3CD63

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cd6300
3CPW2 1YHQ3 1VQ73 1W2B2 1Q824 3CC43 3CD63 3I563 3CCM3 1KD14 1VQN3 3G4S3 3CCR3 1K734 1VQL3 3CXC2 1VQK3 3CCQ3 3G6E3 3CCV3 1QVF2 3OW22 1YIT3 1VQ53 1VQM3 3CC73 3CCJ3 2QEX3 1YJ93 1K8A4 3CME3 1KQS2 3CMA3 1YJN3 1M1K4 3CCE3 1YJW3 1S723 1NJI4 1JJ22 1QVG2 3G713 1YI23 1VQ93 3CCU3 1Q7Y4 3CCS3 1K9M4 3I553 1N8R4 1M904 1Q814 1VQP3 3CC23 1Q864 1KC84 1YIJ3 1VQ83 1VQ63 2OTJ3 3CCL3 2OTL3 1VQO3 2QA43 1VQ43
chains in the Genus database with same CATH superfamily
3CPW2 4EV5A 3HOHA 3SOYA 3BNDA 1W6YA 2F5WA 3FG3A 5LC6A 1E3RA 3VSYA 1W6GA 2BMQB 4WYKA 3WDGB 3FLJA 2YFJB 1IU7A 2CFWA 3LT8A 1K41A 4LMIA 5AYRB 1VQ53 1PFPA 1RKYA 3WOFB 1RCKA 2CX0A 2QEX3 3AHSA 3FF0A 3OWSA 4FMDA 4J8TA 1G0TA 2RBIA 4KZ1A 3UB1A 1WMOA 1CQSA 1YJN3 4FMAA 1AV4A 1YJW3 2W2CA 4OUQA 4XBTA 1OUNA 4HM5B 9RNTA 1UI8A 1WNHA 3FZWA 4L8PA 4R9KA 3X3ZA 1TRQA 3FG1A 3I553 4RNYA 4HM0B 1A2KA 4XBXA 5AEUB 2Z76A 3DGOA 2KAAA 5DRVA 1O7GB 1BRHA 4HM8B 1VQ43 2H0HA 5GSPA 1OACA 3G8ZA 3PXMA 4R80A 4BU4A 3MG1A 1V58A 1DETA 1STFI 1ZX2A 3ROBA 1ULIB 1YGWA 3KIIA 1MNLA 3G0KA 1GMRA 4AKYA 1BRIA 1JN5A 3NV0B 1JB5A 4FCZA 8RNTA 1C54A 1KSIA 1HU9A 3LXUX 3V98A 5IW9A 5AEWB 2BO9B 1W6CA 2IA7A 2OWPA 1BRGA 1AVLA 1T2IA 1LOYA 2IUKA 1I70A 3IMAB 3EC9A 4LEHA 4GSPA 4N6MA 3CNMA 5AYSC 5G1KA 6STDA 3LTBA 1EUIC 1GY6A 3K5TA 1Q42A 3WA2X 1O7NB 1RNBA 1TJDA 3X42A 3WOEB 1LOVA 1UCLA 2D42A 3V92A 3ALAA 3M8CA 1OF5A 2PNCA 3MWZA 2ML6A 1NB5I 1TP6A 1LXEA 3CCR3 1DYUA 3KSPA 1SQWA 2ZHXB 1VQL3 1VQK3 3CCQ3 3DXOA 3ZG5A 1BNSA 2L1SA 1O7WB 2INXA 7STDA 1BRKA 8CHOA 1YJ93 3D3LA 1KQS2 1I0XA 3LTAA 5KP3A 1ROVA 1GD3A 1G02A 3MPHA 2SBLA 5JBSA 2OQEC 1PY3A 2P0XA 3WMDA 3KKGA 3NHXA 3PCRA 4HJLB 5CLKA 1MWUA 1FYSA 1RGLA 2IY2A 3FSDA 5EVHA 5STDA 6RNTA 3RDEA 2BIRA 4WP5A 4KVHA 1QMAA 1CH0A 6GSPA 1VQP3 2B1XB 3G16A 3WR2A 1CYUA 2BNGA 1W7CA 3BNBA 3NBBA 1ZS7A 1W01A 1B3SA 1IV9A 1VQ73 3CC43 1JV2B 2CHCA 1IT8A 3KN4A 3AHWA 1TU5A 1AQZA 5IENA 4Q53A 5JPUA 3WA3A 3LTDA 1O7HB 3A5EA 4N6LA 1YIT3 2IYJA 1JZDA 5CF2A 1BVIA 3GWRA 3WODG 3NBRA 2F99A 5BVBA 4LYLB 4J5GA 5CF1A 1EA2A 1VQQA 1JN5B 3F7XA 3ECFA 1OHSA 1ULJB 2HMOB 4BTWA 1ZO2A 3K0ZA 4EW5A 2W9PA 3NM2A 4ZM8A 3F7SA 1KC84 4KFDA 1QJGA 1Q9EA 4BL2A 1C7HA 3WHOA 1JKGA 7RNTA 1JBSA 3Q2PA 3S29A 1EEJA 1GOYA 5IEPA 3EN8A 3CCM3 1BNRA 1A67A 1DVDA 1R4YA 3EQQB 1BSAA 3G6E3 1EKMA 3DGLA 4N6NB 3MSOA 3RGAA 2BMOB 3URPA 1BSCA 2O9UX 1OF5B 1OHPA 2K0MA 5BIRA 3K63A 3JUMA 1QAKA 3X40A 5ELJA 2GXFA 3BB9A 1TFOA 4BTYA 5KP1A 1Q40A 3CCS3 5FW5A 3OXAA 3JUOA 1JB4A 3ZG0A 3AGOA 3HK4A 2E2UA 2Y73A 4HM4B 4HM7B 1HYFA 1RDSA 1BGSA 2XFSA 2HMNB 3BLZA 4NPBA 5A0OB 1JRQA 2XH9A 1VQO3 4R9LA 1RGAA 2XSHB 4GHOA 4JF8A 1W2B2 1MWTA 5IG5A 3DGYA 3UL5A 2W04A 3AMOB 3LTCA 3PYJA 3U97A 2KCDA 1X1WA 3Q3FA 3GAXA 4L8OA 1X1YA 1T2HA 3CCJ3 3J7Yd 2J8XB 1T5YA 4WWUC 3B7CA 1S723 1BU4A 3NM7A 1FUWA 3KSED 4FR9A 1W02A 2RNTA 4N6V0 3T8NA 3EJVA 4X2OA 1RGCA 1M904 1AR0A 2STDA 1NNVA 2IUJA 4K1UA 1UI7A 1U8CB 3NXJA 1W00A 1ASKA 4HBRA 5AIHA 3ER7A 1SIHA 4PEJA 4JRFA 3SLUA 1YHQ3 4R4KA 4MMYB 2CFKA 5D82A 4H61A 4EYCA 2CW9A 3NQYA 3UNLA 2XEPA 2F4YA 3OWYA 3JUNA 2XRXB 3U1WA 1JKGB 2GBWB 3EX9A 2KF4A 1QVF2 1BRNL 1K8A4 3D9RA 4CCVA 1GMQA 1TUHA 2Z6BA 3D5IA 2ZA4A 1LQGC 3MG2A 5AIGA 3GSPA 1UGHI 3B4OA 2FGTA 2RFRA 2W0QA 4O8SA 1AY7A 2Q07A 5M1AA 1A2VA 4NHFA 3AGNA 1BRSA 5IERA 4BTXA 1STDA 1B21A 4FMBA 1YIJ3 3GZYB 4N3VA 1FA3A 1X1XA 1UDII 3L0RA 1Q40B 2JDIH 1KWIA 1YNVX 2V1LA 2SARA 4H3UA 2FNQA 4IIAA 1IV7A 1V74A 3S28A 1NWWA 2E2VA 3G4S3 1K734 2CC3A 2CK3H 4FCMA 3F8XA 1IYYA 1I3FA 1E97A 2CWVA 3F40A 1WMNA 1M1XB 3N54B 1B2MA 1VQM3 3SVAA 2QGUA 3CC73 1HKXA 1RGHA 1V57A 3LZAA 1ROAA 2R4IA 3NBJA 2MF7A 1IQXA 4O3VA 1UUWB 2UUGC 1N8QA 3TDGA 1GY5A 1YI23 2CFGA 2P09A 2ZDJA 5KP4A 2MC8A 3GZXB 1B2ZA 1M1K4 4MMXB 1CEWI 2HMMB 1SJWA 3AMOA 5CK6A 1ISKA 1MGRA 1DVCA 3UL6A 1Q824 2CKFB 1IQYA 1I2EA 1T3BA 1IT7A 3DM8A 1RGEA 1RN4A 2RSXA 4AEQA 2OOVA 3O8YA 2CFDA 2BHMA 1IQ8A 4ILFA 3MYTA 1PYLA 2E2TA 1BNFA 4XM4A 1RGFA 2I9WA 4AKZA 2P0MA 3LOYA 4MEIA 1GYBA 2A15A 3EN1B 1W4NA 3SYUA 4MMZB 1JJ22 2B24B 3DGMA 3BNCA 1W2ZA 3CU3A 5I97A 3FCSB 4EBGA 1FGOA 3E99A 1NO3A 2XSOB 1TIJA 1TFKA 2LYXA 3Q1CA 3SEDA 1UCKA 4EV2A 1R4CA 3CC23 2WOFA 1RLSA 4NREA 2RCDA 1B2SA 3NUVA 1S5AA 2OCTA 3KE7A 3JUQA 4OVMA 7GSPA 3SXXA 2GEXA 3D4AA 3GRDA 3CXC2 2C11A 4MJDA 4RNZA 3CCV3 3BIRA 2UX0A 4I5QA 1RRLA 3VF1A 2HMJB 1N9JA 4L7KA 3SX1A 4EXRA 4G1MB 4HZBB 4RBNA 3F14A 4HZ9B 1FGTA 3CPOA 1F8NA 1BNIA 2C4BA 1DE3A 1JBTA 3H51A 1BSEA 1VQ93 1Q7Y4 2P38A 3OV4A 4U13A 2HMLB 5JPPA 1OPYA 2YFIB 3RGRA 3HI7A 1VQ63 4OK0A 2O3OA 2OTJ3 2FXTA 2WGOA 1NB3I 4X2HA 5BU4A 3EF8A 1OHOA 3GZBA 2CG0A 1K28A 1I2GA 1LRAA 1W5ZA 2KF3A 2GU3A 4HM2B 1BSBA 2YFLB 5BXQA 3KZTA 3X3XA 1IVUA 1LVNA 5FGOA 4HKVB 1BSDA 2BMRB 1BANA 2OQEA 1N5HA 1YGEA 3LMLA 1RGGA 2KF6A 3KCHA 3LT9A 4GL6A 2D1WA 4TX4A 1BRJA 1LNHA 1NDOB 2KRTA 2PZVA 2W56A 5M18A 1BNGA 1Q7HA 3LH4A 1FUSA 3CCU3 3H3HA 2CWUA 5AIIA 4BIRA 4RNTA 4LZIA 3N8BA 3QRDA 4CPKA 2BT3A 1MOLA 1A90A 1D6ZA 3CNXA 4J9AA 1DMQA 5D83A 3JUPA 1OGZA 2GBXB 2W03A 3DY5A 3ZFZA 1KD14 2GEYA 3LYGA 5EQLA 1Z1SA 4EC6A 1UCJA 1FGRA 1MWRA 5DREA 5EEOA 3DH2A 4KFEA 4HYZA 2UGIA 1SIIA 5HGRA 1EG9B 3MKIA 1BNJA 3F9SA 1UUVB 2OOVC 4R1KA 1GSPA 1SPUA 1B20A 1N9EA 1RJOA 3K7CA 2HOHA 2L4VA 2KXGA 3G713 3D5GA 4XB5A 2AAEA 1BIRA 4LGQA 2WGQA 3V99A 2H0IA 3F8HA 2CH9A 4DKIA 1I3IA 2XFTA 1A2PA 3VGNA 1LOWA 3Q90A 1GS3A 2F5MA 3PZWA 1N5PA 1FZUA 4O02B 5D81A 1WQLB 2C10A 4HAAA 2QA43 2IMJA 4BL3A 2CWTA 3HZPA 4GB5A 1MGWA 2XGLA 4ORLA 3I563 4XDWA 1RRHA 1FGQA 1IVXA 1JNQA 1BUJA 2XR8B 3EBYA 3STDA 3GZRA 1WTHA 2XF3A 1L5GB 4K1VA 1CYVA 1RCLA 1RNTA 3RNTA 1NU3A 3QK9A 1LQMB 2YX9A 3CMA3 3PS8A 2CX1A 4XBYA 2CIUA 3DMCA 1UCIA 1ZGXA 1BAOA 5IG0A 5M19A 2RGQA 3FGYA 3EHCA 3UJMA 2W6JH 1I0VA 5AIFA 2W56B 3N9HA 1Q864 1TRPA 3DZLA 1RHLA 5G1LA 2OTL3 1UW1A 3HIIA 2JQ5A 5LC7A 3MHEA 2W9QA 3S27A 3OWUA 4K90B 4HOHA 1VQN3 1SARA 2WO0A 4LSOA 3PGBA 3X3YA 1Y4KA 3OW22 3T0UA 4I4KA 4WYKB 5CXOA 5TGNA 1IK3A 5IF6A 4CJNA 1UGIA 3K9MC 1DMMA 1JB2A 1QVG2 1JBRA 2K54A 2Y74A 1FUTA 2R41A 4O2HA 3FH1A 3T8UA 1BOXA 3A76A 1JZOA 3HX8A 2WOHA 4KFFA 1MWSA 1EQKA 1TTOA 1RN7A 1GOVA 1RMSA 1BUQA 2ZL8A 3NQZA 3S5CA 2H0GA 1E3VA 5IEOA 1FGMA 3BNEA 4FMCA 3X41A 2Z77A 2GU1A 3IPTA 2HMKB 2KF5A 2QIYA 3B8LA 4XDVA 1IVWA 1GY7A 1IDPA 4HVNA 1J2BA 1M9GA 4N6UA 1AVKA 3PCSA 1D6YA 3NX0A 2F56A 4HM3B 2Z7AA 3CME3 1LOXA 1OGXA 3CCE3 3IJEB 3BU4A 1I8VA 1I2FA 1US1A 3I0YA 4N6OB 1OH0A 4RZMA 3HIGA 1O7MB 4WHAA 5RNTA 3JVCA 1YVSA 2XGNA 3S67A 1VQ83 3CCL3 3SOAA 3FF2A 4K61A 2AADA 3MG3A 4WFOA 1VZZA 3NV0A 1RSNA 3CD63 4IPBA 2BU4A 3B4PA 3OX9A 1DMNA 5HOHA 1LNIA 2M7OA 1OCVA 1HZ1A 1IVVA 4J5KA 3DGNA 2CG1A 3EB8A 1GMPA 1RGKA 1UUGB 3EBTA 1G96A 1GOUA 2K3DA 4N6TA 1FW7A 2P05A 3FKAA 4QWTA 1PU4A 1YVBI 4HM6B 2LQVA 1BNEA 1B2XA 4FCJA 5IG4A 1NJI4 2ML5A 3EE1A 4IT7A 1RN1A 1O7PB 1GD4A 4HM1B 5ELUA 1K9M4 1N8R4 1B2UA 3KFQC 2CFLA 4CDLA 2GSPA 1U5OA 1RTUA 2F98A 4STDA 3FG4A 1X1UA 1Q814 3D79A 1D6UA 1QAFA 2F86B 1WMPA 3DUKA 4KT3B 5G2GA 5IG3A 1B27A 1QALA 5AI1A
chains in the Genus database with same CATH topology
3CPW2 4EV5A 3SOYA 3BNDA 1W6YA 3FG3A 5LC6A 1E3RA 3VSYA 1W6GA 2BMQB 4WYKA 3FLJA 2YFJB 1IU7A 2CFWA 3LT8A 1K41A 4LMIA 5AYRB 1VQ53 1PFPA 1RKYA 3WOFB 2QEX3 3WDGB 3FF0A 3OWSA 4FMDA 4J8TA 4KZ1A 3UB1A 1YJN3 1WMOA 1CQSA 4FMAA 1AV4A 1YJW3 2W2CA 4OUQA 4XBTA 1OUNA 4HM5B 1UI8A 1WNHA 3FZWA 4L8PA 4R9KA 3X3ZA 3FG1A 3I553 4RNYA 4HM0B 1A2KA 4XBXA 5AEUB 2Z76A 3DGOA 5DRVA 1O7GB 4HM8B 1VQ43 1OACA 3G8ZA 3PXMA 4R80A 3MG1A 3ROBA 1STFI 1ZX2A 1ULIB 3KIIA 1MNLA 3G0KA 4AKYA 4FCZA 1JN5A 3NV0B 1JB5A 1KSIA 1HU9A 3LXUX 3V98A 5IW9A 5AEWB 2BO9B 1W6CA 2IA7A 2OWPA 1AVLA 2IUKA 3IMAB 3EC9A 4LEHA 4N6MA 3CNMA 5AYSC 6STDA 3LTBA 1GY6A 3K5TA 1Q42A 3WA2X 1O7NB 3X42A 3WOEB 2D42A 3V92A 3ALAA 3M8CA 1OF5A 2PNCA 3MWZA 2ML6A 1NB5I 1TP6A 1LXEA 3CCR3 1DYUA 3KSPA 1SQWA 1VQL3 1VQK3 3CCQ3 3DXOA 1O7WB 2INXA 7STDA 8CHOA 1YJ93 3D3LA 1KQS2 3LTAA 5KP3A 1ROVA 1GD3A 3MPHA 2SBLA 5JBSA 2OQEC 2P0XA 3WMDA 3KKGA 3NHXA 3PCRA 4HJLB 5CLKA 3FSDA 5EVHA 5STDA 3RDEA 4WP5A 1VQP3 4KVHA 1QMAA 2B1XB 3G16A 1CYUA 2BNGA 1W7CA 3BNBA 3NBBA 1W01A 1IV9A 1VQ73 3CC43 1JV2B 2CHCA 1IT8A 3KN4A 1TU5A 5IENA 4Q53A 5JPUA 3WA3A 3LTDA 1O7HB 1YIT3 4N6LA 5CF2A 3GWRA 3WODG 3NBRA 2F99A 5BVBA 5CF1A 1EA2A 1JN5B 3F7XA 3ECFA 1OHSA 1ULJB 2HMOB 4BTWA 1ZO2A 3K0ZA 2W9PA 3NM2A 4ZM8A 3F7SA 1KC84 4KFDA 1QJGA 1C7HA 1JKGA 3Q2PA 3S29A 5IEPA 3EN8A 3CCM3 1A67A 1DVDA 3EQQB 3G6E3 1EKMA 3DGLA 4N6NB 3MSOA 3RGAA 2BMOB 2O9UX 1OF5B 1OHPA 2K0MA 3K63A 3JUMA 1QAKA 3X40A 5ELJA 2GXFA 3BB9A 1TFOA 4BTYA 5KP1A 1Q40A 3CCS3 5FW5A 3OXAA 3JUOA 1JB4A 3HK4A 4HM7B 2E2UA 2Y73A 4HM4B 2XFSA 2HMNB 3BLZA 5A0OB 1JRQA 2XH9A 1VQO3 4R9LA 2XSHB 4JF8A 1W2B2 5IG5A 3UL5A 2W04A 3AMOB 3LTCA 3PYJA 3U97A 2KCDA 4L8OA 3GAXA 3CCJ3 3J7Yd 1T5YA 4WWUC 3B7CA 1S723 3NM7A 1FUWA 3KSED 4FR9A 1W02A 3T8NA 4N6V0 3EJVA 4X2OA 1M904 1AR0A 2STDA 2IUJA 4K1UA 1UI7A 1U8CB 3NXJA 1W00A 1ASKA 4HBRA 5AIHA 3ER7A 1SIHA 4PEJA 4JRFA 3SLUA 1YHQ3 4R4KA 4MMYB 2CFKA 5D82A 4H61A 4EYCA 2CW9A 3NQYA 3UNLA 2XEPA 3OWYA 3JUNA 2XRXB 3U1WA 1JKGB 2GBWB 3EX9A 1QVF2 1K8A4 3D9RA 4CCVA 1TUHA 2Z6BA 3MG2A 5AIGA 3B4OA 2FGTA 2RFRA 2W0QA 4O8SA 2Q07A 1A2VA 4NHFA 5IERA 4BTXA 1STDA 4FMBA 1YIJ3 3GZYB 4N3VA 1FA3A 3L0RA 1Q40B 2JDIH 1KWIA 2V1LA 4H3UA 2FNQA 4IIAA 1IV7A 1V74A 3S28A 1NWWA 2E2VA 3G4S3 1K734 2CC3A 2CK3H 4FCMA 2CWVA 1E97A 3F40A 1WMNA 1M1XB 3N54B 1VQM3 3SVAA 2QGUA 3CC73 1HKXA 3LZAA 1ROAA 2R4IA 3NBJA 2MF7A 1IQXA 4O3VA 1UUWB 1N8QA 3TDGA 1GY5A 1YI23 2CFGA 2P09A 2ZDJA 5KP4A 2MC8A 3GZXB 4MMXB 1CEWI 2HMMB 1SJWA 3AMOA 5CK6A 1ISKA 1DVCA 3UL6A 1Q824 2CKFB 1IQYA 1IT7A 3DM8A 2RSXA 4AEQA 2OOVA 3O8YA 2CFDA 2BHMA 1IQ8A 4AKZA 3MYTA 4XM4A 2E2TA 2I9WA 2P0MA 3LOYA 4MEIA 1GYBA 2A15A 3EN1B 1W4NA 4MMZB 1JJ22 2B24B 3DGMA 3BNCA 1W2ZA 3CU3A 5I97A 3FCSB 4EBGA 1FGOA 3E99A 1NO3A 2XSOB 1TIJA 1TFKA 2LYXA 3Q1CA 3SEDA 4EV2A 3CC23 1R4CA 2WOFA 4NREA 2RCDA 3NUVA 1S5AA 2OCTA 3KE7A 3JUQA 4OVMA 3SXXA 2GEXA 3GRDA 3CXC2 2C11A 4MJDA 4RNZA 3CCV3 2UX0A 1RRLA 3VF1A 2HMJB 1N9JA 4L7KA 3SX1A 4EXRA 4G1MB 4HZBB 4RBNA 3F14A 4HZ9B 1FGTA 3CPOA 1F8NA 3H51A 1VQ93 1Q7Y4 2P38A 3OV4A 4U13A 2HMLB 5JPPA 1OPYA 2YFIB 3RGRA 3HI7A 1VQ63 4OK0A 2O3OA 2OTJ3 2FXTA 2WGOA 1NB3I 4X2HA 3EF8A 1OHOA 3GZBA 2CG0A 1K28A 1W5ZA 4HM2B 2GU3A 2YFLB 5BXQA 3KZTA 3X3XA 1IVUA 1LVNA 5FGOA 4HKVB 2BMRB 2OQEA 1N5HA 1YGEA 3LMLA 4GL6A 3LT9A 4TX4A 2D1WA 1M1K4 2PZVA 1LNHA 1NDOB 2KRTA 2W56A 3LH4A 3CCU3 3H3HA 2CWUA 5AIIA 4LZIA 3N8BA 3QRDA 2BT3A 1MOLA 1A90A 1D6ZA 3CNXA 4J9AA 1DMQA 5D83A 3JUPA 1OGZA 2GBXB 2W03A 3DY5A 1KD14 2GEYA 3LYGA 5EQLA 1Z1SA 4EC6A 5DREA 1FGRA 5EEOA 4KFEA 4HYZA 5HGRA 1SIIA 1EG9B 3MKIA 3F9SA 1UUVB 2OOVC 4R1KA 1SPUA 1N9EA 3K7CA 1RJOA 2L4VA 2KXGA 3G713 4XB5A 3V99A 4LGQA 2WGQA 3F8HA 2CH9A 2XFTA 3VGNA 3Q90A 1GS3A 3PZWA 4O02B 1N5PA 5D81A 2C10A 1WQLB 2QA43 2IMJA 2CWTA 3HZPA 4GB5A 2XGLA 4ORLA 3I563 4XDWA 1RRHA 1FGQA 1IVXA 1JNQA 2XR8B 3EBYA 3STDA 3GZRA 1WTHA 2XF3A 1L5GB 4K1VA 1CYVA 1NU3A 3QK9A 3CMA3 2YX9A 3PS8A 4XBYA 2CIUA 3DMCA 5IG0A 2RGQA 3FGYA 3EHCA 3UJMA 2W6JH 5AIFA 2W56B 3N9HA 1Q864 3DZLA 2OTL3 1UW1A 3HIIA 2JQ5A 5LC7A 3MHEA 2W9QA 3S27A 3OWUA 4K90B 1VQN3 2WO0A 4LSOA 3PGBA 3X3YA 1Y4KA 3OW22 3T0UA 4I4KA 4WYKB 5CXOA 5TGNA 1IK3A 5IF6A 3K9MC 1DMMA 1JB2A 1QVG2 2K54A 2Y74A 4O2HA 3FH1A 3T8UA 3A76A 4KFFA 3HX8A 2WOHA 1EQKA 1RN7A 1BUQA 2ZL8A 3NQZA 3S5CA 1E3VA 5IEOA 1FGMA 3BNEA 4FMCA 3X41A 2Z77A 2GU1A 3IPTA 2HMKB 2QIYA 3B8LA 4XDVA 1IVWA 1GY7A 1IDPA 4HVNA 1J2BA 1M9GA 4N6UA 1AVKA 3PCSA 1D6YA 3NX0A 4HM3B 2Z7AA 3CME3 1LOXA 1OGXA 3CCE3 3IJEB 3I0YA 1US1A 4N6OB 1OH0A 4RZMA 3HIGA 1O7MB 4WHAA 3JVCA 2XGNA 3S67A 1VQ83 3CCL3 3SOAA 3FF2A 4K61A 3MG3A 4WFOA 1VZZA 3NV0A 3CD63 4IPBA 3B4PA 3OX9A 1DMNA 2M7OA 1OCVA 1IVVA 3DGNA 2CG1A 3EB8A 3EBTA 1G96A 4N6TA 2P05A 3FKAA 4QWTA 1PU4A 1YVBI 4HM6B 2LQVA 5IG4A 4FCJA 1NJI4 2ML5A 3EE1A 4IT7A 1O7PB 1GD4A 4HM1B 5ELUA 1K9M4 1N8R4 3KFQC 2CFLA 4CDLA 1U5OA 2F98A 1Q814 4STDA 3FG4A 1D6UA 1QAFA 2F86B 1WMPA 3DUKA 5G2GA 5IG3A 3F8XA 1QALA 5AI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW 2;  1YHQ 3;  1VQ7 3;  1W2B 2;  1Q82 4;  3CC4 3;  3CD6 3;  3I56 3;  3CCM 3;  1KD1 4;  1VQN 3;  3G4S 3;  3CCR 3;  1K73 4;  1VQL 3;  3CXC 2;  1VQK 3;  3CCQ 3;  3G6E 3;  3CCV 3;  1QVF 2;  3OW2 2;  1YIT 3;  1VQ5 3;  1VQM 3;  3CC7 3;  3CCJ 3;  2QEX 3;  1YJ9 3;  1K8A 4;  3CME 3;  1KQS 2;  3CMA 3;  1YJN 3;  1M1K 4;  3CCE 3;  1YJW 3;  1S72 3;  1NJI 4;  1JJ2 2;  1QVG 2;  3G71 3;  1YI2 3;  1VQ9 3;  3CCU 3;  1Q7Y 4;  3CCS 3;  1K9M 4;  3I55 3;  1N8R 4;  1M90 4;  1Q81 4;  1VQP 3;  3CC2 3;  1Q86 4;  1KC8 4;  1YIJ 3;  1VQ8 3;  1VQ6 3;  2OTJ 3;  3CCL 3;  2OTL 3;  1VQO 3;  2QA4 3;  1VQ4 3; 
#chains in the Genus database with same CATH topology
 3CPW 2;  4EV5 A;  3HOH A;  3SOY A;  3BND A;  1W6Y A;  2F5W A;  3FG3 A;  5LC6 A;  1E3R A;  3VSY A;  1W6G A;  2BMQ B;  4WYK A;  3WDG B;  3FLJ A;  2YFJ B;  1IU7 A;  2CFW A;  3LT8 A;  1K41 A;  4LMI A;  5AYR B;  1VQ5 3;  1PFP A;  1RKY A;  3WOF B;  1RCK A;  2CX0 A;  2QEX 3;  3AHS A;  3FF0 A;  3OWS A;  4FMD A;  4J8T A;  1G0T A;  2RBI A;  4KZ1 A;  3UB1 A;  1WMO A;  1CQS A;  1YJN 3;  4FMA A;  1AV4 A;  1YJW 3;  2W2C A;  4OUQ A;  4XBT A;  1OUN A;  4HM5 B;  9RNT A;  1UI8 A;  1WNH A;  3FZW A;  4L8P A;  4R9K A;  3X3Z A;  1TRQ A;  3FG1 A;  3I55 3;  4RNY A;  4HM0 B;  1A2K A;  4XBX A;  5AEU B;  2Z76 A;  3DGO A;  2KAA A;  5DRV A;  1O7G B;  1BRH A;  4HM8 B;  1VQ4 3;  2H0H A;  5GSP A;  1OAC A;  3G8Z A;  3PXM A;  4R80 A;  4BU4 A;  3MG1 A;  1V58 A;  1DET A;  1STF I;  1ZX2 A;  3ROB A;  1ULI B;  1YGW A;  3KII A;  1MNL A;  3G0K A;  1GMR A;  4AKY A;  1BRI A;  1JN5 A;  3NV0 B;  1JB5 A;  4FCZ A;  8RNT A;  1C54 A;  1KSI A;  1HU9 A;  3LXU X;  3V98 A;  5IW9 A;  5AEW B;  2BO9 B;  1W6C A;  2IA7 A;  2OWP A;  1BRG A;  1AVL A;  1T2I A;  1LOY A;  2IUK A;  1I70 A;  3IMA B;  3EC9 A;  4LEH A;  4GSP A;  4N6M A;  3CNM A;  5AYS C;  5G1K A;  6STD A;  3LTB A;  1EUI C;  1GY6 A;  3K5T A;  1Q42 A;  3WA2 X;  1O7N B;  1RNB A;  1TJD A;  3X42 A;  3WOE B;  1LOV A;  1UCL A;  2D42 A;  3V92 A;  3ALA A;  3M8C A;  1OF5 A;  2PNC A;  3MWZ A;  2ML6 A;  1NB5 I;  1TP6 A;  1LXE A;  3CCR 3;  1DYU A;  3KSP A;  1SQW A;  2ZHX B;  1VQL 3;  1VQK 3;  3CCQ 3;  3DXO A;  3ZG5 A;  1BNS A;  2L1S A;  1O7W B;  2INX A;  7STD A;  1BRK A;  8CHO A;  1YJ9 3;  3D3L A;  1KQS 2;  1I0X A;  3LTA A;  5KP3 A;  1ROV A;  1GD3 A;  1G02 A;  3MPH A;  2SBL A;  5JBS A;  2OQE C;  1PY3 A;  2P0X A;  3WMD A;  3KKG A;  3NHX A;  3PCR A;  4HJL B;  5CLK A;  1MWU A;  1FYS A;  1RGL A;  2IY2 A;  3FSD A;  5EVH A;  5STD A;  6RNT A;  3RDE A;  2BIR A;  4WP5 A;  4KVH A;  1QMA A;  1CH0 A;  6GSP A;  1VQP 3;  2B1X B;  3G16 A;  3WR2 A;  1CYU A;  2BNG A;  1W7C A;  3BNB A;  3NBB A;  1ZS7 A;  1W01 A;  1B3S A;  1IV9 A;  1VQ7 3;  3CC4 3;  1JV2 B;  2CHC A;  1IT8 A;  3KN4 A;  3AHW A;  1TU5 A;  1AQZ A;  5IEN A;  4Q53 A;  5JPU A;  3WA3 A;  3LTD A;  1O7H B;  3A5E A;  4N6L A;  1YIT 3;  2IYJ A;  1JZD A;  5CF2 A;  1BVI A;  3GWR A;  3WOD G;  3NBR A;  2F99 A;  5BVB A;  4LYL B;  4J5G A;  5CF1 A;  1EA2 A;  1VQQ A;  1JN5 B;  3F7X A;  3ECF A;  1OHS A;  1ULJ B;  2HMO B;  4BTW A;  1ZO2 A;  3K0Z A;  4EW5 A;  2W9P A;  3NM2 A;  4ZM8 A;  3F7S A;  1KC8 4;  4KFD A;  1QJG A;  1Q9E A;  4BL2 A;  1C7H A;  3WHO A;  1JKG A;  7RNT A;  1JBS A;  3Q2P A;  3S29 A;  1EEJ A;  1GOY A;  5IEP A;  3EN8 A;  3CCM 3;  1BNR A;  1A67 A;  1DVD A;  1R4Y A;  3EQQ B;  1BSA A;  3G6E 3;  1EKM A;  3DGL A;  4N6N B;  3MSO A;  3RGA A;  2BMO B;  3URP A;  1BSC A;  2O9U X;  1OF5 B;  1OHP A;  2K0M A;  5BIR A;  3K63 A;  3JUM A;  1QAK A;  3X40 A;  5ELJ A;  2GXF A;  3BB9 A;  1TFO A;  4BTY A;  5KP1 A;  1Q40 A;  3CCS 3;  5FW5 A;  3OXA A;  3JUO A;  1JB4 A;  3ZG0 A;  3AGO A;  3HK4 A;  2E2U A;  2Y73 A;  4HM4 B;  4HM7 B;  1HYF A;  1RDS A;  1BGS A;  2XFS A;  2HMN B;  3BLZ A;  4NPB A;  5A0O B;  1JRQ A;  2XH9 A;  1VQO 3;  4R9L A;  1RGA A;  2XSH B;  4GHO A;  4JF8 A;  1W2B 2;  1MWT A;  5IG5 A;  3DGY A;  3UL5 A;  2W04 A;  3AMO B;  3LTC A;  3PYJ A;  3U97 A;  2KCD A;  1X1W A;  3Q3F A;  3GAX A;  4L8O A;  1X1Y A;  1T2H A;  3CCJ 3;  3J7Y d;  2J8X B;  1T5Y A;  4WWU C;  3B7C A;  1S72 3;  1BU4 A;  3NM7 A;  1FUW A;  3KSE D;  4FR9 A;  1W02 A;  2RNT A;  4N6V 0;  3T8N A;  3EJV A;  4X2O A;  1RGC A;  1M90 4;  1AR0 A;  2STD A;  1NNV A;  2IUJ A;  4K1U A;  1UI7 A;  1U8C B;  3NXJ A;  1W00 A;  1ASK A;  4HBR A;  5AIH A;  3ER7 A;  1SIH A;  4PEJ A;  4JRF A;  3SLU A;  1YHQ 3;  4R4K A;  4MMY B;  2CFK A;  5D82 A;  4H61 A;  4EYC A;  2CW9 A;  3NQY A;  3UNL A;  2XEP A;  2F4Y A;  3OWY A;  3JUN A;  2XRX B;  3U1W A;  1JKG B;  2GBW B;  3EX9 A;  2KF4 A;  1QVF 2;  1BRN L;  1K8A 4;  3D9R A;  4CCV A;  1GMQ A;  1TUH A;  2Z6B A;  3D5I A;  2ZA4 A;  1LQG C;  3MG2 A;  5AIG A;  3GSP A;  1UGH I;  3B4O A;  2FGT A;  2RFR A;  2W0Q A;  4O8S A;  1AY7 A;  2Q07 A;  5M1A A;  1A2V A;  4NHF A;  3AGN A;  1BRS A;  5IER A;  4BTX A;  1STD A;  1B21 A;  4FMB A;  1YIJ 3;  3GZY B;  4N3V A;  1FA3 A;  1X1X A;  1UDI I;  3L0R A;  1Q40 B;  2JDI H;  1KWI A;  1YNV X;  2V1L A;  2SAR A;  4H3U A;  2FNQ A;  4IIA A;  1IV7 A;  1V74 A;  3S28 A;  1NWW A;  2E2V A;  3G4S 3;  1K73 4;  2CC3 A;  2CK3 H;  4FCM A;  3F8X A;  1IYY A;  1I3F A;  1E97 A;  2CWV A;  3F40 A;  1WMN A;  1M1X B;  3N54 B;  1B2M A;  1VQM 3;  3SVA A;  2QGU A;  3CC7 3;  1HKX A;  1RGH A;  1V57 A;  3LZA A;  1ROA A;  2R4I A;  3NBJ A;  2MF7 A;  1IQX A;  4O3V A;  1UUW B;  2UUG C;  1N8Q A;  3TDG A;  1GY5 A;  1YI2 3;  2CFG A;  2P09 A;  2ZDJ A;  5KP4 A;  2MC8 A;  3GZX B;  1B2Z A;  1M1K 4;  4MMX B;  1CEW I;  2HMM B;  1SJW A;  3AMO A;  5CK6 A;  1ISK A;  1MGR A;  1DVC A;  3UL6 A;  1Q82 4;  2CKF B;  1IQY A;  1I2E A;  1T3B A;  1IT7 A;  3DM8 A;  1RGE A;  1RN4 A;  2RSX A;  4AEQ A;  2OOV A;  3O8Y A;  2CFD A;  2BHM A;  1IQ8 A;  4ILF A;  3MYT A;  1PYL A;  2E2T A;  1BNF A;  4XM4 A;  1RGF A;  2I9W A;  4AKZ A;  2P0M A;  3LOY A;  4MEI A;  1GYB A;  2A15 A;  3EN1 B;  1W4N A;  3SYU A;  4MMZ B;  1JJ2 2;  2B24 B;  3DGM A;  3BNC A;  1W2Z A;  3CU3 A;  5I97 A;  3FCS B;  4EBG A;  1FGO A;  3E99 A;  1NO3 A;  2XSO B;  1TIJ A;  1TFK A;  2LYX A;  3Q1C A;  3SED A;  1UCK A;  4EV2 A;  1R4C A;  3CC2 3;  2WOF A;  1RLS A;  4NRE A;  2RCD A;  1B2S A;  3NUV A;  1S5A A;  2OCT A;  3KE7 A;  3JUQ A;  4OVM A;  7GSP A;  3SXX A;  2GEX A;  3D4A A;  3GRD A;  3CXC 2;  2C11 A;  4MJD A;  4RNZ A;  3CCV 3;  3BIR A;  2UX0 A;  4I5Q A;  1RRL A;  3VF1 A;  2HMJ B;  1N9J A;  4L7K A;  3SX1 A;  4EXR A;  4G1M B;  4HZB B;  4RBN A;  3F14 A;  4HZ9 B;  1FGT A;  3CPO A;  1F8N A;  1BNI A;  2C4B A;  1DE3 A;  1JBT A;  3H51 A;  1BSE A;  1VQ9 3;  1Q7Y 4;  2P38 A;  3OV4 A;  4U13 A;  2HML B;  5JPP A;  1OPY A;  2YFI B;  3RGR A;  3HI7 A;  1VQ6 3;  4OK0 A;  2O3O A;  2OTJ 3;  2FXT A;  2WGO A;  1NB3 I;  4X2H A;  5BU4 A;  3EF8 A;  1OHO A;  3GZB A;  2CG0 A;  1K28 A;  1I2G A;  1LRA A;  1W5Z A;  2KF3 A;  2GU3 A;  4HM2 B;  1BSB A;  2YFL B;  5BXQ A;  3KZT A;  3X3X A;  1IVU A;  1LVN A;  5FGO A;  4HKV B;  1BSD A;  2BMR B;  1BAN A;  2OQE A;  1N5H A;  1YGE A;  3LML A;  1RGG A;  2KF6 A;  3KCH A;  3LT9 A;  4GL6 A;  2D1W A;  4TX4 A;  1BRJ A;  1LNH A;  1NDO B;  2KRT A;  2PZV A;  2W56 A;  5M18 A;  1BNG A;  1Q7H A;  3LH4 A;  1FUS A;  3CCU 3;  3H3H A;  2CWU A;  5AII A;  4BIR A;  4RNT A;  4LZI A;  3N8B A;  3QRD A;  4CPK A;  2BT3 A;  1MOL A;  1A90 A;  1D6Z A;  3CNX A;  4J9A A;  1DMQ A;  5D83 A;  3JUP A;  1OGZ A;  2GBX B;  2W03 A;  3DY5 A;  3ZFZ A;  1KD1 4;  2GEY A;  3LYG A;  5EQL A;  1Z1S A;  4EC6 A;  1UCJ A;  1FGR A;  1MWR A;  5DRE A;  5EEO A;  3DH2 A;  4KFE A;  4HYZ A;  2UGI A;  1SII A;  5HGR A;  1EG9 B;  3MKI A;  1BNJ A;  3F9S A;  1UUV B;  2OOV C;  4R1K A;  1GSP A;  1SPU A;  1B20 A;  1N9E A;  1RJO A;  3K7C A;  2HOH A;  2L4V A;  2KXG A;  3G71 3;  3D5G A;  4XB5 A;  2AAE A;  1BIR A;  4LGQ A;  2WGQ A;  3V99 A;  2H0I A;  3F8H A;  2CH9 A;  4DKI A;  1I3I A;  2XFT A;  1A2P A;  3VGN A;  1LOW A;  3Q90 A;  1GS3 A;  2F5M A;  3PZW A;  1N5P A;  1FZU A;  4O02 B;  5D81 A;  1WQL B;  2C10 A;  4HAA A;  2QA4 3;  2IMJ A;  4BL3 A;  2CWT A;  3HZP A;  4GB5 A;  1MGW A;  2XGL A;  4ORL A;  3I56 3;  4XDW A;  1RRH A;  1FGQ A;  1IVX A;  1JNQ A;  1BUJ A;  2XR8 B;  3EBY A;  3STD A;  3GZR A;  1WTH A;  2XF3 A;  1L5G B;  4K1V A;  1CYV A;  1RCL A;  1RNT A;  3RNT A;  1NU3 A;  3QK9 A;  1LQM B;  2YX9 A;  3CMA 3;  3PS8 A;  2CX1 A;  4XBY A;  2CIU A;  3DMC A;  1UCI A;  1ZGX A;  1BAO A;  5IG0 A;  5M19 A;  2RGQ A;  3FGY A;  3EHC A;  3UJM A;  2W6J H;  1I0V A;  5AIF A;  2W56 B;  3N9H A;  1Q86 4;  1TRP A;  3DZL A;  1RHL A;  5G1L A;  2OTL 3;  1UW1 A;  3HII A;  2JQ5 A;  5LC7 A;  3MHE A;  2W9Q A;  3S27 A;  3OWU A;  4K90 B;  4HOH A;  1VQN 3;  1SAR A;  2WO0 A;  4LSO A;  3PGB A;  3X3Y A;  1Y4K A;  3OW2 2;  3T0U A;  4I4K A;  4WYK B;  5CXO A;  5TGN A;  1IK3 A;  5IF6 A;  4CJN A;  1UGI A;  3K9M C;  1DMM A;  1JB2 A;  1QVG 2;  1JBR A;  2K54 A;  2Y74 A;  1FUT A;  2R41 A;  4O2H A;  3FH1 A;  3T8U A;  1BOX A;  3A76 A;  1JZO A;  3HX8 A;  2WOH A;  4KFF A;  1MWS A;  1EQK A;  1TTO A;  1RN7 A;  1GOV A;  1RMS A;  1BUQ A;  2ZL8 A;  3NQZ A;  3S5C A;  2H0G A;  1E3V A;  5IEO A;  1FGM A;  3BNE A;  4FMC A;  3X41 A;  2Z77 A;  2GU1 A;  3IPT A;  2HMK B;  2KF5 A;  2QIY A;  3B8L A;  4XDV A;  1IVW A;  1GY7 A;  1IDP A;  4HVN A;  1J2B A;  1M9G A;  4N6U A;  1AVK A;  3PCS A;  1D6Y A;  3NX0 A;  2F56 A;  4HM3 B;  2Z7A A;  3CME 3;  1LOX A;  1OGX A;  3CCE 3;  3IJE B;  3BU4 A;  1I8V A;  1I2F A;  1US1 A;  3I0Y A;  4N6O B;  1OH0 A;  4RZM A;  3HIG A;  1O7M B;  4WHA A;  5RNT A;  3JVC A;  1YVS A;  2XGN A;  3S67 A;  1VQ8 3;  3CCL 3;  3SOA A;  3FF2 A;  4K61 A;  2AAD A;  3MG3 A;  4WFO A;  1VZZ A;  3NV0 A;  1RSN A;  3CD6 3;  4IPB A;  2BU4 A;  3B4P A;  3OX9 A;  1DMN A;  5HOH A;  1LNI A;  2M7O A;  1OCV A;  1HZ1 A;  1IVV A;  4J5K A;  3DGN A;  2CG1 A;  3EB8 A;  1GMP A;  1RGK A;  1UUG B;  3EBT A;  1G96 A;  1GOU A;  2K3D A;  4N6T A;  1FW7 A;  2P05 A;  3FKA A;  4QWT A;  1PU4 A;  1YVB I;  4HM6 B;  2LQV A;  1BNE A;  1B2X A;  4FCJ A;  5IG4 A;  1NJI 4;  2ML5 A;  3EE1 A;  4IT7 A;  1RN1 A;  1O7P B;  1GD4 A;  4HM1 B;  5ELU A;  1K9M 4;  1N8R 4;  1B2U A;  3KFQ C;  2CFL A;  4CDL A;  2GSP A;  1U5O A;  1RTU A;  2F98 A;  4STD A;  3FG4 A;  1X1U A;  1Q81 4;  3D79 A;  1D6U A;  1QAF A;  2F86 B;  1WMP A;  3DUK A;  4KT3 B;  5G2G A;  5IG3 A;  1B27 A;  1QAL A;  5AI1 A; 
#chains in the Genus database with same CATH homology
 3CPW 2;  4EV5 A;  3SOY A;  3BND A;  1W6Y A;  3FG3 A;  5LC6 A;  1E3R A;  3VSY A;  1W6G A;  2BMQ B;  4WYK A;  3FLJ A;  2YFJ B;  1IU7 A;  2CFW A;  3LT8 A;  1K41 A;  4LMI A;  5AYR B;  1VQ5 3;  1PFP A;  1RKY A;  3WOF B;  2QEX 3;  3WDG B;  3FF0 A;  3OWS A;  4FMD A;  4J8T A;  4KZ1 A;  3UB1 A;  1YJN 3;  1WMO A;  1CQS A;  4FMA A;  1AV4 A;  1YJW 3;  2W2C A;  4OUQ A;  4XBT A;  1OUN A;  4HM5 B;  1UI8 A;  1WNH A;  3FZW A;  4L8P A;  4R9K A;  3X3Z A;  3FG1 A;  3I55 3;  4RNY A;  4HM0 B;  1A2K A;  4XBX A;  5AEU B;  2Z76 A;  3DGO A;  5DRV A;  1O7G B;  4HM8 B;  1VQ4 3;  1OAC A;  3G8Z A;  3PXM A;  4R80 A;  3MG1 A;  3ROB A;  1STF I;  1ZX2 A;  1ULI B;  3KII A;  1MNL A;  3G0K A;  4AKY A;  4FCZ A;  1JN5 A;  3NV0 B;  1JB5 A;  1KSI A;  1HU9 A;  3LXU X;  3V98 A;  5IW9 A;  5AEW B;  2BO9 B;  1W6C A;  2IA7 A;  2OWP A;  1AVL A;  2IUK A;  3IMA B;  3EC9 A;  4LEH A;  4N6M A;  3CNM A;  5AYS C;  6STD A;  3LTB A;  1GY6 A;  3K5T A;  1Q42 A;  3WA2 X;  1O7N B;  3X42 A;  3WOE B;  2D42 A;  3V92 A;  3ALA A;  3M8C A;  1OF5 A;  2PNC A;  3MWZ A;  2ML6 A;  1NB5 I;  1TP6 A;  1LXE A;  3CCR 3;  1DYU A;  3KSP A;  1SQW A;  1VQL 3;  1VQK 3;  3CCQ 3;  3DXO A;  1O7W B;  2INX A;  7STD A;  8CHO A;  1YJ9 3;  3D3L A;  1KQS 2;  3LTA A;  5KP3 A;  1ROV A;  1GD3 A;  3MPH A;  2SBL A;  5JBS A;  2OQE C;  2P0X A;  3WMD A;  3KKG A;  3NHX A;  3PCR A;  4HJL B;  5CLK A;  3FSD A;  5EVH A;  5STD A;  3RDE A;  4WP5 A;  1VQP 3;  4KVH A;  1QMA A;  2B1X B;  3G16 A;  1CYU A;  2BNG A;  1W7C A;  3BNB A;  3NBB A;  1W01 A;  1IV9 A;  1VQ7 3;  3CC4 3;  1JV2 B;  2CHC A;  1IT8 A;  3KN4 A;  1TU5 A;  5IEN A;  4Q53 A;  5JPU A;  3WA3 A;  3LTD A;  1O7H B;  1YIT 3;  4N6L A;  5CF2 A;  3GWR A;  3WOD G;  3NBR A;  2F99 A;  5BVB A;  5CF1 A;  1EA2 A;  1JN5 B;  3F7X A;  3ECF A;  1OHS A;  1ULJ B;  2HMO B;  4BTW A;  1ZO2 A;  3K0Z A;  2W9P A;  3NM2 A;  4ZM8 A;  3F7S A;  1KC8 4;  4KFD A;  1QJG A;  1C7H A;  1JKG A;  3Q2P A;  3S29 A;  5IEP A;  3EN8 A;  3CCM 3;  1A67 A;  1DVD A;  3EQQ B;  3G6E 3;  1EKM A;  3DGL A;  4N6N B;  3MSO A;  3RGA A;  2BMO B;  2O9U X;  1OF5 B;  1OHP A;  2K0M A;  3K63 A;  3JUM A;  1QAK A;  3X40 A;  5ELJ A;  2GXF A;  3BB9 A;  1TFO A;  4BTY A;  5KP1 A;  1Q40 A;  3CCS 3;  5FW5 A;  3OXA A;  3JUO A;  1JB4 A;  3HK4 A;  4HM7 B;  2E2U A;  2Y73 A;  4HM4 B;  2XFS A;  2HMN B;  3BLZ A;  5A0O B;  1JRQ A;  2XH9 A;  1VQO 3;  4R9L A;  2XSH B;  4JF8 A;  1W2B 2;  5IG5 A;  3UL5 A;  2W04 A;  3AMO B;  3LTC A;  3PYJ A;  3U97 A;  2KCD A;  4L8O A;  3GAX A;  3CCJ 3;  3J7Y d;  1T5Y A;  4WWU C;  3B7C A;  1S72 3;  3NM7 A;  1FUW A;  3KSE D;  4FR9 A;  1W02 A;  3T8N A;  4N6V 0;  3EJV A;  4X2O A;  1M90 4;  1AR0 A;  2STD A;  2IUJ A;  4K1U A;  1UI7 A;  1U8C B;  3NXJ A;  1W00 A;  1ASK A;  4HBR A;  5AIH A;  3ER7 A;  1SIH A;  4PEJ A;  4JRF A;  3SLU A;  1YHQ 3;  4R4K A;  4MMY B;  2CFK A;  5D82 A;  4H61 A;  4EYC A;  2CW9 A;  3NQY A;  3UNL A;  2XEP A;  3OWY A;  3JUN A;  2XRX B;  3U1W A;  1JKG B;  2GBW B;  3EX9 A;  1QVF 2;  1K8A 4;  3D9R A;  4CCV A;  1TUH A;  2Z6B A;  3MG2 A;  5AIG A;  3B4O A;  2FGT A;  2RFR A;  2W0Q A;  4O8S A;  2Q07 A;  1A2V A;  4NHF A;  5IER A;  4BTX A;  1STD A;  4FMB A;  1YIJ 3;  3GZY B;  4N3V A;  1FA3 A;  3L0R A;  1Q40 B;  2JDI H;  1KWI A;  2V1L A;  4H3U A;  2FNQ A;  4IIA A;  1IV7 A;  1V74 A;  3S28 A;  1NWW A;  2E2V A;  3G4S 3;  1K73 4;  2CC3 A;  2CK3 H;  4FCM A;  2CWV A;  1E97 A;  3F40 A;  1WMN A;  1M1X B;  3N54 B;  1VQM 3;  3SVA A;  2QGU A;  3CC7 3;  1HKX A;  3LZA A;  1ROA A;  2R4I A;  3NBJ A;  2MF7 A;  1IQX A;  4O3V A;  1UUW B;  1N8Q A;  3TDG A;  1GY5 A;  1YI2 3;  2CFG A;  2P09 A;  2ZDJ A;  5KP4 A;  2MC8 A;  3GZX B;  4MMX B;  1CEW I;  2HMM B;  1SJW A;  3AMO A;  5CK6 A;  1ISK A;  1DVC A;  3UL6 A;  1Q82 4;  2CKF B;  1IQY A;  1IT7 A;  3DM8 A;  2RSX A;  4AEQ A;  2OOV A;  3O8Y A;  2CFD A;  2BHM A;  1IQ8 A;  4AKZ A;  3MYT A;  4XM4 A;  2E2T A;  2I9W A;  2P0M A;  3LOY A;  4MEI A;  1GYB A;  2A15 A;  3EN1 B;  1W4N A;  4MMZ B;  1JJ2 2;  2B24 B;  3DGM A;  3BNC A;  1W2Z A;  3CU3 A;  5I97 A;  3FCS B;  4EBG A;  1FGO A;  3E99 A;  1NO3 A;  2XSO B;  1TIJ A;  1TFK A;  2LYX A;  3Q1C A;  3SED A;  4EV2 A;  3CC2 3;  1R4C A;  2WOF A;  4NRE A;  2RCD A;  3NUV A;  1S5A A;  2OCT A;  3KE7 A;  3JUQ A;  4OVM A;  3SXX A;  2GEX A;  3GRD A;  3CXC 2;  2C11 A;  4MJD A;  4RNZ A;  3CCV 3;  2UX0 A;  1RRL A;  3VF1 A;  2HMJ B;  1N9J A;  4L7K A;  3SX1 A;  4EXR A;  4G1M B;  4HZB B;  4RBN A;  3F14 A;  4HZ9 B;  1FGT A;  3CPO A;  1F8N A;  3H51 A;  1VQ9 3;  1Q7Y 4;  2P38 A;  3OV4 A;  4U13 A;  2HML B;  5JPP A;  1OPY A;  2YFI B;  3RGR A;  3HI7 A;  1VQ6 3;  4OK0 A;  2O3O A;  2OTJ 3;  2FXT A;  2WGO A;  1NB3 I;  4X2H A;  3EF8 A;  1OHO A;  3GZB A;  2CG0 A;  1K28 A;  1W5Z A;  4HM2 B;  2GU3 A;  2YFL B;  5BXQ A;  3KZT A;  3X3X A;  1IVU A;  1LVN A;  5FGO A;  4HKV B;  2BMR B;  2OQE A;  1N5H A;  1YGE A;  3LML A;  4GL6 A;  3LT9 A;  4TX4 A;  2D1W A;  1M1K 4;  2PZV A;  1LNH A;  1NDO B;  2KRT A;  2W56 A;  3LH4 A;  3CCU 3;  3H3H A;  2CWU A;  5AII A;  4LZI A;  3N8B A;  3QRD A;  2BT3 A;  1MOL A;  1A90 A;  1D6Z A;  3CNX A;  4J9A A;  1DMQ A;  5D83 A;  3JUP A;  1OGZ A;  2GBX B;  2W03 A;  3DY5 A;  1KD1 4;  2GEY A;  3LYG A;  5EQL A;  1Z1S A;  4EC6 A;  5DRE A;  1FGR A;  5EEO A;  4KFE A;  4HYZ A;  5HGR A;  1SII A;  1EG9 B;  3MKI A;  3F9S A;  1UUV B;  2OOV C;  4R1K A;  1SPU A;  1N9E A;  3K7C A;  1RJO A;  2L4V A;  2KXG A;  3G71 3;  4XB5 A;  3V99 A;  4LGQ A;  2WGQ A;  3F8H A;  2CH9 A;  2XFT A;  3VGN A;  3Q90 A;  1GS3 A;  3PZW A;  4O02 B;  1N5P A;  5D81 A;  2C10 A;  1WQL B;  2QA4 3;  2IMJ A;  2CWT A;  3HZP A;  4GB5 A;  2XGL A;  4ORL A;  3I56 3;  4XDW A;  1RRH A;  1FGQ A;  1IVX A;  1JNQ A;  2XR8 B;  3EBY A;  3STD A;  3GZR A;  1WTH A;  2XF3 A;  1L5G B;  4K1V A;  1CYV A;  1NU3 A;  3QK9 A;  3CMA 3;  2YX9 A;  3PS8 A;  4XBY A;  2CIU A;  3DMC A;  5IG0 A;  2RGQ A;  3FGY A;  3EHC A;  3UJM A;  2W6J H;  5AIF A;  2W56 B;  3N9H A;  1Q86 4;  3DZL A;  2OTL 3;  1UW1 A;  3HII A;  2JQ5 A;  5LC7 A;  3MHE A;  2W9Q A;  3S27 A;  3OWU A;  4K90 B;  1VQN 3;  2WO0 A;  4LSO A;  3PGB A;  3X3Y A;  1Y4K A;  3OW2 2;  3T0U A;  4I4K A;  4WYK B;  5CXO A;  5TGN A;  1IK3 A;  5IF6 A;  3K9M C;  1DMM A;  1JB2 A;  1QVG 2;  2K54 A;  2Y74 A;  4O2H A;  3FH1 A;  3T8U A;  3A76 A;  4KFF A;  3HX8 A;  2WOH A;  1EQK A;  1RN7 A;  1BUQ A;  2ZL8 A;  3NQZ A;  3S5C A;  1E3V A;  5IEO A;  1FGM A;  3BNE A;  4FMC A;  3X41 A;  2Z77 A;  2GU1 A;  3IPT A;  2HMK B;  2QIY A;  3B8L A;  4XDV A;  1IVW A;  1GY7 A;  1IDP A;  4HVN A;  1J2B A;  1M9G A;  4N6U A;  1AVK A;  3PCS A;  1D6Y A;  3NX0 A;  4HM3 B;  2Z7A A;  3CME 3;  1LOX A;  1OGX A;  3CCE 3;  3IJE B;  3I0Y A;  1US1 A;  4N6O B;  1OH0 A;  4RZM A;  3HIG A;  1O7M B;  4WHA A;  3JVC A;  2XGN A;  3S67 A;  1VQ8 3;  3CCL 3;  3SOA A;  3FF2 A;  4K61 A;  3MG3 A;  4WFO A;  1VZZ A;  3NV0 A;  3CD6 3;  4IPB A;  3B4P A;  3OX9 A;  1DMN A;  2M7O A;  1OCV A;  1IVV A;  3DGN A;  2CG1 A;  3EB8 A;  3EBT A;  1G96 A;  4N6T A;  2P05 A;  3FKA A;  4QWT A;  1PU4 A;  1YVB I;  4HM6 B;  2LQV A;  5IG4 A;  4FCJ A;  1NJI 4;  2ML5 A;  3EE1 A;  4IT7 A;  1O7P B;  1GD4 A;  4HM1 B;  5ELU A;  1K9M 4;  1N8R 4;  3KFQ C;  2CFL A;  4CDL A;  1U5O A;  2F98 A;  1Q81 4;  4STD A;  3FG4 A;  1D6U A;  1QAF A;  2F86 B;  1WMP A;  3DUK A;  5G2G A;  5IG3 A;  3F8X A;  1QAL A;  5AI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...