3CD63

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cd6300
1VQ63 1YIT3 1K8A4 1Q814 1YJW3 1VQM3 1N8R4 1KQS2 2OTJ3 1M904 1VQ53 3CCJ3 1QVF2 3CC73 3CCV3 3OW22 1Q824 3G4S3 3CCL3 3I563 1VQK3 3G6E3 1Q7Y4 1Q864 3CCU3 1K9M4 3CPW2 3CCS3 1QVG2 1K734 1KD14 1W2B2 1JJ22 1VQO3 1VQ73 1YIJ3 1YHQ3 1M1K4 1VQN3 2QA43 1S723 1YI23 3CCE3 1YJ93 3I553 1VQ43 3CXC2 3CC23 1VQL3 1YJN3 3CME3 3CC43 1NJI4 1VQ83 1VQP3 3G713 3CCM3 1KC84 1VQ93 3CMA3 3CD63 3CCR3 2OTL3 2QEX3 3CCQ3
chains in the Genus database with same CATH superfamily
1T3BA 3H3HA 3MWZA 1IVWA 1K8A4 1L5GB 1ROAA 1RHLA 2IYJA 4AKZA 1O7HB 3K0ZA 1CH0A 4EW5A 1ROVA 3V92A 1N8R4 1QJGA 1PY3A 4RZMA 1WNHA 3BNCA 1OHSA 2KF4A 1BRGA 1O7MB 3NV0B 1K28A 3ZG0A 4KFFA 5BVBA 2CC3A 1U5OA 1I0VA 1D6UA 1E3VA 1SIIA 2P38A 2WOFA 1ZX2A 1I0XA 4LEHA 1YI23 1ISKA 1TRPA 3G16A 4EYCA 3LYGA 4LYLB 1DMQA 3EBYA 1VQL3 1YVSA 1A67A 1NNVA 2XSOB 1BGSA 1B21A 2HOHA 1VQ93 3CMA3 3OX9A 2RCDA 4HM4B 1GOYA 4STDA 1EA2A 4LGQA 1RN7A 4LSOA 4FCJA 2INXA 4FMAA 1N5PA 2GEXA 4GSPA 3WA2X 1MWSA 1Q9EA 2V1LA 5CK6A 5D81A 4L8PA 1BOXA 1RDSA 4J5GA 1CQSA 4WHAA 2I9WA 3LOYA 1FW7A 4R9KA 3N8BA 2Z7AA 3FH1A 3G6E3 3AGOA 3K63A 3SEDA 1PFPA 1SQWA 2F99A 5STDA 1BVIA 1JJ22 1O7WB 4IT7A 4CJNA 1BUQA 4J5KA 5GSPA 3MYTA 2CFGA 4X2OA 5IEOA 1Q40A 4HM2B 3E99A 3ER7A 2ML5A 4HM1B 2P0XA 1BNEA 3D4AA 1VQ83 3PYJA 2OQEA 3BIRA 1B2ZA 3DUKA 2KF6A 2GBWB 4O2HA 1GD4A 2CH9A 2D1WA 4CCVA 1FA3A 1R4CA 4J9AA 1GY6A 2CW9A 1IQ8A 1UCJA 4R80A 2E2UA 1N9JA 1ZGXA 3LXUX 5M18A 3CPOA 1VQ53 1IV9A 1MGWA 2BMRB 1W01A 1BU4A 3GSPA 4AKYA 3Q3FA 4O02B 4HM5B 1RN4A 3V98A 1I2GA 2HMJB 4XDWA 5AEUB 3LTAA 1GS3A 4TX4A 1IQYA 3ZFZA 1IYYA 3ROBA 5AIFA 4OUQA 2KAAA 2GXFA 1MOLA 2CWTA 1K41A 3BNEA 4NPBA 1AR0A 2AADA 2B24B 4L7KA 3X42A 1BNRA 3G713 3PS8A 3MPHA 3HIIA 2RNTA 3B4PA 3HI7A 4H61A 1RMSA 1IVUA 1VQM3 1LXEA 5LC6A 2FXTA 1UCLA 1AVKA 1RJOA 3RNTA 1LOWA 1FZUA 1RNTA 1BRIA 1V58A 1I70A 4RBNA 5CLKA 3T0UA 1EG9B 2KCDA 2H0GA 2XRXB 3EF8A 3KCHA 1TTOA 1K734 5A0OB 5ELUA 1VQO3 2WGQA 2CK3H 3D5GA 1BSEA 5EVHA 1JZDA 3X41A 3JUNA 1OF5B 1OUNA 1JN5A 1BIRA 1W02A 3CNMA 3EN1B 4KT3B 4MJDA 3VGNA 3I553 4NHFA 2D42A 4N6LA 5KP1A 5LC7A 2IUJA 2XFTA 2R4IA 2C11A 3MG3A 2JQ5A 2WGOA 2JDIH 3KKGA 1J2BA 3CD63 2KRTA 3CCQ3 3EE1A 7STDA 1FUTA 1N8QA 4WYKB 2PZVA 3CU3A 3NHXA 3B7CA 1TRQA 3M8CA 3OWSA 5I97A 1LOVA 2Z6BA 3DY5A 3WMDA 1B20A 1F8NA 1VQQA 1RGAA 2Y74A 3NUVA 3URPA 3CCL3 1LRAA 2O9UX 1S5AA 2OQEC 2QGUA 3LTDA 3F7SA 4EV2A 1K9M4 1W4NA 2P0MA 1TIJA 2HMLB 1X1UA 2CIUA 3F14A 4FMCA 1IU7A 4BL3A 2J8XB 1U8CB 1X1XA 3IMAB 1GY5A 6STDA 1N5HA 4OK0A 1IV7A 2GSPA 1A90A 1FGQA 1W00A 2QEX3 1W6YA 1I3FA 1OCVA 1DVDA 2RBIA 2XGLA 3NQZA 3OWYA 1GOUA 3PXMA 4H3UA 2YFLB 1Q814 4HM0B 3X3YA 1UDII 4K1VA 4N6NB 1SIHA 1EKMA 4J8TA 3SYUA 3CCJ3 2CFKA 2CKFB 3GRDA 3CC73 3SXXA 3CCV3 1RGHA 2O3OA 1R4YA 1BSDA 2HMNB 4R9LA 1AVLA 4RNZA 4EXRA 1QVG2 3PZWA 1RCLA 1RGLA 2OCTA 2PNCA 1JBSA 1RRLA 1RKYA 3FG4A 5AYRB 4WYKA 1YJN3 3CME3 3CC43 2W2CA 3FLJA 2ZHXB 1DETA 4I4KA 4ILFA 1I2EA 1UCIA 1OPYA 1Q40B 3LT8A 1YGEA 2WO0A 2GEYA 4KFDA 1YIT3 4NREA 4WFOA 2E2VA 4IIAA 3OV4A 3OXAA 1CEWI 1B2XA 3IJEB 3DGLA 3D5IA 4HZBB 3FKAA 4EV5A 1Q864 1EUIC 1ZO2A 3AMOB 3DM8A 1VQN3 2R41A 4N6OB 1YJ93 4N3VA 3NBRA 1LQGC 3F8XA 1NJI4 4BTWA 5CF2A 1B2UA 1LOXA 3PCRA 1TUHA 1BNJA 4FR9A 4ORLA 3CCR3 1BUJA 1IT7A 2Q07A 8RNTA 2CFWA 3N54B 1BNGA 1FYSA 8CHOA 2MF7A 4LZIA 3SOAA 2BO9B 2K0MA 5HGRA 4R1KA 1YGWA 2BMOB 3KSED 1EQKA 1E97A 2SBLA 3WR2A 1RGCA 5EQLA 1UCKA 2STDA 2W04A 3I0YA 1ULIB 4K1UA 4N6V0 4XDVA 3I563 1RN1A 1I3IA 5IG5A 1W2B2 1IDPA 1VQ73 3EBTA 4HAAA 1A2VA 2L1SA 3FSDA 3OWUA 4RNYA 3LH4A 3S5CA 2FNQA 2UUGC 2ML6A 6GSPA 1HYFA 1RLSA 3F9SA 2GU3A 4OVMA 3T8NA 5ELJA 2UGIA 1T2HA 3D9RA 2SARA 4KVHA 1YNVX 2RFRA 1VZZA 3BNDA 4HM8B 2H0HA 1UW1A 4R4KA 1BRSA 1W5ZA 3F7XA 1AY7A 1IVXA 3NXJA 2Z77A 4U13A 1RCKA 1B27A 1RGGA 1WMPA 2AAEA 1A2PA 2W9PA 4GHOA 3AMOA 1X1WA 1OH0A 1JB5A 5TGNA 3J7Yd 3IPTA 4JRFA 1JNQA 4HJLB 1Q824 3MHEA 1WQLB 1RGKA 1Q7Y4 1JKGA 3N9HA 1IQXA 2CFLA 4LMIA 1LQMB 1S723 1HZ1A 4HVNA 5IG0A 4MMZB 5BU4A 2W9QA 1NDOB 3A5EA 3Q2PA 5KP4A 3AHSA 3BB9A 3HX8A 1HKXA 1TP6A 2XFSA 3MG1A 4G1MB 1WMNA 3CC23 1NB3I 3UB1A 3FG1A 1T2IA 2Y73A 3PGBA 3FCSB 4MMYB 4FCZA 5AIHA 1B3SA 1STFI 3FZWA 2BT3A 1O7PB 2ZDJA 1UI7A 3QK9A 3LTCA 4HBRA 1MNLA 2XH9A 1MWTA 4WP5A 2H0IA 5FW5A 1QAKA 2QIYA 1RGEA 1O7GB 3GZBA 3JVCA 1NU3A 2M7OA 1BRKA 4HYZA 4KFEA 1Z1SA 3UNLA 3KIIA 1W7CA 2BIRA 3SOYA 3GZRA 1ULJB 3JUOA 1BNSA 1LNHA 1PU4A 2W0QA 3CCS3 1FGTA 1M1XB 2BU4A 1JBRA 1M1K4 5AI1A 3V99A 3WOEB 2QA43 4XBXA 3NM7A 3RGRA 5FGOA 2F4YA 3ZG5A 2F5WA 2YFJB 1ZS7A 1RTUA 1RRHA 2HMMB 5CXOA 4FMBA 2RGQA 3T8UA 3JUMA 3X3ZA 1GMPA 5BXQA 4HKVB 3NBBA 1Y4KA 3DGNA 1JN5B 4HM3B 4CPKA 2W03A 4KZ1A 1CYVA 1E3RA 1V57A 3L0RA 2CG1A 4BU4A 2ZL8A 3HZPA 1BSBA 1JB2A 3LTBA 3DH2A 4GL6A 4XM4A 2XF3A 3S27A 1KQS2 3FGYA 1JKGB 1BAOA 3GAXA 2C10A 1AV4A 1I2FA 4BTXA 3UL5A 3JUQA 1NO3A 2CG0A 2BMQB 2XR8B 3S29A 3H51A 1N9EA 5D82A 1GOVA 3QRDA 5D83A 3UJMA 2IA7A 1D6ZA 4MEIA 3DGYA 4O8SA 2WOHA 1JBTA 2A15A 5IENA 1QMAA 1OGXA 2UX0A 4JF8A 2F56A 5DRVA 1SARA 3MSOA 1M9GA 3BLZA 1GSPA 2MC8A 1US1A 4AEQA 1DYUA 1I8VA 3U97A 1YVBI 4IPBA 1QALA 3WDGB 3RDEA 3LT9A 5IF6A 3G4S3 1IVVA 3VSYA 4BIRA 4EBGA 2KF3A 5EEOA 5M1AA 2OOVA 3LMLA 1FUSA 3K5TA 3D79A 3MKIA 1BNFA 3RGAA 3S67A 4K90B 1C54A 3LZAA 3KZTA 3KSPA 3SVAA 3SX1A 1VQ43 3CXC2 3SLUA 3O8YA 4HOHA 3NX0A 4Q53A 5AYSC 4FCMA 1BSCA 1DE3A 1NB5I 1GD3A 3HOHA 3S28A 3B4OA 2W6JH 1B2SA 1BANA 1RGFA 1SPUA 2F5MA 3AGNA 4QWTA 2IUKA 4O3VA 1KC84 1UGHI 2F98A 4XB5A 3U1WA 3EJVA 3KFQC 5JPPA 1M904 1QVF2 7GSPA 3OW22 3X40A 4DKIA 2BHMA 4HM7B 3G0KA 1GY7A 4MMXB 5G1KA 4WWUC 1SJWA 3TDGA 3NM2A 1KD14 3DGOA 3F8HA 3ECFA 1BSAA 4X2HA 2CX1A 5IERA 1IK3A 5IEPA 3Q1CA 4HZ9B 1CYUA 3D3LA 4HM6B 3KE7A 1B2MA 3BU4A 4I5QA 3FF2A 2K54A 2W56A 5M19A 1BRNL 3STDA 3NBJA 1VQP3 3CCM3 1HU9A 1LNIA 1OHOA 3K9MC 5AIGA 2OTL3 4L8OA 3K7CA 3FF0A 1UUGB 1TU5A 1JZOA 1X1YA 1UI8A 1GMRA 3NQYA 2OOVC 1IT8A 2CWUA 3CNXA 1MGRA 1OACA 3DZLA 3PCSA 2K3DA 5JBSA 1VQK3 1GYBA 3CCU3 2B1XB 5KP3A 1MWUA 1UGIA 3NV0A 2P09A 1FGRA 4GB5A 3FG3A 4PEJA 3B8LA 5IW9A 1W2ZA 3EHCA 1WTHA 1W6CA 4BTYA 4EC6A 2RSXA 5BIRA 3EX9A 1FGOA 3UL6A 9RNTA 5IG3A 7RNTA 1V74A 3BNBA 3G8ZA 3GZXB 5AIIA 1JB4A 1ASKA 1FGMA 2IMJA 5JPUA 1NWWA 4N6MA 1JRQA 2XSHB 1VQ63 1OF5A 1MWRA 2YFIB 3EB8A 3WA3A 4XBYA 1TJDA 3HIGA 1YJW3 3EQQB 1T5YA 2ZA4A 2FGTA 2F86B 2OWPA 2E2TA 3JUPA 1W6GA 3Q90A 3EC9A 5IG4A 2HMKB 1EEJA 4K61A 2L4VA 3DXOA 3DGMA 3CPW2 1PYLA 3GZYB 2HMOB 2CFDA 2GU1A 1YHQ3 2Z76A 4N6UA 3WHOA 2CX0A 1AQZA 3CCE3 5CF1A 1D6YA 2KXGA 4XBTA 1G96A 3DMCA 3A76A 3WODG 1TFOA 4FMDA 4CDLA 5RNTA 1RNBA 5G2GA 3HK4A 3AHWA 1A2KA 1RSNA 1DVCA 1UUWB 1O7NB 1STDA 3GWRA 2GBXB 2BNGA 2CHCA 1G0TA 5AEWB 3EN8A 1C7HA 1OHPA 1GMQA 3WOFB 1G02A 1LOYA 4N6TA 1LVNA 1BRJA 2OTJ3 2LQVA 1Q42A 1UUVB 1QAFA 4BL2A 2LYXA 1Q7HA 3F40A 1DMMA 2P05A 1WMOA 1JV2B 2KF5A 1OGZA 5DREA 5G1LA 2IY2A 2XEPA 3VF1A 5HOHA 1FUWA 2XGNA 1YIJ3 3X3XA 1KWIA 2W56B 2YX9A 1KSIA 1BNIA 3MG2A 6RNTA 4ZM8A 4RNTA 1DMNA 1TFKA 3ALAA 2CWVA 3KN4A 2C4BA 1BRHA
chains in the Genus database with same CATH topology
3H3HA 3MWZA 1IVWA 1K8A4 1L5GB 1ROAA 1N8R4 4AKZA 1O7HB 3K0ZA 1ROVA 3V92A 1QJGA 4RZMA 1WNHA 3BNCA 1OHSA 3NV0B 1O7MB 1K28A 4KFFA 5BVBA 2CC3A 1U5OA 1D6UA 1E3VA 1SIIA 2P38A 2WOFA 1ZX2A 4LEHA 1YI23 1ISKA 3G16A 4EYCA 3LYGA 1DMQA 3EBYA 1VQL3 1A67A 2XSOB 1VQ93 3CMA3 3OX9A 2RCDA 4HM4B 4STDA 1EA2A 4LGQA 1RN7A 4LSOA 4FCJA 2INXA 4FMAA 1N5PA 2GEXA 3WA2X 5CK6A 2V1LA 5D81A 4L8PA 1CQSA 4WHAA 2I9WA 3LOYA 4R9KA 3N8BA 2Z7AA 3FH1A 3G6E3 3K63A 3SEDA 1PFPA 1SQWA 2F99A 5STDA 1JJ22 1O7WB 1BUQA 3MYTA 2CFGA 4X2OA 5IEOA 1Q40A 4HM2B 3E99A 3ER7A 2ML5A 4HM1B 2P0XA 1VQ83 3PYJA 2OQEA 3DUKA 2GBWB 4O2HA 1GD4A 2CH9A 2D1WA 4CCVA 1FA3A 1R4CA 4J9AA 1GY6A 2CW9A 1IQ8A 4R80A 2E2UA 1N9JA 3LXUX 3CPOA 1VQ53 1IV9A 2BMRB 1W01A 4AKYA 4O02B 4HM5B 3V98A 2HMJB 4XDWA 5AEUB 3LTAA 1GS3A 4TX4A 1IQYA 3ROBA 5AIFA 4OUQA 2GXFA 1MOLA 2CWTA 1K41A 3BNEA 1AR0A 2B24B 4L7KA 3X42A 3G713 3PS8A 3MPHA 3HIIA 3B4PA 3HI7A 4H61A 1IVUA 1VQM3 1LXEA 5LC6A 2FXTA 1AVKA 1RJOA 5CLKA 4RBNA 3T0UA 1EG9B 2KCDA 2XRXB 3EF8A 1K734 5A0OB 5ELUA 1VQO3 2WGQA 2CK3H 5EVHA 3X41A 3JUNA 1OF5B 1OUNA 1JN5A 1W02A 3CNMA 3EN1B 3VGNA 3I553 4MJDA 4NHFA 2D42A 4N6LA 5KP1A 5LC7A 2IUJA 2XFTA 2R4IA 2C11A 3MG3A 2JQ5A 2WGOA 2JDIH 3KKGA 1J2BA 3CD63 2KRTA 3CCQ3 3EE1A 7STDA 1N8QA 4WYKB 2PZVA 3CU3A 3NHXA 3B7CA 3M8CA 3OWSA 5I97A 2Z6BA 3DY5A 3WMDA 1F8NA 2Y74A 3NUVA 3CCL3 2O9UX 1S5AA 2OQEC 2QGUA 3LTDA 3F7SA 4EV2A 1K9M4 1W4NA 2P0MA 1TIJA 2HMLB 2CIUA 3F14A 4FMCA 1IU7A 3IMAB 1U8CB 1GY5A 6STDA 1N5HA 4OK0A 1IV7A 1A90A 1FGQA 1W00A 2QEX3 1W6YA 1OCVA 1DVDA 2XGLA 3NQZA 3OWYA 3PXMA 4H3UA 2YFLB 1Q814 4HM0B 3X3YA 4K1VA 4N6NB 1SIHA 1EKMA 4J8TA 3CCJ3 2CFKA 2CKFB 3GRDA 3CC73 3SXXA 3CCV3 2O3OA 4R9LA 2HMNB 1AVLA 4RNZA 4EXRA 1QVG2 3PZWA 2OCTA 2PNCA 1RRLA 1RKYA 3FG4A 5AYRB 4WYKA 1YJN3 3CME3 3CC43 2W2CA 3FLJA 4I4KA 1OPYA 1Q40B 3LT8A 1YGEA 2WO0A 2GEYA 4KFDA 1YIT3 4NREA 4WFOA 2E2VA 4IIAA 3OV4A 3OXAA 1CEWI 3IJEB 3DGLA 4HZBB 3FKAA 4EV5A 1Q864 1ZO2A 3AMOB 3DM8A 1VQN3 4N6OB 1YJ93 4N3VA 3NBRA 3F8XA 1NJI4 4BTWA 5CF2A 1LOXA 4FR9A 3PCRA 1TUHA 4ORLA 3CCR3 1IT7A 2Q07A 2CFWA 3N54B 8CHOA 2MF7A 4LZIA 3SOAA 2BO9B 2K0MA 5HGRA 4R1KA 2BMOB 3KSED 1EQKA 1E97A 2SBLA 5EQLA 2STDA 2W04A 3I0YA 1ULIB 4K1UA 4N6V0 4XDVA 3I563 5IG5A 1W2B2 1IDPA 1VQ73 3EBTA 4RNYA 1A2VA 3FSDA 3OWUA 3LH4A 3S5CA 2FNQA 2ML6A 4OVMA 3F9SA 2GU3A 3T8NA 5ELJA 3D9RA 4KVHA 2RFRA 1VZZA 3BNDA 4HM8B 4R4KA 1UW1A 1W5ZA 3F7XA 1IVXA 3NXJA 2Z77A 4U13A 5JPUA 1WMPA 2W9PA 3AMOA 1OH0A 1JB5A 5TGNA 3J7Yd 3IPTA 4JRFA 1JNQA 4HJLB 1Q824 3MHEA 1WQLB 1Q7Y4 1JKGA 3N9HA 1IQXA 2CFLA 4LMIA 1S723 4HVNA 5IG0A 4MMZB 2W9QA 1NDOB 3Q2PA 5KP4A 3BB9A 3HX8A 1HKXA 1TP6A 2XFSA 3MG1A 4G1MB 1WMNA 3CC23 1NB3I 3UB1A 3FG1A 2Y73A 3PGBA 4MMYB 3FCSB 1KC84 4FCZA 5AIHA 1STFI 3FZWA 2BT3A 1O7PB 2ZDJA 1UI7A 3QK9A 3LTCA 4HBRA 1MNLA 2XH9A 4WP5A 5FW5A 1QAKA 2QIYA 3GZBA 1O7GB 3JVCA 1NU3A 2M7OA 4HYZA 4KFEA 1Z1SA 3UNLA 3KIIA 1W7CA 3SOYA 3GZRA 3JUOA 1LNHA 1PU4A 2W0QA 3CCS3 1FGTA 1M1XB 1M1K4 5AI1A 3V99A 3WOEB 2QA43 4XBXA 3NM7A 3RGRA 5FGOA 2YFJB 1RRHA 2HMMB 5CXOA 4FMBA 2RGQA 3T8UA 3JUMA 3X3ZA 5BXQA 4HKVB 3NBBA 1Y4KA 3DGNA 1JN5B 4HM3B 2W03A 4KZ1A 1CYVA 1E3RA 3L0RA 2CG1A 2ZL8A 3HZPA 4GL6A 1JB2A 3LTBA 4XM4A 3S27A 1KQS2 2XF3A 3FGYA 1JKGB 3GAXA 2C10A 1AV4A 4BTXA 3UL5A 3JUQA 1NO3A 2CG0A 2BMQB 2XR8B 3S29A 3H51A 1N9EA 5D82A 3QRDA 5D83A 3UJMA 2IA7A 1D6ZA 4MEIA 4O8SA 2WOHA 2A15A 5IENA 1QMAA 1OGXA 2UX0A 4JF8A 5DRVA 3MSOA 1M9GA 3BLZA 2MC8A 1US1A 4AEQA 1DYUA 3U97A 1YVBI 4IPBA 1QALA 3WDGB 3RDEA 3LT9A 5IF6A 3G4S3 1IVVA 3VSYA 4EBGA 5EEOA 2OOVA 3LMLA 3K5TA 3MKIA 3RGAA 3S67A 4K90B 3LZAA 3KZTA 3KSPA 3SVAA 3SX1A 1VQ43 3CXC2 3SLUA 3O8YA 3NX0A 4Q53A 5AYSC 4FCMA 1NB5I 1GD3A 3S28A 3B4OA 2W6JH 1SPUA 4QWTA 2IUKA 4O3VA 2F98A 4XB5A 3U1WA 3EJVA 3KFQC 5JPPA 1M904 1QVF2 3OW22 3X40A 2BHMA 4HM7B 3G0KA 1GY7A 4MMXB 4WWUC 1SJWA 3TDGA 3NM2A 1KD14 3DGOA 3F8HA 3ECFA 4X2HA 5IERA 1IK3A 5IEPA 3Q1CA 4HZ9B 1CYUA 3D3LA 4HM6B 3KE7A 3FF2A 2K54A 2W56A 3STDA 3NBJA 1VQP3 3CCM3 1HU9A 1OHOA 3K9MC 5AIGA 2OTL3 4L8OA 3K7CA 3FF0A 1TU5A 1UI8A 3NQYA 2OOVC 1IT8A 2CWUA 3CNXA 3DZLA 1OACA 5JBSA 3PCSA 1VQK3 1GYBA 3CCU3 2B1XB 5KP3A 3NV0A 2P09A 1FGRA 4GB5A 3FG3A 4PEJA 3B8LA 5IW9A 1W2ZA 3EHCA 1WTHA 1W6CA 4BTYA 4EC6A 2RSXA 3EX9A 1FGOA 3UL6A 5IG3A 1V74A 3BNBA 3G8ZA 3GZXB 5AIIA 1JB4A 1ASKA 1FGMA 2IMJA 1NWWA 4N6MA 2XSHB 1JRQA 1VQ63 1OF5A 3EB8A 2YFIB 3WA3A 4XBYA 3HIGA 1YJW3 3EQQB 1T5YA 2FGTA 2F86B 2OWPA 2E2TA 3JUPA 1W6GA 3Q90A 3EC9A 5IG4A 2HMKB 4K61A 2L4VA 3DXOA 3DGMA 3CPW2 3GZYB 2HMOB 2CFDA 2GU1A 1YHQ3 2Z76A 4N6UA 3CCE3 5CF1A 1D6YA 2KXGA 4XBTA 1G96A 3DMCA 3A76A 3WODG 1TFOA 4FMDA 4CDLA 5G2GA 3HK4A 1A2KA 4IT7A 1DVCA 1UUWB 1O7NB 1STDA 3GWRA 2GBXB 2BNGA 2CHCA 5AEWB 3EN8A 1C7HA 1OHPA 3WOFB 4N6TA 1LVNA 2OTJ3 2LQVA 1Q42A 1UUVB 1QAFA 2LYXA 3F40A 1DMMA 2P05A 1WMOA 1JV2B 5DREA 1OGZA 2XEPA 3VF1A 1FUWA 2XGNA 1YIJ3 3X3XA 1KWIA 2W56B 2YX9A 1KSIA 3MG2A 4ZM8A 1DMNA 1TFKA 3ALAA 2CWVA 3KN4A 1ULJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 3;  1YIT 3;  1K8A 4;  1Q81 4;  1YJW 3;  1VQM 3;  1N8R 4;  1KQS 2;  2OTJ 3;  1M90 4;  1VQ5 3;  3CCJ 3;  1QVF 2;  3CC7 3;  3CCV 3;  3OW2 2;  1Q82 4;  3G4S 3;  3CCL 3;  3I56 3;  1VQK 3;  3G6E 3;  1Q7Y 4;  1Q86 4;  3CCU 3;  1K9M 4;  3CPW 2;  3CCS 3;  1QVG 2;  1K73 4;  1KD1 4;  1W2B 2;  1JJ2 2;  1VQO 3;  1VQ7 3;  1YIJ 3;  1YHQ 3;  1M1K 4;  1VQN 3;  2QA4 3;  1S72 3;  1YI2 3;  3CCE 3;  1YJ9 3;  3I55 3;  1VQ4 3;  3CXC 2;  3CC2 3;  1VQL 3;  1YJN 3;  3CME 3;  3CC4 3;  1NJI 4;  1VQ8 3;  1VQP 3;  3G71 3;  3CCM 3;  1KC8 4;  1VQ9 3;  3CMA 3;  3CD6 3;  3CCR 3;  2OTL 3;  2QEX 3;  3CCQ 3; 
#chains in the Genus database with same CATH topology
 1T3B A;  3H3H A;  3MWZ A;  1IVW A;  1K8A 4;  1L5G B;  1ROA A;  1RHL A;  2IYJ A;  4AKZ A;  1O7H B;  3K0Z A;  1CH0 A;  4EW5 A;  1ROV A;  3V92 A;  1N8R 4;  1QJG A;  1PY3 A;  4RZM A;  1WNH A;  3BNC A;  1OHS A;  2KF4 A;  1BRG A;  1O7M B;  3NV0 B;  1K28 A;  3ZG0 A;  4KFF A;  5BVB A;  2CC3 A;  1U5O A;  1I0V A;  1D6U A;  1E3V A;  1SII A;  2P38 A;  2WOF A;  1ZX2 A;  1I0X A;  4LEH A;  1YI2 3;  1ISK A;  1TRP A;  3G16 A;  4EYC A;  3LYG A;  4LYL B;  1DMQ A;  3EBY A;  1VQL 3;  1YVS A;  1A67 A;  1NNV A;  2XSO B;  1BGS A;  1B21 A;  2HOH A;  1VQ9 3;  3CMA 3;  3OX9 A;  2RCD A;  4HM4 B;  1GOY A;  4STD A;  1EA2 A;  4LGQ A;  1RN7 A;  4LSO A;  4FCJ A;  2INX A;  4FMA A;  1N5P A;  2GEX A;  4GSP A;  3WA2 X;  1MWS A;  1Q9E A;  2V1L A;  5CK6 A;  5D81 A;  4L8P A;  1BOX A;  1RDS A;  4J5G A;  1CQS A;  4WHA A;  2I9W A;  3LOY A;  1FW7 A;  4R9K A;  3N8B A;  2Z7A A;  3FH1 A;  3G6E 3;  3AGO A;  3K63 A;  3SED A;  1PFP A;  1SQW A;  2F99 A;  5STD A;  1BVI A;  1JJ2 2;  1O7W B;  4IT7 A;  4CJN A;  1BUQ A;  4J5K A;  5GSP A;  3MYT A;  2CFG A;  4X2O A;  5IEO A;  1Q40 A;  4HM2 B;  3E99 A;  3ER7 A;  2ML5 A;  4HM1 B;  2P0X A;  1BNE A;  3D4A A;  1VQ8 3;  3PYJ A;  2OQE A;  3BIR A;  1B2Z A;  3DUK A;  2KF6 A;  2GBW B;  4O2H A;  1GD4 A;  2CH9 A;  2D1W A;  4CCV A;  1FA3 A;  1R4C A;  4J9A A;  1GY6 A;  2CW9 A;  1IQ8 A;  1UCJ A;  4R80 A;  2E2U A;  1N9J A;  1ZGX A;  3LXU X;  5M18 A;  3CPO A;  1VQ5 3;  1IV9 A;  1MGW A;  2BMR B;  1W01 A;  1BU4 A;  3GSP A;  4AKY A;  3Q3F A;  4O02 B;  4HM5 B;  1RN4 A;  3V98 A;  1I2G A;  2HMJ B;  4XDW A;  5AEU B;  3LTA A;  1GS3 A;  4TX4 A;  1IQY A;  3ZFZ A;  1IYY A;  3ROB A;  5AIF A;  4OUQ A;  2KAA A;  2GXF A;  1MOL A;  2CWT A;  1K41 A;  3BNE A;  4NPB A;  1AR0 A;  2AAD A;  2B24 B;  4L7K A;  3X42 A;  1BNR A;  3G71 3;  3PS8 A;  3MPH A;  3HII A;  2RNT A;  3B4P A;  3HI7 A;  4H61 A;  1RMS A;  1IVU A;  1VQM 3;  1LXE A;  5LC6 A;  2FXT A;  1UCL A;  1AVK A;  1RJO A;  3RNT A;  1LOW A;  1FZU A;  1RNT A;  1BRI A;  1V58 A;  1I70 A;  4RBN A;  5CLK A;  3T0U A;  1EG9 B;  2KCD A;  2H0G A;  2XRX B;  3EF8 A;  3KCH A;  1TTO A;  1K73 4;  5A0O B;  5ELU A;  1VQO 3;  2WGQ A;  2CK3 H;  3D5G A;  1BSE A;  5EVH A;  1JZD A;  3X41 A;  3JUN A;  1OF5 B;  1OUN A;  1JN5 A;  1BIR A;  1W02 A;  3CNM A;  3EN1 B;  4KT3 B;  4MJD A;  3VGN A;  3I55 3;  4NHF A;  2D42 A;  4N6L A;  5KP1 A;  5LC7 A;  2IUJ A;  2XFT A;  2R4I A;  2C11 A;  3MG3 A;  2JQ5 A;  2WGO A;  2JDI H;  3KKG A;  1J2B A;  3CD6 3;  2KRT A;  3CCQ 3;  3EE1 A;  7STD A;  1FUT A;  1N8Q A;  4WYK B;  2PZV A;  3CU3 A;  3NHX A;  3B7C A;  1TRQ A;  3M8C A;  3OWS A;  5I97 A;  1LOV A;  2Z6B A;  3DY5 A;  3WMD A;  1B20 A;  1F8N A;  1VQQ A;  1RGA A;  2Y74 A;  3NUV A;  3URP A;  3CCL 3;  1LRA A;  2O9U X;  1S5A A;  2OQE C;  2QGU A;  3LTD A;  3F7S A;  4EV2 A;  1K9M 4;  1W4N A;  2P0M A;  1TIJ A;  2HML B;  1X1U A;  2CIU A;  3F14 A;  4FMC A;  1IU7 A;  4BL3 A;  2J8X B;  1U8C B;  1X1X A;  3IMA B;  1GY5 A;  6STD A;  1N5H A;  4OK0 A;  1IV7 A;  2GSP A;  1A90 A;  1FGQ A;  1W00 A;  2QEX 3;  1W6Y A;  1I3F A;  1OCV A;  1DVD A;  2RBI A;  2XGL A;  3NQZ A;  3OWY A;  1GOU A;  3PXM A;  4H3U A;  2YFL B;  1Q81 4;  4HM0 B;  3X3Y A;  1UDI I;  4K1V A;  4N6N B;  1SIH A;  1EKM A;  4J8T A;  3SYU A;  3CCJ 3;  2CFK A;  2CKF B;  3GRD A;  3CC7 3;  3SXX A;  3CCV 3;  1RGH A;  2O3O A;  1R4Y A;  1BSD A;  2HMN B;  4R9L A;  1AVL A;  4RNZ A;  4EXR A;  1QVG 2;  3PZW A;  1RCL A;  1RGL A;  2OCT A;  2PNC A;  1JBS A;  1RRL A;  1RKY A;  3FG4 A;  5AYR B;  4WYK A;  1YJN 3;  3CME 3;  3CC4 3;  2W2C A;  3FLJ A;  2ZHX B;  1DET A;  4I4K A;  4ILF A;  1I2E A;  1UCI A;  1OPY A;  1Q40 B;  3LT8 A;  1YGE A;  2WO0 A;  2GEY A;  4KFD A;  1YIT 3;  4NRE A;  4WFO A;  2E2V A;  4IIA A;  3OV4 A;  3OXA A;  1CEW I;  1B2X A;  3IJE B;  3DGL A;  3D5I A;  4HZB B;  3FKA A;  4EV5 A;  1Q86 4;  1EUI C;  1ZO2 A;  3AMO B;  3DM8 A;  1VQN 3;  2R41 A;  4N6O B;  1YJ9 3;  4N3V A;  3NBR A;  1LQG C;  3F8X A;  1NJI 4;  4BTW A;  5CF2 A;  1B2U A;  1LOX A;  3PCR A;  1TUH A;  1BNJ A;  4FR9 A;  4ORL A;  3CCR 3;  1BUJ A;  1IT7 A;  2Q07 A;  8RNT A;  2CFW A;  3N54 B;  1BNG A;  1FYS A;  8CHO A;  2MF7 A;  4LZI A;  3SOA A;  2BO9 B;  2K0M A;  5HGR A;  4R1K A;  1YGW A;  2BMO B;  3KSE D;  1EQK A;  1E97 A;  2SBL A;  3WR2 A;  1RGC A;  5EQL A;  1UCK A;  2STD A;  2W04 A;  3I0Y A;  1ULI B;  4K1U A;  4N6V 0;  4XDV A;  3I56 3;  1RN1 A;  1I3I A;  5IG5 A;  1W2B 2;  1IDP A;  1VQ7 3;  3EBT A;  4HAA A;  1A2V A;  2L1S A;  3FSD A;  3OWU A;  4RNY A;  3LH4 A;  3S5C A;  2FNQ A;  2UUG C;  2ML6 A;  6GSP A;  1HYF A;  1RLS A;  3F9S A;  2GU3 A;  4OVM A;  3T8N A;  5ELJ A;  2UGI A;  1T2H A;  3D9R A;  2SAR A;  4KVH A;  1YNV X;  2RFR A;  1VZZ A;  3BND A;  4HM8 B;  2H0H A;  1UW1 A;  4R4K A;  1BRS A;  1W5Z A;  3F7X A;  1AY7 A;  1IVX A;  3NXJ A;  2Z77 A;  4U13 A;  1RCK A;  1B27 A;  1RGG A;  1WMP A;  2AAE A;  1A2P A;  2W9P A;  4GHO A;  3AMO A;  1X1W A;  1OH0 A;  1JB5 A;  5TGN A;  3J7Y d;  3IPT A;  4JRF A;  1JNQ A;  4HJL B;  1Q82 4;  3MHE A;  1WQL B;  1RGK A;  1Q7Y 4;  1JKG A;  3N9H A;  1IQX A;  2CFL A;  4LMI A;  1LQM B;  1S72 3;  1HZ1 A;  4HVN A;  5IG0 A;  4MMZ B;  5BU4 A;  2W9Q A;  1NDO B;  3A5E A;  3Q2P A;  5KP4 A;  3AHS A;  3BB9 A;  3HX8 A;  1HKX A;  1TP6 A;  2XFS A;  3MG1 A;  4G1M B;  1WMN A;  3CC2 3;  1NB3 I;  3UB1 A;  3FG1 A;  1T2I A;  2Y73 A;  3PGB A;  3FCS B;  4MMY B;  4FCZ A;  5AIH A;  1B3S A;  1STF I;  3FZW A;  2BT3 A;  1O7P B;  2ZDJ A;  1UI7 A;  3QK9 A;  3LTC A;  4HBR A;  1MNL A;  2XH9 A;  1MWT A;  4WP5 A;  2H0I A;  5FW5 A;  1QAK A;  2QIY A;  1RGE A;  1O7G B;  3GZB A;  3JVC A;  1NU3 A;  2M7O A;  1BRK A;  4HYZ A;  4KFE A;  1Z1S A;  3UNL A;  3KII A;  1W7C A;  2BIR A;  3SOY A;  3GZR A;  1ULJ B;  3JUO A;  1BNS A;  1LNH A;  1PU4 A;  2W0Q A;  3CCS 3;  1FGT A;  1M1X B;  2BU4 A;  1JBR A;  1M1K 4;  5AI1 A;  3V99 A;  3WOE B;  2QA4 3;  4XBX A;  3NM7 A;  3RGR A;  5FGO A;  2F4Y A;  3ZG5 A;  2F5W A;  2YFJ B;  1ZS7 A;  1RTU A;  1RRH A;  2HMM B;  5CXO A;  4FMB A;  2RGQ A;  3T8U A;  3JUM A;  3X3Z A;  1GMP A;  5BXQ A;  4HKV B;  3NBB A;  1Y4K A;  3DGN A;  1JN5 B;  4HM3 B;  4CPK A;  2W03 A;  4KZ1 A;  1CYV A;  1E3R A;  1V57 A;  3L0R A;  2CG1 A;  4BU4 A;  2ZL8 A;  3HZP A;  1BSB A;  1JB2 A;  3LTB A;  3DH2 A;  4GL6 A;  4XM4 A;  2XF3 A;  3S27 A;  1KQS 2;  3FGY A;  1JKG B;  1BAO A;  3GAX A;  2C10 A;  1AV4 A;  1I2F A;  4BTX A;  3UL5 A;  3JUQ A;  1NO3 A;  2CG0 A;  2BMQ B;  2XR8 B;  3S29 A;  3H51 A;  1N9E A;  5D82 A;  1GOV A;  3QRD A;  5D83 A;  3UJM A;  2IA7 A;  1D6Z A;  4MEI A;  3DGY A;  4O8S A;  2WOH A;  1JBT A;  2A15 A;  5IEN A;  1QMA A;  1OGX A;  2UX0 A;  4JF8 A;  2F56 A;  5DRV A;  1SAR A;  3MSO A;  1M9G A;  3BLZ A;  1GSP A;  2MC8 A;  1US1 A;  4AEQ A;  1DYU A;  1I8V A;  3U97 A;  1YVB I;  4IPB A;  1QAL A;  3WDG B;  3RDE A;  3LT9 A;  5IF6 A;  3G4S 3;  1IVV A;  3VSY A;  4BIR A;  4EBG A;  2KF3 A;  5EEO A;  5M1A A;  2OOV A;  3LML A;  1FUS A;  3K5T A;  3D79 A;  3MKI A;  1BNF A;  3RGA A;  3S67 A;  4K90 B;  1C54 A;  3LZA A;  3KZT A;  3KSP A;  3SVA A;  3SX1 A;  1VQ4 3;  3CXC 2;  3SLU A;  3O8Y A;  4HOH A;  3NX0 A;  4Q53 A;  5AYS C;  4FCM A;  1BSC A;  1DE3 A;  1NB5 I;  1GD3 A;  3HOH A;  3S28 A;  3B4O A;  2W6J H;  1B2S A;  1BAN A;  1RGF A;  1SPU A;  2F5M A;  3AGN A;  4QWT A;  2IUK A;  4O3V A;  1KC8 4;  1UGH I;  2F98 A;  4XB5 A;  3U1W A;  3EJV A;  3KFQ C;  5JPP A;  1M90 4;  1QVF 2;  7GSP A;  3OW2 2;  3X40 A;  4DKI A;  2BHM A;  4HM7 B;  3G0K A;  1GY7 A;  4MMX B;  5G1K A;  4WWU C;  1SJW A;  3TDG A;  3NM2 A;  1KD1 4;  3DGO A;  3F8H A;  3ECF A;  1BSA A;  4X2H A;  2CX1 A;  5IER A;  1IK3 A;  5IEP A;  3Q1C A;  4HZ9 B;  1CYU A;  3D3L A;  4HM6 B;  3KE7 A;  1B2M A;  3BU4 A;  4I5Q A;  3FF2 A;  2K54 A;  2W56 A;  5M19 A;  1BRN L;  3STD A;  3NBJ A;  1VQP 3;  3CCM 3;  1HU9 A;  1LNI A;  1OHO A;  3K9M C;  5AIG A;  2OTL 3;  4L8O A;  3K7C A;  3FF0 A;  1UUG B;  1TU5 A;  1JZO A;  1X1Y A;  1UI8 A;  1GMR A;  3NQY A;  2OOV C;  1IT8 A;  2CWU A;  3CNX A;  1MGR A;  1OAC A;  3DZL A;  3PCS A;  2K3D A;  5JBS A;  1VQK 3;  1GYB A;  3CCU 3;  2B1X B;  5KP3 A;  1MWU A;  1UGI A;  3NV0 A;  2P09 A;  1FGR A;  4GB5 A;  3FG3 A;  4PEJ A;  3B8L A;  5IW9 A;  1W2Z A;  3EHC A;  1WTH A;  1W6C A;  4BTY A;  4EC6 A;  2RSX A;  5BIR A;  3EX9 A;  1FGO A;  3UL6 A;  9RNT A;  5IG3 A;  7RNT A;  1V74 A;  3BNB A;  3G8Z A;  3GZX B;  5AII A;  1JB4 A;  1ASK A;  1FGM A;  2IMJ A;  5JPU A;  1NWW A;  4N6M A;  1JRQ A;  2XSH B;  1VQ6 3;  1OF5 A;  1MWR A;  2YFI B;  3EB8 A;  3WA3 A;  4XBY A;  1TJD A;  3HIG A;  1YJW 3;  3EQQ B;  1T5Y A;  2ZA4 A;  2FGT A;  2F86 B;  2OWP A;  2E2T A;  3JUP A;  1W6G A;  3Q90 A;  3EC9 A;  5IG4 A;  2HMK B;  1EEJ A;  4K61 A;  2L4V A;  3DXO A;  3DGM A;  3CPW 2;  1PYL A;  3GZY B;  2HMO B;  2CFD A;  2GU1 A;  1YHQ 3;  2Z76 A;  4N6U A;  3WHO A;  2CX0 A;  1AQZ A;  3CCE 3;  5CF1 A;  1D6Y A;  2KXG A;  4XBT A;  1G96 A;  3DMC A;  3A76 A;  3WOD G;  1TFO A;  4FMD A;  4CDL A;  5RNT A;  1RNB A;  5G2G A;  3HK4 A;  3AHW A;  1A2K A;  1RSN A;  1DVC A;  1UUW B;  1O7N B;  1STD A;  3GWR A;  2GBX B;  2BNG A;  2CHC A;  1G0T A;  5AEW B;  3EN8 A;  1C7H A;  1OHP A;  1GMQ A;  3WOF B;  1G02 A;  1LOY A;  4N6T A;  1LVN A;  1BRJ A;  2OTJ 3;  2LQV A;  1Q42 A;  1UUV B;  1QAF A;  4BL2 A;  2LYX A;  1Q7H A;  3F40 A;  1DMM A;  2P05 A;  1WMO A;  1JV2 B;  2KF5 A;  1OGZ A;  5DRE A;  5G1L A;  2IY2 A;  2XEP A;  3VF1 A;  5HOH A;  1FUW A;  2XGN A;  1YIJ 3;  3X3X A;  1KWI A;  2W56 B;  2YX9 A;  1KSI A;  1BNI A;  3MG2 A;  6RNT A;  4ZM8 A;  4RNT A;  1DMN A;  1TFK A;  3ALA A;  2CWV A;  3KN4 A;  2C4B A;  1BRH A; 
#chains in the Genus database with same CATH homology
 3H3H A;  3MWZ A;  1IVW A;  1K8A 4;  1L5G B;  1ROA A;  1N8R 4;  4AKZ A;  1O7H B;  3K0Z A;  1ROV A;  3V92 A;  1QJG A;  4RZM A;  1WNH A;  3BNC A;  1OHS A;  3NV0 B;  1O7M B;  1K28 A;  4KFF A;  5BVB A;  2CC3 A;  1U5O A;  1D6U A;  1E3V A;  1SII A;  2P38 A;  2WOF A;  1ZX2 A;  4LEH A;  1YI2 3;  1ISK A;  3G16 A;  4EYC A;  3LYG A;  1DMQ A;  3EBY A;  1VQL 3;  1A67 A;  2XSO B;  1VQ9 3;  3CMA 3;  3OX9 A;  2RCD A;  4HM4 B;  4STD A;  1EA2 A;  4LGQ A;  1RN7 A;  4LSO A;  4FCJ A;  2INX A;  4FMA A;  1N5P A;  2GEX A;  3WA2 X;  5CK6 A;  2V1L A;  5D81 A;  4L8P A;  1CQS A;  4WHA A;  2I9W A;  3LOY A;  4R9K A;  3N8B A;  2Z7A A;  3FH1 A;  3G6E 3;  3K63 A;  3SED A;  1PFP A;  1SQW A;  2F99 A;  5STD A;  1JJ2 2;  1O7W B;  1BUQ A;  3MYT A;  2CFG A;  4X2O A;  5IEO A;  1Q40 A;  4HM2 B;  3E99 A;  3ER7 A;  2ML5 A;  4HM1 B;  2P0X A;  1VQ8 3;  3PYJ A;  2OQE A;  3DUK A;  2GBW B;  4O2H A;  1GD4 A;  2CH9 A;  2D1W A;  4CCV A;  1FA3 A;  1R4C A;  4J9A A;  1GY6 A;  2CW9 A;  1IQ8 A;  4R80 A;  2E2U A;  1N9J A;  3LXU X;  3CPO A;  1VQ5 3;  1IV9 A;  2BMR B;  1W01 A;  4AKY A;  4O02 B;  4HM5 B;  3V98 A;  2HMJ B;  4XDW A;  5AEU B;  3LTA A;  1GS3 A;  4TX4 A;  1IQY A;  3ROB A;  5AIF A;  4OUQ A;  2GXF A;  1MOL A;  2CWT A;  1K41 A;  3BNE A;  1AR0 A;  2B24 B;  4L7K A;  3X42 A;  3G71 3;  3PS8 A;  3MPH A;  3HII A;  3B4P A;  3HI7 A;  4H61 A;  1IVU A;  1VQM 3;  1LXE A;  5LC6 A;  2FXT A;  1AVK A;  1RJO A;  5CLK A;  4RBN A;  3T0U A;  1EG9 B;  2KCD A;  2XRX B;  3EF8 A;  1K73 4;  5A0O B;  5ELU A;  1VQO 3;  2WGQ A;  2CK3 H;  5EVH A;  3X41 A;  3JUN A;  1OF5 B;  1OUN A;  1JN5 A;  1W02 A;  3CNM A;  3EN1 B;  3VGN A;  3I55 3;  4MJD A;  4NHF A;  2D42 A;  4N6L A;  5KP1 A;  5LC7 A;  2IUJ A;  2XFT A;  2R4I A;  2C11 A;  3MG3 A;  2JQ5 A;  2WGO A;  2JDI H;  3KKG A;  1J2B A;  3CD6 3;  2KRT A;  3CCQ 3;  3EE1 A;  7STD A;  1N8Q A;  4WYK B;  2PZV A;  3CU3 A;  3NHX A;  3B7C A;  3M8C A;  3OWS A;  5I97 A;  2Z6B A;  3DY5 A;  3WMD A;  1F8N A;  2Y74 A;  3NUV A;  3CCL 3;  2O9U X;  1S5A A;  2OQE C;  2QGU A;  3LTD A;  3F7S A;  4EV2 A;  1K9M 4;  1W4N A;  2P0M A;  1TIJ A;  2HML B;  2CIU A;  3F14 A;  4FMC A;  1IU7 A;  3IMA B;  1U8C B;  1GY5 A;  6STD A;  1N5H A;  4OK0 A;  1IV7 A;  1A90 A;  1FGQ A;  1W00 A;  2QEX 3;  1W6Y A;  1OCV A;  1DVD A;  2XGL A;  3NQZ A;  3OWY A;  3PXM A;  4H3U A;  2YFL B;  1Q81 4;  4HM0 B;  3X3Y A;  4K1V A;  4N6N B;  1SIH A;  1EKM A;  4J8T A;  3CCJ 3;  2CFK A;  2CKF B;  3GRD A;  3CC7 3;  3SXX A;  3CCV 3;  2O3O A;  4R9L A;  2HMN B;  1AVL A;  4RNZ A;  4EXR A;  1QVG 2;  3PZW A;  2OCT A;  2PNC A;  1RRL A;  1RKY A;  3FG4 A;  5AYR B;  4WYK A;  1YJN 3;  3CME 3;  3CC4 3;  2W2C A;  3FLJ A;  4I4K A;  1OPY A;  1Q40 B;  3LT8 A;  1YGE A;  2WO0 A;  2GEY A;  4KFD A;  1YIT 3;  4NRE A;  4WFO A;  2E2V A;  4IIA A;  3OV4 A;  3OXA A;  1CEW I;  3IJE B;  3DGL A;  4HZB B;  3FKA A;  4EV5 A;  1Q86 4;  1ZO2 A;  3AMO B;  3DM8 A;  1VQN 3;  4N6O B;  1YJ9 3;  4N3V A;  3NBR A;  3F8X A;  1NJI 4;  4BTW A;  5CF2 A;  1LOX A;  4FR9 A;  3PCR A;  1TUH A;  4ORL A;  3CCR 3;  1IT7 A;  2Q07 A;  2CFW A;  3N54 B;  8CHO A;  2MF7 A;  4LZI A;  3SOA A;  2BO9 B;  2K0M A;  5HGR A;  4R1K A;  2BMO B;  3KSE D;  1EQK A;  1E97 A;  2SBL A;  5EQL A;  2STD A;  2W04 A;  3I0Y A;  1ULI B;  4K1U A;  4N6V 0;  4XDV A;  3I56 3;  5IG5 A;  1W2B 2;  1IDP A;  1VQ7 3;  3EBT A;  4RNY A;  1A2V A;  3FSD A;  3OWU A;  3LH4 A;  3S5C A;  2FNQ A;  2ML6 A;  4OVM A;  3F9S A;  2GU3 A;  3T8N A;  5ELJ A;  3D9R A;  4KVH A;  2RFR A;  1VZZ A;  3BND A;  4HM8 B;  4R4K A;  1UW1 A;  1W5Z A;  3F7X A;  1IVX A;  3NXJ A;  2Z77 A;  4U13 A;  5JPU A;  1WMP A;  2W9P A;  3AMO A;  1OH0 A;  1JB5 A;  5TGN A;  3J7Y d;  3IPT A;  4JRF A;  1JNQ A;  4HJL B;  1Q82 4;  3MHE A;  1WQL B;  1Q7Y 4;  1JKG A;  3N9H A;  1IQX A;  2CFL A;  4LMI A;  1S72 3;  4HVN A;  5IG0 A;  4MMZ B;  2W9Q A;  1NDO B;  3Q2P A;  5KP4 A;  3BB9 A;  3HX8 A;  1HKX A;  1TP6 A;  2XFS A;  3MG1 A;  4G1M B;  1WMN A;  3CC2 3;  1NB3 I;  3UB1 A;  3FG1 A;  2Y73 A;  3PGB A;  4MMY B;  3FCS B;  1KC8 4;  4FCZ A;  5AIH A;  1STF I;  3FZW A;  2BT3 A;  1O7P B;  2ZDJ A;  1UI7 A;  3QK9 A;  3LTC A;  4HBR A;  1MNL A;  2XH9 A;  4WP5 A;  5FW5 A;  1QAK A;  2QIY A;  3GZB A;  1O7G B;  3JVC A;  1NU3 A;  2M7O A;  4HYZ A;  4KFE A;  1Z1S A;  3UNL A;  3KII A;  1W7C A;  3SOY A;  3GZR A;  3JUO A;  1LNH A;  1PU4 A;  2W0Q A;  3CCS 3;  1FGT A;  1M1X B;  1M1K 4;  5AI1 A;  3V99 A;  3WOE B;  2QA4 3;  4XBX A;  3NM7 A;  3RGR A;  5FGO A;  2YFJ B;  1RRH A;  2HMM B;  5CXO A;  4FMB A;  2RGQ A;  3T8U A;  3JUM A;  3X3Z A;  5BXQ A;  4HKV B;  3NBB A;  1Y4K A;  3DGN A;  1JN5 B;  4HM3 B;  2W03 A;  4KZ1 A;  1CYV A;  1E3R A;  3L0R A;  2CG1 A;  2ZL8 A;  3HZP A;  4GL6 A;  1JB2 A;  3LTB A;  4XM4 A;  3S27 A;  1KQS 2;  2XF3 A;  3FGY A;  1JKG B;  3GAX A;  2C10 A;  1AV4 A;  4BTX A;  3UL5 A;  3JUQ A;  1NO3 A;  2CG0 A;  2BMQ B;  2XR8 B;  3S29 A;  3H51 A;  1N9E A;  5D82 A;  3QRD A;  5D83 A;  3UJM A;  2IA7 A;  1D6Z A;  4MEI A;  4O8S A;  2WOH A;  2A15 A;  5IEN A;  1QMA A;  1OGX A;  2UX0 A;  4JF8 A;  5DRV A;  3MSO A;  1M9G A;  3BLZ A;  2MC8 A;  1US1 A;  4AEQ A;  1DYU A;  3U97 A;  1YVB I;  4IPB A;  1QAL A;  3WDG B;  3RDE A;  3LT9 A;  5IF6 A;  3G4S 3;  1IVV A;  3VSY A;  4EBG A;  5EEO A;  2OOV A;  3LML A;  3K5T A;  3MKI A;  3RGA A;  3S67 A;  4K90 B;  3LZA A;  3KZT A;  3KSP A;  3SVA A;  3SX1 A;  1VQ4 3;  3CXC 2;  3SLU A;  3O8Y A;  3NX0 A;  4Q53 A;  5AYS C;  4FCM A;  1NB5 I;  1GD3 A;  3S28 A;  3B4O A;  2W6J H;  1SPU A;  4QWT A;  2IUK A;  4O3V A;  2F98 A;  4XB5 A;  3U1W A;  3EJV A;  3KFQ C;  5JPP A;  1M90 4;  1QVF 2;  3OW2 2;  3X40 A;  2BHM A;  4HM7 B;  3G0K A;  1GY7 A;  4MMX B;  4WWU C;  1SJW A;  3TDG A;  3NM2 A;  1KD1 4;  3DGO A;  3F8H A;  3ECF A;  4X2H A;  5IER A;  1IK3 A;  5IEP A;  3Q1C A;  4HZ9 B;  1CYU A;  3D3L A;  4HM6 B;  3KE7 A;  3FF2 A;  2K54 A;  2W56 A;  3STD A;  3NBJ A;  1VQP 3;  3CCM 3;  1HU9 A;  1OHO A;  3K9M C;  5AIG A;  2OTL 3;  4L8O A;  3K7C A;  3FF0 A;  1TU5 A;  1UI8 A;  3NQY A;  2OOV C;  1IT8 A;  2CWU A;  3CNX A;  3DZL A;  1OAC A;  5JBS A;  3PCS A;  1VQK 3;  1GYB A;  3CCU 3;  2B1X B;  5KP3 A;  3NV0 A;  2P09 A;  1FGR A;  4GB5 A;  3FG3 A;  4PEJ A;  3B8L A;  5IW9 A;  1W2Z A;  3EHC A;  1WTH A;  1W6C A;  4BTY A;  4EC6 A;  2RSX A;  3EX9 A;  1FGO A;  3UL6 A;  5IG3 A;  1V74 A;  3BNB A;  3G8Z A;  3GZX B;  5AII A;  1JB4 A;  1ASK A;  1FGM A;  2IMJ A;  1NWW A;  4N6M A;  2XSH B;  1JRQ A;  1VQ6 3;  1OF5 A;  3EB8 A;  2YFI B;  3WA3 A;  4XBY A;  3HIG A;  1YJW 3;  3EQQ B;  1T5Y A;  2FGT A;  2F86 B;  2OWP A;  2E2T A;  3JUP A;  1W6G A;  3Q90 A;  3EC9 A;  5IG4 A;  2HMK B;  4K61 A;  2L4V A;  3DXO A;  3DGM A;  3CPW 2;  3GZY B;  2HMO B;  2CFD A;  2GU1 A;  1YHQ 3;  2Z76 A;  4N6U A;  3CCE 3;  5CF1 A;  1D6Y A;  2KXG A;  4XBT A;  1G96 A;  3DMC A;  3A76 A;  3WOD G;  1TFO A;  4FMD A;  4CDL A;  5G2G A;  3HK4 A;  1A2K A;  4IT7 A;  1DVC A;  1UUW B;  1O7N B;  1STD A;  3GWR A;  2GBX B;  2BNG A;  2CHC A;  5AEW B;  3EN8 A;  1C7H A;  1OHP A;  3WOF B;  4N6T A;  1LVN A;  2OTJ 3;  2LQV A;  1Q42 A;  1UUV B;  1QAF A;  2LYX A;  3F40 A;  1DMM A;  2P05 A;  1WMO A;  1JV2 B;  5DRE A;  1OGZ A;  2XEP A;  3VF1 A;  1FUW A;  2XGN A;  1YIJ 3;  3X3X A;  1KWI A;  2W56 B;  2YX9 A;  1KSI A;  3MG2 A;  4ZM8 A;  1DMN A;  1TFK A;  3ALA A;  2CWV A;  3KN4 A;  1ULJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...