3CD63

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cd6300
1QVF2 1Q824 3CME3 3CCM3 1YHQ3 1Q7Y4 3CXC2 1M904 1VQL3 1VQN3 2OTJ3 1N8R4 1NJI4 1M1K4 1KQS2 1VQM3 3G6E3 1VQ53 1VQ83 1Q814 1KC84 1K8A4 3CCU3 3CCQ3 1VQ73 1W2B2 3CC73 3G4S3 1YIT3 1Q864 3G713 1JJ22 1VQ63 3CCL3 1YI23 1YJN3 1K9M4 3OW22 1S723 3CD63 3CCE3 1YJ93 3CMA3 1YJW3 1VQP3 3CCR3 2QA43 3CCS3 3I563 1QVG2 2QEX3 3CC23 3CCV3 1YIJ3 1VQ93 2OTL3 1VQO3 3CC43 3I553 1VQ43 3CCJ3 1K734 1KD14 3CPW2 1VQK3
chains in the Genus database with same CATH superfamily
4HM0B 4WHAA 1AQZA 4R9KA 3AGOA 2F86B 1STFI 1I3IA 4HM4B 3MWZA 3PYJA 2W9QA 4OVMA 2CFWA 5G1KA 1VQ83 1A67A 1OHOA 1HYFA 1JV2B 2B24B 3WMDA 4BL3A 4LEHA 1EEJA 4N6UA 3K63A 1W7CA 1T2IA 3NQZA 6GSPA 3F14A 3NX0A 1A2KA 2BO9B 4HBRA 4AEQA 2K3DA 9RNTA 3NHXA 3DGNA 1JN5A 1X1XA 3EN8A 4R9LA 4MMZB 5DRVA 1RGKA 4L8PA 5M19A 1RN1A 4IPBA 1W01A 2F4YA 4N6TA 1SPUA 1BSDA 1R4YA 1UI8A 2J8XB 1OGXA 2F99A 2OQEA 5TGNA 1M1K4 3KSED 1VQM3 4WFOA 1RN4A 1BRIA 8RNTA 1TFOA 5JPPA 1V57A 3IPTA 5IENA 3G0KA 3V98A 8CHOA 2IY2A 5AYSC 1W2B2 1JZOA 1N5HA 3G4S3 3G16A 3B4OA 1Q864 1VQ63 1BNGA 1K9M4 2GXFA 3DM8A 3KKGA 1MWRA 5IERA 2XGLA 1SJWA 3F40A 5IG3A 1Q42A 2HMNB 2F5MA 1O7GB 1AVKA 3K7CA 5STDA 2H0IA 3I553 1YIJ3 2I9WA 1FW7A 2GBXB 1ULJB 3DZLA 3UB1A 1QMAA 2H0GA 4FMAA 4HOHA 2INXA 4EV5A 4BTXA 2CWUA 1IQ8A 4RZMA 2BU4A 1KC84 4FMBA 3BLZA 1RGEA 1MGRA 5A0OB 1YGWA 2A15A 1OH0A 3EHCA 3G8ZA 5LC7A 1JJ22 1JBRA 4FCMA 1RMSA 4RNTA 1BOXA 5EEOA 1DE3A 3EB8A 1EA2A 1LOWA 3WA3A 3PCSA 5AIIA 3LTAA 1R4CA 3AMOA 5IF6A 1RGFA 1QVF2 1U5OA 4KFFA 3CCM3 1E3VA 2BHMA 4GSPA 5CF2A 2ML5A 5LC6A 1EG9B 3G6E3 5IG4A 1B27A 3EF8A 3N8BA 4BU4A 2WO0A 3JUMA 3UL5A 4ILFA 3NBBA 3J7Yd 1EKMA 2XRXB 1T3BA 1O7PB 3D9RA 1JBTA 1EUIC 4EYCA 4FMDA 4MMYB 1JRQA 1NO3A 3DGMA 1BRHA 3MG1A 3D79A 3OW22 5FW5A 1K41A 4BTYA 2GBWB 1GSPA 1LXEA 3OX9A 4BTWA 1J2BA 4AKYA 1VZZA 1BIRA 3SX1A 1PFPA 1UUVB 2XR8B 1KSIA 2E2TA 1WMPA 1LRAA 3CPW2 2CFKA 3HX8A 3SVAA 4XDWA 1B21A 1A2PA 1BAOA 1M9GA 1UCKA 1M904 1GY6A 2ZL8A 3LOYA 4LZIA 4TX4A 4BIRA 2WGQA 1SIIA 3FKAA 3RGAA 6RNTA 4KT3B 1AV4A 4I5QA 2W04A 3CC73 1TU5A 3GWRA 1V58A 3GZRA 4HZBB 2Y73A 1IT8A 4MJDA 1RGLA 3KFQC 1BSAA 4HZ9B 2O3OA 1RJOA 3JUPA 3CMA3 1RKYA 4ORLA 1ASKA 1I70A 1IVVA 1IK3A 1VQP3 1IVWA 2HMLB 2Z76A 3MHEA 3CC23 2R41A 1JB2A 3FH1A 4N6MA 3CCV3 3DGYA 4MEIA 3CC43 1Q40B 3FZWA 2F98A 1QAKA 1Z1SA 2OQEC 4J8TA 4H3UA 1NB5I 4WWUC 2P09A 2D1WA 2C4BA 4HYZA 3EBTA 3X42A 3WHOA 1C54A 1TRQA 2SARA 1ZO2A 3CCU3 1B3SA 3JVCA 2YFIB 2HOHA 2STDA 3HIIA 4LGQA 1NNVA 2MF7A 1BRGA 2YFLB 5CLKA 1DVCA 1GMPA 2F56A 1OF5B 3NM7A 1SIHA 1BGSA 2XFTA 1DMQA 4JRFA 1RCKA 2GSPA 1T5YA 2O9UX 4OK0A 3GAXA 3U1WA 3D5IA 4FR9A 3CCR3 1BSEA 3NV0B 3UNLA 1BRKA 1B2ZA 2LYXA 3S28A 1K734 1AR0A 1W6GA 2W56B 3ER7A 4FCJA 1UW1A 3HI7A 5EVHA 3SLUA 1BVIA 1PYLA 4HM8B 1CQSA 3F7XA 6STDA 2K0MA 2OTJ3 2OOVA 1IVUA 4OUQA 5KP4A 1IQXA 3MSOA 4I4KA 5BU4A 1QALA 1O7WB 1I2EA 1LNIA 3RGRA 1O7HB 1UCIA 4L8OA 3GZYB 2CX0A 1HZ1A 3X40A 1DMMA 1EQKA 2KF3A 1GYBA 4BL2A 3MKIA 4RBNA 3UL6A 3CCE3 1UI7A 1TTOA 3X3ZA 4N3VA 1N5PA 3LT9A 3LH4A 3M8CA 4HM5B 1N9JA 1RNTA 2UX0A 2YX9A 1W6CA 3PGBA 4MMXB 2Q07A 2W9PA 1GOYA 4CDLA 1F8NA 1I8VA 4JF8A 2BNGA 1UGIA 3WA2X 2XFSA 1UUGB 5HOHA 1SQWA 3KN4A 1WNHA 3DGOA 3MG2A 4XB5A 2XGNA 2IYJA 3F9SA 3LMLA 3NBJA 3O8YA 4NHFA 3FLJA 4LMIA 5M1AA 2KRTA 3ZG5A 2QGUA 2W0QA 1TJDA 4J9AA 3G713 5AIFA 1IV9A 3JUNA 1T2HA 4EBGA 4R1KA 3Q3FA 2P0MA 1IYYA 4IT7A 1D6YA 4GL6A 2D42A 2CWTA 1IQYA 1FGQA 1RSNA 3S29A 3FSDA 2Z7AA 3T8NA 1MWUA 4HM6B 5ELJA 4IIAA 1VQ43 2YFJB 5CXOA 4HM2B 1B2XA 2HMOB 1GOUA 1C7HA 3A5EA 5KP1A 1KQS2 2WOHA 2GEXA 4HAAA 3K5TA 3KSPA 1OGZA 1ZS7A 3T0UA 3D4AA 1V74A 2CW9A 1GS3A 3BIRA 3KCHA 4WYKA 4EXRA 4CCVA 1BRJA 4R80A 2W03A 1OACA 4XBXA 3OXAA 2E2UA 5AEWB 1O7MB 1W2ZA 2IMJA 1BNJA 5IEOA 1NWWA 3F8XA 5D83A 2R4IA 1OUNA 3FCSB 7STDA 2K54A 1JKGA 1BNSA 2FGTA 4WP5A 1RGAA 2CFLA 2CH9A 5AI1A 5DREA 1FA3A 3ECFA 2CIUA 3SYUA 2XH9A 5RNTA 1Q7Y4 3FG4A 3U97A 1BSBA 1UGHI 1STDA 1BUQA 2SBLA 3DH2A 1JB5A 3QK9A 1W6YA 3B4PA 3EQQB 3FG3A 3VGNA 1JZDA 1ROAA 1X1UA 2W6JH 4H61A 1VQ73 4HM1B 3ZFZA 4X2OA 3TDGA 1BNIA 1FGTA 3URPA 3LZAA 4DKIA 2LQVA 4J5GA 4KZ1A 2E2VA 5BXQA 1A90A 1DMNA 1YJN3 3EBYA 5HGRA 1S723 1BANA 2UGIA 4G1MB 1YJ93 1BSCA 1LQMB 2CWVA 4XDVA 3H51A 5IG5A 2BMQB 3NXJA 1FUSA 1QVG2 1TFKA 1NB3I 4O3VA 2KF4A 2XSHB 5KP3A 1CYVA 4K90B 2H0HA 4J5KA 1VQO3 2OTL3 5EQLA 2QIYA 1LOVA 3S5CA 4QWTA 3EE1A 1Q824 1FYSA 4KFDA 3AMOB 4O02B 3CXC2 1VQL3 2OOVC 1E97A 1RN7A 4X2HA 1WTHA 1BRSA 2PNCA 3DMCA 3E99A 1MGWA 1LQGC 2IA7A 2RFRA 1G96A 1W02A 4HM7B 3IJEB 2Z77A 5D81A 1S5AA 5JBSA 3MG3A 4O8SA 2IUKA 3HOHA 3D3LA 3RDEA 2ZDJA 4L7KA 1L5GB 1Y4KA 1MWSA 2C11A 3SOAA 1BNEA 1PY3A 2QA43 1I2FA 3CCS3 4KFEA 2BT3A 4R4KA 3GZBA 2OWPA 1UCLA 1OHSA 1OCVA 2AADA 1X1WA 1GOVA 1B20A 1X1YA 3CPOA 3CCJ3 1YGEA 1IT7A 2C10A 5BIRA 1VQK3 2F5WA 3CME3 3EN1B 1YHQ3 1FGMA 4CJNA 2CX1A 3B7CA 3LTCA 1FZUA 1BUJA 3BB9A 1W5ZA 5IW9A 3ROBA 3WOFB 1GY5A 2GU1A 3WDGB 1LOYA 3NQYA 3L0RA 1MOLA 1RRHA 3DXOA 2XEPA 3HK4A 4FCZA 3DY5A 1Q7HA 3SXXA 1RGGA 2RNTA 1YIT3 1I0VA 4KVHA 3QRDA 1CH0A 3PZWA 3H3HA 1ZGXA 3LTBA 2RSXA 3OWUA 4GB5A 1IU7A 3IMAB 1MNLA 4XM4A 3SEDA 5IG0A 3I563 4RNZA 2KAAA 1FGOA 3LTDA 2MC8A 1E3RA 3LYGA 4EV2A 1TIJA 4CPKA 1CYUA 1N8QA 4HJLB 1DYUA 2KF6A 1NU3A 2OCTA 2CFGA 2UUGC 3MPHA 4HKVB 3UJMA 1ROVA 1K28A 1YVSA 4FMCA 5D82A 7RNTA 5GSPA 1KD14 2WOFA 3WODG 2BMRB 1TP6A 3NUVA 1WMOA 2ZA4A 3S67A 3BNDA 2GEYA 1RTUA 1GMQA 3Q90A 4K1VA 1GY7A 1NDOB 4U13A 3OWYA 1VQ53 2ZHXB 1FGRA 1BNFA 1LNHA 2KXGA 1M1XB 1B2UA 5G1LA 1YVBI 1D6ZA 1RDSA 3F7SA 4AKZA 5AIGA 3CD63 1ZX2A 3LT8A 1D6UA 3PS8A 1DETA 4NPBA 1YJW3 1BU4A 1GMRA 4N6V0 5IEPA 1GD3A 1OPYA 1WMNA 4N6OB 3V92A 2QEX3 1JBSA 3BNCA 3N9HA 1BNRA 2L4VA 3AGNA 1FUWA 2V1LA 3DGLA 3EJVA 2P38A 3N54B 1JB4A 1I0XA 1JN5B 1GD4A 1HU9A 1AY7A 1KWIA 1QJGA 3PCRA 3X3XA 1RHLA 4LSOA 1NJI4 1UDII 4XBTA 4NREA 4EW5A 2M7OA 1K8A4 3WR2A 3KE7A 3B8LA 3CCQ3 2JDIH 3AHSA 2XF3A 3GZXB 4HVNA 1U8CB 3BNEA 4O2HA 3HZPA 3CCL3 3Q2PA 1US1A 1B2SA 2P0XA 2CKFB 1RNBA 1B2MA 1DVDA 2HMJB 2RCDA 3BNBA 1Q40A 1IDPA 2BMOB 2KF5A 4GHOA 1G02A 3MYTA 2CC3A 2PZVA 2RGQA 1VQ93 1HKXA 3EX9A 2AAEA 3JUQA 1LOXA 1CEWI 3OV4A 5JPUA 1VQN3 1I2GA 3EC9A 4STDA 3GSPA 1UUWB 4ZM8A 3CU3A 3F8HA 5CK6A 3FF2A 1Q814 2WGOA 2JQ5A 4LYLB 4Q53A 3FGYA 2BIRA 5G2GA 2CK3H 1OF5A 5BVBA 3PXMA 4K61A 1Q9EA 1LVNA 2HMKB 3K0ZA 2Y74A 3LXUX 3WOEB 1IV7A 2Z6BA 5CF1A 1MWTA 3A76A 3NM2A 3OWSA 1G0TA 3K9MC 2KCDA 3NV0A 1TRPA 1A2VA 1RCLA 5M18A 3HIGA 2IUJA 2W56A 1RRLA 1ULIB 2B1XB 3I0YA 4XBYA 1I3FA 1ISKA 7GSPA 3S27A 3D5GA 2RBIA 3X3YA 3Q1CA 2CFDA 3FG1A 2XSOB 3CNXA 1JNQA 3ALAA 2P05A 5AYRB 1UCJA 2CG0A 1W00A 3GRDA 1N8R4 3SOYA 1SARA 1BRNL 2HMMB 3ZG0A 2W2CA 1PU4A 2GU3A 2L1SA 1RGCA 3VSYA 4EC6A 1VQQA 1O7NB 1W4NA 2FNQA 5I97A 3FF0A 3BU4A 4WYKB 2CG1A 1AVLA 1FUTA 3V99A 1N9EA 5ELUA 1YI23 3KZTA 1RLSA 3X41A 5AEUB 5FGOA 3NBRA 1YNVX 3KIIA 4HM3B 3CNMA 4N6LA 4RNYA 3STDA 1IVXA 4K1UA 4PEJA 3AHWA 3JUOA 3T8UA 1RGHA 1OHPA 1WQLB 1QAFA 3DUKA 1TUHA 4N6NB 2CHCA 5AIHA 3RNTA 3VF1A 2ML6A 1JKGB 2FXTA
chains in the Genus database with same CATH topology
4HM0B 4WHAA 4R9KA 2F86B 1STFI 4HM4B 3MWZA 3PYJA 2W9QA 4OVMA 2CFWA 1VQ83 1A67A 1OHOA 2B24B 1JV2B 3WMDA 4LEHA 4N6UA 3K63A 1W7CA 3NQZA 3F14A 3NX0A 1A2KA 2BO9B 4HBRA 4AEQA 3NHXA 3DGNA 1JN5A 3EN8A 4R9LA 4MMZB 5DRVA 4L8PA 4IPBA 1W01A 4N6TA 1SPUA 1UI8A 1OGXA 2F99A 2OQEA 5TGNA 1M1K4 3KSED 1VQM3 4WFOA 1TFOA 5JPPA 3IPTA 5IENA 3G0KA 3V98A 8CHOA 5AYSC 1W2B2 1N5HA 3G4S3 3G16A 3B4OA 1Q864 1VQ63 1K9M4 2GXFA 3DM8A 3KKGA 5IERA 2XGLA 1SJWA 3F40A 5IG3A 1Q42A 2HMNB 1O7GB 1AVKA 3K7CA 5STDA 1YIJ3 2I9WA 2GBXB 1ULJB 3DZLA 3UB1A 1QMAA 4FMAA 2INXA 4EV5A 4BTXA 2CWUA 1IQ8A 4RZMA 1KC84 4FMBA 3BLZA 5A0OB 2A15A 1OH0A 3EHCA 3G8ZA 5LC7A 1JJ22 4FCMA 5EEOA 3EB8A 1EA2A 3WA3A 3PCSA 5AIIA 3LTAA 1R4CA 3AMOA 5IF6A 1QVF2 1U5OA 4KFFA 3CCM3 1E3VA 2BHMA 5CF2A 2ML5A 5LC6A 1EG9B 3G6E3 5IG4A 3EF8A 3N8BA 2WO0A 3JUMA 3UL5A 3NBBA 3J7Yd 1EKMA 2XRXB 1O7PB 3D9RA 4EYCA 4FMDA 4MMYB 1JRQA 1NO3A 3DGMA 3MG1A 3OW22 5FW5A 1K41A 4BTYA 2GBWB 1LXEA 3OX9A 4BTWA 1J2BA 4AKYA 1VZZA 3SX1A 1PFPA 1UUVB 2XR8B 1KSIA 2E2TA 1WMPA 3CPW2 2CFKA 3HX8A 3SVAA 4XDWA 1M9GA 1M904 1GY6A 2ZL8A 3LOYA 4LZIA 4TX4A 2WGQA 1SIIA 3FKAA 3RGAA 1AV4A 2W04A 3CC73 1TU5A 3GWRA 3GZRA 4HZBB 2Y73A 1IT8A 4MJDA 3KFQC 4HZ9B 2O3OA 1RJOA 3JUPA 3CMA3 1RKYA 4ORLA 1ASKA 1VQP3 1IVVA 1IK3A 1IVWA 2HMLB 2Z76A 3MHEA 3CC23 1JB2A 3FH1A 4N6MA 3CCV3 4MEIA 3CC43 1Q40B 3FZWA 2F98A 1QAKA 1Z1SA 2OQEC 4J8TA 4H3UA 1NB5I 4WWUC 2P09A 2D1WA 4HYZA 3EBTA 3X42A 1ZO2A 3CCU3 3JVCA 2YFIB 2STDA 3HIIA 4LGQA 2MF7A 5CLKA 2YFLB 1DVCA 3NM7A 1OF5B 1SIHA 4JRFA 2XFTA 1DMQA 4OK0A 2O9UX 1T5YA 3GAXA 3U1WA 4FR9A 3CCR3 3UNLA 3NV0B 2LYXA 3S28A 1K734 1AR0A 1W6GA 2W56B 3ER7A 4FCJA 1UW1A 3HI7A 5EVHA 3SLUA 5IEPA 2OTJ3 4HM8B 1CQSA 3F7XA 6STDA 2K0MA 2OOVA 1IVUA 4OUQA 5KP4A 1IQXA 3MSOA 4I4KA 1QALA 1O7WB 3RGRA 1O7HB 4L8OA 3GZYB 3X40A 1DMMA 1EQKA 1GYBA 3MKIA 4RBNA 3UL6A 3CCE3 1UI7A 3X3ZA 4N3VA 1N5PA 3LT9A 3LH4A 3M8CA 4HM5B 1N9JA 2UX0A 2YX9A 1W6CA 3PGBA 4MMXB 2Q07A 2W9PA 4CDLA 1F8NA 4JF8A 3WA2X 2BNGA 2XFSA 1SQWA 3KN4A 1WNHA 3DGOA 3MG2A 4XB5A 2XGNA 3O8YA 3F9SA 3LMLA 3NBJA 4NHFA 3FLJA 4LMIA 2KRTA 2QGUA 2W0QA 4J9AA 3G713 5AIFA 1IV9A 3JUNA 4EBGA 4R1KA 2P0MA 4IT7A 1D6YA 4GL6A 2D42A 2CWTA 1IQYA 1FGQA 3S29A 3FSDA 2Z7AA 3T8NA 4HM6B 5ELJA 4IIAA 1VQ43 2YFJB 5CXOA 4HM2B 2HMOB 1C7HA 1KQS2 5KP1A 2WOHA 2GEXA 3K5TA 3KSPA 1OGZA 3T0UA 1V74A 2CW9A 1GS3A 4WYKA 4EXRA 4CCVA 4R80A 2W03A 1OACA 4XBXA 3OXAA 2E2UA 5AEWB 1O7MB 1W2ZA 2IMJA 5IEOA 1NWWA 3F8XA 5D83A 2R4IA 1OUNA 3FCSB 7STDA 2K54A 1JKGA 2FGTA 4WP5A 2CFLA 2CH9A 5AI1A 5DREA 1FA3A 3ECFA 2CIUA 1Q7Y4 2XH9A 3FG4A 3U97A 1STDA 1BUQA 2SBLA 1JB5A 3QK9A 1W6YA 3B4PA 3EQQB 3FG3A 3VGNA 1ROAA 2W6JH 4H61A 1VQ73 4HM1B 4X2OA 3TDGA 1FGTA 3LZAA 2LQVA 4KZ1A 2E2VA 5BXQA 1A90A 1DMNA 1YJN3 3EBYA 5HGRA 1S723 1YJ93 4G1MB 2CWVA 4XDVA 5IG5A 3H51A 2BMQB 3NXJA 1QVG2 1TFKA 1NB3I 4O3VA 2XSHB 5KP3A 1CYVA 4K90B 2OTL3 1VQO3 5EQLA 2QIYA 3S5CA 4QWTA 3EE1A 1Q824 4KFDA 3AMOB 4O02B 3CXC2 1VQL3 2OOVC 1E97A 1RN7A 4X2HA 1WTHA 2PNCA 3DMCA 3E99A 2IA7A 2RFRA 1G96A 1W02A 4HM7B 3IJEB 2Z77A 5D81A 1S5AA 5JBSA 3MG3A 4O8SA 2IUKA 3RDEA 3D3LA 2ZDJA 4L7KA 1L5GB 1Y4KA 2C11A 3SOAA 2QA43 3CCS3 4KFEA 2BT3A 4R4KA 3GZBA 2OWPA 1OHSA 1OCVA 3CPOA 3CCJ3 1YGEA 1IT7A 2C10A 1VQK3 3CME3 3EN1B 1YHQ3 1FGMA 3B7CA 3LTCA 3BB9A 1W5ZA 5IW9A 3ROBA 3WOFB 1GY5A 2GU1A 3WDGB 3NQYA 3L0RA 1MOLA 1RRHA 3DXOA 2XEPA 3HK4A 4FCZA 3DY5A 3SXXA 1YIT3 4KVHA 3QRDA 3PZWA 3H3HA 3LTBA 2RSXA 3OWUA 4GB5A 1IU7A 3IMAB 1MNLA 4XM4A 3SEDA 5IG0A 3I563 4RNZA 3LTDA 1FGOA 2MC8A 1E3RA 3LYGA 4EV2A 1TIJA 1CYUA 1N8QA 4HJLB 1DYUA 4HKVB 2OCTA 1NU3A 2CFGA 3MPHA 3UJMA 3I553 1ROVA 1K28A 4FMCA 1KD14 5D82A 2WOFA 3WODG 2BMRB 1TP6A 3NUVA 1WMOA 3S67A 3BNDA 2GEYA 3Q90A 4K1VA 4U13A 1GY7A 1NDOB 1VQ53 3OWYA 1FGRA 1LNHA 2KXGA 1M1XB 1YVBI 1D6ZA 3F7SA 4AKZA 5AIGA 3CD63 1ZX2A 3LT8A 1D6UA 3PS8A 1YJW3 4N6V0 1GD3A 1OPYA 1WMNA 4N6OB 3V92A 2QEX3 3BNCA 3N9HA 2L4VA 1FUWA 2V1LA 3DGLA 3EJVA 2P38A 3N54B 1JB4A 1JN5B 1GD4A 1HU9A 1KWIA 1QJGA 1NJI4 3PCRA 3X3XA 4LSOA 4XBTA 4NREA 2M7OA 1K8A4 3KE7A 3B8LA 3CCQ3 2JDIH 3GZXB 2XF3A 4HVNA 1U8CB 3BNEA 4O2HA 3HZPA 3CCL3 3Q2PA 1US1A 2P0XA 2CKFB 1DVDA 2HMJB 2RCDA 3BNBA 1Q40A 1IDPA 2BMOB 3MYTA 2CC3A 2PZVA 2RGQA 1VQ93 1HKXA 3EX9A 3JUQA 1LOXA 1CEWI 3OV4A 5JPUA 1VQN3 4STDA 3EC9A 1UUWB 4ZM8A 3CU3A 3F8HA 5CK6A 3FF2A 1Q814 2WGOA 2JQ5A 4Q53A 5G2GA 3FGYA 2CK3H 1OF5A 5BVBA 3PXMA 4K61A 3K0ZA 1LVNA 2HMKB 3LXUX 2Y74A 3WOEB 1IV7A 2Z6BA 5CF1A 3A76A 3NM2A 3OWSA 3K9MC 2KCDA 3NV0A 1A2VA 3HIGA 2IUJA 2W56A 1RRLA 1ULIB 2B1XB 3I0YA 4XBYA 1ISKA 3S27A 3X3YA 3Q1CA 2CFDA 3FG1A 2XSOB 3CNXA 1JNQA 3ALAA 2P05A 5AYRB 2CG0A 1W00A 3GRDA 1N8R4 3SOYA 2HMMB 2W2CA 1PU4A 2GU3A 3VSYA 4EC6A 2FNQA 1O7NB 1W4NA 5I97A 3FF0A 4WYKB 2CG1A 1AVLA 3V99A 1N9EA 5ELUA 1YI23 3KZTA 3X41A 5AEUB 5FGOA 3NBRA 3KIIA 4HM3B 3CNMA 4N6LA 4RNYA 3STDA 1IVXA 4K1UA 4PEJA 3T8UA 3JUOA 1OHPA 1WQLB 1QAFA 3DUKA 1TUHA 4N6NB 2CHCA 5AIHA 3VF1A 2ML6A 1JKGB 2FXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF 2;  1Q82 4;  3CME 3;  3CCM 3;  1YHQ 3;  1Q7Y 4;  3CXC 2;  1M90 4;  1VQL 3;  1VQN 3;  2OTJ 3;  1N8R 4;  1NJI 4;  1M1K 4;  1KQS 2;  1VQM 3;  3G6E 3;  1VQ5 3;  1VQ8 3;  1Q81 4;  1KC8 4;  1K8A 4;  3CCU 3;  3CCQ 3;  1VQ7 3;  1W2B 2;  3CC7 3;  3G4S 3;  1YIT 3;  1Q86 4;  3G71 3;  1JJ2 2;  1VQ6 3;  3CCL 3;  1YI2 3;  1YJN 3;  1K9M 4;  3OW2 2;  1S72 3;  3CD6 3;  3CCE 3;  1YJ9 3;  3CMA 3;  1YJW 3;  1VQP 3;  3CCR 3;  2QA4 3;  3CCS 3;  3I56 3;  1QVG 2;  2QEX 3;  3CC2 3;  3CCV 3;  1YIJ 3;  1VQ9 3;  2OTL 3;  1VQO 3;  3CC4 3;  3I55 3;  1VQ4 3;  3CCJ 3;  1K73 4;  1KD1 4;  3CPW 2;  1VQK 3; 
#chains in the Genus database with same CATH topology
 4HM0 B;  4WHA A;  1AQZ A;  4R9K A;  3AGO A;  2F86 B;  1STF I;  1I3I A;  4HM4 B;  3MWZ A;  3PYJ A;  2W9Q A;  4OVM A;  2CFW A;  5G1K A;  1VQ8 3;  1A67 A;  1OHO A;  1HYF A;  1JV2 B;  2B24 B;  3WMD A;  4BL3 A;  4LEH A;  1EEJ A;  4N6U A;  3K63 A;  1W7C A;  1T2I A;  3NQZ A;  6GSP A;  3F14 A;  3NX0 A;  1A2K A;  2BO9 B;  4HBR A;  4AEQ A;  2K3D A;  9RNT A;  3NHX A;  3DGN A;  1JN5 A;  1X1X A;  3EN8 A;  4R9L A;  4MMZ B;  5DRV A;  1RGK A;  4L8P A;  5M19 A;  1RN1 A;  4IPB A;  1W01 A;  2F4Y A;  4N6T A;  1SPU A;  1BSD A;  1R4Y A;  1UI8 A;  2J8X B;  1OGX A;  2F99 A;  2OQE A;  5TGN A;  1M1K 4;  3KSE D;  1VQM 3;  4WFO A;  1RN4 A;  1BRI A;  8RNT A;  1TFO A;  5JPP A;  1V57 A;  3IPT A;  5IEN A;  3G0K A;  3V98 A;  8CHO A;  2IY2 A;  5AYS C;  1W2B 2;  1JZO A;  1N5H A;  3G4S 3;  3G16 A;  3B4O A;  1Q86 4;  1VQ6 3;  1BNG A;  1K9M 4;  2GXF A;  3DM8 A;  3KKG A;  1MWR A;  5IER A;  2XGL A;  1SJW A;  3F40 A;  5IG3 A;  1Q42 A;  2HMN B;  2F5M A;  1O7G B;  1AVK A;  3K7C A;  5STD A;  2H0I A;  3I55 3;  1YIJ 3;  2I9W A;  1FW7 A;  2GBX B;  1ULJ B;  3DZL A;  3UB1 A;  1QMA A;  2H0G A;  4FMA A;  4HOH A;  2INX A;  4EV5 A;  4BTX A;  2CWU A;  1IQ8 A;  4RZM A;  2BU4 A;  1KC8 4;  4FMB A;  3BLZ A;  1RGE A;  1MGR A;  5A0O B;  1YGW A;  2A15 A;  1OH0 A;  3EHC A;  3G8Z A;  5LC7 A;  1JJ2 2;  1JBR A;  4FCM A;  1RMS A;  4RNT A;  1BOX A;  5EEO A;  1DE3 A;  3EB8 A;  1EA2 A;  1LOW A;  3WA3 A;  3PCS A;  5AII A;  3LTA A;  1R4C A;  3AMO A;  5IF6 A;  1RGF A;  1QVF 2;  1U5O A;  4KFF A;  3CCM 3;  1E3V A;  2BHM A;  4GSP A;  5CF2 A;  2ML5 A;  5LC6 A;  1EG9 B;  3G6E 3;  5IG4 A;  1B27 A;  3EF8 A;  3N8B A;  4BU4 A;  2WO0 A;  3JUM A;  3UL5 A;  4ILF A;  3NBB A;  3J7Y d;  1EKM A;  2XRX B;  1T3B A;  1O7P B;  3D9R A;  1JBT A;  1EUI C;  4EYC A;  4FMD A;  4MMY B;  1JRQ A;  1NO3 A;  3DGM A;  1BRH A;  3MG1 A;  3D79 A;  3OW2 2;  5FW5 A;  1K41 A;  4BTY A;  2GBW B;  1GSP A;  1LXE A;  3OX9 A;  4BTW A;  1J2B A;  4AKY A;  1VZZ A;  1BIR A;  3SX1 A;  1PFP A;  1UUV B;  2XR8 B;  1KSI A;  2E2T A;  1WMP A;  1LRA A;  3CPW 2;  2CFK A;  3HX8 A;  3SVA A;  4XDW A;  1B21 A;  1A2P A;  1BAO A;  1M9G A;  1UCK A;  1M90 4;  1GY6 A;  2ZL8 A;  3LOY A;  4LZI A;  4TX4 A;  4BIR A;  2WGQ A;  1SII A;  3FKA A;  3RGA A;  6RNT A;  4KT3 B;  1AV4 A;  4I5Q A;  2W04 A;  3CC7 3;  1TU5 A;  3GWR A;  1V58 A;  3GZR A;  4HZB B;  2Y73 A;  1IT8 A;  4MJD A;  1RGL A;  3KFQ C;  1BSA A;  4HZ9 B;  2O3O A;  1RJO A;  3JUP A;  3CMA 3;  1RKY A;  4ORL A;  1ASK A;  1I70 A;  1IVV A;  1IK3 A;  1VQP 3;  1IVW A;  2HML B;  2Z76 A;  3MHE A;  3CC2 3;  2R41 A;  1JB2 A;  3FH1 A;  4N6M A;  3CCV 3;  3DGY A;  4MEI A;  3CC4 3;  1Q40 B;  3FZW A;  2F98 A;  1QAK A;  1Z1S A;  2OQE C;  4J8T A;  4H3U A;  1NB5 I;  4WWU C;  2P09 A;  2D1W A;  2C4B A;  4HYZ A;  3EBT A;  3X42 A;  3WHO A;  1C54 A;  1TRQ A;  2SAR A;  1ZO2 A;  3CCU 3;  1B3S A;  3JVC A;  2YFI B;  2HOH A;  2STD A;  3HII A;  4LGQ A;  1NNV A;  2MF7 A;  1BRG A;  2YFL B;  5CLK A;  1DVC A;  1GMP A;  2F56 A;  1OF5 B;  3NM7 A;  1SIH A;  1BGS A;  2XFT A;  1DMQ A;  4JRF A;  1RCK A;  2GSP A;  1T5Y A;  2O9U X;  4OK0 A;  3GAX A;  3U1W A;  3D5I A;  4FR9 A;  3CCR 3;  1BSE A;  3NV0 B;  3UNL A;  1BRK A;  1B2Z A;  2LYX A;  3S28 A;  1K73 4;  1AR0 A;  1W6G A;  2W56 B;  3ER7 A;  4FCJ A;  1UW1 A;  3HI7 A;  5EVH A;  3SLU A;  1BVI A;  1PYL A;  4HM8 B;  1CQS A;  3F7X A;  6STD A;  2K0M A;  2OTJ 3;  2OOV A;  1IVU A;  4OUQ A;  5KP4 A;  1IQX A;  3MSO A;  4I4K A;  5BU4 A;  1QAL A;  1O7W B;  1I2E A;  1LNI A;  3RGR A;  1O7H B;  1UCI A;  4L8O A;  3GZY B;  2CX0 A;  1HZ1 A;  3X40 A;  1DMM A;  1EQK A;  2KF3 A;  1GYB A;  4BL2 A;  3MKI A;  4RBN A;  3UL6 A;  3CCE 3;  1UI7 A;  1TTO A;  3X3Z A;  4N3V A;  1N5P A;  3LT9 A;  3LH4 A;  3M8C A;  4HM5 B;  1N9J A;  1RNT A;  2UX0 A;  2YX9 A;  1W6C A;  3PGB A;  4MMX B;  2Q07 A;  2W9P A;  1GOY A;  4CDL A;  1F8N A;  1I8V A;  4JF8 A;  2BNG A;  1UGI A;  3WA2 X;  2XFS A;  1UUG B;  5HOH A;  1SQW A;  3KN4 A;  1WNH A;  3DGO A;  3MG2 A;  4XB5 A;  2XGN A;  2IYJ A;  3F9S A;  3LML A;  3NBJ A;  3O8Y A;  4NHF A;  3FLJ A;  4LMI A;  5M1A A;  2KRT A;  3ZG5 A;  2QGU A;  2W0Q A;  1TJD A;  4J9A A;  3G71 3;  5AIF A;  1IV9 A;  3JUN A;  1T2H A;  4EBG A;  4R1K A;  3Q3F A;  2P0M A;  1IYY A;  4IT7 A;  1D6Y A;  4GL6 A;  2D42 A;  2CWT A;  1IQY A;  1FGQ A;  1RSN A;  3S29 A;  3FSD A;  2Z7A A;  3T8N A;  1MWU A;  4HM6 B;  5ELJ A;  4IIA A;  1VQ4 3;  2YFJ B;  5CXO A;  4HM2 B;  1B2X A;  2HMO B;  1GOU A;  1C7H A;  3A5E A;  5KP1 A;  1KQS 2;  2WOH A;  2GEX A;  4HAA A;  3K5T A;  3KSP A;  1OGZ A;  1ZS7 A;  3T0U A;  3D4A A;  1V74 A;  2CW9 A;  1GS3 A;  3BIR A;  3KCH A;  4WYK A;  4EXR A;  4CCV A;  1BRJ A;  4R80 A;  2W03 A;  1OAC A;  4XBX A;  3OXA A;  2E2U A;  5AEW B;  1O7M B;  1W2Z A;  2IMJ A;  1BNJ A;  5IEO A;  1NWW A;  3F8X A;  5D83 A;  2R4I A;  1OUN A;  3FCS B;  7STD A;  2K54 A;  1JKG A;  1BNS A;  2FGT A;  4WP5 A;  1RGA A;  2CFL A;  2CH9 A;  5AI1 A;  5DRE A;  1FA3 A;  3ECF A;  2CIU A;  3SYU A;  2XH9 A;  5RNT A;  1Q7Y 4;  3FG4 A;  3U97 A;  1BSB A;  1UGH I;  1STD A;  1BUQ A;  2SBL A;  3DH2 A;  1JB5 A;  3QK9 A;  1W6Y A;  3B4P A;  3EQQ B;  3FG3 A;  3VGN A;  1JZD A;  1ROA A;  1X1U A;  2W6J H;  4H61 A;  1VQ7 3;  4HM1 B;  3ZFZ A;  4X2O A;  3TDG A;  1BNI A;  1FGT A;  3URP A;  3LZA A;  4DKI A;  2LQV A;  4J5G A;  4KZ1 A;  2E2V A;  5BXQ A;  1A90 A;  1DMN A;  1YJN 3;  3EBY A;  5HGR A;  1S72 3;  1BAN A;  2UGI A;  4G1M B;  1YJ9 3;  1BSC A;  1LQM B;  2CWV A;  4XDV A;  3H51 A;  5IG5 A;  2BMQ B;  3NXJ A;  1FUS A;  1QVG 2;  1TFK A;  1NB3 I;  4O3V A;  2KF4 A;  2XSH B;  5KP3 A;  1CYV A;  4K90 B;  2H0H A;  4J5K A;  1VQO 3;  2OTL 3;  5EQL A;  2QIY A;  1LOV A;  3S5C A;  4QWT A;  3EE1 A;  1Q82 4;  1FYS A;  4KFD A;  3AMO B;  4O02 B;  3CXC 2;  1VQL 3;  2OOV C;  1E97 A;  1RN7 A;  4X2H A;  1WTH A;  1BRS A;  2PNC A;  3DMC A;  3E99 A;  1MGW A;  1LQG C;  2IA7 A;  2RFR A;  1G96 A;  1W02 A;  4HM7 B;  3IJE B;  2Z77 A;  5D81 A;  1S5A A;  5JBS A;  3MG3 A;  4O8S A;  2IUK A;  3HOH A;  3D3L A;  3RDE A;  2ZDJ A;  4L7K A;  1L5G B;  1Y4K A;  1MWS A;  2C11 A;  3SOA A;  1BNE A;  1PY3 A;  2QA4 3;  1I2F A;  3CCS 3;  4KFE A;  2BT3 A;  4R4K A;  3GZB A;  2OWP A;  1UCL A;  1OHS A;  1OCV A;  2AAD A;  1X1W A;  1GOV A;  1B20 A;  1X1Y A;  3CPO A;  3CCJ 3;  1YGE A;  1IT7 A;  2C10 A;  5BIR A;  1VQK 3;  2F5W A;  3CME 3;  3EN1 B;  1YHQ 3;  1FGM A;  4CJN A;  2CX1 A;  3B7C A;  3LTC A;  1FZU A;  1BUJ A;  3BB9 A;  1W5Z A;  5IW9 A;  3ROB A;  3WOF B;  1GY5 A;  2GU1 A;  3WDG B;  1LOY A;  3NQY A;  3L0R A;  1MOL A;  1RRH A;  3DXO A;  2XEP A;  3HK4 A;  4FCZ A;  3DY5 A;  1Q7H A;  3SXX A;  1RGG A;  2RNT A;  1YIT 3;  1I0V A;  4KVH A;  3QRD A;  1CH0 A;  3PZW A;  3H3H A;  1ZGX A;  3LTB A;  2RSX A;  3OWU A;  4GB5 A;  1IU7 A;  3IMA B;  1MNL A;  4XM4 A;  3SED A;  5IG0 A;  3I56 3;  4RNZ A;  2KAA A;  1FGO A;  3LTD A;  2MC8 A;  1E3R A;  3LYG A;  4EV2 A;  1TIJ A;  4CPK A;  1CYU A;  1N8Q A;  4HJL B;  1DYU A;  2KF6 A;  1NU3 A;  2OCT A;  2CFG A;  2UUG C;  3MPH A;  4HKV B;  3UJM A;  1ROV A;  1K28 A;  1YVS A;  4FMC A;  5D82 A;  7RNT A;  5GSP A;  1KD1 4;  2WOF A;  3WOD G;  2BMR B;  1TP6 A;  3NUV A;  1WMO A;  2ZA4 A;  3S67 A;  3BND A;  2GEY A;  1RTU A;  1GMQ A;  3Q90 A;  4K1V A;  1GY7 A;  1NDO B;  4U13 A;  3OWY A;  1VQ5 3;  2ZHX B;  1FGR A;  1BNF A;  1LNH A;  2KXG A;  1M1X B;  1B2U A;  5G1L A;  1YVB I;  1D6Z A;  1RDS A;  3F7S A;  4AKZ A;  5AIG A;  3CD6 3;  1ZX2 A;  3LT8 A;  1D6U A;  3PS8 A;  1DET A;  4NPB A;  1YJW 3;  1BU4 A;  1GMR A;  4N6V 0;  5IEP A;  1GD3 A;  1OPY A;  1WMN A;  4N6O B;  3V92 A;  2QEX 3;  1JBS A;  3BNC A;  3N9H A;  1BNR A;  2L4V A;  3AGN A;  1FUW A;  2V1L A;  3DGL A;  3EJV A;  2P38 A;  3N54 B;  1JB4 A;  1I0X A;  1JN5 B;  1GD4 A;  1HU9 A;  1AY7 A;  1KWI A;  1QJG A;  3PCR A;  3X3X A;  1RHL A;  4LSO A;  1NJI 4;  1UDI I;  4XBT A;  4NRE A;  4EW5 A;  2M7O A;  1K8A 4;  3WR2 A;  3KE7 A;  3B8L A;  3CCQ 3;  2JDI H;  3AHS A;  2XF3 A;  3GZX B;  4HVN A;  1U8C B;  3BNE A;  4O2H A;  3HZP A;  3CCL 3;  3Q2P A;  1US1 A;  1B2S A;  2P0X A;  2CKF B;  1RNB A;  1B2M A;  1DVD A;  2HMJ B;  2RCD A;  3BNB A;  1Q40 A;  1IDP A;  2BMO B;  2KF5 A;  4GHO A;  1G02 A;  3MYT A;  2CC3 A;  2PZV A;  2RGQ A;  1VQ9 3;  1HKX A;  3EX9 A;  2AAE A;  3JUQ A;  1LOX A;  1CEW I;  3OV4 A;  5JPU A;  1VQN 3;  1I2G A;  3EC9 A;  4STD A;  3GSP A;  1UUW B;  4ZM8 A;  3CU3 A;  3F8H A;  5CK6 A;  3FF2 A;  1Q81 4;  2WGO A;  2JQ5 A;  4LYL B;  4Q53 A;  3FGY A;  2BIR A;  5G2G A;  2CK3 H;  1OF5 A;  5BVB A;  3PXM A;  4K61 A;  1Q9E A;  1LVN A;  2HMK B;  3K0Z A;  2Y74 A;  3LXU X;  3WOE B;  1IV7 A;  2Z6B A;  5CF1 A;  1MWT A;  3A76 A;  3NM2 A;  3OWS A;  1G0T A;  3K9M C;  2KCD A;  3NV0 A;  1TRP A;  1A2V A;  1RCL A;  5M18 A;  3HIG A;  2IUJ A;  2W56 A;  1RRL A;  1ULI B;  2B1X B;  3I0Y A;  4XBY A;  1I3F A;  1ISK A;  7GSP A;  3S27 A;  3D5G A;  2RBI A;  3X3Y A;  3Q1C A;  2CFD A;  3FG1 A;  2XSO B;  3CNX A;  1JNQ A;  3ALA A;  2P05 A;  5AYR B;  1UCJ A;  2CG0 A;  1W00 A;  3GRD A;  1N8R 4;  3SOY A;  1SAR A;  1BRN L;  2HMM B;  3ZG0 A;  2W2C A;  1PU4 A;  2GU3 A;  2L1S A;  1RGC A;  3VSY A;  4EC6 A;  1VQQ A;  1O7N B;  1W4N A;  2FNQ A;  5I97 A;  3FF0 A;  3BU4 A;  4WYK B;  2CG1 A;  1AVL A;  1FUT A;  3V99 A;  1N9E A;  5ELU A;  1YI2 3;  3KZT A;  1RLS A;  3X41 A;  5AEU B;  5FGO A;  3NBR A;  1YNV X;  3KII A;  4HM3 B;  3CNM A;  4N6L A;  4RNY A;  3STD A;  1IVX A;  4K1U A;  4PEJ A;  3AHW A;  3JUO A;  3T8U A;  1RGH A;  1OHP A;  1WQL B;  1QAF A;  3DUK A;  1TUH A;  4N6N B;  2CHC A;  5AIH A;  3RNT A;  3VF1 A;  2ML6 A;  1JKG B;  2FXT A; 
#chains in the Genus database with same CATH homology
 4HM0 B;  4WHA A;  4R9K A;  2F86 B;  1STF I;  4HM4 B;  3MWZ A;  3PYJ A;  2W9Q A;  4OVM A;  2CFW A;  1VQ8 3;  1A67 A;  1OHO A;  2B24 B;  1JV2 B;  3WMD A;  4LEH A;  4N6U A;  3K63 A;  1W7C A;  3NQZ A;  3F14 A;  3NX0 A;  1A2K A;  2BO9 B;  4HBR A;  4AEQ A;  3NHX A;  3DGN A;  1JN5 A;  3EN8 A;  4R9L A;  4MMZ B;  5DRV A;  4L8P A;  4IPB A;  1W01 A;  4N6T A;  1SPU A;  1UI8 A;  1OGX A;  2F99 A;  2OQE A;  5TGN A;  1M1K 4;  3KSE D;  1VQM 3;  4WFO A;  1TFO A;  5JPP A;  3IPT A;  5IEN A;  3G0K A;  3V98 A;  8CHO A;  5AYS C;  1W2B 2;  1N5H A;  3G4S 3;  3G16 A;  3B4O A;  1Q86 4;  1VQ6 3;  1K9M 4;  2GXF A;  3DM8 A;  3KKG A;  5IER A;  2XGL A;  1SJW A;  3F40 A;  5IG3 A;  1Q42 A;  2HMN B;  1O7G B;  1AVK A;  3K7C A;  5STD A;  1YIJ 3;  2I9W A;  2GBX B;  1ULJ B;  3DZL A;  3UB1 A;  1QMA A;  4FMA A;  2INX A;  4EV5 A;  4BTX A;  2CWU A;  1IQ8 A;  4RZM A;  1KC8 4;  4FMB A;  3BLZ A;  5A0O B;  2A15 A;  1OH0 A;  3EHC A;  3G8Z A;  5LC7 A;  1JJ2 2;  4FCM A;  5EEO A;  3EB8 A;  1EA2 A;  3WA3 A;  3PCS A;  5AII A;  3LTA A;  1R4C A;  3AMO A;  5IF6 A;  1QVF 2;  1U5O A;  4KFF A;  3CCM 3;  1E3V A;  2BHM A;  5CF2 A;  2ML5 A;  5LC6 A;  1EG9 B;  3G6E 3;  5IG4 A;  3EF8 A;  3N8B A;  2WO0 A;  3JUM A;  3UL5 A;  3NBB A;  3J7Y d;  1EKM A;  2XRX B;  1O7P B;  3D9R A;  4EYC A;  4FMD A;  4MMY B;  1JRQ A;  1NO3 A;  3DGM A;  3MG1 A;  3OW2 2;  5FW5 A;  1K41 A;  4BTY A;  2GBW B;  1LXE A;  3OX9 A;  4BTW A;  1J2B A;  4AKY A;  1VZZ A;  3SX1 A;  1PFP A;  1UUV B;  2XR8 B;  1KSI A;  2E2T A;  1WMP A;  3CPW 2;  2CFK A;  3HX8 A;  3SVA A;  4XDW A;  1M9G A;  1M90 4;  1GY6 A;  2ZL8 A;  3LOY A;  4LZI A;  4TX4 A;  2WGQ A;  1SII A;  3FKA A;  3RGA A;  1AV4 A;  2W04 A;  3CC7 3;  1TU5 A;  3GWR A;  3GZR A;  4HZB B;  2Y73 A;  1IT8 A;  4MJD A;  3KFQ C;  4HZ9 B;  2O3O A;  1RJO A;  3JUP A;  3CMA 3;  1RKY A;  4ORL A;  1ASK A;  1VQP 3;  1IVV A;  1IK3 A;  1IVW A;  2HML B;  2Z76 A;  3MHE A;  3CC2 3;  1JB2 A;  3FH1 A;  4N6M A;  3CCV 3;  4MEI A;  3CC4 3;  1Q40 B;  3FZW A;  2F98 A;  1QAK A;  1Z1S A;  2OQE C;  4J8T A;  4H3U A;  1NB5 I;  4WWU C;  2P09 A;  2D1W A;  4HYZ A;  3EBT A;  3X42 A;  1ZO2 A;  3CCU 3;  3JVC A;  2YFI B;  2STD A;  3HII A;  4LGQ A;  2MF7 A;  5CLK A;  2YFL B;  1DVC A;  3NM7 A;  1OF5 B;  1SIH A;  4JRF A;  2XFT A;  1DMQ A;  4OK0 A;  2O9U X;  1T5Y A;  3GAX A;  3U1W A;  4FR9 A;  3CCR 3;  3UNL A;  3NV0 B;  2LYX A;  3S28 A;  1K73 4;  1AR0 A;  1W6G A;  2W56 B;  3ER7 A;  4FCJ A;  1UW1 A;  3HI7 A;  5EVH A;  3SLU A;  5IEP A;  2OTJ 3;  4HM8 B;  1CQS A;  3F7X A;  6STD A;  2K0M A;  2OOV A;  1IVU A;  4OUQ A;  5KP4 A;  1IQX A;  3MSO A;  4I4K A;  1QAL A;  1O7W B;  3RGR A;  1O7H B;  4L8O A;  3GZY B;  3X40 A;  1DMM A;  1EQK A;  1GYB A;  3MKI A;  4RBN A;  3UL6 A;  3CCE 3;  1UI7 A;  3X3Z A;  4N3V A;  1N5P A;  3LT9 A;  3LH4 A;  3M8C A;  4HM5 B;  1N9J A;  2UX0 A;  2YX9 A;  1W6C A;  3PGB A;  4MMX B;  2Q07 A;  2W9P A;  4CDL A;  1F8N A;  4JF8 A;  3WA2 X;  2BNG A;  2XFS A;  1SQW A;  3KN4 A;  1WNH A;  3DGO A;  3MG2 A;  4XB5 A;  2XGN A;  3O8Y A;  3F9S A;  3LML A;  3NBJ A;  4NHF A;  3FLJ A;  4LMI A;  2KRT A;  2QGU A;  2W0Q A;  4J9A A;  3G71 3;  5AIF A;  1IV9 A;  3JUN A;  4EBG A;  4R1K A;  2P0M A;  4IT7 A;  1D6Y A;  4GL6 A;  2D42 A;  2CWT A;  1IQY A;  1FGQ A;  3S29 A;  3FSD A;  2Z7A A;  3T8N A;  4HM6 B;  5ELJ A;  4IIA A;  1VQ4 3;  2YFJ B;  5CXO A;  4HM2 B;  2HMO B;  1C7H A;  1KQS 2;  5KP1 A;  2WOH A;  2GEX A;  3K5T A;  3KSP A;  1OGZ A;  3T0U A;  1V74 A;  2CW9 A;  1GS3 A;  4WYK A;  4EXR A;  4CCV A;  4R80 A;  2W03 A;  1OAC A;  4XBX A;  3OXA A;  2E2U A;  5AEW B;  1O7M B;  1W2Z A;  2IMJ A;  5IEO A;  1NWW A;  3F8X A;  5D83 A;  2R4I A;  1OUN A;  3FCS B;  7STD A;  2K54 A;  1JKG A;  2FGT A;  4WP5 A;  2CFL A;  2CH9 A;  5AI1 A;  5DRE A;  1FA3 A;  3ECF A;  2CIU A;  1Q7Y 4;  2XH9 A;  3FG4 A;  3U97 A;  1STD A;  1BUQ A;  2SBL A;  1JB5 A;  3QK9 A;  1W6Y A;  3B4P A;  3EQQ B;  3FG3 A;  3VGN A;  1ROA A;  2W6J H;  4H61 A;  1VQ7 3;  4HM1 B;  4X2O A;  3TDG A;  1FGT A;  3LZA A;  2LQV A;  4KZ1 A;  2E2V A;  5BXQ A;  1A90 A;  1DMN A;  1YJN 3;  3EBY A;  5HGR A;  1S72 3;  1YJ9 3;  4G1M B;  2CWV A;  4XDV A;  5IG5 A;  3H51 A;  2BMQ B;  3NXJ A;  1QVG 2;  1TFK A;  1NB3 I;  4O3V A;  2XSH B;  5KP3 A;  1CYV A;  4K90 B;  2OTL 3;  1VQO 3;  5EQL A;  2QIY A;  3S5C A;  4QWT A;  3EE1 A;  1Q82 4;  4KFD A;  3AMO B;  4O02 B;  3CXC 2;  1VQL 3;  2OOV C;  1E97 A;  1RN7 A;  4X2H A;  1WTH A;  2PNC A;  3DMC A;  3E99 A;  2IA7 A;  2RFR A;  1G96 A;  1W02 A;  4HM7 B;  3IJE B;  2Z77 A;  5D81 A;  1S5A A;  5JBS A;  3MG3 A;  4O8S A;  2IUK A;  3RDE A;  3D3L A;  2ZDJ A;  4L7K A;  1L5G B;  1Y4K A;  2C11 A;  3SOA A;  2QA4 3;  3CCS 3;  4KFE A;  2BT3 A;  4R4K A;  3GZB A;  2OWP A;  1OHS A;  1OCV A;  3CPO A;  3CCJ 3;  1YGE A;  1IT7 A;  2C10 A;  1VQK 3;  3CME 3;  3EN1 B;  1YHQ 3;  1FGM A;  3B7C A;  3LTC A;  3BB9 A;  1W5Z A;  5IW9 A;  3ROB A;  3WOF B;  1GY5 A;  2GU1 A;  3WDG B;  3NQY A;  3L0R A;  1MOL A;  1RRH A;  3DXO A;  2XEP A;  3HK4 A;  4FCZ A;  3DY5 A;  3SXX A;  1YIT 3;  4KVH A;  3QRD A;  3PZW A;  3H3H A;  3LTB A;  2RSX A;  3OWU A;  4GB5 A;  1IU7 A;  3IMA B;  1MNL A;  4XM4 A;  3SED A;  5IG0 A;  3I56 3;  4RNZ A;  3LTD A;  1FGO A;  2MC8 A;  1E3R A;  3LYG A;  4EV2 A;  1TIJ A;  1CYU A;  1N8Q A;  4HJL B;  1DYU A;  4HKV B;  2OCT A;  1NU3 A;  2CFG A;  3MPH A;  3UJM A;  3I55 3;  1ROV A;  1K28 A;  4FMC A;  1KD1 4;  5D82 A;  2WOF A;  3WOD G;  2BMR B;  1TP6 A;  3NUV A;  1WMO A;  3S67 A;  3BND A;  2GEY A;  3Q90 A;  4K1V A;  4U13 A;  1GY7 A;  1NDO B;  1VQ5 3;  3OWY A;  1FGR A;  1LNH A;  2KXG A;  1M1X B;  1YVB I;  1D6Z A;  3F7S A;  4AKZ A;  5AIG A;  3CD6 3;  1ZX2 A;  3LT8 A;  1D6U A;  3PS8 A;  1YJW 3;  4N6V 0;  1GD3 A;  1OPY A;  1WMN A;  4N6O B;  3V92 A;  2QEX 3;  3BNC A;  3N9H A;  2L4V A;  1FUW A;  2V1L A;  3DGL A;  3EJV A;  2P38 A;  3N54 B;  1JB4 A;  1JN5 B;  1GD4 A;  1HU9 A;  1KWI A;  1QJG A;  1NJI 4;  3PCR A;  3X3X A;  4LSO A;  4XBT A;  4NRE A;  2M7O A;  1K8A 4;  3KE7 A;  3B8L A;  3CCQ 3;  2JDI H;  3GZX B;  2XF3 A;  4HVN A;  1U8C B;  3BNE A;  4O2H A;  3HZP A;  3CCL 3;  3Q2P A;  1US1 A;  2P0X A;  2CKF B;  1DVD A;  2HMJ B;  2RCD A;  3BNB A;  1Q40 A;  1IDP A;  2BMO B;  3MYT A;  2CC3 A;  2PZV A;  2RGQ A;  1VQ9 3;  1HKX A;  3EX9 A;  3JUQ A;  1LOX A;  1CEW I;  3OV4 A;  5JPU A;  1VQN 3;  4STD A;  3EC9 A;  1UUW B;  4ZM8 A;  3CU3 A;  3F8H A;  5CK6 A;  3FF2 A;  1Q81 4;  2WGO A;  2JQ5 A;  4Q53 A;  5G2G A;  3FGY A;  2CK3 H;  1OF5 A;  5BVB A;  3PXM A;  4K61 A;  3K0Z A;  1LVN A;  2HMK B;  3LXU X;  2Y74 A;  3WOE B;  1IV7 A;  2Z6B A;  5CF1 A;  3A76 A;  3NM2 A;  3OWS A;  3K9M C;  2KCD A;  3NV0 A;  1A2V A;  3HIG A;  2IUJ A;  2W56 A;  1RRL A;  1ULI B;  2B1X B;  3I0Y A;  4XBY A;  1ISK A;  3S27 A;  3X3Y A;  3Q1C A;  2CFD A;  3FG1 A;  2XSO B;  3CNX A;  1JNQ A;  3ALA A;  2P05 A;  5AYR B;  2CG0 A;  1W00 A;  3GRD A;  1N8R 4;  3SOY A;  2HMM B;  2W2C A;  1PU4 A;  2GU3 A;  3VSY A;  4EC6 A;  2FNQ A;  1O7N B;  1W4N A;  5I97 A;  3FF0 A;  4WYK B;  2CG1 A;  1AVL A;  3V99 A;  1N9E A;  5ELU A;  1YI2 3;  3KZT A;  3X41 A;  5AEU B;  5FGO A;  3NBR A;  3KII A;  4HM3 B;  3CNM A;  4N6L A;  4RNY A;  3STD A;  1IVX A;  4K1U A;  4PEJ A;  3T8U A;  3JUO A;  1OHP A;  1WQL B;  1QAF A;  3DUK A;  1TUH A;  4N6N B;  2CHC A;  5AIH A;  3VF1 A;  2ML6 A;  1JKG B;  2FXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...