5KP4A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to 19-nortestosterone
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
b'MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp4A00
5AEWB 4R1KA 3EN1B 4L7KA 3DXOA 3OWSA 2HMNB 1E97A 3MG2A 5IF6A 3GZBA 1Q40B 1Q40A 3B4OA 3MHEA 4HM4B 2CHCA 2RFRA 4FCJA 1JB2A 3G0KA 2BMRB 1K41A 3BLZA 7STDA 3NHXA 5STDA 3ECFA 3EBTA 2Z7AA 4N3VA 4RZMA 3F14A 4CDLA 1QMAA 3EF8A 3F8HA 1ASKA 2B24B 3B7CA 1W6YA 3RGRA 1NU3A 2QGUA 4GB5A 4PEJA 1AR0A 5IENA 1E3RA 3ER7A 4X2OA 3F8XA 4HM8B 1W02A 2F86B 4K1UA 4HM5B 3OV4A 1SJWA 5IG4A 1W00A 1WQLB 3KKGA 3KZTA 4HVNA 3B8LA 1OHPA 2B1XB 1TUHA 4WP5A 5AI1A 1ULIB 3K0ZA 1JB5A 1JKGB 5CLKA 3K7CA 3STDA 4XDVA 1JKGA 1OHOA 3BB9A 3DM8A 3CU3A 4L8OA 1OUNA 2GEYA 3SOAA 3T8UA 4HM2B 3MG1A 1ULJB 3MSOA 5CF1A 5KP3A 1VZZA 5IG0A 4LGQA 3DZLA 1ISKA 4K1VA 3EJVA 3FH1A 1OCVA 5DRVA 3FF2A 2HMLB 5TGNA 3EQQB 2I9WA 2HMOB 1DMQA 5IERA 1EA2A 2JQ5A 5IEOA 5FW5A 4WWUC 2GEXA 3EBYA 3SEDA 1O7GB 3FLJA 2CKFB 4XBYA 3I0YA 4XM4A 5DREA 4HZ9B 3F7XA 2XSHB 1S5AA 4IIAA 3EN8A 1JN5B 1JN5A 4HM0B 1C7HA 1ZO2A 3H3HA 4HM7B 2XR8B 5BXQA 1GY5A 3SOYA 3LZAA 1OF5B 1GY6A 1OF5A 4J9AA 1OHSA 1STDA 1OGZA 4HKVB 3NBRA 4HM3B 4HM1B 5AEUB 5AIHA 1Q42A 5KP4A 5HGRA 1O7HB 4L8PA 3EHCA 3GZYB 8CHOA 5G2GA 5EVHA 1A2KA 1ZX2A 3GWRA 3OX9A 3T8NA 4HZBB 1OGXA 3NXJA 3A76A 2UX0A 1OPYA 3UJMA 3UNLA 3E99A 2BMOB 2YFJB 4LEHA 4X2HA 4HJLB 4XDWA 1TP6A 3KE7A 4R9KA 1O7WB 3EC9A 2INXA 3NM2A 4OVMA 3VSYA 3CPOA 2HMKB 1U5OA 2PZVA 3FSDA 1JB4A 1OH0A 2XSOB 4HM6B 2QIYA 3H51A 5CK6A 3FZWA 3WMDA 3NUVA 1O7MB 2GXFA 3G8ZA 2XRXB 1GS3A 2F98A 1UUVB 3MKIA 5KP1A 5IG5A 2Z76A 1DMMA 4XBTA 2BMQB 5CF2A 4MJDA 3ROBA 3D9RA 3EX9A 4H3UA 1EG9B 4WYKB 1O7NB 4WYKA 3FGYA 3JUQA 3FKAA 1CQSA 4LMIA 5IEPA 5CXOA 3GZXB 1NDOB 3JUNA 2K54A 2YFIB 3HK4A 2STDA 3OXAA 2RCDA 2BNGA 4XB5A 1BUQA 3VGNA 3HX8A 1E3VA 3F7SA 5AIGA 1GYBA 3JUOA 3OWYA 3FF0A 3CNMA 4Q53A 2IMJA 1UUWB 5D82A 3JUMA 3F9SA 3F40A 4XBXA 4J8TA 1DMNA 5IG3A 3S5CA 2HMJB 2YFLB 3KSPA 5D81A 5AIIA 5BVBA 1O7PB 1QJGA 2F99A 1IDPA 3IPTA 4OUQA 3B4PA 4ORLA 2HMMB 1Z1SA 6STDA 3RGAA 2GBWB 2W2CA 1GY7A 2GBXB 3DMCA 4STDA 3G16A 1W01A 3NV0B 2A15A 3GZRA 3OWUA 4R9LA 3Q90A 3NV0A 2R4IA 2OWPA 1NWWA 1HKXA 5JPUA 3JUPA 3HZPA 2Z77A 5AIFA 4I4KA 3MYTA 2RGQA 5D83A 3MG3A 4FCMA 3DUKA 5JPPA 3LYGA 4KVHA 3GRDA 3M8CA 3CNXA 4U13A
chains in the Genus database with same CATH superfamily
2IY2A 5AEWB 4R1KA 2P0MA 1I3IA 3EN1B 2ZHXB 4O8SA 4L7KA 2OTL3 2BU4A 2CFDA 4CPKA 7RNTA 3DXOA 3OWSA 2HMNB 1E97A 3MG2A 5IF6A 1I2FA 1Q40B 3GZBA 1BGSA 1MOLA 3JVCA 2W9QA 2KF6A 2KF5A 1Q40A 2ZL8A 1CH0A 3HIGA 2W9PA 3VF1A 1RKYA 1DE3A 2E2UA 3B4OA 1X1WA 1LOVA 3KIIA 2CW9A 5I97A 4GL6A 4EV5A 1X1XA 4DKIA 2CWUA 3MHEA 3CC23 4HM4B 3T0UA 1NB5I 2ML6A 2CHCA 2RFRA 4FCJA 2CIUA 2CFWA 3CME3 1JB2A 3AHWA 3G0KA 4N6V0 5GSPA 2V1LA 4R4KA 2BMRB 1K41A 1SIIA 1IV9A 1BRIA 3BLZA 4CJNA 7STDA 2QA43 3NHXA 1AY7A 3K63A 5STDA 3ECFA 1FW7A 3D5IA 3X40A 9RNTA 1HYFA 1Q7HA 2H0HA 3TDGA 1VQN3 2L1SA 3EBTA 2Z7AA 4N3VA 4RZMA 3F14A 3Q2PA 4CDLA 3CCV3 1YIJ3 1QMAA 1B20A 3FG3A 4RBNA 4H61A 1M1K4 3EF8A 3F8HA 2CG0A 1ASKA 3BU4A 1VQ73 2B24B 5LC7A 2RBIA 1PY3A 1D6UA 3B7CA 3CD63 1D6YA 1W6YA 4R80A 1Q9EA 3RGRA 1NU3A 1X1UA 2QGUA 2C10A 1QAFA 2RNTA 1AR0A 1YGEA 4GB5A 4PEJA 5IENA 1M1XB 1E3RA 3ER7A 3DGOA 3MPHA 4X2OA 3F8XA 5M18A 4HM8B 3CCU3 1IYYA 1SQWA 1AVLA 3DGNA 1W02A 1T5YA 1BNGA 1UI8A 1CYVA 1CYUA 3BIRA 2GU3A 2F86B 1IT7A 2W56B 4K1UA 4BIRA 4HM5B 1TFKA 3NM7A 3OV4A 2C11A 1EUIC 1SJWA 2W56A 3PXMA 1A90A 2OOVC 4NPBA 5IG4A 1G02A 1W00A 2E2TA 1WQLB 1RGAA 1PFPA 1K28A 4N6LA 4J5GA 2KRTA 5AYRB 1VQ53 3FG1A 1MNLA 4LZIA 3KKGA 5EEOA 3KZTA 1MWTA 2FNQA 3BNCA 4HVNA 1B2ZA 1OHPA 2B1XB 1V74A 1TUHA 1GMPA 3B8LA 1RRLA 4WP5A 3KSED 5AI1A 1EQKA 1ULIB 1UW1A 3CPW2 1QAKA 5M1AA 1IU7A 3BNEA 3K0ZA 1JB5A 1BNRA 1UCIA 3SXXA 2CX1A 1NNVA 1JKGB 3AGNA 2CC3A 1UGHI 3K7CA 5CLKA 3STDA 4FMAA 1W6CA 4XDVA 1N9EA 1JKGA 5A0OB 1OHOA 3BB9A 3NBBA 3DY5A 1FUTA 1U8CB 3DM8A 3HI7A 1DETA 5JBSA 1LQGC 3CU3A 1OACA 3OW22 4L8OA 3S27A 3I553 2UGIA 3D4AA 2GU1A 3NX0A 1CEWI 1OUNA 2GEYA 3IJEB 2K0MA 4RNTA 3SOAA 3T8UA 1YGWA 2L4VA 4KT3B 6RNTA 1LNHA 3EE1A 4HM2B 3MG1A 4NHFA 1J2BA 1ULJB 1FGQA 1K9M4 3MSOA 5CF1A 3CCS3 2RSXA 5KP3A 1VZZA 4BL2A 5IG0A 4LGQA 4N6MA 3DZLA 1ISKA 3UL6A 1I8VA 1ZGXA 4ZM8A 4K1VA 1AQZA 3PCRA 3EJVA 1I0XA 3FH1A 3KN4A 1OCVA 2D42A 5DRVA 2CWTA 3FF2A 3LH4A 4EXRA 1EKMA 1IQXA 3UL5A 4KZ1A 2HMLB 1Q824 1NO3A 5TGNA 3EQQB 1BIRA 1RSNA 3G713 1JBRA 1B2UA 2I9WA 2HMOB 2ML5A 3CXC2 1DMQA 2O9UX 5IERA 1EA2A 1GOVA 4AEQA 5ELJA 5BIRA 2JQ5A 5IEOA 1GMRA 5FW5A 4J5KA 4WWUC 2GEXA 3EBYA 5G1LA 4EV2A 1A2PA 3AGOA 1UCJA 1B2SA 1RGLA 1O7GB 3FLJA 3LTBA 3SEDA 1JNQA 2CKFB 3J7Yd 1RHLA 3I0YA 4XBYA 4XM4A 1M904 2XFTA 4IT7A 1UCKA 1WMPA 1LXEA 2SBLA 5DREA 1G0TA 4HZ9B 4CCVA 1FGTA 3F7XA 2XSHB 3PCSA 1BANA 1S5AA 4IIAA 1RGKA 3EN8A 1AVKA 1BRKA 1JN5B 2CWVA 2IYJA 4BTWA 4JRFA 1JN5A 4HM0B 1VQP3 1BRJA 1C7HA 1RCLA 1Q814 4GHOA 5HOHA 4LYLB 1ZO2A 3H3HA 4HM7B 2XR8B 3DGLA 1FZUA 3X3YA 2Q07A 4HYZA 3CCE3 5BXQA 3U97A 2CH9A 1GY5A 3SOYA 2H0GA 3LZAA 2LYXA 1B3SA 4O02B 5AYSC 1VQO3 1OF5B 1GY6A 1YNVX 1RRHA 2BHMA 1BSDA 4I5QA 2XEPA 3G6E3 2IUKA 1VQM3 1HZ1A 1OF5A 4BTXA 1RGEA 1YVBI 4U13A 4J9AA 1Y4KA 3WODG 1OHSA 4BL3A 2CFGA 2MF7A 3X3XA 1STDA 1HU9A 1OGZA 4N6TA 3UB1A 1VQ83 4HKVB 5FGOA 1D6ZA 3AMOB 3NBRA 4HM3B 4FMBA 3PS8A 1I2EA 3AMOA 1DVCA 4HM1B 1MGRA 3V99A 3PGBA 5AEUB 5AIHA 1Q42A 1K734 3MWZA 1KD14 5KP4A 3S67A 3A5EA 5HGRA 1VQL3 2W0QA 4WFOA 3D3LA 1TIJA 1LVNA 1O7HB 4L8PA 1ZS7A 3EHCA 2KF3A 2HOHA 4IPBA 3X41A 4EBGA 1BUJA 3GZYB 1T2HA 1JBSA 5EQLA 1V57A 8CHOA 1BOXA 1I70A 4TX4A 2GSPA 4RNYA 5G2GA 5EVHA 1A2KA 1ZX2A 3GWRA 3BNDA 3OX9A 3IMAB 2OOVA 3T8NA 4HZBB 1VQK3 1OGXA 3NXJA 1RNBA 3WOFB 4QWTA 3HOHA 8RNTA 7GSPA 1B2XA 3A76A 3S28A 3FCSB 4EC6A 1I2GA 1RGFA 3U1WA 2UX0A 1AV4A 2FGTA 1OPYA 1W2ZA 3QRDA 3UJMA 3UNLA 3L0RA 3E99A 2BMOB 3PZWA 1WTHA 2YFJB 1GSPA 1STFI 4LEHA 2W03A 1YHQ3 1Q864 4X2HA 2W04A 2KAAA 4AKYA 1YJN3 4HJLB 4O2HA 1VQ43 4XDWA 3NQZA 1TP6A 2LQVA 1M9GA 3LT9A 1YJ93 1FUSA 1BNEA 3KE7A 4R9KA 3CCL3 2XF3A 1JZDA 1MGWA 1R4CA 1SIHA 1O7WB 1TRQA 1T3BA 1ROAA 3EC9A 3WA3A 1DVDA 3K9MC 5BU4A 2INXA 3NM2A 2F4YA 4OVMA 1FGRA 1YJW3 1MWRA 3GSPA 1JV2B 3Q3FA 3VSYA 2KXGA 2XFSA 1LQMB 3CPOA 3LXUX 1IVWA 2P05A 2HMKB 2P38A 1QVF2 2BIRA 1U5OA 2PZVA 1LNIA 3EB8A 1BRSA 1BNSA 1Q7Y4 4JF8A 3FSDA 1NJI4 1JB4A 3K5TA 1FA3A 2XGNA 1N8R4 1TRPA 1OH0A 2XSOB 2WGOA 2WOFA 2QIYA 4HM6B 1RJOA 3D79A 4N6NB 4MMZB 1US1A 1BNFA 3H51A 5CK6A 2WGQA 2KCDA 2C4BA 3DH2A 3FG4A 3FZWA 1W7CA 3LT8A 1BSAA 2F5WA 4GSPA 1BSBA 3WDGB 3WMDA 3NUVA 2PNCA 5LC6A 1O7MB 4WHAA 1I3FA 1G96A 2GXFA 3G8ZA 2XRXB 3CMA3 4BU4A 1GS3A 2F98A 2P09A 1UUGB 1UUVB 2IA7A 4LSOA 3MKIA 1N5HA 1R4YA 3NBJA 5KP1A 1KSIA 1MWSA 5IW9A 1FUWA 5IG5A 2CX0A 2Z76A 3AHSA 1RNTA 4ILFA 1DMMA 4XBTA 4N6OB 3N8BA 4EYCA 4AKZA 3SYUA 2QEX3 2JDIH 5G1KA 2CFKA 2BMQB 1RGCA 2ZDJA 5CF2A 4EW5A 2E2VA 4MJDA 3ROBA 3CC73 1BVIA 1YIT3 4MEIA 3D9RA 3EX9A 4H3UA 3SX1A 1EG9B 1MWUA 3D5GA 4NREA 1EEJA 2Y73A 4WYKB 1I0VA 1B21A 1O7NB 2BO9B 4WYKA 1X1YA 6GSPA 1RGHA 2J8XB 3WHOA 2M7OA 1BRGA 2H0IA 3PYJA 1GOYA 1IV7A 5RNTA 1BAOA 1W5ZA 3FGYA 1VQ63 1GD3A 1WMOA 3FKAA 3JUQA 3RDEA 3S29A 3ZG5A 1CQSA 4HBRA 4LMIA 3WR2A 4MMYB 1RDSA 3CCQ3 1B2MA 3G4S3 1BNJA 5IEPA 1RN4A 3WOEB 1BRHA 1TFOA 3X3ZA 5CXOA 3GZXB 1NDOB 3LTCA 2YX9A 1LOYA 2UUGC 1KWIA 1RCKA 1B27A 2K54A 3JUNA 3QK9A 1SARA 3SLUA 2YFIB 3HK4A 4RNZA 2STDA 4FR9A 3OXAA 2RCDA 2BNGA 1UI7A 2CFLA 4XB5A 1BUQA 1SPUA 3HX8A 1E3VA 2Y74A 3F7SA 5AIGA 3KFQC 1GMQA 3VGNA 2OTJ3 1GYBA 2CK3H 3JUOA 3ZFZA 1RGGA 1W6GA 3OWYA 3FF0A 1T2IA 3CNMA 1IK3A 3LOYA 3CC43 4Q53A 1UGIA 2IMJA 1VQQA 1UUWB 2Z6BA 1GD4A 1QALA 5D82A 4KFEA 1TJDA 3JUMA 2WOHA 1IT8A 2AADA 1A2VA 1BSEA 3F9SA 1W2B2 1RTUA 3F40A 2K3DA 1UCLA 4XBXA 3LTAA 1LOWA 2F56A 3KCHA 1DMNA 1IVVA 1YVSA 1N5PA 3O8YA 4J8TA 4K90B 5IG3A 3S5CA 1WNHA 2HMJB 2YFLB 3DGYA 3KSPA 1BRNL 5D81A 2P0XA 1DYUA 2R41A 3HIIA 5AIIA 5BVBA 1O7PB 1K8A4 1QJGA 2F99A 3N54B 3GAXA 1IDPA 2KF4A 1S723 3NQYA 1RLSA 1RMSA 2CG1A 2XGLA 3ZG0A 3IPTA 1FGMA 2AAEA 1YI23 4FMCA 1BU4A 4OUQA 4BTYA 1GOUA 3B4PA 3I563 2HMMB 3V98A 1UDII 1Z1SA 4MMXB 6STDA 1ROVA 1KQS2 1F8NA 1W4NA 3BNBA 1A67A 4K61A 3RGAA 1IVUA 2GBWB 1IQ8A 3RNTA 1JBTA 2O3OA 1JZOA 1RN7A 2W2CA 4O3VA 2D1WA 1WMNA 1GY7A 2SARA 2GBXB 3DMCA 4STDA 2BT3A 3LTDA 3G16A 3CCM3 1W01A 2ZA4A 3NV0B 1IQYA 2A15A 1BSCA 1BNIA 3GZRA 3OWUA 4R9LA 3SVAA 3Q90A 4OK0A 4FCZA 3NV0A 1FYSA 3URPA 1FGOA 2XH9A 2R4IA 3Q1CA 4G1MB 2OWPA 3WA2X 3CCR3 1NWWA 1PU4A 1HKXA 5JPUA 1IVXA 2IUJA 3JUPA 1RN1A 3HZPA 2Z77A 2F5MA 5AIFA 3X42A 4KFDA 4I4KA 3ALAA 1TU5A 3MYTA 1KC84 3DGMA 2OQEC 4KFFA 2RGQA 1JRQA 1JJ22 1N9JA 1V58A 4HAAA 4HOHA 5D83A 1C54A 1VQ93 1N8QA 4N6UA 2WO0A 2OCTA 1LOXA 2FXTA 1L5GB 3MG3A 1NB3I 5ELUA 5M19A 1TTOA 2MC8A 3CCJ3 4FCMA 3DUKA 1PYLA 5JPPA 3V92A 3LYGA 3LMLA 3N9HA 1LRAA 4FMDA 4KVHA 2OQEA 1QVG2 2W6JH 3GRDA 3M8CA 3CNXA 4ORLA
chains in the Genus database with same CATH topology
5AEWB 4R1KA 2P0MA 3EN1B 4O8SA 4L7KA 2OTL3 2CFDA 3DXOA 3OWSA 2HMNB 1E97A 3MG2A 5IF6A 3GZBA 1Q40B 1MOLA 3JVCA 2W9QA 2ZL8A 1Q40A 3VF1A 3HIGA 1RKYA 2W9PA 2E2UA 3B4OA 3KIIA 2CW9A 5I97A 4GL6A 4EV5A 2CWUA 3MHEA 3CC23 4HM4B 3T0UA 1NB5I 2ML6A 2CHCA 2RFRA 4FCJA 2CIUA 2CFWA 3CME3 1JB2A 3G0KA 4N6V0 2V1LA 4R4KA 2BMRB 1K41A 1IV9A 1SIIA 3BLZA 7STDA 2QA43 3NHXA 3K63A 5STDA 3ECFA 3X40A 1VQN3 3TDGA 3EBTA 2Z7AA 4N3VA 4RZMA 3F14A 3Q2PA 4CDLA 3CCV3 1YIJ3 1QMAA 3FG3A 4RBNA 4H61A 1M1K4 3EF8A 3F8HA 2CG0A 1ASKA 1VQ73 2B24B 5LC7A 1D6UA 3B7CA 3CD63 1D6YA 1W6YA 4R80A 3RGRA 1NU3A 2QGUA 4GB5A 2C10A 1QAFA 4PEJA 1AR0A 1YGEA 5IENA 3CC73 1M1XB 1E3RA 3ER7A 3DGOA 3MPHA 4X2OA 3F8XA 3CCU3 4HM8B 1SQWA 1AVLA 3DGNA 1W02A 1T5YA 1UI8A 1CYVA 1CYUA 2GU3A 2F86B 1IT7A 2W56B 4K1UA 4HM5B 1TFKA 3NM7A 3OV4A 2C11A 1SJWA 2W56A 3PXMA 1A90A 2OOVC 5IG4A 1W00A 2E2TA 1WQLB 1PFPA 1K28A 4N6LA 2KRTA 5AYRB 1VQ53 3FG1A 1MNLA 4LZIA 3KKGA 5EEOA 3KZTA 2FNQA 3BNCA 4HVNA 3B8LA 1OHPA 1V74A 1TUHA 2B1XB 4WP5A 1RRLA 3KSED 5AI1A 1EQKA 1ULIB 1UW1A 3CPW2 1QAKA 1IU7A 3BNEA 3K0ZA 1JB5A 3SXXA 1JKGB 2CC3A 5CLKA 3K7CA 3STDA 4FMAA 1W6CA 4XDVA 1N9EA 1JKGA 5A0OB 1OHOA 3BB9A 3NBBA 3DY5A 1U8CB 3DM8A 3HI7A 5JBSA 3CU3A 1OACA 3OW22 4L8OA 3S27A 3I553 2GU1A 3NX0A 1CEWI 1OUNA 2GEYA 3IJEB 2K0MA 3SOAA 3T8UA 2L4VA 1LNHA 3EE1A 4HM2B 3MG1A 4NHFA 1J2BA 1ULJB 1FGQA 1K9M4 3MSOA 5CF1A 3CCS3 2RSXA 5KP3A 1VZZA 5IG0A 4LGQA 4N6MA 3DZLA 1ISKA 3UL6A 4ZM8A 4K1VA 3PCRA 3EJVA 3FH1A 3KN4A 1OCVA 2D42A 5DRVA 2CWTA 3FF2A 3LH4A 4EXRA 1EKMA 1IQXA 3UL5A 4KZ1A 2HMLB 1Q824 1NO3A 5TGNA 3EQQB 3G713 2I9WA 2ML5A 2HMOB 3CXC2 1DMQA 2O9UX 5IERA 1EA2A 4AEQA 5ELJA 2JQ5A 5IEOA 5FW5A 4EV2A 4WWUC 2GEXA 3EBYA 3LTBA 3SEDA 1O7GB 3FLJA 1JNQA 2CKFB 3J7Yd 4XBYA 3I0YA 4XM4A 1M904 2XFTA 4IT7A 1WMPA 1LXEA 2SBLA 5DREA 4HZ9B 4CCVA 1FGTA 3F7XA 2XSHB 3PCSA 1S5AA 4IIAA 3EN8A 1AVKA 1JN5B 2CWVA 4BTWA 4JRFA 1JN5A 4HM0B 1VQP3 1C7HA 1Q814 1ZO2A 3H3HA 4HM7B 2XR8B 3DGLA 3X3YA 2Q07A 4HYZA 3CCE3 5BXQA 3U97A 2CH9A 1GY5A 3SOYA 3LZAA 2LYXA 4O02B 5AYSC 1VQO3 1OF5B 1GY6A 2BHMA 1RRHA 3G6E3 1JJ22 1VQM3 2XEPA 2IUKA 1OF5A 4BTXA 1YVBI 4U13A 4J9AA 1Y4KA 3WODG 1OHSA 2CFGA 2MF7A 3X3XA 1STDA 1HU9A 1OGZA 4N6TA 3UB1A 1VQ83 4HKVB 5FGOA 1D6ZA 3AMOB 3NBRA 4HM3B 4FMBA 3PS8A 3AMOA 1DVCA 4HM1B 3V99A 5AEUB 3PGBA 5AIHA 1Q42A 1K734 3MWZA 1KD14 5KP4A 3S67A 1VQL3 5HGRA 2W0QA 4WFOA 3D3LA 1TIJA 1LVNA 1O7HB 4L8PA 3EHCA 4IPBA 3X41A 4EBGA 3GZYB 5EQLA 8CHOA 4TX4A 4RNYA 5G2GA 5EVHA 1A2KA 1ZX2A 3GWRA 3BNDA 3OX9A 3IMAB 2OOVA 3T8NA 4HZBB 1VQK3 1OGXA 3NXJA 3WOFB 4QWTA 3A76A 3S28A 3FCSB 4EC6A 3U1WA 2UX0A 1AV4A 2FGTA 1OPYA 1W2ZA 3QRDA 3UJMA 3UNLA 3L0RA 3E99A 2BMOB 3PZWA 1WTHA 2YFJB 1STFI 4LEHA 2W03A 1YHQ3 1Q864 4X2HA 2W04A 4AKYA 1YJN3 4HJLB 4O2HA 1VQ43 4XDWA 3NQZA 1TP6A 2LQVA 1M9GA 3LT9A 1YJ93 3KE7A 4R9KA 3CCL3 2XF3A 1SIHA 1R4CA 1O7WB 1ROAA 3EC9A 3WA3A 1DVDA 3K9MC 2INXA 3NM2A 4OVMA 1FGRA 1YJW3 1JV2B 3VSYA 2KXGA 2XFSA 3CPOA 3LXUX 1IVWA 2P05A 2HMKB 2P38A 1QVF2 1U5OA 2PZVA 3EB8A 1Q7Y4 4JF8A 3FSDA 1NJI4 1JB4A 3K5TA 1FA3A 2XGNA 1N8R4 1OH0A 2XSOB 2WGOA 2WOFA 2QIYA 4HM6B 1RJOA 4N6NB 4MMZB 1US1A 3H51A 5CK6A 2WGQA 2KCDA 1A67A 3FG4A 3FZWA 1W7CA 3LT8A 3WDGB 3WMDA 3NUVA 2PNCA 5LC6A 1O7MB 4WHAA 1G96A 2GXFA 3G8ZA 2XRXB 3CMA3 1GS3A 2F98A 2P09A 1UUVB 2IA7A 4LSOA 3MKIA 1N5HA 3NBJA 5KP1A 1KSIA 5IW9A 1FUWA 5IG5A 2Z76A 1DMMA 4XBTA 4N6OB 3N8BA 4EYCA 4AKZA 2QEX3 2JDIH 2CFKA 2BMQB 2ZDJA 5CF2A 2E2VA 4MJDA 3ROBA 1YIT3 4MEIA 3D9RA 3EX9A 4H3UA 3SX1A 1EG9B 4NREA 2Y73A 4WYKB 1O7NB 2BO9B 4WYKA 2M7OA 3PYJA 1IV7A 1W5ZA 3FGYA 1VQ63 1GD3A 1WMOA 3FKAA 3JUQA 3RDEA 3S29A 1CQSA 4HBRA 4LMIA 4MMYB 3CCQ3 3G4S3 5IEPA 3WOEB 1TFOA 3X3ZA 5CXOA 3GZXB 1NDOB 3LTCA 2YX9A 3QK9A 3JUNA 1KWIA 2K54A 3SLUA 2YFIB 3HK4A 4RNZA 2STDA 4FR9A 3OXAA 2RCDA 2BNGA 1UI7A 2CFLA 4XB5A 1BUQA 1SPUA 3HX8A 1E3VA 2Y74A 3F7SA 5AIGA 3KFQC 3VGNA 2OTJ3 1GYBA 2CK3H 3JUOA 1W6GA 3OWYA 3FF0A 3CNMA 1IK3A 3LOYA 3CC43 4Q53A 2IMJA 2Z6BA 1UUWB 1GD4A 1QALA 5D82A 4KFEA 3JUMA 2WOHA 1IT8A 3F9SA 1A2VA 1W2B2 3F40A 4XBXA 3LTAA 3O8YA 4J8TA 4K90B 1DMNA 1IVVA 1N5PA 5IG3A 3S5CA 1WNHA 2HMJB 2YFLB 3KSPA 5D81A 2P0XA 1DYUA 3HIIA 5AIIA 5BVBA 1K8A4 1O7PB 1QJGA 2F99A 3N54B 3GAXA 1IDPA 1S723 3NQYA 2CG1A 2XGLA 3IPTA 1FGMA 1YI23 4FMCA 4OUQA 4BTYA 3B4PA 3I563 2HMMB 3V98A 1Z1SA 4MMXB 6STDA 1ROVA 1KQS2 1F8NA 1W4NA 3BNBA 4K61A 3RGAA 1IVUA 2GBWB 1IQ8A 2O3OA 1RN7A 2W2CA 4O3VA 2D1WA 1WMNA 1GY7A 2GBXB 3DMCA 4STDA 2BT3A 3LTDA 3G16A 3CCM3 1W01A 3NV0B 1IQYA 2A15A 3GZRA 3OWUA 4R9LA 3SVAA 3Q90A 4OK0A 4FCZA 3NV0A 1FGOA 2XH9A 2R4IA 3Q1CA 4G1MB 2OWPA 3WA2X 3CCR3 1NWWA 1PU4A 1HKXA 5JPUA 1IVXA 2IUJA 3JUPA 3HZPA 2Z77A 5AIFA 3X42A 4KFDA 4I4KA 3ALAA 1TU5A 3MYTA 1KC84 3DGMA 2OQEC 4KFFA 2RGQA 1JRQA 1N9JA 5D83A 1VQ93 1N8QA 4N6UA 2WO0A 2OCTA 1LOXA 2FXTA 1L5GB 3MG3A 1NB3I 5ELUA 2MC8A 3CCJ3 4FCMA 3DUKA 5JPPA 3V92A 3LYGA 3LMLA 3N9HA 4FMDA 4KVHA 1QVG2 2OQEA 2W6JH 3GRDA 3M8CA 3CNXA 4ORLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEW B;  4R1K A;  3EN1 B;  4L7K A;  3DXO A;  3OWS A;  2HMN B;  1E97 A;  3MG2 A;  5IF6 A;  3GZB A;  1Q40 B;  1Q40 A;  3B4O A;  3MHE A;  4HM4 B;  2CHC A;  2RFR A;  4FCJ A;  1JB2 A;  3G0K A;  2BMR B;  1K41 A;  3BLZ A;  7STD A;  3NHX A;  5STD A;  3ECF A;  3EBT A;  2Z7A A;  4N3V A;  4RZM A;  3F14 A;  4CDL A;  1QMA A;  3EF8 A;  3F8H A;  1ASK A;  2B24 B;  3B7C A;  1W6Y A;  3RGR A;  1NU3 A;  2QGU A;  4GB5 A;  4PEJ A;  1AR0 A;  5IEN A;  1E3R A;  3ER7 A;  4X2O A;  3F8X A;  4HM8 B;  1W02 A;  2F86 B;  4K1U A;  4HM5 B;  3OV4 A;  1SJW A;  5IG4 A;  1W00 A;  1WQL B;  3KKG A;  3KZT A;  4HVN A;  3B8L A;  1OHP A;  2B1X B;  1TUH A;  4WP5 A;  5AI1 A;  1ULI B;  3K0Z A;  1JB5 A;  1JKG B;  5CLK A;  3K7C A;  3STD A;  4XDV A;  1JKG A;  1OHO A;  3BB9 A;  3DM8 A;  3CU3 A;  4L8O A;  1OUN A;  2GEY A;  3SOA A;  3T8U A;  4HM2 B;  3MG1 A;  1ULJ B;  3MSO A;  5CF1 A;  5KP3 A;  1VZZ A;  5IG0 A;  4LGQ A;  3DZL A;  1ISK A;  4K1V A;  3EJV A;  3FH1 A;  1OCV A;  5DRV A;  3FF2 A;  2HML B;  5TGN A;  3EQQ B;  2I9W A;  2HMO B;  1DMQ A;  5IER A;  1EA2 A;  2JQ5 A;  5IEO A;  5FW5 A;  4WWU C;  2GEX A;  3EBY A;  3SED A;  1O7G B;  3FLJ A;  2CKF B;  4XBY A;  3I0Y A;  4XM4 A;  5DRE A;  4HZ9 B;  3F7X A;  2XSH B;  1S5A A;  4IIA A;  3EN8 A;  1JN5 B;  1JN5 A;  4HM0 B;  1C7H A;  1ZO2 A;  3H3H A;  4HM7 B;  2XR8 B;  5BXQ A;  1GY5 A;  3SOY A;  3LZA A;  1OF5 B;  1GY6 A;  1OF5 A;  4J9A A;  1OHS A;  1STD A;  1OGZ A;  4HKV B;  3NBR A;  4HM3 B;  4HM1 B;  5AEU B;  5AIH A;  1Q42 A;  5KP4 A;  5HGR A;  1O7H B;  4L8P A;  3EHC A;  3GZY B;  8CHO A;  5G2G A;  5EVH A;  1A2K A;  1ZX2 A;  3GWR A;  3OX9 A;  3T8N A;  4HZB B;  1OGX A;  3NXJ A;  3A76 A;  2UX0 A;  1OPY A;  3UJM A;  3UNL A;  3E99 A;  2BMO B;  2YFJ B;  4LEH A;  4X2H A;  4HJL B;  4XDW A;  1TP6 A;  3KE7 A;  4R9K A;  1O7W B;  3EC9 A;  2INX A;  3NM2 A;  4OVM A;  3VSY A;  3CPO A;  2HMK B;  1U5O A;  2PZV A;  3FSD A;  1JB4 A;  1OH0 A;  2XSO B;  4HM6 B;  2QIY A;  3H51 A;  5CK6 A;  3FZW A;  3WMD A;  3NUV A;  1O7M B;  2GXF A;  3G8Z A;  2XRX B;  1GS3 A;  2F98 A;  1UUV B;  3MKI A;  5KP1 A;  5IG5 A;  2Z76 A;  1DMM A;  4XBT A;  2BMQ B;  5CF2 A;  4MJD A;  3ROB A;  3D9R A;  3EX9 A;  4H3U A;  1EG9 B;  4WYK B;  1O7N B;  4WYK A;  3FGY A;  3JUQ A;  3FKA A;  1CQS A;  4LMI A;  5IEP A;  5CXO A;  3GZX B;  1NDO B;  3JUN A;  2K54 A;  2YFI B;  3HK4 A;  2STD A;  3OXA A;  2RCD A;  2BNG A;  4XB5 A;  1BUQ A;  3VGN A;  3HX8 A;  1E3V A;  3F7S A;  5AIG A;  1GYB A;  3JUO A;  3OWY A;  3FF0 A;  3CNM A;  4Q53 A;  2IMJ A;  1UUW B;  5D82 A;  3JUM A;  3F9S A;  3F40 A;  4XBX A;  4J8T A;  1DMN A;  5IG3 A;  3S5C A;  2HMJ B;  2YFL B;  3KSP A;  5D81 A;  5AII A;  5BVB A;  1O7P B;  1QJG A;  2F99 A;  1IDP A;  3IPT A;  4OUQ A;  3B4P A;  4ORL A;  2HMM B;  1Z1S A;  6STD A;  3RGA A;  2GBW B;  2W2C A;  1GY7 A;  2GBX B;  3DMC A;  4STD A;  3G16 A;  1W01 A;  3NV0 B;  2A15 A;  3GZR A;  3OWU A;  4R9L A;  3Q90 A;  3NV0 A;  2R4I A;  2OWP A;  1NWW A;  1HKX A;  5JPU A;  3JUP A;  3HZP A;  2Z77 A;  5AIF A;  4I4K A;  3MYT A;  2RGQ A;  5D83 A;  3MG3 A;  4FCM A;  3DUK A;  5JPP A;  3LYG A;  4KVH A;  3GRD A;  3M8C A;  3CNX A;  4U13 A; 
#chains in the Genus database with same CATH topology
 2IY2 A;  5AEW B;  4R1K A;  2P0M A;  1I3I A;  3EN1 B;  2ZHX B;  4O8S A;  4L7K A;  2OTL 3;  2BU4 A;  2CFD A;  4CPK A;  7RNT A;  3DXO A;  3OWS A;  2HMN B;  1E97 A;  3MG2 A;  5IF6 A;  1I2F A;  1Q40 B;  3GZB A;  1BGS A;  1MOL A;  3JVC A;  2W9Q A;  2KF6 A;  2KF5 A;  1Q40 A;  2ZL8 A;  1CH0 A;  3HIG A;  2W9P A;  3VF1 A;  1RKY A;  1DE3 A;  2E2U A;  3B4O A;  1X1W A;  1LOV A;  3KII A;  2CW9 A;  5I97 A;  4GL6 A;  4EV5 A;  1X1X A;  4DKI A;  2CWU A;  3MHE A;  3CC2 3;  4HM4 B;  3T0U A;  1NB5 I;  2ML6 A;  2CHC A;  2RFR A;  4FCJ A;  2CIU A;  2CFW A;  3CME 3;  1JB2 A;  3AHW A;  3G0K A;  4N6V 0;  5GSP A;  2V1L A;  4R4K A;  2BMR B;  1K41 A;  1SII A;  1IV9 A;  1BRI A;  3BLZ A;  4CJN A;  7STD A;  2QA4 3;  3NHX A;  1AY7 A;  3K63 A;  5STD A;  3ECF A;  1FW7 A;  3D5I A;  3X40 A;  9RNT A;  1HYF A;  1Q7H A;  2H0H A;  3TDG A;  1VQN 3;  2L1S A;  3EBT A;  2Z7A A;  4N3V A;  4RZM A;  3F14 A;  3Q2P A;  4CDL A;  3CCV 3;  1YIJ 3;  1QMA A;  1B20 A;  3FG3 A;  4RBN A;  4H61 A;  1M1K 4;  3EF8 A;  3F8H A;  2CG0 A;  1ASK A;  3BU4 A;  1VQ7 3;  2B24 B;  5LC7 A;  2RBI A;  1PY3 A;  1D6U A;  3B7C A;  3CD6 3;  1D6Y A;  1W6Y A;  4R80 A;  1Q9E A;  3RGR A;  1NU3 A;  1X1U A;  2QGU A;  2C10 A;  1QAF A;  2RNT A;  1AR0 A;  1YGE A;  4GB5 A;  4PEJ A;  5IEN A;  1M1X B;  1E3R A;  3ER7 A;  3DGO A;  3MPH A;  4X2O A;  3F8X A;  5M18 A;  4HM8 B;  3CCU 3;  1IYY A;  1SQW A;  1AVL A;  3DGN A;  1W02 A;  1T5Y A;  1BNG A;  1UI8 A;  1CYV A;  1CYU A;  3BIR A;  2GU3 A;  2F86 B;  1IT7 A;  2W56 B;  4K1U A;  4BIR A;  4HM5 B;  1TFK A;  3NM7 A;  3OV4 A;  2C11 A;  1EUI C;  1SJW A;  2W56 A;  3PXM A;  1A90 A;  2OOV C;  4NPB A;  5IG4 A;  1G02 A;  1W00 A;  2E2T A;  1WQL B;  1RGA A;  1PFP A;  1K28 A;  4N6L A;  4J5G A;  2KRT A;  5AYR B;  1VQ5 3;  3FG1 A;  1MNL A;  4LZI A;  3KKG A;  5EEO A;  3KZT A;  1MWT A;  2FNQ A;  3BNC A;  4HVN A;  1B2Z A;  1OHP A;  2B1X B;  1V74 A;  1TUH A;  1GMP A;  3B8L A;  1RRL A;  4WP5 A;  3KSE D;  5AI1 A;  1EQK A;  1ULI B;  1UW1 A;  3CPW 2;  1QAK A;  5M1A A;  1IU7 A;  3BNE A;  3K0Z A;  1JB5 A;  1BNR A;  1UCI A;  3SXX A;  2CX1 A;  1NNV A;  1JKG B;  3AGN A;  2CC3 A;  1UGH I;  3K7C A;  5CLK A;  3STD A;  4FMA A;  1W6C A;  4XDV A;  1N9E A;  1JKG A;  5A0O B;  1OHO A;  3BB9 A;  3NBB A;  3DY5 A;  1FUT A;  1U8C B;  3DM8 A;  3HI7 A;  1DET A;  5JBS A;  1LQG C;  3CU3 A;  1OAC A;  3OW2 2;  4L8O A;  3S27 A;  3I55 3;  2UGI A;  3D4A A;  2GU1 A;  3NX0 A;  1CEW I;  1OUN A;  2GEY A;  3IJE B;  2K0M A;  4RNT A;  3SOA A;  3T8U A;  1YGW A;  2L4V A;  4KT3 B;  6RNT A;  1LNH A;  3EE1 A;  4HM2 B;  3MG1 A;  4NHF A;  1J2B A;  1ULJ B;  1FGQ A;  1K9M 4;  3MSO A;  5CF1 A;  3CCS 3;  2RSX A;  5KP3 A;  1VZZ A;  4BL2 A;  5IG0 A;  4LGQ A;  4N6M A;  3DZL A;  1ISK A;  3UL6 A;  1I8V A;  1ZGX A;  4ZM8 A;  4K1V A;  1AQZ A;  3PCR A;  3EJV A;  1I0X A;  3FH1 A;  3KN4 A;  1OCV A;  2D42 A;  5DRV A;  2CWT A;  3FF2 A;  3LH4 A;  4EXR A;  1EKM A;  1IQX A;  3UL5 A;  4KZ1 A;  2HML B;  1Q82 4;  1NO3 A;  5TGN A;  3EQQ B;  1BIR A;  1RSN A;  3G71 3;  1JBR A;  1B2U A;  2I9W A;  2HMO B;  2ML5 A;  3CXC 2;  1DMQ A;  2O9U X;  5IER A;  1EA2 A;  1GOV A;  4AEQ A;  5ELJ A;  5BIR A;  2JQ5 A;  5IEO A;  1GMR A;  5FW5 A;  4J5K A;  4WWU C;  2GEX A;  3EBY A;  5G1L A;  4EV2 A;  1A2P A;  3AGO A;  1UCJ A;  1B2S A;  1RGL A;  1O7G B;  3FLJ A;  3LTB A;  3SED A;  1JNQ A;  2CKF B;  3J7Y d;  1RHL A;  3I0Y A;  4XBY A;  4XM4 A;  1M90 4;  2XFT A;  4IT7 A;  1UCK A;  1WMP A;  1LXE A;  2SBL A;  5DRE A;  1G0T A;  4HZ9 B;  4CCV A;  1FGT A;  3F7X A;  2XSH B;  3PCS A;  1BAN A;  1S5A A;  4IIA A;  1RGK A;  3EN8 A;  1AVK A;  1BRK A;  1JN5 B;  2CWV A;  2IYJ A;  4BTW A;  4JRF A;  1JN5 A;  4HM0 B;  1VQP 3;  1BRJ A;  1C7H A;  1RCL A;  1Q81 4;  4GHO A;  5HOH A;  4LYL B;  1ZO2 A;  3H3H A;  4HM7 B;  2XR8 B;  3DGL A;  1FZU A;  3X3Y A;  2Q07 A;  4HYZ A;  3CCE 3;  5BXQ A;  3U97 A;  2CH9 A;  1GY5 A;  3SOY A;  2H0G A;  3LZA A;  2LYX A;  1B3S A;  4O02 B;  5AYS C;  1VQO 3;  1OF5 B;  1GY6 A;  1YNV X;  1RRH A;  2BHM A;  1BSD A;  4I5Q A;  2XEP A;  3G6E 3;  2IUK A;  1VQM 3;  1HZ1 A;  1OF5 A;  4BTX A;  1RGE A;  1YVB I;  4U13 A;  4J9A A;  1Y4K A;  3WOD G;  1OHS A;  4BL3 A;  2CFG A;  2MF7 A;  3X3X A;  1STD A;  1HU9 A;  1OGZ A;  4N6T A;  3UB1 A;  1VQ8 3;  4HKV B;  5FGO A;  1D6Z A;  3AMO B;  3NBR A;  4HM3 B;  4FMB A;  3PS8 A;  1I2E A;  3AMO A;  1DVC A;  4HM1 B;  1MGR A;  3V99 A;  3PGB A;  5AEU B;  5AIH A;  1Q42 A;  1K73 4;  3MWZ A;  1KD1 4;  5KP4 A;  3S67 A;  3A5E A;  5HGR A;  1VQL 3;  2W0Q A;  4WFO A;  3D3L A;  1TIJ A;  1LVN A;  1O7H B;  4L8P A;  1ZS7 A;  3EHC A;  2KF3 A;  2HOH A;  4IPB A;  3X41 A;  4EBG A;  1BUJ A;  3GZY B;  1T2H A;  1JBS A;  5EQL A;  1V57 A;  8CHO A;  1BOX A;  1I70 A;  4TX4 A;  2GSP A;  4RNY A;  5G2G A;  5EVH A;  1A2K A;  1ZX2 A;  3GWR A;  3BND A;  3OX9 A;  3IMA B;  2OOV A;  3T8N A;  4HZB B;  1VQK 3;  1OGX A;  3NXJ A;  1RNB A;  3WOF B;  4QWT A;  3HOH A;  8RNT A;  7GSP A;  1B2X A;  3A76 A;  3S28 A;  3FCS B;  4EC6 A;  1I2G A;  1RGF A;  3U1W A;  2UX0 A;  1AV4 A;  2FGT A;  1OPY A;  1W2Z A;  3QRD A;  3UJM A;  3UNL A;  3L0R A;  3E99 A;  2BMO B;  3PZW A;  1WTH A;  2YFJ B;  1GSP A;  1STF I;  4LEH A;  2W03 A;  1YHQ 3;  1Q86 4;  4X2H A;  2W04 A;  2KAA A;  4AKY A;  1YJN 3;  4HJL B;  4O2H A;  1VQ4 3;  4XDW A;  3NQZ A;  1TP6 A;  2LQV A;  1M9G A;  3LT9 A;  1YJ9 3;  1FUS A;  1BNE A;  3KE7 A;  4R9K A;  3CCL 3;  2XF3 A;  1JZD A;  1MGW A;  1R4C A;  1SIH A;  1O7W B;  1TRQ A;  1T3B A;  1ROA A;  3EC9 A;  3WA3 A;  1DVD A;  3K9M C;  5BU4 A;  2INX A;  3NM2 A;  2F4Y A;  4OVM A;  1FGR A;  1YJW 3;  1MWR A;  3GSP A;  1JV2 B;  3Q3F A;  3VSY A;  2KXG A;  2XFS A;  1LQM B;  3CPO A;  3LXU X;  1IVW A;  2P05 A;  2HMK B;  2P38 A;  1QVF 2;  2BIR A;  1U5O A;  2PZV A;  1LNI A;  3EB8 A;  1BRS A;  1BNS A;  1Q7Y 4;  4JF8 A;  3FSD A;  1NJI 4;  1JB4 A;  3K5T A;  1FA3 A;  2XGN A;  1N8R 4;  1TRP A;  1OH0 A;  2XSO B;  2WGO A;  2WOF A;  2QIY A;  4HM6 B;  1RJO A;  3D79 A;  4N6N B;  4MMZ B;  1US1 A;  1BNF A;  3H51 A;  5CK6 A;  2WGQ A;  2KCD A;  2C4B A;  3DH2 A;  3FG4 A;  3FZW A;  1W7C A;  3LT8 A;  1BSA A;  2F5W A;  4GSP A;  1BSB A;  3WDG B;  3WMD A;  3NUV A;  2PNC A;  5LC6 A;  1O7M B;  4WHA A;  1I3F A;  1G96 A;  2GXF A;  3G8Z A;  2XRX B;  3CMA 3;  4BU4 A;  1GS3 A;  2F98 A;  2P09 A;  1UUG B;  1UUV B;  2IA7 A;  4LSO A;  3MKI A;  1N5H A;  1R4Y A;  3NBJ A;  5KP1 A;  1KSI A;  1MWS A;  5IW9 A;  1FUW A;  5IG5 A;  2CX0 A;  2Z76 A;  3AHS A;  1RNT A;  4ILF A;  1DMM A;  4XBT A;  4N6O B;  3N8B A;  4EYC A;  4AKZ A;  3SYU A;  2QEX 3;  2JDI H;  5G1K A;  2CFK A;  2BMQ B;  1RGC A;  2ZDJ A;  5CF2 A;  4EW5 A;  2E2V A;  4MJD A;  3ROB A;  3CC7 3;  1BVI A;  1YIT 3;  4MEI A;  3D9R A;  3EX9 A;  4H3U A;  3SX1 A;  1EG9 B;  1MWU A;  3D5G A;  4NRE A;  1EEJ A;  2Y73 A;  4WYK B;  1I0V A;  1B21 A;  1O7N B;  2BO9 B;  4WYK A;  1X1Y A;  6GSP A;  1RGH A;  2J8X B;  3WHO A;  2M7O A;  1BRG A;  2H0I A;  3PYJ A;  1GOY A;  1IV7 A;  5RNT A;  1BAO A;  1W5Z A;  3FGY A;  1VQ6 3;  1GD3 A;  1WMO A;  3FKA A;  3JUQ A;  3RDE A;  3S29 A;  3ZG5 A;  1CQS A;  4HBR A;  4LMI A;  3WR2 A;  4MMY B;  1RDS A;  3CCQ 3;  1B2M A;  3G4S 3;  1BNJ A;  5IEP A;  1RN4 A;  3WOE B;  1BRH A;  1TFO A;  3X3Z A;  5CXO A;  3GZX B;  1NDO B;  3LTC A;  2YX9 A;  1LOY A;  2UUG C;  1KWI A;  1RCK A;  1B27 A;  2K54 A;  3JUN A;  3QK9 A;  1SAR A;  3SLU A;  2YFI B;  3HK4 A;  4RNZ A;  2STD A;  4FR9 A;  3OXA A;  2RCD A;  2BNG A;  1UI7 A;  2CFL A;  4XB5 A;  1BUQ A;  1SPU A;  3HX8 A;  1E3V A;  2Y74 A;  3F7S A;  5AIG A;  3KFQ C;  1GMQ A;  3VGN A;  2OTJ 3;  1GYB A;  2CK3 H;  3JUO A;  3ZFZ A;  1RGG A;  1W6G A;  3OWY A;  3FF0 A;  1T2I A;  3CNM A;  1IK3 A;  3LOY A;  3CC4 3;  4Q53 A;  1UGI A;  2IMJ A;  1VQQ A;  1UUW B;  2Z6B A;  1GD4 A;  1QAL A;  5D82 A;  4KFE A;  1TJD A;  3JUM A;  2WOH A;  1IT8 A;  2AAD A;  1A2V A;  1BSE A;  3F9S A;  1W2B 2;  1RTU A;  3F40 A;  2K3D A;  1UCL A;  4XBX A;  3LTA A;  1LOW A;  2F56 A;  3KCH A;  1DMN A;  1IVV A;  1YVS A;  1N5P A;  3O8Y A;  4J8T A;  4K90 B;  5IG3 A;  3S5C A;  1WNH A;  2HMJ B;  2YFL B;  3DGY A;  3KSP A;  1BRN L;  5D81 A;  2P0X A;  1DYU A;  2R41 A;  3HII A;  5AII A;  5BVB A;  1O7P B;  1K8A 4;  1QJG A;  2F99 A;  3N54 B;  3GAX A;  1IDP A;  2KF4 A;  1S72 3;  3NQY A;  1RLS A;  1RMS A;  2CG1 A;  2XGL A;  3ZG0 A;  3IPT A;  1FGM A;  2AAE A;  1YI2 3;  4FMC A;  1BU4 A;  4OUQ A;  4BTY A;  1GOU A;  3B4P A;  3I56 3;  2HMM B;  3V98 A;  1UDI I;  1Z1S A;  4MMX B;  6STD A;  1ROV A;  1KQS 2;  1F8N A;  1W4N A;  3BNB A;  1A67 A;  4K61 A;  3RGA A;  1IVU A;  2GBW B;  1IQ8 A;  3RNT A;  1JBT A;  2O3O A;  1JZO A;  1RN7 A;  2W2C A;  4O3V A;  2D1W A;  1WMN A;  1GY7 A;  2SAR A;  2GBX B;  3DMC A;  4STD A;  2BT3 A;  3LTD A;  3G16 A;  3CCM 3;  1W01 A;  2ZA4 A;  3NV0 B;  1IQY A;  2A15 A;  1BSC A;  1BNI A;  3GZR A;  3OWU A;  4R9L A;  3SVA A;  3Q90 A;  4OK0 A;  4FCZ A;  3NV0 A;  1FYS A;  3URP A;  1FGO A;  2XH9 A;  2R4I A;  3Q1C A;  4G1M B;  2OWP A;  3WA2 X;  3CCR 3;  1NWW A;  1PU4 A;  1HKX A;  5JPU A;  1IVX A;  2IUJ A;  3JUP A;  1RN1 A;  3HZP A;  2Z77 A;  2F5M A;  5AIF A;  3X42 A;  4KFD A;  4I4K A;  3ALA A;  1TU5 A;  3MYT A;  1KC8 4;  3DGM A;  2OQE C;  4KFF A;  2RGQ A;  1JRQ A;  1JJ2 2;  1N9J A;  1V58 A;  4HAA A;  4HOH A;  5D83 A;  1C54 A;  1VQ9 3;  1N8Q A;  4N6U A;  2WO0 A;  2OCT A;  1LOX A;  2FXT A;  1L5G B;  3MG3 A;  1NB3 I;  5ELU A;  5M19 A;  1TTO A;  2MC8 A;  3CCJ 3;  4FCM A;  3DUK A;  1PYL A;  5JPP A;  3V92 A;  3LYG A;  3LML A;  3N9H A;  1LRA A;  4FMD A;  4KVH A;  2OQE A;  1QVG 2;  2W6J H;  3GRD A;  3M8C A;  3CNX A;  4ORL A; 
#chains in the Genus database with same CATH homology
 5AEW B;  4R1K A;  2P0M A;  3EN1 B;  4O8S A;  4L7K A;  2OTL 3;  2CFD A;  3DXO A;  3OWS A;  2HMN B;  1E97 A;  3MG2 A;  5IF6 A;  3GZB A;  1Q40 B;  1MOL A;  3JVC A;  2W9Q A;  2ZL8 A;  1Q40 A;  3VF1 A;  3HIG A;  1RKY A;  2W9P A;  2E2U A;  3B4O A;  3KII A;  2CW9 A;  5I97 A;  4GL6 A;  4EV5 A;  2CWU A;  3MHE A;  3CC2 3;  4HM4 B;  3T0U A;  1NB5 I;  2ML6 A;  2CHC A;  2RFR A;  4FCJ A;  2CIU A;  2CFW A;  3CME 3;  1JB2 A;  3G0K A;  4N6V 0;  2V1L A;  4R4K A;  2BMR B;  1K41 A;  1IV9 A;  1SII A;  3BLZ A;  7STD A;  2QA4 3;  3NHX A;  3K63 A;  5STD A;  3ECF A;  3X40 A;  1VQN 3;  3TDG A;  3EBT A;  2Z7A A;  4N3V A;  4RZM A;  3F14 A;  3Q2P A;  4CDL A;  3CCV 3;  1YIJ 3;  1QMA A;  3FG3 A;  4RBN A;  4H61 A;  1M1K 4;  3EF8 A;  3F8H A;  2CG0 A;  1ASK A;  1VQ7 3;  2B24 B;  5LC7 A;  1D6U A;  3B7C A;  3CD6 3;  1D6Y A;  1W6Y A;  4R80 A;  3RGR A;  1NU3 A;  2QGU A;  4GB5 A;  2C10 A;  1QAF A;  4PEJ A;  1AR0 A;  1YGE A;  5IEN A;  3CC7 3;  1M1X B;  1E3R A;  3ER7 A;  3DGO A;  3MPH A;  4X2O A;  3F8X A;  3CCU 3;  4HM8 B;  1SQW A;  1AVL A;  3DGN A;  1W02 A;  1T5Y A;  1UI8 A;  1CYV A;  1CYU A;  2GU3 A;  2F86 B;  1IT7 A;  2W56 B;  4K1U A;  4HM5 B;  1TFK A;  3NM7 A;  3OV4 A;  2C11 A;  1SJW A;  2W56 A;  3PXM A;  1A90 A;  2OOV C;  5IG4 A;  1W00 A;  2E2T A;  1WQL B;  1PFP A;  1K28 A;  4N6L A;  2KRT A;  5AYR B;  1VQ5 3;  3FG1 A;  1MNL A;  4LZI A;  3KKG A;  5EEO A;  3KZT A;  2FNQ A;  3BNC A;  4HVN A;  3B8L A;  1OHP A;  1V74 A;  1TUH A;  2B1X B;  4WP5 A;  1RRL A;  3KSE D;  5AI1 A;  1EQK A;  1ULI B;  1UW1 A;  3CPW 2;  1QAK A;  1IU7 A;  3BNE A;  3K0Z A;  1JB5 A;  3SXX A;  1JKG B;  2CC3 A;  5CLK A;  3K7C A;  3STD A;  4FMA A;  1W6C A;  4XDV A;  1N9E A;  1JKG A;  5A0O B;  1OHO A;  3BB9 A;  3NBB A;  3DY5 A;  1U8C B;  3DM8 A;  3HI7 A;  5JBS A;  3CU3 A;  1OAC A;  3OW2 2;  4L8O A;  3S27 A;  3I55 3;  2GU1 A;  3NX0 A;  1CEW I;  1OUN A;  2GEY A;  3IJE B;  2K0M A;  3SOA A;  3T8U A;  2L4V A;  1LNH A;  3EE1 A;  4HM2 B;  3MG1 A;  4NHF A;  1J2B A;  1ULJ B;  1FGQ A;  1K9M 4;  3MSO A;  5CF1 A;  3CCS 3;  2RSX A;  5KP3 A;  1VZZ A;  5IG0 A;  4LGQ A;  4N6M A;  3DZL A;  1ISK A;  3UL6 A;  4ZM8 A;  4K1V A;  3PCR A;  3EJV A;  3FH1 A;  3KN4 A;  1OCV A;  2D42 A;  5DRV A;  2CWT A;  3FF2 A;  3LH4 A;  4EXR A;  1EKM A;  1IQX A;  3UL5 A;  4KZ1 A;  2HML B;  1Q82 4;  1NO3 A;  5TGN A;  3EQQ B;  3G71 3;  2I9W A;  2ML5 A;  2HMO B;  3CXC 2;  1DMQ A;  2O9U X;  5IER A;  1EA2 A;  4AEQ A;  5ELJ A;  2JQ5 A;  5IEO A;  5FW5 A;  4EV2 A;  4WWU C;  2GEX A;  3EBY A;  3LTB A;  3SED A;  1O7G B;  3FLJ A;  1JNQ A;  2CKF B;  3J7Y d;  4XBY A;  3I0Y A;  4XM4 A;  1M90 4;  2XFT A;  4IT7 A;  1WMP A;  1LXE A;  2SBL A;  5DRE A;  4HZ9 B;  4CCV A;  1FGT A;  3F7X A;  2XSH B;  3PCS A;  1S5A A;  4IIA A;  3EN8 A;  1AVK A;  1JN5 B;  2CWV A;  4BTW A;  4JRF A;  1JN5 A;  4HM0 B;  1VQP 3;  1C7H A;  1Q81 4;  1ZO2 A;  3H3H A;  4HM7 B;  2XR8 B;  3DGL A;  3X3Y A;  2Q07 A;  4HYZ A;  3CCE 3;  5BXQ A;  3U97 A;  2CH9 A;  1GY5 A;  3SOY A;  3LZA A;  2LYX A;  4O02 B;  5AYS C;  1VQO 3;  1OF5 B;  1GY6 A;  2BHM A;  1RRH A;  3G6E 3;  1JJ2 2;  1VQM 3;  2XEP A;  2IUK A;  1OF5 A;  4BTX A;  1YVB I;  4U13 A;  4J9A A;  1Y4K A;  3WOD G;  1OHS A;  2CFG A;  2MF7 A;  3X3X A;  1STD A;  1HU9 A;  1OGZ A;  4N6T A;  3UB1 A;  1VQ8 3;  4HKV B;  5FGO A;  1D6Z A;  3AMO B;  3NBR A;  4HM3 B;  4FMB A;  3PS8 A;  3AMO A;  1DVC A;  4HM1 B;  3V99 A;  5AEU B;  3PGB A;  5AIH A;  1Q42 A;  1K73 4;  3MWZ A;  1KD1 4;  5KP4 A;  3S67 A;  1VQL 3;  5HGR A;  2W0Q A;  4WFO A;  3D3L A;  1TIJ A;  1LVN A;  1O7H B;  4L8P A;  3EHC A;  4IPB A;  3X41 A;  4EBG A;  3GZY B;  5EQL A;  8CHO A;  4TX4 A;  4RNY A;  5G2G A;  5EVH A;  1A2K A;  1ZX2 A;  3GWR A;  3BND A;  3OX9 A;  3IMA B;  2OOV A;  3T8N A;  4HZB B;  1VQK 3;  1OGX A;  3NXJ A;  3WOF B;  4QWT A;  3A76 A;  3S28 A;  3FCS B;  4EC6 A;  3U1W A;  2UX0 A;  1AV4 A;  2FGT A;  1OPY A;  1W2Z A;  3QRD A;  3UJM A;  3UNL A;  3L0R A;  3E99 A;  2BMO B;  3PZW A;  1WTH A;  2YFJ B;  1STF I;  4LEH A;  2W03 A;  1YHQ 3;  1Q86 4;  4X2H A;  2W04 A;  4AKY A;  1YJN 3;  4HJL B;  4O2H A;  1VQ4 3;  4XDW A;  3NQZ A;  1TP6 A;  2LQV A;  1M9G A;  3LT9 A;  1YJ9 3;  3KE7 A;  4R9K A;  3CCL 3;  2XF3 A;  1SIH A;  1R4C A;  1O7W B;  1ROA A;  3EC9 A;  3WA3 A;  1DVD A;  3K9M C;  2INX A;  3NM2 A;  4OVM A;  1FGR A;  1YJW 3;  1JV2 B;  3VSY A;  2KXG A;  2XFS A;  3CPO A;  3LXU X;  1IVW A;  2P05 A;  2HMK B;  2P38 A;  1QVF 2;  1U5O A;  2PZV A;  3EB8 A;  1Q7Y 4;  4JF8 A;  3FSD A;  1NJI 4;  1JB4 A;  3K5T A;  1FA3 A;  2XGN A;  1N8R 4;  1OH0 A;  2XSO B;  2WGO A;  2WOF A;  2QIY A;  4HM6 B;  1RJO A;  4N6N B;  4MMZ B;  1US1 A;  3H51 A;  5CK6 A;  2WGQ A;  2KCD A;  1A67 A;  3FG4 A;  3FZW A;  1W7C A;  3LT8 A;  3WDG B;  3WMD A;  3NUV A;  2PNC A;  5LC6 A;  1O7M B;  4WHA A;  1G96 A;  2GXF A;  3G8Z A;  2XRX B;  3CMA 3;  1GS3 A;  2F98 A;  2P09 A;  1UUV B;  2IA7 A;  4LSO A;  3MKI A;  1N5H A;  3NBJ A;  5KP1 A;  1KSI A;  5IW9 A;  1FUW A;  5IG5 A;  2Z76 A;  1DMM A;  4XBT A;  4N6O B;  3N8B A;  4EYC A;  4AKZ A;  2QEX 3;  2JDI H;  2CFK A;  2BMQ B;  2ZDJ A;  5CF2 A;  2E2V A;  4MJD A;  3ROB A;  1YIT 3;  4MEI A;  3D9R A;  3EX9 A;  4H3U A;  3SX1 A;  1EG9 B;  4NRE A;  2Y73 A;  4WYK B;  1O7N B;  2BO9 B;  4WYK A;  2M7O A;  3PYJ A;  1IV7 A;  1W5Z A;  3FGY A;  1VQ6 3;  1GD3 A;  1WMO A;  3FKA A;  3JUQ A;  3RDE A;  3S29 A;  1CQS A;  4HBR A;  4LMI A;  4MMY B;  3CCQ 3;  3G4S 3;  5IEP A;  3WOE B;  1TFO A;  3X3Z A;  5CXO A;  3GZX B;  1NDO B;  3LTC A;  2YX9 A;  3QK9 A;  3JUN A;  1KWI A;  2K54 A;  3SLU A;  2YFI B;  3HK4 A;  4RNZ A;  2STD A;  4FR9 A;  3OXA A;  2RCD A;  2BNG A;  1UI7 A;  2CFL A;  4XB5 A;  1BUQ A;  1SPU A;  3HX8 A;  1E3V A;  2Y74 A;  3F7S A;  5AIG A;  3KFQ C;  3VGN A;  2OTJ 3;  1GYB A;  2CK3 H;  3JUO A;  1W6G A;  3OWY A;  3FF0 A;  3CNM A;  1IK3 A;  3LOY A;  3CC4 3;  4Q53 A;  2IMJ A;  2Z6B A;  1UUW B;  1GD4 A;  1QAL A;  5D82 A;  4KFE A;  3JUM A;  2WOH A;  1IT8 A;  3F9S A;  1A2V A;  1W2B 2;  3F40 A;  4XBX A;  3LTA A;  3O8Y A;  4J8T A;  4K90 B;  1DMN A;  1IVV A;  1N5P A;  5IG3 A;  3S5C A;  1WNH A;  2HMJ B;  2YFL B;  3KSP A;  5D81 A;  2P0X A;  1DYU A;  3HII A;  5AII A;  5BVB A;  1K8A 4;  1O7P B;  1QJG A;  2F99 A;  3N54 B;  3GAX A;  1IDP A;  1S72 3;  3NQY A;  2CG1 A;  2XGL A;  3IPT A;  1FGM A;  1YI2 3;  4FMC A;  4OUQ A;  4BTY A;  3B4P A;  3I56 3;  2HMM B;  3V98 A;  1Z1S A;  4MMX B;  6STD A;  1ROV A;  1KQS 2;  1F8N A;  1W4N A;  3BNB A;  4K61 A;  3RGA A;  1IVU A;  2GBW B;  1IQ8 A;  2O3O A;  1RN7 A;  2W2C A;  4O3V A;  2D1W A;  1WMN A;  1GY7 A;  2GBX B;  3DMC A;  4STD A;  2BT3 A;  3LTD A;  3G16 A;  3CCM 3;  1W01 A;  3NV0 B;  1IQY A;  2A15 A;  3GZR A;  3OWU A;  4R9L A;  3SVA A;  3Q90 A;  4OK0 A;  4FCZ A;  3NV0 A;  1FGO A;  2XH9 A;  2R4I A;  3Q1C A;  4G1M B;  2OWP A;  3WA2 X;  3CCR 3;  1NWW A;  1PU4 A;  1HKX A;  5JPU A;  1IVX A;  2IUJ A;  3JUP A;  3HZP A;  2Z77 A;  5AIF A;  3X42 A;  4KFD A;  4I4K A;  3ALA A;  1TU5 A;  3MYT A;  1KC8 4;  3DGM A;  2OQE C;  4KFF A;  2RGQ A;  1JRQ A;  1N9J A;  5D83 A;  1VQ9 3;  1N8Q A;  4N6U A;  2WO0 A;  2OCT A;  1LOX A;  2FXT A;  1L5G B;  3MG3 A;  1NB3 I;  5ELU A;  2MC8 A;  3CCJ 3;  4FCM A;  3DUK A;  5JPP A;  3V92 A;  3LYG A;  3LML A;  3N9H A;  4FMD A;  4KVH A;  1QVG 2;  2OQE A;  2W6J H;  3GRD A;  3M8C A;  3CNX A;  4ORL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...