3CD63

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3cd6300
3I563 3CCE3 1YJW3 1YJ93 1VQ83 1QVF2 1K734 1VQP3 1M904 1VQ53 1VQO3 1VQ73 1YJN3 3I553 1KD14 3CCS3 1VQL3 1W2B2 1QVG2 1KC84 1Q864 1YI23 1M1K4 2OTJ3 3CXC2 3CME3 3CC73 1YHQ3 1JJ22 1VQ43 1K8A4 1Q824 1Q7Y4 3CCR3 2QA43 1K9M4 1VQN3 3OW22 1VQK3 3CMA3 1N8R4 2QEX3 1YIT3 3CCM3 3G6E3 1S723 3CC43 3CC23 3CPW2 3CCL3 1YIJ3 1NJI4 3CCJ3 1VQM3 2OTL3 3G4S3 3CCV3 1VQ93 3CD63 1KQS2 1Q814 3G713 1VQ63 3CCQ3 3CCU3
chains in the Genus database with same CATH superfamily
1GOYA 2AAEA 1BAOA 1LOYA 2C11A 3K5TA 3UNLA 4CCVA 5CF2A 1I2FA 4O02B 1VQL3 2W9PA 2HMJB 3OWYA 1W6YA 2CWTA 1EEJA 3X3XA 3GRDA 4FCMA 4BU4A 1TTOA 2IYJA 5D83A 2Z76A 1R4YA 2KF5A 3AGNA 5AIGA 1D6UA 3OW22 5G1LA 4O3VA 2RNTA 2W56B 1YGWA 3BB9A 1RLSA 1OUNA 3DUKA 1BGSA 2W2CA 3FG1A 3PGBA 3PXMA 3LXUX 4JF8A 1X1WA 4XBYA 3X42A 1Q7HA 3I0YA 3FH1A 3CD63 4EYCA 3D5IA 1J2BA 1FUTA 3EF8A 2QIYA 4J5GA 3CCE3 1UCKA 3FF2A 3LTCA 1TFKA 1E3RA 3KSPA 4QWTA 1O7WB 1T2HA 2P0XA 1W6GA 1IVWA 3A76A 3EX9A 3F8HA 3X40A 2XH9A 4I4KA 1BRNL 5GSPA 1HU9A 3NM7A 4FCJA 4X2OA 2WO0A 5RNTA 1TRPA 2L4VA 3CCR3 1DE3A 1R4CA 2I9WA 2UX0A 2W9QA 1DETA 1BRKA 1EQKA 1WMNA 4HAAA 1IQYA 1N9JA 1UUWB 4H3UA 1T5YA 2AADA 2H0GA 4HM6B 3H3HA 4WWUC 2K0MA 3NV0A 2KXGA 2RFRA 2O9UX 3SYUA 1I70A 1RDSA 4XBXA 5IG5A 1UUVB 1STFI 2BU4A 3MG3A 3NQZA 4KVHA 1A2VA 1MGRA 5HOHA 1B2MA 4R9LA 4RZMA 1KD14 2P05A 1PU4A 3F14A 4L8PA 3MYTA 3SVAA 1W2B2 1KC84 1LVNA 4CPKA 1QALA 4AKZA 5M1AA 3TDGA 1BU4A 1UCLA 2LQVA 3F8XA 1NU3A 1FGMA 3KIIA 1WMOA 3PZWA 4R4KA 2CH9A 5AI1A 4ILFA 4H61A 1IT7A 2ZL8A 2R4IA 3KZTA 3F7XA 5D81A 1RGKA 3KKGA 3F40A 3T0UA 5AEWB 4XBTA 3CCV3 1RCKA 1JNQA 2CIUA 4ORLA 1BUQA 3MWZA 5CXOA 1G96A 3X3YA 3MKIA 1I0VA 4HJLB 1IK3A 3M8CA 5BIRA 4GL6A 3QK9A 2CFDA 2GSPA 2O3OA 1GYBA 3K7CA 3RGRA 3BNEA 4XDVA 1WTHA 3MHEA 3GWRA 3S29A 1BOXA 5BVBA 1LNHA 1Y4KA 1RMSA 2KF4A 5AYRB 2RBIA 5IG3A 2BNGA 1F8NA 2XEPA 2XF3A 4IPBA 3SLUA 1S723 1YIJ3 1K41A 2BMQB 2INXA 3HZPA 2H0HA 3WODG 2RSXA 1BNJA 2YFIB 2Z6BA 3D9RA 1VQ63 1W02A 1V74A 3NV0B 1RRLA 3FCSB 2HMNB 3BLZA 1ROAA 3EQQB 4EC6A 2ZA4A 1CYUA 2H0IA 2BO9B 3ZG0A 1LNIA 1BNFA 2OWPA 4MMYB 1FA3A 3LMLA 3DGMA 3FF0A 1FGTA 4AEQA 4XDWA 3BNDA 5G1KA 2HMMB 1YI23 3LZAA 1Q864 2P0MA 2CG0A 2GEXA 4IIAA 1NB3I 4NHFA 4WP5A 1JV2B 5TGNA 1JBRA 5D82A 1C54A 1IDPA 1PFPA 1WQLB 2CX1A 1NWWA 2W56A 1V57A 1VQQA 3FSDA 3OXAA 4LZIA 4NPBA 3VF1A 1O7PB 3B7CA 1RGCA 2GBWB 3GZBA 1RNBA 4K1VA 2OQEA 1FGRA 3DM8A 3CC23 8CHOA 2CK3H 3KSED 4BIRA 1A2PA 3G16A 1RTUA 1MGWA 2WGOA 1OGZA 1BNIA 2A15A 4JRFA 1W5ZA 2WGQA 4U13A 3B4PA 3WDGB 1YHQ3 1B2SA 3S5CA 1QVF2 1QJGA 2CFGA 4LEHA 3K9MC 3AMOA 1RNTA 1DVCA 1VQO3 3NBRA 1ULJB 1FW7A 1RN7A 1E97A 1JRQA 2RGQA 4HOHA 1I2EA 5IG0A 2F4YA 4KFFA 5CF1A 1OF5A 1RGLA 3BNBA 3FKAA 2CKFB 2KCDA 4XB5A 4BL2A 3VSYA 1KSIA 1UCIA 2K3DA 2XSHB 3F7SA 4N6UA 3PCSA 1K8A4 2SBLA 2V1LA 4CDLA 1UGIA 1OGXA 3S28A 1GY7A 2HMLB 4L8OA 4EW5A 1JKGA 2CFKA 1G02A 1B2ZA 3DGYA 3LT9A 1IQ8A 3CPW2 1RGHA 2IMJA 1OCVA 5IEOA 2LYXA 3DZLA 4Q53A 4HZ9B 2GBXB 3ECFA 1ROVA 3G0KA 3I563 1ASKA 1BVIA 4O8SA 4EV2A 1WNHA 2GXFA 2OCTA 1M904 1US1A 1GMRA 1DVDA 1BRGA 3BU4A 1A90A 3EBTA 1PYLA 3JUNA 1NB5I 2CWVA 2M7OA 3D3LA 8RNTA 1JJ22 3DXOA 2GU3A 2CFLA 2ZHXB 1L5GB 1FUSA 2WOFA 3MG1A 5BXQA 1N8R4 5CK6A 1X1YA 1B3SA 3Q90A 1FYSA 4GHOA 1W6CA 1SQWA 1YVBI 1U8CB 2CHCA 2W6JH 4N6MA 1T2IA 6STDA 3CCU3 1IVXA 1RGEA 4R9KA 4G1MB 1VQ83 1BSDA 3KE7A 3MSOA 3F9SA 2J8XB 3ZG5A 3RNTA 1M1XB 3NHXA 3CCS3 2KF6A 4KFEA 4HM8B 3DMCA 1E3VA 5JBSA 3CME3 5AYSC 2XSOB 1ZS7A 2D1WA 1JN5A 1GOUA 4R1KA 3K0ZA 1BNSA 3X41A 3EBYA 1VQN3 5KP1A 1JZOA 2BMOB 4R80A 4RNZA 6RNTA 3CCM3 1X1UA 5FGOA 5AIHA 3CCL3 4HM7B 1O7HB 2Y73A 1RRHA 3EC9A 1GS3A 2PZVA 1MWRA 3GZXB 3MG2A 4J8TA 1Q9EA 1GD4A 3EB8A 1YJ93 1SARA 2OOVC 1Q40A 1K734 4J5KA 4HYZA 1V58A 5HGRA 5A0OB 1HYFA 1UCJA 1IU7A 3J7Yd 1QAFA 1QMAA 1AVLA 1C7HA 1ZX2A 4FMAA 4FCZA 2W04A 3DY5A 3NBJA 3CC73 1VQ43 1I3IA 3LH4A 3B4OA 4N6TA 4FR9A 4EV5A 2Q07A 4J9AA 1HKXA 4HM3B 4RNYA 3JUOA 1B27A 1RGAA 3T8UA 1DMMA 3WR2A 4WFOA 4BTWA 2Y74A 3K63A 2XR8B 4HM1B 3NQYA 1N5HA 3CCJ3 1BIRA 1OHSA 1EG9B 1A2KA 2GU1A 3GZRA 1D6YA 3D4AA 1TIJA 1MWTA 3NXJA 2FNQA 5AIFA 3CCQ3 2YFLB 3E99A 5ELUA 1JBSA 1W00A 3N9HA 2E2TA 4EBGA 1YGEA 1VQP3 1OHPA 2F56A 1S5AA 1TFOA 1FZUA 1DMQA 3IJEB 4HVNA 1AR0A 1JB5A 1JN5B 3UL5A 3HX8A 1BSEA 3LTBA 3KFQC 3LOYA 2YX9A 1UGHI 1W4NA 3FG4A 3HOHA 1RN4A 1WMPA 1GMPA 1IVVA 1N9EA 3GZYB 3SX1A 1VQK3 3CMA3 2R41A 4MJDA 1ISKA 1MWSA 1B2XA 2XGNA 1BSBA 2BT3A 2IUJA 1OACA 5G2GA 1N8QA 2CC3A 1RHLA 3V92A 4EXRA 5CLKA 1EA2A 1TUHA 1KWIA 2MC8A 1UDII 5JPPA 1CYVA 1ZO2A 1LQGC 1IVUA 1FGQA 1Q40B 2PNCA 3CNMA 3FLJA 1LOVA 2F98A 1JZDA 4LSOA 1Q824 2Z7AA 1TU5A 1RJOA 1BANA 2FGTA 5EQLA 2XFSA 3JVCA 3CXC2 2STDA 5AEUB 1NNVA 5I97A 9RNTA 1JBTA 7GSPA 3EE1A 7STDA 1JB2A 1DMNA 1RGGA 3NM2A 5IENA 4MEIA 3NBBA 3AGOA 4DKIA 3Q3FA 1VQM3 1B2UA 5EVHA 3G4S3 4WHAA 3SOAA 3CU3A 4LGQA 3EHCA 3JUQA 4HM0B 1VZZA 2IUKA 3WHOA 2C10A 1JKGB 1YJW3 5M18A 1IV9A 2C4BA 4OVMA 1RGFA 4FMDA 1X1XA 2P09A 5FW5A 7RNTA 4LMIA 5BU4A 2OOVA 3SXXA 1M1K4 1NDOB 1I2GA 3N8BA 5KP4A 3T8NA 3DH2A 1BNEA 4K90B 1BRJA 2KRTA 1GOVA 4OUQA 3GAXA 4STDA 4K61A 3OV4A 2XFTA 4NREA 5DRVA 4ZM8A 3G6E3 1UI8A 4BTYA 1GMQA 4HZBB 1LXEA 3A5EA 4KZ1A 1UW1A 4GSPA 3DGNA 1RSNA 3LTDA 1BRHA 3U1WA 2P38A 1DYUA 2ML5A 1IQXA 1YVSA 3UL6A 5JPUA 2W03A 4HM2B 2KAAA 2UGIA 4XM4A 1STDA 1BNRA 1SPUA 4RNTA 3MPHA 1IT8A 1TJDA 1B21A 2JDIH 3QRDA 3I553 1YJN3 2MF7A 1SJWA 3HK4A 3HI7A 4X2HA 4BL3A 1O7NB 2SARA 1EUIC 4O2HA 1CH0A 2XGLA 1ULIB 1GY6A 1OH0A 3G8ZA 2B1XB 1M9GA 3LTAA 2CFWA 3D79A 3OWSA 4TX4A 2QA43 1PY3A 1QAKA 3DGOA 3LYGA 3STDA 3URPA 2HOHA 4HM4B 5AIIA 5M19A 1YIT3 3DGLA 2QGUA 5ELJA 1O7MB 4HBRA 1KQS2 1IYYA 1SIIA 2RCDA 5IG4A 5IF6A 3G713 1B20A 1Q814 3AMOB 2BMRB 3WOFB 4WYKB 1W01A 4MMZB 3O8YA 4L7KA 4K1UA 5IW9A 1T3BA 3OX9A 2HMOB 4N6NB 3RGAA 5IEPA 2OQEC 1OF5B 3NUVA 5LC6A 2CG1A 3VGNA 1UI7A 1IV7A 3ZFZA 1BSCA 4GB5A 2K54A 3Q1CA 1OHOA 2B24B 2IA7A 1CQSA 2HMKB 2CW9A 2E2UA 3L0RA 4N3VA 3X3ZA 3WA3A 2Z77A 1A67A 3EN1B 1TRQA 1D6ZA 1N5PA 4N6V0 4AKYA 2YFJB 1Z1SA 3WMDA 2QEX3 1I0XA 3WA2X 4WYKA 4OK0A 1AV4A 4HKVB 3KN4A 1OPYA 3NX0A 1NJI4 1FUWA 3V98A 1AY7A 1G0TA 1W2ZA 2BIRA 3D5GA 3IMAB 1U5OA 1GD3A 1LQMB 3IPTA 1BRIA 1BNGA 1I8VA 2ML6A 3GSPA 2D42A 4PEJA 3OWUA 4N6LA 2F5WA 1JB4A 3B8LA 4FMBA 3U97A 1FGOA 3BNCA 2CX0A 1MOLA 3N54B 4MMXB 4HM5B 2UUGC 2JQ5A 1RN1A 1TP6A 1I3FA 1GSPA 1LOXA 3AHSA 1YNVX 3SOYA 2OTJ3 1ZGXA 3FZWA 1AQZA 1W7CA 3ROBA 2ZDJA 3EN8A 3FGYA 3UJMA 3HIIA 5STDA 3EJVA 4N6OB 1K28A 2GEYA 3BIRA 1LOWA 4I5QA 5IERA 3FG3A 1CEWI 3UB1A 4BTXA 4KFDA 1BSAA 1BRSA 2XRXB 1BUJA 3ER7A 1GY5A 1HZ1A 2OTL3 3PCRA 1AVKA 1MNLA 2L1SA 1RKYA 4KT3B 1SIHA 3PS8A 4IT7A 2WOHA 3RDEA 4LYLB 3S27A 1O7GB 2IY2A 2W0QA 3SEDA 3CNXA 1VQ53 3S67A 4FMCA 1VQ73 2F99A 2F5MA 5DREA 1EKMA 1NO3A 1QVG2 4CJNA 3HIGA 3AHWA 1LRAA 1Q42A 1UUGB 2F86B 3Q2PA 1Q7Y4 5LC7A 5EEOA 3V99A 1K9M4 2BHMA 3KCHA 3LT8A 3JUMA 1MWUA 3WOEB 2CWUA 3ALAA 1RCLA 3CC43 4RBNA 6GSPA 2E2VA 2FXTA 3H51A 5KP3A 3PYJA 2KF3A 3JUPA 1VQ93 3CPOA
chains in the Genus database with same CATH topology
3UNLA 2C11A 3K5TA 4CCVA 5CF2A 4O02B 1VQL3 2W9PA 2HMJB 3OWYA 1W6YA 2CWTA 3X3XA 3GRDA 4FCMA 5D83A 2Z76A 5AIGA 1D6UA 3OW22 4O3VA 2W56B 3BB9A 1OUNA 3DUKA 3FG1A 2W2CA 3PGBA 3PXMA 4JF8A 3LXUX 4XBYA 3X42A 3I0YA 3FH1A 3CD63 4EYCA 1J2BA 3EF8A 2QIYA 3CCE3 3FF2A 3LTCA 1TFKA 1E3RA 3KSPA 4QWTA 1O7WB 2P0XA 1W6GA 1IVWA 3A76A 3EX9A 3F8HA 3X40A 2XH9A 4I4KA 1HU9A 3NM7A 4FCJA 4X2OA 2WO0A 2L4VA 3CCR3 1R4CA 2I9WA 2UX0A 2W9QA 1EQKA 1WMNA 1IQYA 1N9JA 1UUWB 4H3UA 1T5YA 4HM6B 3H3HA 4WWUC 2K0MA 3NV0A 2KXGA 2RFRA 2O9UX 4XBXA 5IG5A 1UUVB 1STFI 3MG3A 3NQZA 4KVHA 1A2VA 4R9LA 4RZMA 1KD14 2P05A 1PU4A 3F14A 4L8PA 3MYTA 3SVAA 1W2B2 1KC84 1LVNA 1QALA 4AKZA 3TDGA 2LQVA 3F8XA 1NU3A 1FGMA 3KIIA 1WMOA 3PZWA 4R4KA 2CH9A 5AI1A 4H61A 1IT7A 2ZL8A 2R4IA 3KZTA 3F7XA 5D81A 3KKGA 3T0UA 3F40A 5AEWB 4XBTA 3CCV3 1JNQA 2CIUA 4ORLA 1BUQA 3MWZA 5CXOA 1G96A 3X3YA 3MKIA 4HJLB 1IK3A 3M8CA 4GL6A 3QK9A 2CFDA 2O3OA 1GYBA 3K7CA 3RGRA 3BNEA 4XDVA 1WTHA 3MHEA 3GWRA 3S29A 5BVBA 1LNHA 1Y4KA 5AYRB 5IG3A 2BNGA 1F8NA 2XEPA 2XF3A 4IPBA 3SLUA 1S723 1YIJ3 1K41A 2BMQB 2INXA 3HZPA 3WODG 2RSXA 2YFIB 3D9RA 2Z6BA 1VQ63 1W02A 1V74A 3NV0B 1RRLA 3FCSB 3BLZA 2HMNB 1ROAA 3EQQB 4EC6A 1CYUA 2BO9B 2OWPA 4MMYB 1FA3A 3LMLA 3DGMA 3FF0A 1FGTA 4AEQA 4XDWA 3BNDA 1Q864 2HMMB 1YI23 3LZAA 2P0MA 2CG0A 2GEXA 4IIAA 1NB3I 4NHFA 4WP5A 1JV2B 5TGNA 5D82A 1IDPA 1PFPA 1WQLB 2W56A 1NWWA 3FSDA 3OXAA 4LZIA 1Q824 3VF1A 1O7PB 3B7CA 2GBWB 3GZBA 4K1VA 2OQEA 1FGRA 3DM8A 3CC23 8CHOA 2CK3H 3KSED 3G16A 2WGOA 1OGZA 2A15A 4U13A 4JRFA 1W5ZA 2WGQA 3WDGB 3B4PA 1YHQ3 3S5CA 1QVF2 1QJGA 2CFGA 4LEHA 3K9MC 3AMOA 1DVCA 1VQO3 3NBRA 1ULJB 1RN7A 1E97A 1JRQA 2RGQA 5IG0A 4KFFA 5CF1A 1OF5A 3BNBA 3FKAA 2CKFB 2KCDA 4XB5A 3VSYA 1KSIA 2XSHB 4N6UA 3F7SA 1K8A4 3PCSA 2SBLA 2V1LA 4CDLA 1OGXA 3S28A 1GY7A 2HMLB 4L8OA 1JKGA 2CFKA 3LT9A 1IQ8A 3CPW2 2IMJA 1OCVA 5IEOA 2LYXA 3DZLA 4Q53A 4HZ9B 2GBXB 3ECFA 1ROVA 3G0KA 3I563 1ASKA 4O8SA 4EV2A 1WNHA 2GXFA 2OCTA 1M904 1US1A 1DVDA 1A90A 3EBTA 3JUNA 1NB5I 2CWVA 2M7OA 3D3LA 1JJ22 3DXOA 2GU3A 2CFLA 1L5GB 2WOFA 5BXQA 3MG1A 1N8R4 5CK6A 3Q90A 1W6CA 1SQWA 1YVBI 1U8CB 2CHCA 2W6JH 4N6MA 6STDA 3CCU3 1IVXA 4R9KA 4G1MB 1VQ83 3KE7A 3MSOA 3F9SA 1M1XB 3NHXA 3CCS3 4KFEA 4HM8B 3DMCA 1E3VA 5JBSA 3CME3 5AYSC 2XSOB 2D1WA 1JN5A 4R1KA 3K0ZA 3X41A 3EBYA 1VQN3 5KP1A 4RNZA 2BMOB 4R80A 3CCM3 5FGOA 5AIHA 3CCL3 4HM7B 1O7HB 2Y73A 1RRHA 3EC9A 1GS3A 2PZVA 3GZXB 3MG2A 4J8TA 1GD4A 3EB8A 1YJ93 2OOVC 1Q40A 1K734 4HYZA 5HGRA 5A0OB 1IU7A 3J7Yd 1QAFA 1QMAA 1AVLA 1C7HA 1ZX2A 4FMAA 4FCZA 2W04A 3DY5A 3NBJA 3CC73 1VQ43 3LH4A 3B4OA 4N6TA 4FR9A 4EV5A 2Q07A 4J9AA 1HKXA 4HM3B 4RNYA 3JUOA 3T8UA 4BTWA 1DMMA 4WFOA 2Y74A 3K63A 2XR8B 4HM1B 3NQYA 1N5HA 3CCJ3 1OHSA 1EG9B 1A2KA 2GU1A 3GZRA 1D6YA 1TIJA 3NXJA 5AIFA 2FNQA 3CCQ3 2YFLB 3E99A 5ELUA 1W00A 3N9HA 2E2TA 4EBGA 1YGEA 1VQP3 1OHPA 1S5AA 1TFOA 1DMQA 3IJEB 4HVNA 1AR0A 1JB5A 1JN5B 3UL5A 3HX8A 3LTBA 3KFQC 3LOYA 2YX9A 1W4NA 3FG4A 1WMPA 3SX1A 1IVVA 1N9EA 3GZYB 1VQK3 3CMA3 4MJDA 1ISKA 2XGNA 2BT3A 2IUJA 1OACA 5G2GA 1N8QA 2CC3A 3V92A 4EXRA 5CLKA 1EA2A 1TUHA 1KWIA 2MC8A 5JPPA 1CYVA 3CNMA 1Q40B 1IVUA 1FGQA 1ZO2A 2PNCA 3FLJA 2F98A 4LSOA 2Z7AA 1TU5A 1RJOA 2FGTA 5EQLA 2XFSA 3JVCA 3CXC2 2STDA 5AEUB 5I97A 3EE1A 7STDA 1JB2A 1DMNA 3NM2A 5IENA 4MEIA 3NBBA 1VQM3 5EVHA 3G4S3 4WHAA 3SOAA 3CU3A 4LGQA 3EHCA 3JUQA 4HM0B 1VZZA 2IUKA 1YJW3 2C10A 1JKGB 1IV9A 4OVMA 4FMDA 2P09A 5FW5A 4LMIA 2OOVA 3SXXA 1M1K4 1NDOB 5KP4A 3N8BA 3T8NA 4K90B 2KRTA 4OUQA 3GAXA 4STDA 4K61A 3OV4A 2XFTA 4NREA 5DRVA 4ZM8A 3G6E3 1UI8A 4BTYA 4HZBB 1LXEA 4KZ1A 1UW1A 3DGNA 3LTDA 3U1WA 3UL6A 2P38A 1DYUA 2ML5A 1IQXA 5JPUA 2W03A 4HM2B 4XM4A 1STDA 1SPUA 3MPHA 1IT8A 2JDIH 3QRDA 3I553 1YJN3 2MF7A 1SJWA 3HK4A 3HI7A 4X2HA 1O7NB 4O2HA 2XGLA 1ULIB 1GY6A 1OH0A 3G8ZA 2B1XB 1M9GA 3LTAA 2CFWA 3OWSA 2QA43 4TX4A 1QAKA 3DGOA 3LYGA 3STDA 5AIIA 4HM4B 1YIT3 3DGLA 2QGUA 5ELJA 1O7MB 4HBRA 1KQS2 1SIIA 2RCDA 5IG4A 5IF6A 3G713 1Q814 3AMOB 2BMRB 3WOFB 4WYKB 1W01A 4MMZB 3O8YA 4L7KA 4K1UA 5IW9A 4N6NB 3OX9A 2HMOB 3RGAA 5IEPA 2OQEC 1OF5B 3NUVA 5LC6A 2CG1A 3VGNA 1UI7A 1IV7A 4GB5A 2K54A 3Q1CA 1OHOA 2B24B 2IA7A 1CQSA 2HMKB 2CW9A 2E2UA 3L0RA 4N3VA 3X3ZA 3WA3A 2Z77A 1A67A 3EN1B 1D6ZA 1N5PA 4N6V0 4AKYA 2YFJB 1Z1SA 3WMDA 2QEX3 3WA2X 4WYKA 4OK0A 1AV4A 4HKVB 3KN4A 1OPYA 3NX0A 1NJI4 1FUWA 3V98A 1W2ZA 3IMAB 1U5OA 1GD3A 3IPTA 4PEJA 2ML6A 2D42A 3OWUA 4N6LA 4FMBA 1JB4A 3B8LA 3U97A 1FGOA 3BNCA 3N54B 1MOLA 4MMXB 4HM5B 2JQ5A 1TP6A 1LOXA 3SOYA 2OTJ3 3FZWA 1W7CA 3ROBA 2ZDJA 3EN8A 3FGYA 3UJMA 3HIIA 5STDA 3EJVA 4N6OB 1K28A 2GEYA 5IERA 3FG3A 1CEWI 3UB1A 4BTXA 4KFDA 2XRXB 3ER7A 1GY5A 2OTL3 3PCRA 1AVKA 1MNLA 1RKYA 1SIHA 3PS8A 4IT7A 2WOHA 3RDEA 3S27A 1O7GB 2W0QA 3SEDA 3CNXA 1VQ53 3S67A 4FMCA 1VQ73 2F99A 5DREA 1EKMA 1NO3A 1QVG2 3HIGA 1Q42A 2F86B 3Q2PA 1Q7Y4 5LC7A 5EEOA 3V99A 1K9M4 2BHMA 3LT8A 3JUMA 3WOEB 2CWUA 3ALAA 3CC43 4RBNA 2E2VA 2FXTA 3H51A 5KP3A 3PYJA 3JUPA 1VQ93 3CPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  3CCE 3;  1YJW 3;  1YJ9 3;  1VQ8 3;  1QVF 2;  1K73 4;  1VQP 3;  1M90 4;  1VQ5 3;  1VQO 3;  1VQ7 3;  1YJN 3;  3I55 3;  1KD1 4;  3CCS 3;  1VQL 3;  1W2B 2;  1QVG 2;  1KC8 4;  1Q86 4;  1YI2 3;  1M1K 4;  2OTJ 3;  3CXC 2;  3CME 3;  3CC7 3;  1YHQ 3;  1JJ2 2;  1VQ4 3;  1K8A 4;  1Q82 4;  1Q7Y 4;  3CCR 3;  2QA4 3;  1K9M 4;  1VQN 3;  3OW2 2;  1VQK 3;  3CMA 3;  1N8R 4;  2QEX 3;  1YIT 3;  3CCM 3;  3G6E 3;  1S72 3;  3CC4 3;  3CC2 3;  3CPW 2;  3CCL 3;  1YIJ 3;  1NJI 4;  3CCJ 3;  1VQM 3;  2OTL 3;  3G4S 3;  3CCV 3;  1VQ9 3;  3CD6 3;  1KQS 2;  1Q81 4;  3G71 3;  1VQ6 3;  3CCQ 3;  3CCU 3; 
#chains in the Genus database with same CATH topology
 1GOY A;  2AAE A;  1BAO A;  1LOY A;  2C11 A;  3K5T A;  3UNL A;  4CCV A;  5CF2 A;  1I2F A;  4O02 B;  1VQL 3;  2W9P A;  2HMJ B;  3OWY A;  1W6Y A;  2CWT A;  1EEJ A;  3X3X A;  3GRD A;  4FCM A;  4BU4 A;  1TTO A;  2IYJ A;  5D83 A;  2Z76 A;  1R4Y A;  2KF5 A;  3AGN A;  5AIG A;  1D6U A;  3OW2 2;  5G1L A;  4O3V A;  2RNT A;  2W56 B;  1YGW A;  3BB9 A;  1RLS A;  1OUN A;  3DUK A;  1BGS A;  2W2C A;  3FG1 A;  3PGB A;  3PXM A;  3LXU X;  4JF8 A;  1X1W A;  4XBY A;  3X42 A;  1Q7H A;  3I0Y A;  3FH1 A;  3CD6 3;  4EYC A;  3D5I A;  1J2B A;  1FUT A;  3EF8 A;  2QIY A;  4J5G A;  3CCE 3;  1UCK A;  3FF2 A;  3LTC A;  1TFK A;  1E3R A;  3KSP A;  4QWT A;  1O7W B;  1T2H A;  2P0X A;  1W6G A;  1IVW A;  3A76 A;  3EX9 A;  3F8H A;  3X40 A;  2XH9 A;  4I4K A;  1BRN L;  5GSP A;  1HU9 A;  3NM7 A;  4FCJ A;  4X2O A;  2WO0 A;  5RNT A;  1TRP A;  2L4V A;  3CCR 3;  1DE3 A;  1R4C A;  2I9W A;  2UX0 A;  2W9Q A;  1DET A;  1BRK A;  1EQK A;  1WMN A;  4HAA A;  1IQY A;  1N9J A;  1UUW B;  4H3U A;  1T5Y A;  2AAD A;  2H0G A;  4HM6 B;  3H3H A;  4WWU C;  2K0M A;  3NV0 A;  2KXG A;  2RFR A;  2O9U X;  3SYU A;  1I70 A;  1RDS A;  4XBX A;  5IG5 A;  1UUV B;  1STF I;  2BU4 A;  3MG3 A;  3NQZ A;  4KVH A;  1A2V A;  1MGR A;  5HOH A;  1B2M A;  4R9L A;  4RZM A;  1KD1 4;  2P05 A;  1PU4 A;  3F14 A;  4L8P A;  3MYT A;  3SVA A;  1W2B 2;  1KC8 4;  1LVN A;  4CPK A;  1QAL A;  4AKZ A;  5M1A A;  3TDG A;  1BU4 A;  1UCL A;  2LQV A;  3F8X A;  1NU3 A;  1FGM A;  3KII A;  1WMO A;  3PZW A;  4R4K A;  2CH9 A;  5AI1 A;  4ILF A;  4H61 A;  1IT7 A;  2ZL8 A;  2R4I A;  3KZT A;  3F7X A;  5D81 A;  1RGK A;  3KKG A;  3F40 A;  3T0U A;  5AEW B;  4XBT A;  3CCV 3;  1RCK A;  1JNQ A;  2CIU A;  4ORL A;  1BUQ A;  3MWZ A;  5CXO A;  1G96 A;  3X3Y A;  3MKI A;  1I0V A;  4HJL B;  1IK3 A;  3M8C A;  5BIR A;  4GL6 A;  3QK9 A;  2CFD A;  2GSP A;  2O3O A;  1GYB A;  3K7C A;  3RGR A;  3BNE A;  4XDV A;  1WTH A;  3MHE A;  3GWR A;  3S29 A;  1BOX A;  5BVB A;  1LNH A;  1Y4K A;  1RMS A;  2KF4 A;  5AYR B;  2RBI A;  5IG3 A;  2BNG A;  1F8N A;  2XEP A;  2XF3 A;  4IPB A;  3SLU A;  1S72 3;  1YIJ 3;  1K41 A;  2BMQ B;  2INX A;  3HZP A;  2H0H A;  3WOD G;  2RSX A;  1BNJ A;  2YFI B;  2Z6B A;  3D9R A;  1VQ6 3;  1W02 A;  1V74 A;  3NV0 B;  1RRL A;  3FCS B;  2HMN B;  3BLZ A;  1ROA A;  3EQQ B;  4EC6 A;  2ZA4 A;  1CYU A;  2H0I A;  2BO9 B;  3ZG0 A;  1LNI A;  1BNF A;  2OWP A;  4MMY B;  1FA3 A;  3LML A;  3DGM A;  3FF0 A;  1FGT A;  4AEQ A;  4XDW A;  3BND A;  5G1K A;  2HMM B;  1YI2 3;  3LZA A;  1Q86 4;  2P0M A;  2CG0 A;  2GEX A;  4IIA A;  1NB3 I;  4NHF A;  4WP5 A;  1JV2 B;  5TGN A;  1JBR A;  5D82 A;  1C54 A;  1IDP A;  1PFP A;  1WQL B;  2CX1 A;  1NWW A;  2W56 A;  1V57 A;  1VQQ A;  3FSD A;  3OXA A;  4LZI A;  4NPB A;  3VF1 A;  1O7P B;  3B7C A;  1RGC A;  2GBW B;  3GZB A;  1RNB A;  4K1V A;  2OQE A;  1FGR A;  3DM8 A;  3CC2 3;  8CHO A;  2CK3 H;  3KSE D;  4BIR A;  1A2P A;  3G16 A;  1RTU A;  1MGW A;  2WGO A;  1OGZ A;  1BNI A;  2A15 A;  4JRF A;  1W5Z A;  2WGQ A;  4U13 A;  3B4P A;  3WDG B;  1YHQ 3;  1B2S A;  3S5C A;  1QVF 2;  1QJG A;  2CFG A;  4LEH A;  3K9M C;  3AMO A;  1RNT A;  1DVC A;  1VQO 3;  3NBR A;  1ULJ B;  1FW7 A;  1RN7 A;  1E97 A;  1JRQ A;  2RGQ A;  4HOH A;  1I2E A;  5IG0 A;  2F4Y A;  4KFF A;  5CF1 A;  1OF5 A;  1RGL A;  3BNB A;  3FKA A;  2CKF B;  2KCD A;  4XB5 A;  4BL2 A;  3VSY A;  1KSI A;  1UCI A;  2K3D A;  2XSH B;  3F7S A;  4N6U A;  3PCS A;  1K8A 4;  2SBL A;  2V1L A;  4CDL A;  1UGI A;  1OGX A;  3S28 A;  1GY7 A;  2HML B;  4L8O A;  4EW5 A;  1JKG A;  2CFK A;  1G02 A;  1B2Z A;  3DGY A;  3LT9 A;  1IQ8 A;  3CPW 2;  1RGH A;  2IMJ A;  1OCV A;  5IEO A;  2LYX A;  3DZL A;  4Q53 A;  4HZ9 B;  2GBX B;  3ECF A;  1ROV A;  3G0K A;  3I56 3;  1ASK A;  1BVI A;  4O8S A;  4EV2 A;  1WNH A;  2GXF A;  2OCT A;  1M90 4;  1US1 A;  1GMR A;  1DVD A;  1BRG A;  3BU4 A;  1A90 A;  3EBT A;  1PYL A;  3JUN A;  1NB5 I;  2CWV A;  2M7O A;  3D3L A;  8RNT A;  1JJ2 2;  3DXO A;  2GU3 A;  2CFL A;  2ZHX B;  1L5G B;  1FUS A;  2WOF A;  3MG1 A;  5BXQ A;  1N8R 4;  5CK6 A;  1X1Y A;  1B3S A;  3Q90 A;  1FYS A;  4GHO A;  1W6C A;  1SQW A;  1YVB I;  1U8C B;  2CHC A;  2W6J H;  4N6M A;  1T2I A;  6STD A;  3CCU 3;  1IVX A;  1RGE A;  4R9K A;  4G1M B;  1VQ8 3;  1BSD A;  3KE7 A;  3MSO A;  3F9S A;  2J8X B;  3ZG5 A;  3RNT A;  1M1X B;  3NHX A;  3CCS 3;  2KF6 A;  4KFE A;  4HM8 B;  3DMC A;  1E3V A;  5JBS A;  3CME 3;  5AYS C;  2XSO B;  1ZS7 A;  2D1W A;  1JN5 A;  1GOU A;  4R1K A;  3K0Z A;  1BNS A;  3X41 A;  3EBY A;  1VQN 3;  5KP1 A;  1JZO A;  2BMO B;  4R80 A;  4RNZ A;  6RNT A;  3CCM 3;  1X1U A;  5FGO A;  5AIH A;  3CCL 3;  4HM7 B;  1O7H B;  2Y73 A;  1RRH A;  3EC9 A;  1GS3 A;  2PZV A;  1MWR A;  3GZX B;  3MG2 A;  4J8T A;  1Q9E A;  1GD4 A;  3EB8 A;  1YJ9 3;  1SAR A;  2OOV C;  1Q40 A;  1K73 4;  4J5K A;  4HYZ A;  1V58 A;  5HGR A;  5A0O B;  1HYF A;  1UCJ A;  1IU7 A;  3J7Y d;  1QAF A;  1QMA A;  1AVL A;  1C7H A;  1ZX2 A;  4FMA A;  4FCZ A;  2W04 A;  3DY5 A;  3NBJ A;  3CC7 3;  1VQ4 3;  1I3I A;  3LH4 A;  3B4O A;  4N6T A;  4FR9 A;  4EV5 A;  2Q07 A;  4J9A A;  1HKX A;  4HM3 B;  4RNY A;  3JUO A;  1B27 A;  1RGA A;  3T8U A;  1DMM A;  3WR2 A;  4WFO A;  4BTW A;  2Y74 A;  3K63 A;  2XR8 B;  4HM1 B;  3NQY A;  1N5H A;  3CCJ 3;  1BIR A;  1OHS A;  1EG9 B;  1A2K A;  2GU1 A;  3GZR A;  1D6Y A;  3D4A A;  1TIJ A;  1MWT A;  3NXJ A;  2FNQ A;  5AIF A;  3CCQ 3;  2YFL B;  3E99 A;  5ELU A;  1JBS A;  1W00 A;  3N9H A;  2E2T A;  4EBG A;  1YGE A;  1VQP 3;  1OHP A;  2F56 A;  1S5A A;  1TFO A;  1FZU A;  1DMQ A;  3IJE B;  4HVN A;  1AR0 A;  1JB5 A;  1JN5 B;  3UL5 A;  3HX8 A;  1BSE A;  3LTB A;  3KFQ C;  3LOY A;  2YX9 A;  1UGH I;  1W4N A;  3FG4 A;  3HOH A;  1RN4 A;  1WMP A;  1GMP A;  1IVV A;  1N9E A;  3GZY B;  3SX1 A;  1VQK 3;  3CMA 3;  2R41 A;  4MJD A;  1ISK A;  1MWS A;  1B2X A;  2XGN A;  1BSB A;  2BT3 A;  2IUJ A;  1OAC A;  5G2G A;  1N8Q A;  2CC3 A;  1RHL A;  3V92 A;  4EXR A;  5CLK A;  1EA2 A;  1TUH A;  1KWI A;  2MC8 A;  1UDI I;  5JPP A;  1CYV A;  1ZO2 A;  1LQG C;  1IVU A;  1FGQ A;  1Q40 B;  2PNC A;  3CNM A;  3FLJ A;  1LOV A;  2F98 A;  1JZD A;  4LSO A;  1Q82 4;  2Z7A A;  1TU5 A;  1RJO A;  1BAN A;  2FGT A;  5EQL A;  2XFS A;  3JVC A;  3CXC 2;  2STD A;  5AEU B;  1NNV A;  5I97 A;  9RNT A;  1JBT A;  7GSP A;  3EE1 A;  7STD A;  1JB2 A;  1DMN A;  1RGG A;  3NM2 A;  5IEN A;  4MEI A;  3NBB A;  3AGO A;  4DKI A;  3Q3F A;  1VQM 3;  1B2U A;  5EVH A;  3G4S 3;  4WHA A;  3SOA A;  3CU3 A;  4LGQ A;  3EHC A;  3JUQ A;  4HM0 B;  1VZZ A;  2IUK A;  3WHO A;  2C10 A;  1JKG B;  1YJW 3;  5M18 A;  1IV9 A;  2C4B A;  4OVM A;  1RGF A;  4FMD A;  1X1X A;  2P09 A;  5FW5 A;  7RNT A;  4LMI A;  5BU4 A;  2OOV A;  3SXX A;  1M1K 4;  1NDO B;  1I2G A;  3N8B A;  5KP4 A;  3T8N A;  3DH2 A;  1BNE A;  4K90 B;  1BRJ A;  2KRT A;  1GOV A;  4OUQ A;  3GAX A;  4STD A;  4K61 A;  3OV4 A;  2XFT A;  4NRE A;  5DRV A;  4ZM8 A;  3G6E 3;  1UI8 A;  4BTY A;  1GMQ A;  4HZB B;  1LXE A;  3A5E A;  4KZ1 A;  1UW1 A;  4GSP A;  3DGN A;  1RSN A;  3LTD A;  1BRH A;  3U1W A;  2P38 A;  1DYU A;  2ML5 A;  1IQX A;  1YVS A;  3UL6 A;  5JPU A;  2W03 A;  4HM2 B;  2KAA A;  2UGI A;  4XM4 A;  1STD A;  1BNR A;  1SPU A;  4RNT A;  3MPH A;  1IT8 A;  1TJD A;  1B21 A;  2JDI H;  3QRD A;  3I55 3;  1YJN 3;  2MF7 A;  1SJW A;  3HK4 A;  3HI7 A;  4X2H A;  4BL3 A;  1O7N B;  2SAR A;  1EUI C;  4O2H A;  1CH0 A;  2XGL A;  1ULI B;  1GY6 A;  1OH0 A;  3G8Z A;  2B1X B;  1M9G A;  3LTA A;  2CFW A;  3D79 A;  3OWS A;  4TX4 A;  2QA4 3;  1PY3 A;  1QAK A;  3DGO A;  3LYG A;  3STD A;  3URP A;  2HOH A;  4HM4 B;  5AII A;  5M19 A;  1YIT 3;  3DGL A;  2QGU A;  5ELJ A;  1O7M B;  4HBR A;  1KQS 2;  1IYY A;  1SII A;  2RCD A;  5IG4 A;  5IF6 A;  3G71 3;  1B20 A;  1Q81 4;  3AMO B;  2BMR B;  3WOF B;  4WYK B;  1W01 A;  4MMZ B;  3O8Y A;  4L7K A;  4K1U A;  5IW9 A;  1T3B A;  3OX9 A;  2HMO B;  4N6N B;  3RGA A;  5IEP A;  2OQE C;  1OF5 B;  3NUV A;  5LC6 A;  2CG1 A;  3VGN A;  1UI7 A;  1IV7 A;  3ZFZ A;  1BSC A;  4GB5 A;  2K54 A;  3Q1C A;  1OHO A;  2B24 B;  2IA7 A;  1CQS A;  2HMK B;  2CW9 A;  2E2U A;  3L0R A;  4N3V A;  3X3Z A;  3WA3 A;  2Z77 A;  1A67 A;  3EN1 B;  1TRQ A;  1D6Z A;  1N5P A;  4N6V 0;  4AKY A;  2YFJ B;  1Z1S A;  3WMD A;  2QEX 3;  1I0X A;  3WA2 X;  4WYK A;  4OK0 A;  1AV4 A;  4HKV B;  3KN4 A;  1OPY A;  3NX0 A;  1NJI 4;  1FUW A;  3V98 A;  1AY7 A;  1G0T A;  1W2Z A;  2BIR A;  3D5G A;  3IMA B;  1U5O A;  1GD3 A;  1LQM B;  3IPT A;  1BRI A;  1BNG A;  1I8V A;  2ML6 A;  3GSP A;  2D42 A;  4PEJ A;  3OWU A;  4N6L A;  2F5W A;  1JB4 A;  3B8L A;  4FMB A;  3U97 A;  1FGO A;  3BNC A;  2CX0 A;  1MOL A;  3N54 B;  4MMX B;  4HM5 B;  2UUG C;  2JQ5 A;  1RN1 A;  1TP6 A;  1I3F A;  1GSP A;  1LOX A;  3AHS A;  1YNV X;  3SOY A;  2OTJ 3;  1ZGX A;  3FZW A;  1AQZ A;  1W7C A;  3ROB A;  2ZDJ A;  3EN8 A;  3FGY A;  3UJM A;  3HII A;  5STD A;  3EJV A;  4N6O B;  1K28 A;  2GEY A;  3BIR A;  1LOW A;  4I5Q A;  5IER A;  3FG3 A;  1CEW I;  3UB1 A;  4BTX A;  4KFD A;  1BSA A;  1BRS A;  2XRX B;  1BUJ A;  3ER7 A;  1GY5 A;  1HZ1 A;  2OTL 3;  3PCR A;  1AVK A;  1MNL A;  2L1S A;  1RKY A;  4KT3 B;  1SIH A;  3PS8 A;  4IT7 A;  2WOH A;  3RDE A;  4LYL B;  3S27 A;  1O7G B;  2IY2 A;  2W0Q A;  3SED A;  3CNX A;  1VQ5 3;  3S67 A;  4FMC A;  1VQ7 3;  2F99 A;  2F5M A;  5DRE A;  1EKM A;  1NO3 A;  1QVG 2;  4CJN A;  3HIG A;  3AHW A;  1LRA A;  1Q42 A;  1UUG B;  2F86 B;  3Q2P A;  1Q7Y 4;  5LC7 A;  5EEO A;  3V99 A;  1K9M 4;  2BHM A;  3KCH A;  3LT8 A;  3JUM A;  1MWU A;  3WOE B;  2CWU A;  3ALA A;  1RCL A;  3CC4 3;  4RBN A;  6GSP A;  2E2V A;  2FXT A;  3H51 A;  5KP3 A;  3PYJ A;  2KF3 A;  3JUP A;  1VQ9 3;  3CPO A; 
#chains in the Genus database with same CATH homology
 3UNL A;  2C11 A;  3K5T A;  4CCV A;  5CF2 A;  4O02 B;  1VQL 3;  2W9P A;  2HMJ B;  3OWY A;  1W6Y A;  2CWT A;  3X3X A;  3GRD A;  4FCM A;  5D83 A;  2Z76 A;  5AIG A;  1D6U A;  3OW2 2;  4O3V A;  2W56 B;  3BB9 A;  1OUN A;  3DUK A;  3FG1 A;  2W2C A;  3PGB A;  3PXM A;  4JF8 A;  3LXU X;  4XBY A;  3X42 A;  3I0Y A;  3FH1 A;  3CD6 3;  4EYC A;  1J2B A;  3EF8 A;  2QIY A;  3CCE 3;  3FF2 A;  3LTC A;  1TFK A;  1E3R A;  3KSP A;  4QWT A;  1O7W B;  2P0X A;  1W6G A;  1IVW A;  3A76 A;  3EX9 A;  3F8H A;  3X40 A;  2XH9 A;  4I4K A;  1HU9 A;  3NM7 A;  4FCJ A;  4X2O A;  2WO0 A;  2L4V A;  3CCR 3;  1R4C A;  2I9W A;  2UX0 A;  2W9Q A;  1EQK A;  1WMN A;  1IQY A;  1N9J A;  1UUW B;  4H3U A;  1T5Y A;  4HM6 B;  3H3H A;  4WWU C;  2K0M A;  3NV0 A;  2KXG A;  2RFR A;  2O9U X;  4XBX A;  5IG5 A;  1UUV B;  1STF I;  3MG3 A;  3NQZ A;  4KVH A;  1A2V A;  4R9L A;  4RZM A;  1KD1 4;  2P05 A;  1PU4 A;  3F14 A;  4L8P A;  3MYT A;  3SVA A;  1W2B 2;  1KC8 4;  1LVN A;  1QAL A;  4AKZ A;  3TDG A;  2LQV A;  3F8X A;  1NU3 A;  1FGM A;  3KII A;  1WMO A;  3PZW A;  4R4K A;  2CH9 A;  5AI1 A;  4H61 A;  1IT7 A;  2ZL8 A;  2R4I A;  3KZT A;  3F7X A;  5D81 A;  3KKG A;  3T0U A;  3F40 A;  5AEW B;  4XBT A;  3CCV 3;  1JNQ A;  2CIU A;  4ORL A;  1BUQ A;  3MWZ A;  5CXO A;  1G96 A;  3X3Y A;  3MKI A;  4HJL B;  1IK3 A;  3M8C A;  4GL6 A;  3QK9 A;  2CFD A;  2O3O A;  1GYB A;  3K7C A;  3RGR A;  3BNE A;  4XDV A;  1WTH A;  3MHE A;  3GWR A;  3S29 A;  5BVB A;  1LNH A;  1Y4K A;  5AYR B;  5IG3 A;  2BNG A;  1F8N A;  2XEP A;  2XF3 A;  4IPB A;  3SLU A;  1S72 3;  1YIJ 3;  1K41 A;  2BMQ B;  2INX A;  3HZP A;  3WOD G;  2RSX A;  2YFI B;  3D9R A;  2Z6B A;  1VQ6 3;  1W02 A;  1V74 A;  3NV0 B;  1RRL A;  3FCS B;  3BLZ A;  2HMN B;  1ROA A;  3EQQ B;  4EC6 A;  1CYU A;  2BO9 B;  2OWP A;  4MMY B;  1FA3 A;  3LML A;  3DGM A;  3FF0 A;  1FGT A;  4AEQ A;  4XDW A;  3BND A;  1Q86 4;  2HMM B;  1YI2 3;  3LZA A;  2P0M A;  2CG0 A;  2GEX A;  4IIA A;  1NB3 I;  4NHF A;  4WP5 A;  1JV2 B;  5TGN A;  5D82 A;  1IDP A;  1PFP A;  1WQL B;  2W56 A;  1NWW A;  3FSD A;  3OXA A;  4LZI A;  1Q82 4;  3VF1 A;  1O7P B;  3B7C A;  2GBW B;  3GZB A;  4K1V A;  2OQE A;  1FGR A;  3DM8 A;  3CC2 3;  8CHO A;  2CK3 H;  3KSE D;  3G16 A;  2WGO A;  1OGZ A;  2A15 A;  4U13 A;  4JRF A;  1W5Z A;  2WGQ A;  3WDG B;  3B4P A;  1YHQ 3;  3S5C A;  1QVF 2;  1QJG A;  2CFG A;  4LEH A;  3K9M C;  3AMO A;  1DVC A;  1VQO 3;  3NBR A;  1ULJ B;  1RN7 A;  1E97 A;  1JRQ A;  2RGQ A;  5IG0 A;  4KFF A;  5CF1 A;  1OF5 A;  3BNB A;  3FKA A;  2CKF B;  2KCD A;  4XB5 A;  3VSY A;  1KSI A;  2XSH B;  4N6U A;  3F7S A;  1K8A 4;  3PCS A;  2SBL A;  2V1L A;  4CDL A;  1OGX A;  3S28 A;  1GY7 A;  2HML B;  4L8O A;  1JKG A;  2CFK A;  3LT9 A;  1IQ8 A;  3CPW 2;  2IMJ A;  1OCV A;  5IEO A;  2LYX A;  3DZL A;  4Q53 A;  4HZ9 B;  2GBX B;  3ECF A;  1ROV A;  3G0K A;  3I56 3;  1ASK A;  4O8S A;  4EV2 A;  1WNH A;  2GXF A;  2OCT A;  1M90 4;  1US1 A;  1DVD A;  1A90 A;  3EBT A;  3JUN A;  1NB5 I;  2CWV A;  2M7O A;  3D3L A;  1JJ2 2;  3DXO A;  2GU3 A;  2CFL A;  1L5G B;  2WOF A;  5BXQ A;  3MG1 A;  1N8R 4;  5CK6 A;  3Q90 A;  1W6C A;  1SQW A;  1YVB I;  1U8C B;  2CHC A;  2W6J H;  4N6M A;  6STD A;  3CCU 3;  1IVX A;  4R9K A;  4G1M B;  1VQ8 3;  3KE7 A;  3MSO A;  3F9S A;  1M1X B;  3NHX A;  3CCS 3;  4KFE A;  4HM8 B;  3DMC A;  1E3V A;  5JBS A;  3CME 3;  5AYS C;  2XSO B;  2D1W A;  1JN5 A;  4R1K A;  3K0Z A;  3X41 A;  3EBY A;  1VQN 3;  5KP1 A;  4RNZ A;  2BMO B;  4R80 A;  3CCM 3;  5FGO A;  5AIH A;  3CCL 3;  4HM7 B;  1O7H B;  2Y73 A;  1RRH A;  3EC9 A;  1GS3 A;  2PZV A;  3GZX B;  3MG2 A;  4J8T A;  1GD4 A;  3EB8 A;  1YJ9 3;  2OOV C;  1Q40 A;  1K73 4;  4HYZ A;  5HGR A;  5A0O B;  1IU7 A;  3J7Y d;  1QAF A;  1QMA A;  1AVL A;  1C7H A;  1ZX2 A;  4FMA A;  4FCZ A;  2W04 A;  3DY5 A;  3NBJ A;  3CC7 3;  1VQ4 3;  3LH4 A;  3B4O A;  4N6T A;  4FR9 A;  4EV5 A;  2Q07 A;  4J9A A;  1HKX A;  4HM3 B;  4RNY A;  3JUO A;  3T8U A;  4BTW A;  1DMM A;  4WFO A;  2Y74 A;  3K63 A;  2XR8 B;  4HM1 B;  3NQY A;  1N5H A;  3CCJ 3;  1OHS A;  1EG9 B;  1A2K A;  2GU1 A;  3GZR A;  1D6Y A;  1TIJ A;  3NXJ A;  5AIF A;  2FNQ A;  3CCQ 3;  2YFL B;  3E99 A;  5ELU A;  1W00 A;  3N9H A;  2E2T A;  4EBG A;  1YGE A;  1VQP 3;  1OHP A;  1S5A A;  1TFO A;  1DMQ A;  3IJE B;  4HVN A;  1AR0 A;  1JB5 A;  1JN5 B;  3UL5 A;  3HX8 A;  3LTB A;  3KFQ C;  3LOY A;  2YX9 A;  1W4N A;  3FG4 A;  1WMP A;  3SX1 A;  1IVV A;  1N9E A;  3GZY B;  1VQK 3;  3CMA 3;  4MJD A;  1ISK A;  2XGN A;  2BT3 A;  2IUJ A;  1OAC A;  5G2G A;  1N8Q A;  2CC3 A;  3V92 A;  4EXR A;  5CLK A;  1EA2 A;  1TUH A;  1KWI A;  2MC8 A;  5JPP A;  1CYV A;  3CNM A;  1Q40 B;  1IVU A;  1FGQ A;  1ZO2 A;  2PNC A;  3FLJ A;  2F98 A;  4LSO A;  2Z7A A;  1TU5 A;  1RJO A;  2FGT A;  5EQL A;  2XFS A;  3JVC A;  3CXC 2;  2STD A;  5AEU B;  5I97 A;  3EE1 A;  7STD A;  1JB2 A;  1DMN A;  3NM2 A;  5IEN A;  4MEI A;  3NBB A;  1VQM 3;  5EVH A;  3G4S 3;  4WHA A;  3SOA A;  3CU3 A;  4LGQ A;  3EHC A;  3JUQ A;  4HM0 B;  1VZZ A;  2IUK A;  1YJW 3;  2C10 A;  1JKG B;  1IV9 A;  4OVM A;  4FMD A;  2P09 A;  5FW5 A;  4LMI A;  2OOV A;  3SXX A;  1M1K 4;  1NDO B;  5KP4 A;  3N8B A;  3T8N A;  4K90 B;  2KRT A;  4OUQ A;  3GAX A;  4STD A;  4K61 A;  3OV4 A;  2XFT A;  4NRE A;  5DRV A;  4ZM8 A;  3G6E 3;  1UI8 A;  4BTY A;  4HZB B;  1LXE A;  4KZ1 A;  1UW1 A;  3DGN A;  3LTD A;  3U1W A;  3UL6 A;  2P38 A;  1DYU A;  2ML5 A;  1IQX A;  5JPU A;  2W03 A;  4HM2 B;  4XM4 A;  1STD A;  1SPU A;  3MPH A;  1IT8 A;  2JDI H;  3QRD A;  3I55 3;  1YJN 3;  2MF7 A;  1SJW A;  3HK4 A;  3HI7 A;  4X2H A;  1O7N B;  4O2H A;  2XGL A;  1ULI B;  1GY6 A;  1OH0 A;  3G8Z A;  2B1X B;  1M9G A;  3LTA A;  2CFW A;  3OWS A;  2QA4 3;  4TX4 A;  1QAK A;  3DGO A;  3LYG A;  3STD A;  5AII A;  4HM4 B;  1YIT 3;  3DGL A;  2QGU A;  5ELJ A;  1O7M B;  4HBR A;  1KQS 2;  1SII A;  2RCD A;  5IG4 A;  5IF6 A;  3G71 3;  1Q81 4;  3AMO B;  2BMR B;  3WOF B;  4WYK B;  1W01 A;  4MMZ B;  3O8Y A;  4L7K A;  4K1U A;  5IW9 A;  4N6N B;  3OX9 A;  2HMO B;  3RGA A;  5IEP A;  2OQE C;  1OF5 B;  3NUV A;  5LC6 A;  2CG1 A;  3VGN A;  1UI7 A;  1IV7 A;  4GB5 A;  2K54 A;  3Q1C A;  1OHO A;  2B24 B;  2IA7 A;  1CQS A;  2HMK B;  2CW9 A;  2E2U A;  3L0R A;  4N3V A;  3X3Z A;  3WA3 A;  2Z77 A;  1A67 A;  3EN1 B;  1D6Z A;  1N5P A;  4N6V 0;  4AKY A;  2YFJ B;  1Z1S A;  3WMD A;  2QEX 3;  3WA2 X;  4WYK A;  4OK0 A;  1AV4 A;  4HKV B;  3KN4 A;  1OPY A;  3NX0 A;  1NJI 4;  1FUW A;  3V98 A;  1W2Z A;  3IMA B;  1U5O A;  1GD3 A;  3IPT A;  4PEJ A;  2ML6 A;  2D42 A;  3OWU A;  4N6L A;  4FMB A;  1JB4 A;  3B8L A;  3U97 A;  1FGO A;  3BNC A;  3N54 B;  1MOL A;  4MMX B;  4HM5 B;  2JQ5 A;  1TP6 A;  1LOX A;  3SOY A;  2OTJ 3;  3FZW A;  1W7C A;  3ROB A;  2ZDJ A;  3EN8 A;  3FGY A;  3UJM A;  3HII A;  5STD A;  3EJV A;  4N6O B;  1K28 A;  2GEY A;  5IER A;  3FG3 A;  1CEW I;  3UB1 A;  4BTX A;  4KFD A;  2XRX B;  3ER7 A;  1GY5 A;  2OTL 3;  3PCR A;  1AVK A;  1MNL A;  1RKY A;  1SIH A;  3PS8 A;  4IT7 A;  2WOH A;  3RDE A;  3S27 A;  1O7G B;  2W0Q A;  3SED A;  3CNX A;  1VQ5 3;  3S67 A;  4FMC A;  1VQ7 3;  2F99 A;  5DRE A;  1EKM A;  1NO3 A;  1QVG 2;  3HIG A;  1Q42 A;  2F86 B;  3Q2P A;  1Q7Y 4;  5LC7 A;  5EEO A;  3V99 A;  1K9M 4;  2BHM A;  3LT8 A;  3JUM A;  3WOE B;  2CWU A;  3ALA A;  3CC4 3;  4RBN A;  2E2V A;  2FXT A;  3H51 A;  5KP3 A;  3PYJ A;  3JUP A;  1VQ9 3;  3CPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...