A;  1JKG B;  3I0Y A;  4H3U A;  3D5G A;  3X42 A;  2JDI H;  1LNI A;  1RGA A;  2FNQ A;  3FG4 A;  2IUK A;  3JUQ A;  3DGN A;  4N6N B;  5CK6 A;  1W02 A;  1OH0 A;  5IG0 A;  3URP A;  1T5Y A;  3UNL A;  1DE3 A;  1EEJ A;  1X1X A;  1A2K A;  2QGU A;  1HU9 A;  3N54 B;  3B8L A;  3U1W A;  2RCD A;  1M9G A;  1NO3 A;  1B3S A;  1O7H B;  1X1U A;  3AGN A;  3MG1 A;  5IG3 A;  4K61 A;  1J2B A;  4EW5 A;  1RN1 A;  1BNG A;  1JKG A;  1ZO2 A;  1LOV A;  1EQK A;  3DGO A;  3O8Y A;  4HZ9 B;  3VSY A;  2LQV A;  2P38 A;  1T2H A;  2CWT A;  1SIH A;  2ML5 A;  3GZR A;  3CCL 3;  5HOH A;  1YGE A;  4K90 B;  2F5M A;  3CC7 3;  2IMJ A;  3F8H A;  1GSP A;  1RTU A;  1Z1S A;  4N6T A;  2CH9 A;  3NHX A;  4HYZ A;  3RGR A;  4G1M B;  1RNT A;  5JPP A;  3CC2 3;  2Z77 A;  3NBJ A;  3OW2 2;  3S29 A;  4BTY A;  4EC6 A;  1VQP 3;  3AMO B;  4K1V A;  2HMO B;  3PCS A;  1PYL A;  1QAL A;  1VQ9 3;  1D6U A;  4L7K A;  1GMP A;  3WA3 A;  1VQ8 3;  2GXF A;  3E99 A;  1LOX A;  4XBX A;  2W2C A;  3RGA A;  1B20 A;  1FUT A;  1QAF A;  2YFL B;  3CNX A;  4LZI A;  3PGB A;  4WFO A;  3S27 A;  3GZX B;  5AIG A;  3K9M C;  3F40 A;  1NB5 I;  1OHS A;  5GSP A;  4J8T A;  1RCL A;  2OOV C;  3DUK A;  2GEX A;  3AMO A;  2LYX A;  2V1L A;  3LOY A;  1B2M A;  1WQL B;  1U5O A;  1ZX2 A;  3GZB A;  2YX9 A;  1N8Q A;  1B2U A;  3ZG5 A;  1VQ6 3;  1KSI A;  3FH1 A;  1R4C A;  3IMA B;  4R9K A;  3I56 3;  1BOX A;  1I3F A;  2OQE A;  3KZT A;  6STD A;  3I55 3;  2F4Y A;  1OGX A;  7GSP A;  2K54 A;  1I3I A;  3HII A;  2O3O A;  3K5T A;  3OV4 A;  4J9A A;  4XM4 A;  3TDG A;  3FZW A;  1AY7 A;  3UB1 A;  5FGO A;  2OTJ 3;  1BRG A;  2O9U X;  1BNE A;  3T8N A;  3FF0 A;  1I70 A;  4X2H A;  2XR8 B;  3F7S A;  2BMQ B;  2CFD A;  2H0G A;  2UX0 A;  1I2F A;  3FKA A;  1K8A 4;  1RKY A;  1LXE A;  1QJG A;  1MWS A;  5AII A;  1IT8 A;  5G1L A;  3EHC A;  2XFT A;  3DGM A;  3EF8 A;  1ASK A;  3Q2P A;  3F14 A;  1RGC A;  1UCJ A;  1E3V A;  1EG9 B;  1STF I;  3CC4 3;  3ZFZ A;  5KP3 A;  1G96 A;  3X41 A;  1DVD A;  2IY2 A;  3SVA A;  4BIR A;  2C10 A;  3B7C A;  3X3X A;  3G6E 3;  1GOU A;  1VQQ A;  1BRK A;  1IK3 A;  1MNL A;  3NQY A;  4KFE A;  4FCZ A;  5LC6 A;  1T2I A;  3ALA A;  5HGR A;  3H51 A;  3X3Y A;  1CYV A;  1MWU A;  1VQN 3;  4MMY B;  3LXU X;  1ISK A;  3GWR A;  2XRX B;  1EA2 A;  2W56 B;  3HK4 A;  4K1U A;  2GBX B;  1UCL A;  3CXC 2;  1VQO 3;  1BVI A;  2WGO A;  3CPO A;  4LMI A;  4WYK B;  3BNE A;  1FW7 A;  1O7P B;  3V99 A;  4HM1 B;  3S28 A;  3KFQ C;  2H0I A;  3KSP A;  1BIR A;  2IA7 A;  2OQE C;  4DKI A;  3CME 3;  3MKI A;  1YJW 3;  1IQX A;  1N9J A;  1TFO A;  4ILF A;  4R9L A;  5IG5 A;  2F86 B;  2P0X A;  1GMQ A;  1RGF A;  1OGZ A;  4KZ1 A;  1RGG A;  2W6J H;  4U13 A;  3LYG A;  2QEX 3;  1UUW B;  1JV2 B;  2W56 A;  3NQZ A;  4IT7 A;  1NU3 A;  1UCI A;  5IEN A;  3LML A;  4WYK A;  1YVS A;  1W01 A;  1BAN A;  2SAR A;  3MWZ A;  5D82 A;  1VQM 3;  1YJN 3;  1VQ4 3;  5LC7 A;  2UGI A;  4HJL B;  1Q9E A;  1WNH A;  2CG0 A;  5EEO A;  1BSD A;  2RGQ A;  3BU4 A;  2XSO B;  1JBS A;  1BRN L;  1X1W A;  2RSX A;  1B2X A;  1IVW A;  3EBY A;  5M19 A;  4L8P A; 
#chains in the Genus database with same CATH homology
 1IVV A;  2GEY A;  5BVB A;  1JRQ A;  1IQ8 A;  2IUJ A;  1RRL A;  1YIT 3;  3MHE A;  4L8O A;  2FGT A;  3FF2 A;  2BMR B;  2MF7 A;  2CG1 A;  3U97 A;  3LT8 A;  3VGN A;  1AVL A;  1V74 A;  1O7N B;  1O7G B;  1OPY A;  2R4I A;  2FXT A;  1JN5 B;  1N5P A;  3KN4 A;  4RZM A;  4FMD A;  4MEI A;  4FCM A;  3D9R A;  3UL5 A;  1YHQ 3;  2HMK B;  5STD A;  3CCQ 3;  2WO0 A;  3HI7 A;  2CWV A;  3F7X A;  3PYJ A;  3LZA A;  5AI1 A;  1TUH A;  5AYS C;  4LEH A;  3FGY A;  3X40 A;  3JVC A;  3IPT A;  3OXA A;  5D81 A;  3MG3 A;  5A0O B;  3CCV 3;  4XBT A;  1W2B 2;  1D6Y A;  2W9P A;  1JN5 A;  2F99 A;  3VF1 A;  1FUW A;  3DM8 A;  1LNH A;  1OF5 B;  5BXQ A;  3G71 3;  1SJW A;  3GRD A;  5I97 A;  3WOE B;  1UI8 A;  1RJO A;  1W5Z A;  1YIJ 3;  1QVF 2;  5JPU A;  1GS3 A;  5CF1 A;  1Q40 B;  2E2V A;  2F98 A;  4N6V 0;  1M1K 4;  4O02 B;  1Q7Y 4;  2W03 A;  4HM4 B;  3CCU 3;  1OF5 A;  3OX9 A;  3GZY B;  2ML6 A;  4AEQ A;  4ZM8 A;  3CCM 3;  1S72 3;  2XH9 A;  1RRH A;  3CCR 3;  2YFJ B;  4ORL A;  2Q07 A;  4EYC A;  3KKG A;  4NHF A;  1FGM A;  1VQ5 3;  2HMJ B;  5AEW B;  3DGL A;  3NXJ A;  1Q40 A;  2ZL8 A;  4XBY A;  3T0U A;  1OAC A;  2WOF A;  3SXX A;  1FA3 A;  5FW5 A;  3K7C A;  3L0R A;  1JB2 A;  4MMX B;  4TX4 A;  4EV2 A;  1DMN A;  2CW9 A;  2P05 A;  2W04 A;  1GD4 A;  1AV4 A;  2Z7A A;  1JB4 A;  2D42 A;  2OCT A;  2KCD A;  4Q53 A;  3F9S A;  4XDV A;  2Z76 A;  3EC9 A;  1JNQ A;  1W00 A;  3LH4 A;  2XSH B;  1IU7 A;  1WMN A;  1ROA A;  4O8S A;  4RBN A;  4AKY A;  1L5G B;  3DZL A;  2CWU A;  1FGR A;  4N6L A;  3ECF A;  3WA2 X;  8CHO A;  1O7W B;  2CC3 A;  4AKZ A;  4N6M A;  2W9Q A;  5ELU A;  4OVM A;  2BT3 A;  3UJM A;  1A67 A;  3MG2 A;  3LTA A;  1ULI B;  3CPW 2;  1D6Z A;  2BMO B;  4H61 A;  4R4K A;  1FGT A;  3T8U A;  5CF2 A;  4IIA A;  1O7M B;  2P0M A;  5IF6 A;  3HZP A;  1M90 4;  2C11 A;  1TIJ A;  2XFS A;  1KD1 4;  1Q81 4;  4HM3 B;  1IQY A;  2WOH A;  3B4P A;  1JB5 A;  1Q82 4;  4XDW A;  3EN8 A;  4MJD A;  3JUM A;  1IVU A;  3G0K A;  3ROB A;  1M1X B;  5EVH A;  1IV7 A;  1IT7 A;  1YVB I;  3DMC A;  4FMC A;  3DXO A;  4LSO A;  2XF3 A;  2B1X B;  2CFG A;  3GAX A;  3JUP A;  3Q1C A;  4EBG A;  5KP4 A;  1DMM A;  5ELJ A;  1US1 A;  1BUQ A;  1N9E A;  3EX9 A;  3PS8 A;  2HMM B;  1SII A;  4FR9 A;  4GB5 A;  4R80 A;  4GL6 A;  4CDL A;  5CLK A;  1NWW A;  2CFK A;  5IEO A;  3ER7 A;  4KFD A;  1WTH A;  1EKM A;  2MC8 A;  1W6Y A;  3N9H A;  1Q86 4;  1VQK 3;  3UL6 A;  4HM8 B;  4NRE A;  2INX A;  3FLJ A;  1TU5 A;  2I9W A;  2OWP A;  3EE1 A;  2KRT A;  2YFI B;  3LT9 A;  4LGQ A;  3CCJ 3;  1K9M 4;  3BNC A;  1U8C B;  1K73 4;  2Y73 A;  3PXM A;  2B24 B;  2QA4 3;  1C7H A;  2E2T A;  2XGL A;  4HZB B;  3SLU A;  1STD A;  2QIY A;  3G8Z A;  3MSO A;  1GY6 A;  4BTW A;  1SQW A;  2CFW A;  4O2H A;  5AIH A;  2BHM A;  1HKX A;  3CU3 A;  3WOF B;  3K63 A;  1W7C A;  3SOA A;  5IER A;  4OUQ A;  2BNG A;  1NDO B;  3G4S 3;  1VZZ A;  3KII A;  2JQ5 A;  3OWS A;  1FGO A;  4RNY A;  5AEU B;  2Z6B A;  1YI2 3;  4QWT A;  4I4K A;  2BO9 B;  4N6U A;  4WWU C;  2OOV A;  3KSE D;  5G2G A;  2GU1 A;  1S5A A;  1E3R A;  4JF8 A;  4HVN A;  2PNC A;  3OWY A;  1CYU A;  1IDP A;  3LTB A;  1CQS A;  3WMD A;  4HM6 B;  2CHC A;  4FMB A;  2KXG A;  1PFP A;  4CCV A;  3QK9 A;  4X2O A;  1E97 A;  4R1K A;  1CEW I;  3QRD A;  1DYU A;  4EV5 A;  5DRV A;  3LTC A;  3SED A;  1VQ7 3;  1Q42 A;  1RN7 A;  3G16 A;  1NJI 4;  1OCV A;  4N6O B;  1IV9 A;  1ROV A;  2L4V A;  3CD6 3;  3NX0 A;  3WOD G;  2OTL 3;  1F8N A;  2A15 A;  1DVC A;  1TP6 A;  5IW9 A;  1KWI A;  1W2Z A;  4HM2 B;  3PCR A;  4N3V A;  4HBR A;  1GYB A;  5AYR B;  3V98 A;  2PZV A;  4HM5 B;  1N8R 4;  3FG3 A;  2Y74 A;  7STD A;  2CFL A;  4O3V A;  3CCE 3;  5JBS A;  3NBB A;  3BLZ A;  1PU4 A;  5DRE A;  2ZDJ A;  3NM2 A;  1WMO A;  1Y4K A;  1OHO A;  2SBL A;  4EXR A;  2HMN B;  2P09 A;  4JRF A;  3RDE A;  3NBR A;  3V92 A;  3CMA 3;  3BND A;  1DMQ A;  3FCS B;  1A2V A;  3SX1 A;  2HML B;  3STD A;  3IJE B;  1K28 A;  1A90 A;  3NV0 B;  4OK0 A;  3H3H A;  1YJ9 3;  2E2U A;  1VQL 3;  3F8X A;  5EQL A;  4RNZ A;  3FSD A;  3EN1 B;  3CCS 3;  1W6G A;  5IG4 A;  1W4N A;  2WGQ A;  3JUO A;  3M8C A;  4PEJ A;  5CXO A;  3Q90 A;  1ULJ B;  4BTX A;  3J7Y d;  1GY5 A;  4KFF A;  1LVN A;  1K41 A;  1UW1 A;  4WHA A;  3HX8 A;  3EQQ B;  1MOL A;  3NV0 A;  2GBW B;  1OUN A;  3MPH A;  4WP5 A;  1KQS 2;  3S5C A;  2M7O A;  2D1W A;  3EB8 A;  1W6C A;  1N5H A;  3SOY A;  4FMA A;  3LTD A;  1KC8 4;  5D83 A;  3MYT A;  4HKV B;  1QMA A;  2RFR A;  1QAK A;  3EBT A;  2XEP A;  2CKF B;  5TGN A;  3HIG A;  2STD A;  4HM0 B;  3NUV A;  4XB5 A;  2W0Q A;  1SPU A;  3OWU A;  5IEP A;  1NB3 I;  3KE7 A;  3FG1 A;  1GD3 A;  1FGQ A;  1AR0 A;  4HM7 B;  1IVX A;  1GY7 A;  4KVH A;  3K0Z A;  4MMZ B;  2GU3 A;  4STD A;  3JUN A;  3NM7 A;  2CIU A;  1TFK A;  3DY5 A;  3S67 A;  1QVG 2;  3CNM A;  2K0M A;  1WMP A;  3PZW A;  1JJ2 2;  3WDG B;  4FCJ A;  3BB9 A;  5KP1 A;  3A76 A;  3N8B A;  5AIF A;  1UUV B;  2XGN A;  3EJV A;  4IPB A;  3D3L A;  1OHP A;  2CK3 H;  3BNB A;  1UI7 A;  3X3Z A;  3B4O A;  1JKG B;  1AVK A;  3I0Y A;  4H3U A;  3X42 A;  2JDI H;  2FNQ A;  3FG4 A;  2IUK A;  3JUQ A;  3DGN A;  4N6N B;  5CK6 A;  1W02 A;  1OH0 A;  5IG0 A;  3UNL A;  1T5Y A;  1A2K A;  2QGU A;  1HU9 A;  3N54 B;  3B8L A;  3U1W A;  2RCD A;  1M9G A;  1NO3 A;  1O7H B;  3MG1 A;  5IG3 A;  1VQ4 3;  1J2B A;  4K61 A;  1ZO2 A;  1JKG A;  1EQK A;  3DGO A;  3O8Y A;  4HZ9 B;  3VSY A;  2LQV A;  2P38 A;  2CWT A;  2ML5 A;  1SIH A;  3GZR A;  3CCL 3;  1YGE A;  4K90 B;  3CC7 3;  2IMJ A;  3F8H A;  1Z1S A;  4N6T A;  2CH9 A;  3NHX A;  4HYZ A;  3RGR A;  4G1M B;  5JPP A;  3CC2 3;  2Z77 A;  3NBJ A;  3OW2 2;  3S29 A;  4BTY A;  4EC6 A;  1VQP 3;  3AMO B;  4K1V A;  2HMO B;  3PCS A;  1QAL A;  1VQ9 3;  1D6U A;  4L7K A;  3WA3 A;  1VQ8 3;  2GXF A;  3E99 A;  1LOX A;  4XBX A;  2W2C A;  3RGA A;  1QAF A;  2YFL B;  3CNX A;  4LZI A;  3PGB A;  4WFO A;  3S27 A;  3GZX B;  5AIG A;  3K9M C;  3F40 A;  1NB5 I;  1OHS A;  4J8T A;  2OOV C;  3DUK A;  2GEX A;  3AMO A;  2LYX A;  2V1L A;  3LOY A;  1WQL B;  1U5O A;  1ZX2 A;  3GZB A;  2YX9 A;  1N8Q A;  1VQ6 3;  1KSI A;  3FH1 A;  1R4C A;  3IMA B;  4R9K A;  3I56 3;  2OQE A;  3KZT A;  6STD A;  3I55 3;  1OGX A;  2K54 A;  3HII A;  2O3O A;  3K5T A;  3OV4 A;  4J9A A;  4XM4 A;  3TDG A;  3FZW A;  3UB1 A;  5FGO A;  2OTJ 3;  2O9U X;  3T8N A;  3FF0 A;  4X2H A;  2XR8 B;  3F7S A;  2BMQ B;  2CFD A;  2UX0 A;  3FKA A;  1K8A 4;  1RKY A;  1LXE A;  1QJG A;  5AII A;  1IT8 A;  3EHC A;  2XFT A;  3DGM A;  3EF8 A;  1ASK A;  3Q2P A;  3F14 A;  1E3V A;  1EG9 B;  1STF I;  3CC4 3;  5KP3 A;  1G96 A;  3X41 A;  1DVD A;  3SVA A;  2C10 A;  3B7C A;  3X3X A;  3G6E 3;  1IK3 A;  1MNL A;  3NQY A;  4KFE A;  4FCZ A;  5LC6 A;  3ALA A;  5HGR A;  3H51 A;  3X3Y A;  1CYV A;  1VQN 3;  4MMY B;  3LXU X;  1ISK A;  3GWR A;  2XRX B;  1EA2 A;  2W56 B;  3HK4 A;  4K1U A;  2GBX B;  3CXC 2;  1VQO 3;  4LMI A;  2WGO A;  3CPO A;  4WYK B;  3BNE A;  1O7P B;  3V99 A;  4HM1 B;  3S28 A;  3KFQ C;  3KSP A;  2IA7 A;  2OQE C;  3CME 3;  3MKI A;  1YJW 3;  1IQX A;  1N9J A;  1TFO A;  5IG5 A;  4R9L A;  2F86 B;  2P0X A;  1OGZ A;  4KZ1 A;  2W6J H;  4U13 A;  2QEX 3;  3LYG A;  1JV2 B;  1UUW B;  2W56 A;  3NQZ A;  4IT7 A;  1NU3 A;  5IEN A;  3LML A;  4WYK A;  1W01 A;  3MWZ A;  1VQM 3;  5D82 A;  1YJN 3;  5LC7 A;  4HJL B;  1WNH A;  2CG0 A;  5EEO A;  2RGQ A;  2XSO B;  2RSX A;  1IVW A;  3EBY A;  4L8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...