1GYBA

N77y point mutant of yntf2 bound to fxfg nucleoporin repeat
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
b'LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLNYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 33
structure length 122
sequence length 122
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gybA00
1Q42A 2YFLB 3F8HA 3UJMA 3IPTA 4OUQA 4R9KA 2GBWB 3FF2A 4HZBB 1O7NB 3F14A 2B24B 2IMJA 1OPYA 2OWPA 3EJVA 3OV4A 3T8NA 2GXFA 3MG2A 3K0ZA 2UX0A 2GEYA 5BXQA 7STDA 1OHPA 1GY5A 4HVNA 4J8TA 4MJDA 3EX9A 1ASKA 1OHOA 3OWSA 5AEWB 3FGYA 2XRXB 3LYGA 1GY7A 4HZ9B 3NM2A 3KE7A 5HGRA 3WMDA 4R1KA 5FW5A 3VSYA 4FCMA 4ORLA 5AI1A 5KP1A 2R4IA 2BMQB 1U5OA 5CF2A 2STDA 4GB5A 2QGUA 3RGAA 3JUOA 2INXA 3DZLA 5AIFA 4STDA 1JN5B 3F8XA 3E99A 1JN5A 1W02A 2F86B 5D83A 1W6YA 3OXAA 1OHSA 3GZRA 3A76A 2CKFB 2PZVA 2HMKB 3RGRA 8CHOA 2F99A 5KP4A 1S5AA 4Q53A 1OF5A 5BVBA 4LGQA 4WWUC 1E97A 4H3UA 2XSHB 3SEDA 3EBYA 4XB5A 3FKAA 1O7PB 5TGNA 4K1UA 3F7XA 4IIAA 4HM6B 1W01A 5IG5A 5IF6A 3MHEA 3DUKA 1ZO2A 3B8LA 3ROBA 4X2OA 5STDA 5CF1A 2YFJB 1STDA 3JUMA 3SOAA 3NXJA 4HM4B 4X2HA 3NBRA 1JB5A 4HM0B 4CDLA 5CK6A 5JPPA 4LMIA 2CHCA 3F9SA 5IG4A 5AIHA 1TUHA 1W00A 1E3VA 5AEUB 4XBXA 4U13A 3EF8A 2I9WA 2XSOB 3MG1A 1JB4A 3B7CA 3DM8A 3JUPA 2HMJB 3FLJA 3EQQB 3B4OA 3HZPA 5IG3A 3EC9A 3ECFA 2HMLB 1VZZA 3HK4A 4FCJA 3LZAA 3CU3A 3OWUA 3JUQA 5CXOA 4PEJA 5IG0A 4N3VA 5IEPA 1GY6A 4HM8B 1E3RA 3BB9A 2A15A 1CQSA 3CNMA 4HJLB 3SOYA 1OGXA 3CPOA 3GRDA 2RFRA 3I0YA 1UUVB 3MKIA 1Z1SA 2Z76A 1GYBA 1GS3A 2GBXB 4HM5B 4R9LA 1AR0A 3KKGA 3EN8A 4XBYA 1O7HB 3H3HA 4XBTA 5EVHA 1DMQA 3K7CA 4I4KA 3T8UA 4RZMA 1OF5B 5AIIA 2F98A 3STDA 3GZBA 4OVMA 1C7HA 4K1VA 1O7MB 3EN1B 5DRVA 4L8PA 1EA2A 5CLKA 3G8ZA 1IDPA 3H51A 5AIGA 5IEOA 1Q40B 2BMOB 1Q40A 2Z7AA 3DMCA 3EBTA 5KP3A 1O7GB 1DMMA 3OX9A 6STDA 4KVHA 2Z77A 3NV0B 3F40A 1EG9B 2W2CA 4XM4A 3GWRA 3JUNA 1A2KA 3FZWA 3NV0A 4HKVB 1NU3A 3MSOA 1WQLB 1JB2A 1ZX2A 3HX8A 4HM7B 3ER7A 5JPUA 2HMMB 3VGNA 3NUVA 3B4PA 2QIYA 3CNXA 2RGQA 3G16A 1SJWA 4LEHA 3OWYA 2BNGA 3MG3A 4L8OA 3FSDA 2YFIB 4HM3B 3UNLA 1TP6A 2RCDA 1OCVA 3G0KA 3M8CA 3D9RA 1NDOB 1JKGB 2B1XB 4WYKB 1K41A 2XR8B 1JKGA 2K54A 4WYKA 5IENA 1ULIB 1BUQA 3GZYB 4HM1B 5IERA 5G2GA 3F7SA 2BMRB 5D82A 5DREA 1QJGA 3EHCA 4XDVA 3MYTA 3DXOA 3S5CA 1NWWA 3FF0A 2JQ5A 3GZXB 1QMAA 2HMOB 3KZTA 4XDWA 1UUWB 4L7KA 3Q90A 1HKXA 4J9AA 1OGZA 1OUNA 5D81A 3KSPA 3FH1A 2HMNB 3NHXA 3BLZA 1OH0A 4WP5A 4HM2B 1O7WB 1ISKA 2GEXA 1DMNA 1ULJB
chains in the Genus database with same CATH superfamily
3MWZA 5M19A 1Q42A 1X1WA 2LQVA 2YFLB 3F8HA 3BNCA 3UJMA 5M18A 3WOEB 2YX9A 2J8XB 1B21A 1STFI 2XFSA 2RNTA 2RSXA 1BRKA 1MGRA 2KF4A 3X40A 1N9EA 1VQ93 3IPTA 3Q2PA 1N8QA 4FMDA 4OK0A 3S27A 1HU9A 2CWUA 4OUQA 3HI7A 1BRJA 1FGOA 4R9KA 1B27A 2GBWB 3FF2A 4HZBB 2O3OA 1PU4A 4LSOA 1IQXA 2QA43 1O7NB 1X1YA 3F14A 1JZOA 3CCL3 2B24B 2IMJA 1OPYA 2OWPA 3EJVA 3OV4A 1RGKA 2CWVA 4FR9A 3T8NA 1VQP3 1M1K4 1DVDA 3CC73 2GXFA 4HBRA 4O8SA 3MG2A 1RN1A 4HAAA 4EBGA 3CCV3 3FG4A 3K0ZA 3NX0A 1RRHA 3KIIA 1IV7A 3CPW2 1MOLA 2UX0A 1WMNA 2GEYA 3V98A 4BIRA 5BXQA 1TFKA 7STDA 1OHPA 1JZDA 1N5HA 1MGWA 3D3LA 2AADA 1GY5A 4HVNA 2XEPA 4IPBA 4KFFA 6RNTA 1JBSA 2H0GA 1VQN3 1WTHA 4J8TA 1I2EA 1IVVA 3G713 2JDIH 3X3XA 2WO0A 2ZA4A 4CCVA 4MJDA 3EX9A 1ASKA 1EQKA 2WOFA 1BRIA 1OHOA 3SVAA 3G4S3 3OWSA 1JV2B 5AEWB 3FGYA 5LC7A 1AQZA 2XRXB 3LYGA 1GY7A 1RGEA 1UGHI 4HZ9B 4GHOA 3NM2A 3AGOA 3KE7A 5HGRA 1YVBI 3Q3FA 1LQMB 1MNLA 1PY3A 1BGSA 3WMDA 1CYUA 4R1KA 4EXRA 2KF3A 5FW5A 3VSYA 4R80A 1EUIC 4AKZA 1I70A 3FG3A 1RSNA 4BU4A 2KCDA 2C11A 4FCMA 1DE3A 3DGLA 1Q824 4ORLA 5AI1A 5KP1A 1RJOA 4J5GA 3KFQC 3V92A 2R4IA 2BMQB 2CX0A 1U5OA 1LVNA 3LXUX 1VQ83 1KWIA 1GSPA 3ZFZA 5CF2A 3DGYA 1LQGC 2STDA 1VQQA 3S29A 1RCLA 1UCJA 1M904 4GB5A 2QGUA 1ROAA 3RGAA 3WHOA 3JUOA 2INXA 2CFWA 4BL2A 1YIJ3 3DZLA 5AIFA 1T3BA 4STDA 1QVG2 3UB1A 1IK3A 1JN5B 2F5MA 1RNBA 3CMA3 1IVWA 2ZHXB 3KCHA 2ML6A 2E2UA 3F8XA 4WHAA 1ZGXA 1GOUA 2AAEA 2KAAA 1UGIA 3AHWA 3E99A 3BU4A 1JN5A 1W02A 2F86B 3K9MC 5D83A 2L4VA 1JBTA 1DETA 1W6YA 1FUWA 3GSPA 4AKYA 4FCZA 2H0IA 3LTDA 3OXAA 1OHSA 3GZRA 1R4YA 3LTCA 1NB3I 2BU4A 3EE1A 4I5QA 1EKMA 1Q7HA 2Z6BA 3PZWA 3X41A 3A76A 1US1A 3MPHA 1D6UA 1NB5I 3K5TA 2CKFB 1IT8A 4MMXB 2PZVA 3URPA 2Q07A 2XGNA 2HMKB 3HIIA 1B2SA 3QK9A 1DYUA 3RGRA 1I8VA 8CHOA 2F99A 2KF6A 2CFLA 1S5AA 5AYSC 5KP4A 1LNHA 1YIT3 2C10A 1FYSA 3O8YA 4Q53A 3JVCA 1OF5A 5BVBA 4LGQA 3WA2X 3X42A 4LZIA 4WWUC 1W6CA 1MWUA 1E97A 1UDII 3IMAB 4MMYB 4H3UA 2XSHB 4NREA 2BO9B 2WGQA 3EBYA 4XB5A 1YGEA 3SEDA 3FKAA 1Q814 1O7PB 1YJW3 1FGRA 5TGNA 4K1UA 5FGOA 2CIUA 3F7XA 4IIAA 4JF8A 4HM6B 1W01A 1WMPA 3V99A 1KQS2 1I2FA 3D4AA 5IG5A 1MWSA 5IF6A 1VQ73 3MHEA 3ZG0A 3DGNA 3DUKA 1ZO2A 1BRNL 2CG0A 3K63A 1AY7A 3RNTA 1GD4A 3UL6A 3B8LA 4RNTA 3ROBA 3Q1CA 4X2OA 5STDA 1I0VA 1Y4KA 1MWTA 1RN4A 5CF1A 1LOXA 2YFJB 1ROVA 1STDA 2CH9A 1NJI4 2SARA 2UUGC 3NQZA 2XF3A 3JUMA 3SOAA 3NXJA 4HM4B 4MEIA 1RGHA 3NBRA 4X2HA 3X3ZA 7GSPA 2C4BA 1V74A 3G6E3 1JB5A 4ILFA 2MC8A 3CCS3 2WOHA 1K28A 2KF5A 4HM0B 3BIRA 4CDLA 1R4CA 1GMPA 1QAKA 4HOHA 5CK6A 3I563 5JPPA 1WMOA 1B20A 2CHCA 3F9SA 4LMIA 3CCM3 2R41A 5A0OB 5IG4A 5AIHA 1IYYA 3CC23 1RN7A 1FZUA 1TUHA 4BTXA 3CCR3 1W00A 1E3VA 1TJDA 2UGIA 1B2MA 2ML5A 4KZ1A 1FUTA 2V1LA 5AEUB 4XBXA 1G0TA 4U13A 1VQK3 4FMAA 4N6LA 3A5EA 1Q9EA 3EF8A 3D79A 2I9WA 2KXGA 2XSOB 3MG1A 4H61A 1JB4A 3B7CA 1W7CA 1Q864 1D6YA 3DM8A 3JUPA 3ALAA 2P05A 1BOXA 5M1AA 2HMJB 4RNYA 2CG1A 3FLJA 1BSCA 3EQQB 3B4OA 3HZPA 2CFDA 5IG3A 4NPBA 3EC9A 4KT3B 3ECFA 5EQLA 2HMLB 1BSAA 1VZZA 3HK4A 2CFKA 4FCJA 4EV2A 3PXMA 2P0XA 1JNQA 2BHMA 3LZAA 1RGCA 4EW5A 2IA7A 1YI23 5RNTA 3CU3A 3OWUA 2FNQA 1BVIA 3JUQA 4LYLB 5CXOA 3T0UA 1KC84 1KD14 1TIJA 3NBJA 2D1WA 2SBLA 1KSIA 1BU4A 4PEJA 2GU3A 5IG0A 3PGBA 1B2UA 4N3VA 1RHLA 4N6TA 5EEOA 3UL5A 5IEPA 1GY6A 2XGLA 3NM7A 1SARA 4HM8B 3CCE3 1E3RA 3BB9A 2OTL3 2A15A 1CQSA 3CNMA 4HJLB 3SOYA 1OGXA 1VQ53 3CPOA 3ZG5A 1W2B2 2W9QA 3GRDA 2RFRA 1AVKA 2P0MA 1UUVB 3I0YA 4CJNA 1FGQA 1I2GA 3LT9A 3BNEA 3MKIA 1BAOA 1LOVA 1Z1SA 4G1MB 2HOHA 1F8NA 1AVLA 1N5PA 1UCKA 2Z76A 1MWRA 1GYBA 1GS3A 1BSDA 2F4YA 2GBXB 3U1WA 3GAXA 3NQYA 3TDGA 1YJN3 4HM5B 4R9LA 1AR0A 2K0MA 3KKGA 1RGFA 4IT7A 1RTUA 4R4KA 1YVSA 3LOYA 3BNDA 4FMBA 4WFOA 3EN8A 1A90A 3WDGB 4XBYA 1O7HB 1I0XA 3H3HA 2OOVC 4XBTA 3RDEA 2LYXA 3BNBA 5EVHA 3SX1A 1DMQA 3K7CA 4I4KA 3I553 4GL6A 2W9PA 3T8UA 4RZMA 1OF5B 3PS8A 4O3VA 3WOFB 5AIIA 2F98A 3STDA 3GZBA 4OVMA 1C7HA 4K1VA 1AV4A 4RNZA 1FW7A 1A2VA 1O7MB 1VQ43 3EN1B 3KN4A 7RNTA 1IVUA 2W04A 3CD63 1I3FA 1W6GA 2PNCA 5DRVA 4L8PA 3CCU3 1EA2A 5CLKA 5ELUA 4DKIA 1CYVA 1LNIA 2FXTA 3CXC2 2OQEA 3WODG 2OQEC 1G96A 3G8ZA 4K90B 1UUGB 1IDPA 3H51A 2M7OA 4KFEA 5AIGA 5IEOA 5LC6A 1Q40B 1BRSA 2CC3A 2MF7A 2E2TA 1RCKA 2KRTA 1BIRA 1T2IA 1S723 2RBIA 1TFOA 1UW1A 2BMOB 4K61A 2IUKA 3J7Yd 3SXXA 1Q40A 3N9HA 4N6MA 2F56A 2Z7AA 2ZDJA 3DMCA 2P09A 3EBTA 5KP3A 1L5GB 1BNFA 3PCRA 1O7GB 1RNTA 1DMMA 1V58A 3S67A 2QEX3 3OX9A 3N54B 6STDA 1UCLA 6GSPA 1SIHA 4KVHA 3L0RA 1QVF2 2Z77A 3NV0B 1M1XB 3F40A 1EG9B 1TU5A 1K8A4 3KSED 4TX4A 2L1SA 2W2CA 1RLSA 1X1UA 4XM4A 2D42A 3GWRA 3JUNA 2IYJA 1A2PA 1NNVA 1A2KA 1SPUA 3FZWA 3NV0A 3FCSB 4HKVB 2W0QA 3D5GA 1NU3A 1I3IA 3MSOA 1BSBA 1WQLB 1JB2A 2Y73A 5ELJA 4EYCA 2GSPA 1ZX2A 1RGLA 2XFTA 1GD3A 3HX8A 1RGAA 1C54A 4HM7B 4N6UA 1FGTA 5AYRB 1JBRA 3ER7A 1YNVX 3X3YA 1D6ZA 5JPUA 4N6NB 4ZM8A 3LMLA 1B2XA 1LOYA 2HMMB 3VGNA 3D5IA 3NUVA 1IQ8A 3WR2A 3B4PA 2QIYA 2CK3H 4JRFA 3CNXA 1EEJA 1X1XA 1BRHA 8RNTA 2RGQA 3G16A 2O9UX 1V57A 1WNHA 1PYLA 1SJWA 2Y74A 1BNJA 1IU7A 4GSPA 1J2BA 2K3DA 1LXEA 1BSEA 1B3SA 4LEHA 5IW9A 3OWYA 1BNSA 1IT7A 1U8CB 2BNGA 2CW9A 1YHQ3 1T2HA 1BANA 2CX1A 3N8BA 3MG3A 1W5ZA 4L8OA 3IJEB 1VQ63 3AMOB 3FSDA 1RMSA 1W2ZA 2YFIB 4HM3B 4O2HA 4CPKA 3UNLA 1HYFA 1TP6A 2RCDA 3AGNA 1OCVA 3DH2A 3G0KA 3M8CA 4EV5A 2F5WA 1A67A 3D9RA 5G1LA 4O02B 1B2ZA 3AMOA 5I97A 1NDOB 1QALA 1UI7A 2IUJA 4AEQA 1JKGB 2B1XB 4WYKB 1K41A 5JBSA 3CME3 1G02A 5G1KA 3SYUA 4MMZB 2CWTA 2XR8B 1JKGA 4BL3A 2K54A 4WYKA 1IVXA 5IENA 1GOYA 3AHSA 1ULIB 1BNRA 1BUQA 3GZYB 3CCQ3 3HOHA 5HOHA 1Q7Y4 4HM1B 1K734 1SQWA 5IERA 4RBNA 3F7SA 2WGOA 1DVCA 2BMRB 5G2GA 2IY2A 1TRQA 5D82A 1TTOA 1UCIA 2XH9A 1QJGA 1RDSA 3EHCA 3NBBA 1CEWI 4XDVA 5DREA 1VQL3 1FUSA 3MYTA 4FMCA 3QRDA 2OOVA 2H0HA 3DXOA 4EC6A 1CH0A 1YGWA 2CFGA 3S5CA 1GMQA 1BNEA 3U97A 1RKYA 2E2VA 3LH4A 3PYJA 3FG1A 3CC43 3DY5A 1NWWA 3FF0A 3OW22 1RRLA 3EB8A 3LTBA 2BT3A 1SIIA 3S28A 3WA3A 2JQ5A 4J5KA 3LTAA 3GZXB 4QWTA 1QMAA 1GMRA 2OTJ3 1LOWA 2FGTA 1QAFA 2HMOB 3DGMA 4KFDA 3KZTA 2GU1A 1BNGA 1BUJA 4XDWA 1UUWB 5BU4A 1GOVA 1HZ1A 4L7KA 1VQM3 3CCJ3 1HKXA 3Q90A 1LRAA 2W56B 1TRPA 1ZS7A 4J9AA 1VQO3 1JRQA 1IQYA 1W4NA 4N6OB 1FGMA 1OGZA 1OUNA 1NO3A 3DGOA 2W6JH 3VF1A 3LT8A 2P38A 4HYZA 5D81A 3KSPA 1K9M4 1YJ93 1N8R4 3FH1A 1PFPA 1JJ22 2HMNB 4BTWA 2W56A 1BNIA 1OACA 3NHXA 3BLZA 2W03A 4N6V0 3PCSA 1T5YA 1M9GA 1OH0A 4NHFA 4WP5A 1IV9A 2BIRA 3HIGA 4HM2B 1O7WB 3SLUA 1RGGA 4BTYA 1N9JA 2ZL8A 5BIRA 1ISKA 1UI8A 2GEXA 1FA3A 1BRGA 9RNTA 1DMNA 1ULJB 5GSPA 2OCTA
chains in the Genus database with same CATH topology
3MWZA 1Q42A 2LQVA 2YFLB 3F8HA 3BNCA 3UJMA 3WOEB 2YX9A 1STFI 2XFSA 2RSXA 3X40A 1N9EA 1VQ93 3IPTA 3Q2PA 1N8QA 4FMDA 4OK0A 3S27A 1HU9A 2CWUA 4OUQA 3HI7A 1FGOA 4R9KA 2GBWB 3FF2A 4HZBB 2O3OA 1PU4A 4LSOA 1IQXA 2QA43 1O7NB 3F14A 3CCL3 2B24B 2IMJA 1OPYA 2OWPA 3EJVA 3OV4A 2CWVA 4FR9A 3T8NA 1VQP3 1M1K4 1DVDA 3CC73 2GXFA 4HBRA 4O8SA 3MG2A 4EBGA 3CCV3 3FG4A 3K0ZA 3NX0A 1RRHA 3KIIA 1IV7A 3CPW2 1MOLA 2UX0A 1WMNA 2GEYA 3V98A 5BXQA 7STDA 1TFKA 1OHPA 3D3LA 1N5HA 1GY5A 4HVNA 2XEPA 4IPBA 4KFFA 1VQN3 1WTHA 4J8TA 1IVVA 3G713 2JDIH 3X3XA 2WO0A 4CCVA 4MJDA 3EX9A 1ASKA 1EQKA 2WOFA 1OHOA 3SVAA 3G4S3 3OWSA 1JV2B 5AEWB 3FGYA 5LC7A 2XRXB 3LYGA 1GY7A 4HZ9B 3NM2A 3KE7A 5HGRA 1YVBI 1MNLA 3WMDA 1CYUA 4R1KA 4EXRA 5FW5A 3VSYA 4R80A 4AKZA 3FG3A 2KCDA 2C11A 4FCMA 3DGLA 1Q824 4ORLA 5AI1A 5KP1A 1RJOA 3KFQC 3V92A 2R4IA 2BMQB 1U5OA 1LVNA 3LXUX 1VQ83 1KWIA 5CF2A 2STDA 3S29A 1M904 4GB5A 2QGUA 1ROAA 3RGAA 3JUOA 2INXA 2CFWA 1YIJ3 3DZLA 5AIFA 4STDA 1QVG2 1IK3A 1JN5B 3CMA3 1IVWA 2ML6A 2E2UA 3F8XA 4WHAA 3E99A 1JN5A 1W02A 2F86B 3K9MC 5D83A 2L4VA 1FUWA 1W6YA 4AKYA 4FCZA 3LTDA 3OXAA 1OHSA 3GZRA 3LTCA 1NB3I 3EE1A 3X41A 1EKMA 2Z6BA 3PZWA 1NB5I 3A76A 1US1A 3MPHA 1D6UA 3K5TA 2CKFB 1IT8A 4MMXB 2PZVA 2Q07A 2XGNA 2HMKB 3HIIA 3QK9A 1DYUA 3RGRA 8CHOA 2F99A 5AYSC 2CFLA 1S5AA 5KP4A 1LNHA 1YIT3 2C10A 3O8YA 4Q53A 3JVCA 1OF5A 5BVBA 4LGQA 3WA2X 3X42A 4LZIA 4WWUC 1W6CA 4MMYB 1E97A 3IMAB 4H3UA 2XSHB 4NREA 2BO9B 2WGQA 3EBYA 4XB5A 1YGEA 3SEDA 3FKAA 1Q814 1O7PB 1YJW3 1FGRA 5TGNA 4K1UA 5FGOA 2CIUA 3F7XA 4IIAA 4JF8A 4HM6B 1W01A 1WMPA 3V99A 1KQS2 5IG5A 5IF6A 1VQ73 3MHEA 3DGNA 3DUKA 1ZO2A 2CG0A 3K63A 1GD4A 3UL6A 3B8LA 3ROBA 3Q1CA 4X2OA 5STDA 1Y4KA 5CF1A 1LOXA 2YFJB 1ROVA 1STDA 2CH9A 1NJI4 3NQZA 2XF3A 3JUMA 3SOAA 3NXJA 4HM4B 4MEIA 4X2HA 3NBRA 3X3ZA 3G6E3 1V74A 1JB5A 2MC8A 3CCS3 2WOHA 1K28A 4HM0B 4CDLA 1R4CA 1QAKA 5CK6A 3I563 5JPPA 1WMOA 2CHCA 3F9SA 4LMIA 3CCM3 5A0OB 5IG4A 5AIHA 3CC23 1RN7A 1TUHA 4BTXA 3CCR3 1W00A 1E3VA 2ML5A 4KZ1A 2V1LA 5AEUB 4XBXA 4U13A 1VQK3 4FMAA 4N6LA 3EF8A 2I9WA 2KXGA 2XSOB 3MG1A 4H61A 1JB4A 3B7CA 1W7CA 1Q864 1D6YA 3DM8A 3JUPA 3ALAA 2P05A 2HMJB 4RNYA 2CG1A 3FLJA 3EQQB 3B4OA 3HZPA 2CFDA 5IG3A 3EC9A 3ECFA 5EQLA 2HMLB 1VZZA 3HK4A 2CFKA 4FCJA 4EV2A 3PXMA 2P0XA 1JNQA 2BHMA 3LZAA 2IA7A 1YI23 3CU3A 3OWUA 2FNQA 3JUQA 5CXOA 3T0UA 1KD14 1KC84 1TIJA 3NBJA 2D1WA 2SBLA 1KSIA 4PEJA 2GU3A 5IG0A 3PGBA 4N3VA 4N6TA 5EEOA 3UL5A 5IEPA 1GY6A 2XGLA 3NM7A 4HM8B 3CCE3 1E3RA 3BB9A 2OTL3 2A15A 1CQSA 3CNMA 4HJLB 3SOYA 1OGXA 1VQ53 3CPOA 1W2B2 2W9QA 3GRDA 2RFRA 1AVKA 2P0MA 1UUVB 3I0YA 1FGQA 3LT9A 3BNEA 3MKIA 1Z1SA 4G1MB 1F8NA 1AVLA 1N5PA 2Z76A 1GYBA 1GS3A 3U1WA 2GBXB 3GAXA 3NQYA 3TDGA 1YJN3 4HM5B 4R9LA 1AR0A 2K0MA 3KKGA 4IT7A 4R4KA 3LOYA 3BNDA 4FMBA 4WFOA 3EN8A 1A90A 3WDGB 4XBYA 1O7HB 3RDEA 3H3HA 2OOVC 4XBTA 2LYXA 3BNBA 5EVHA 3SX1A 1DMQA 3K7CA 4I4KA 3I553 4GL6A 2W9PA 3T8UA 4RZMA 1OF5B 3PS8A 4O3VA 3WOFB 5AIIA 2F98A 3STDA 3GZBA 4OVMA 1C7HA 4K1VA 1AV4A 4RNZA 1A2VA 1O7MB 1VQ43 3EN1B 3KN4A 1IVUA 2W04A 3CD63 1W6GA 2PNCA 5DRVA 4L8PA 3CCU3 1EA2A 5CLKA 5ELUA 1CYVA 2FXTA 3CXC2 2OQEA 3WODG 2OQEC 1G96A 3G8ZA 4K90B 1IDPA 3H51A 2M7OA 4KFEA 5AIGA 5IEOA 5LC6A 1Q40B 2CC3A 2MF7A 2E2TA 2KRTA 1S723 1TFOA 1UW1A 2BMOB 4K61A 2IUKA 3J7Yd 3SXXA 1Q40A 3N9HA 4N6MA 2Z7AA 2ZDJA 3DMCA 2P09A 3EBTA 5KP3A 1L5GB 3PCRA 1O7GB 1DMMA 3S67A 2QEX3 3OX9A 3N54B 6STDA 1SIHA 4KVHA 3L0RA 1QVF2 2Z77A 3NV0B 1M1XB 3F40A 1EG9B 1TU5A 1K8A4 3KSED 4TX4A 2W2CA 4XM4A 2D42A 3GWRA 3JUNA 1SPUA 1A2KA 3FZWA 3NV0A 3FCSB 4HKVB 2W0QA 1NU3A 3MSOA 1WQLB 1JB2A 2Y73A 5ELJA 4EYCA 2XFTA 1ZX2A 1GD3A 3HX8A 4HM7B 4N6UA 1FGTA 5AYRB 3ER7A 3X3YA 5JPUA 1D6ZA 4N6NB 4ZM8A 3LMLA 2HMMB 3VGNA 3NUVA 1IQ8A 3B4PA 2QIYA 2CK3H 4JRFA 3CNXA 2RGQA 3G16A 2O9UX 1WNHA 2Y74A 1SJWA 1IU7A 1J2BA 1LXEA 4LEHA 5IW9A 3OWYA 1IT7A 1U8CB 2BNGA 2CW9A 1YHQ3 3N8BA 3MG3A 1W5ZA 4L8OA 3IJEB 1VQ63 3AMOB 3FSDA 1W2ZA 2YFIB 4HM3B 4O2HA 3UNLA 1TP6A 2RCDA 1OCVA 3G0KA 3M8CA 4EV5A 1A67A 3D9RA 4O02B 3AMOA 5I97A 1NDOB 1QALA 1UI7A 2IUJA 4AEQA 1JKGB 2B1XB 4WYKB 1K41A 5JBSA 3CME3 4MMZB 2CWTA 2XR8B 1JKGA 2K54A 4WYKA 1IVXA 5IENA 1ULIB 1BUQA 3GZYB 3CCQ3 1Q7Y4 4HM1B 1K734 1SQWA 5IERA 4RBNA 3F7SA 2WGOA 1DVCA 2BMRB 5G2GA 5D82A 3UB1A 2XH9A 1QJGA 3NBBA 3EHCA 4XDVA 1CEWI 5DREA 1VQL3 3MYTA 4FMCA 3QRDA 2OOVA 3DXOA 4EC6A 2CFGA 3S5CA 3U97A 1RKYA 2E2VA 3LH4A 3PYJA 3FG1A 3CC43 3DY5A 1NWWA 3FF0A 3OW22 1RRLA 3EB8A 3LTBA 2BT3A 1SIIA 3S28A 3WA3A 2JQ5A 3LTAA 3GZXB 4QWTA 1QMAA 2OTJ3 2FGTA 2HMOB 1QAFA 3DGMA 4KFDA 3KZTA 2GU1A 4XDWA 1UUWB 1VQM3 4L7KA 3CCJ3 1HKXA 3Q90A 2W56B 4J9AA 1VQO3 1JRQA 1IQYA 1W4NA 4N6OB 1FGMA 1OGZA 1OUNA 1NO3A 3DGOA 2W6JH 3VF1A 3LT8A 2P38A 4HYZA 5D81A 3KSPA 1K9M4 1YJ93 1N8R4 3FH1A 1PFPA 1JJ22 2HMNB 4BTWA 2W56A 1OACA 3NHXA 3BLZA 2W03A 4N6V0 3PCSA 1T5YA 1M9GA 1OH0A 4NHFA 4WP5A 1IV9A 3HIGA 4HM2B 1O7WB 3SLUA 4BTYA 1N9JA 2ZL8A 1ISKA 1UI8A 2GEXA 1FA3A 1DMNA 1ULJB 2OCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q42 A;  2YFL B;  3F8H A;  3UJM A;  3IPT A;  4OUQ A;  4R9K A;  2GBW B;  3FF2 A;  4HZB B;  1O7N B;  3F14 A;  2B24 B;  2IMJ A;  1OPY A;  2OWP A;  3EJV A;  3OV4 A;  3T8N A;  2GXF A;  3MG2 A;  3K0Z A;  2UX0 A;  2GEY A;  5BXQ A;  7STD A;  1OHP A;  1GY5 A;  4HVN A;  4J8T A;  4MJD A;  3EX9 A;  1ASK A;  1OHO A;  3OWS A;  5AEW B;  3FGY A;  2XRX B;  3LYG A;  1GY7 A;  4HZ9 B;  3NM2 A;  3KE7 A;  5HGR A;  3WMD A;  4R1K A;  5FW5 A;  3VSY A;  4FCM A;  4ORL A;  5AI1 A;  5KP1 A;  2R4I A;  2BMQ B;  1U5O A;  5CF2 A;  2STD A;  4GB5 A;  2QGU A;  3RGA A;  3JUO A;  2INX A;  3DZL A;  5AIF A;  4STD A;  1JN5 B;  3F8X A;  3E99 A;  1JN5 A;  1W02 A;  2F86 B;  5D83 A;  1W6Y A;  3OXA A;  1OHS A;  3GZR A;  3A76 A;  2CKF B;  2PZV A;  2HMK B;  3RGR A;  8CHO A;  2F99 A;  5KP4 A;  1S5A A;  4Q53 A;  1OF5 A;  5BVB A;  4LGQ A;  4WWU C;  1E97 A;  4H3U A;  2XSH B;  3SED A;  3EBY A;  4XB5 A;  3FKA A;  1O7P B;  5TGN A;  4K1U A;  3F7X A;  4IIA A;  4HM6 B;  1W01 A;  5IG5 A;  5IF6 A;  3MHE A;  3DUK A;  1ZO2 A;  3B8L A;  3ROB A;  4X2O A;  5STD A;  5CF1 A;  2YFJ B;  1STD A;  3JUM A;  3SOA A;  3NXJ A;  4HM4 B;  4X2H A;  3NBR A;  1JB5 A;  4HM0 B;  4CDL A;  5CK6 A;  5JPP A;  4LMI A;  2CHC A;  3F9S A;  5IG4 A;  5AIH A;  1TUH A;  1W00 A;  1E3V A;  5AEU B;  4XBX A;  4U13 A;  3EF8 A;  2I9W A;  2XSO B;  3MG1 A;  1JB4 A;  3B7C A;  3DM8 A;  3JUP A;  2HMJ B;  3FLJ A;  3EQQ B;  3B4O A;  3HZP A;  5IG3 A;  3EC9 A;  3ECF A;  2HML B;  1VZZ A;  3HK4 A;  4FCJ A;  3LZA A;  3CU3 A;  3OWU A;  3JUQ A;  5CXO A;  4PEJ A;  5IG0 A;  4N3V A;  5IEP A;  1GY6 A;  4HM8 B;  1E3R A;  3BB9 A;  2A15 A;  1CQS A;  3CNM A;  4HJL B;  3SOY A;  1OGX A;  3CPO A;  3GRD A;  2RFR A;  3I0Y A;  1UUV B;  3MKI A;  1Z1S A;  2Z76 A;  1GYB A;  1GS3 A;  2GBX B;  4HM5 B;  4R9L A;  1AR0 A;  3KKG A;  3EN8 A;  4XBY A;  1O7H B;  3H3H A;  4XBT A;  5EVH A;  1DMQ A;  3K7C A;  4I4K A;  3T8U A;  4RZM A;  1OF5 B;  5AII A;  2F98 A;  3STD A;  3GZB A;  4OVM A;  1C7H A;  4K1V A;  1O7M B;  3EN1 B;  5DRV A;  4L8P A;  1EA2 A;  5CLK A;  3G8Z A;  1IDP A;  3H51 A;  5AIG A;  5IEO A;  1Q40 B;  2BMO B;  1Q40 A;  2Z7A A;  3DMC A;  3EBT A;  5KP3 A;  1O7G B;  1DMM A;  3OX9 A;  6STD A;  4KVH A;  2Z77 A;  3NV0 B;  3F40 A;  1EG9 B;  2W2C A;  4XM4 A;  3GWR A;  3JUN A;  1A2K A;  3FZW A;  3NV0 A;  4HKV B;  1NU3 A;  3MSO A;  1WQL B;  1JB2 A;  1ZX2 A;  3HX8 A;  4HM7 B;  3ER7 A;  5JPU A;  2HMM B;  3VGN A;  3NUV A;  3B4P A;  2QIY A;  3CNX A;  2RGQ A;  3G16 A;  1SJW A;  4LEH A;  3OWY A;  2BNG A;  3MG3 A;  4L8O A;  3FSD A;  2YFI B;  4HM3 B;  3UNL A;  1TP6 A;  2RCD A;  1OCV A;  3G0K A;  3M8C A;  3D9R A;  1NDO B;  1JKG B;  2B1X B;  4WYK B;  1K41 A;  2XR8 B;  1JKG A;  2K54 A;  4WYK A;  5IEN A;  1ULI B;  1BUQ A;  3GZY B;  4HM1 B;  5IER A;  5G2G A;  3F7S A;  2BMR B;  5D82 A;  5DRE A;  1QJG A;  3EHC A;  4XDV A;  3MYT A;  3DXO A;  3S5C A;  1NWW A;  3FF0 A;  2JQ5 A;  3GZX B;  1QMA A;  2HMO B;  3KZT A;  4XDW A;  1UUW B;  4L7K A;  3Q90 A;  1HKX A;  4J9A A;  1OGZ A;  1OUN A;  5D81 A;  3KSP A;  3FH1 A;  2HMN B;  3NHX A;  3BLZ A;  1OH0 A;  4WP5 A;  4HM2 B;  1O7W B;  1ISK A;  2GEX A;  1DMN A;  1ULJ B; 
#chains in the Genus database with same CATH topology
 3MWZ A;  5M19 A;  1Q42 A;  1X1W A;  2LQV A;  2YFL B;  3F8H A;  3BNC A;  3UJM A;  5M18 A;  3WOE B;  2YX9 A;  2J8X B;  1B21 A;  1STF I;  2XFS A;  2RNT A;  2RSX A;  1BRK A;  1MGR A;  2KF4 A;  3X40 A;  1N9E A;  1VQ9 3;  3IPT A;  3Q2P A;  1N8Q A;  4FMD A;  4OK0 A;  3S27 A;  1HU9 A;  2CWU A;  4OUQ A;  3HI7 A;  1BRJ A;  1FGO A;  4R9K A;  1B27 A;  2GBW B;  3FF2 A;  4HZB B;  2O3O A;  1PU4 A;  4LSO A;  1IQX A;  2QA4 3;  1O7N B;  1X1Y A;  3F14 A;  1JZO A;  3CCL 3;  2B24 B;  2IMJ A;  1OPY A;  2OWP A;  3EJV A;  3OV4 A;  1RGK A;  2CWV A;  4FR9 A;  3T8N A;  1VQP 3;  1M1K 4;  1DVD A;  3CC7 3;  2GXF A;  4HBR A;  4O8S A;  3MG2 A;  1RN1 A;  4HAA A;  4EBG A;  3CCV 3;  3FG4 A;  3K0Z A;  3NX0 A;  1RRH A;  3KII A;  1IV7 A;  3CPW 2;  1MOL A;  2UX0 A;  1WMN A;  2GEY A;  3V98 A;  4BIR A;  5BXQ A;  1TFK A;  7STD A;  1OHP A;  1JZD A;  1N5H A;  1MGW A;  3D3L A;  2AAD A;  1GY5 A;  4HVN A;  2XEP A;  4IPB A;  4KFF A;  6RNT A;  1JBS A;  2H0G A;  1VQN 3;  1WTH A;  4J8T A;  1I2E A;  1IVV A;  3G71 3;  2JDI H;  3X3X A;  2WO0 A;  2ZA4 A;  4CCV A;  4MJD A;  3EX9 A;  1ASK A;  1EQK A;  2WOF A;  1BRI A;  1OHO A;  3SVA A;  3G4S 3;  3OWS A;  1JV2 B;  5AEW B;  3FGY A;  5LC7 A;  1AQZ A;  2XRX B;  3LYG A;  1GY7 A;  1RGE A;  1UGH I;  4HZ9 B;  4GHO A;  3NM2 A;  3AGO A;  3KE7 A;  5HGR A;  1YVB I;  3Q3F A;  1LQM B;  1MNL A;  1PY3 A;  1BGS A;  3WMD A;  1CYU A;  4R1K A;  4EXR A;  2KF3 A;  5FW5 A;  3VSY A;  4R80 A;  1EUI C;  4AKZ A;  1I70 A;  3FG3 A;  1RSN A;  4BU4 A;  2KCD A;  2C11 A;  4FCM A;  1DE3 A;  3DGL A;  1Q82 4;  4ORL A;  5AI1 A;  5KP1 A;  1RJO A;  4J5G A;  3KFQ C;  3V92 A;  2R4I A;  2BMQ B;  2CX0 A;  1U5O A;  1LVN A;  3LXU X;  1VQ8 3;  1KWI A;  1GSP A;  3ZFZ A;  5CF2 A;  3DGY A;  1LQG C;  2STD A;  1VQQ A;  3S29 A;  1RCL A;  1UCJ A;  1M90 4;  4GB5 A;  2QGU A;  1ROA A;  3RGA A;  3WHO A;  3JUO A;  2INX A;  2CFW A;  4BL2 A;  1YIJ 3;  3DZL A;  5AIF A;  1T3B A;  4STD A;  1QVG 2;  3UB1 A;  1IK3 A;  1JN5 B;  2F5M A;  1RNB A;  3CMA 3;  1IVW A;  2ZHX B;  3KCH A;  2ML6 A;  2E2U A;  3F8X A;  4WHA A;  1ZGX A;  1GOU A;  2AAE A;  2KAA A;  1UGI A;  3AHW A;  3E99 A;  3BU4 A;  1JN5 A;  1W02 A;  2F86 B;  3K9M C;  5D83 A;  2L4V A;  1JBT A;  1DET A;  1W6Y A;  1FUW A;  3GSP A;  4AKY A;  4FCZ A;  2H0I A;  3LTD A;  3OXA A;  1OHS A;  3GZR A;  1R4Y A;  3LTC A;  1NB3 I;  2BU4 A;  3EE1 A;  4I5Q A;  1EKM A;  1Q7H A;  2Z6B A;  3PZW A;  3X41 A;  3A76 A;  1US1 A;  3MPH A;  1D6U A;  1NB5 I;  3K5T A;  2CKF B;  1IT8 A;  4MMX B;  2PZV A;  3URP A;  2Q07 A;  2XGN A;  2HMK B;  3HII A;  1B2S A;  3QK9 A;  1DYU A;  3RGR A;  1I8V A;  8CHO A;  2F99 A;  2KF6 A;  2CFL A;  1S5A A;  5AYS C;  5KP4 A;  1LNH A;  1YIT 3;  2C10 A;  1FYS A;  3O8Y A;  4Q53 A;  3JVC A;  1OF5 A;  5BVB A;  4LGQ A;  3WA2 X;  3X42 A;  4LZI A;  4WWU C;  1W6C A;  1MWU A;  1E97 A;  1UDI I;  3IMA B;  4MMY B;  4H3U A;  2XSH B;  4NRE A;  2BO9 B;  2WGQ A;  3EBY A;  4XB5 A;  1YGE A;  3SED A;  3FKA A;  1Q81 4;  1O7P B;  1YJW 3;  1FGR A;  5TGN A;  4K1U A;  5FGO A;  2CIU A;  3F7X A;  4IIA A;  4JF8 A;  4HM6 B;  1W01 A;  1WMP A;  3V99 A;  1KQS 2;  1I2F A;  3D4A A;  5IG5 A;  1MWS A;  5IF6 A;  1VQ7 3;  3MHE A;  3ZG0 A;  3DGN A;  3DUK A;  1ZO2 A;  1BRN L;  2CG0 A;  3K63 A;  1AY7 A;  3RNT A;  1GD4 A;  3UL6 A;  3B8L A;  4RNT A;  3ROB A;  3Q1C A;  4X2O A;  5STD A;  1I0V A;  1Y4K A;  1MWT A;  1RN4 A;  5CF1 A;  1LOX A;  2YFJ B;  1ROV A;  1STD A;  2CH9 A;  1NJI 4;  2SAR A;  2UUG C;  3NQZ A;  2XF3 A;  3JUM A;  3SOA A;  3NXJ A;  4HM4 B;  4MEI A;  1RGH A;  3NBR A;  4X2H A;  3X3Z A;  7GSP A;  2C4B A;  1V74 A;  3G6E 3;  1JB5 A;  4ILF A;  2MC8 A;  3CCS 3;  2WOH A;  1K28 A;  2KF5 A;  4HM0 B;  3BIR A;  4CDL A;  1R4C A;  1GMP A;  1QAK A;  4HOH A;  5CK6 A;  3I56 3;  5JPP A;  1WMO A;  1B20 A;  2CHC A;  3F9S A;  4LMI A;  3CCM 3;  2R41 A;  5A0O B;  5IG4 A;  5AIH A;  1IYY A;  3CC2 3;  1RN7 A;  1FZU A;  1TUH A;  4BTX A;  3CCR 3;  1W00 A;  1E3V A;  1TJD A;  2UGI A;  1B2M A;  2ML5 A;  4KZ1 A;  1FUT A;  2V1L A;  5AEU B;  4XBX A;  1G0T A;  4U13 A;  1VQK 3;  4FMA A;  4N6L A;  3A5E A;  1Q9E A;  3EF8 A;  3D79 A;  2I9W A;  2KXG A;  2XSO B;  3MG1 A;  4H61 A;  1JB4 A;  3B7C A;  1W7C A;  1Q86 4;  1D6Y A;  3DM8 A;  3JUP A;  3ALA A;  2P05 A;  1BOX A;  5M1A A;  2HMJ B;  4RNY A;  2CG1 A;  3FLJ A;  1BSC A;  3EQQ B;  3B4O A;  3HZP A;  2CFD A;  5IG3 A;  4NPB A;  3EC9 A;  4KT3 B;  3ECF A;  5EQL A;  2HML B;  1BSA A;  1VZZ A;  3HK4 A;  2CFK A;  4FCJ A;  4EV2 A;  3PXM A;  2P0X A;  1JNQ A;  2BHM A;  3LZA A;  1RGC A;  4EW5 A;  2IA7 A;  1YI2 3;  5RNT A;  3CU3 A;  3OWU A;  2FNQ A;  1BVI A;  3JUQ A;  4LYL B;  5CXO A;  3T0U A;  1KC8 4;  1KD1 4;  1TIJ A;  3NBJ A;  2D1W A;  2SBL A;  1KSI A;  1BU4 A;  4PEJ A;  2GU3 A;  5IG0 A;  3PGB A;  1B2U A;  4N3V A;  1RHL A;  4N6T A;  5EEO A;  3UL5 A;  5IEP A;  1GY6 A;  2XGL A;  3NM7 A;  1SAR A;  4HM8 B;  3CCE 3;  1E3R A;  3BB9 A;  2OTL 3;  2A15 A;  1CQS A;  3CNM A;  4HJL B;  3SOY A;  1OGX A;  1VQ5 3;  3CPO A;  3ZG5 A;  1W2B 2;  2W9Q A;  3GRD A;  2RFR A;  1AVK A;  2P0M A;  1UUV B;  3I0Y A;  4CJN A;  1FGQ A;  1I2G A;  3LT9 A;  3BNE A;  3MKI A;  1BAO A;  1LOV A;  1Z1S A;  4G1M B;  2HOH A;  1F8N A;  1AVL A;  1N5P A;  1UCK A;  2Z76 A;  1MWR A;  1GYB A;  1GS3 A;  1BSD A;  2F4Y A;  2GBX B;  3U1W A;  3GAX A;  3NQY A;  3TDG A;  1YJN 3;  4HM5 B;  4R9L A;  1AR0 A;  2K0M A;  3KKG A;  1RGF A;  4IT7 A;  1RTU A;  4R4K A;  1YVS A;  3LOY A;  3BND A;  4FMB A;  4WFO A;  3EN8 A;  1A90 A;  3WDG B;  4XBY A;  1O7H B;  1I0X A;  3H3H A;  2OOV C;  4XBT A;  3RDE A;  2LYX A;  3BNB A;  5EVH A;  3SX1 A;  1DMQ A;  3K7C A;  4I4K A;  3I55 3;  4GL6 A;  2W9P A;  3T8U A;  4RZM A;  1OF5 B;  3PS8 A;  4O3V A;  3WOF B;  5AII A;  2F98 A;  3STD A;  3GZB A;  4OVM A;  1C7H A;  4K1V A;  1AV4 A;  4RNZ A;  1FW7 A;  1A2V A;  1O7M B;  1VQ4 3;  3EN1 B;  3KN4 A;  7RNT A;  1IVU A;  2W04 A;  3CD6 3;  1I3F A;  1W6G A;  2PNC A;  5DRV A;  4L8P A;  3CCU 3;  1EA2 A;  5CLK A;  5ELU A;  4DKI A;  1CYV A;  1LNI A;  2FXT A;  3CXC 2;  2OQE A;  3WOD G;  2OQE C;  1G96 A;  3G8Z A;  4K90 B;  1UUG B;  1IDP A;  3H51 A;  2M7O A;  4KFE A;  5AIG A;  5IEO A;  5LC6 A;  1Q40 B;  1BRS A;  2CC3 A;  2MF7 A;  2E2T A;  1RCK A;  2KRT A;  1BIR A;  1T2I A;  1S72 3;  2RBI A;  1TFO A;  1UW1 A;  2BMO B;  4K61 A;  2IUK A;  3J7Y d;  3SXX A;  1Q40 A;  3N9H A;  4N6M A;  2F56 A;  2Z7A A;  2ZDJ A;  3DMC A;  2P09 A;  3EBT A;  5KP3 A;  1L5G B;  1BNF A;  3PCR A;  1O7G B;  1RNT A;  1DMM A;  1V58 A;  3S67 A;  2QEX 3;  3OX9 A;  3N54 B;  6STD A;  1UCL A;  6GSP A;  1SIH A;  4KVH A;  3L0R A;  1QVF 2;  2Z77 A;  3NV0 B;  1M1X B;  3F40 A;  1EG9 B;  1TU5 A;  1K8A 4;  3KSE D;  4TX4 A;  2L1S A;  2W2C A;  1RLS A;  1X1U A;  4XM4 A;  2D42 A;  3GWR A;  3JUN A;  2IYJ A;  1A2P A;  1NNV A;  1A2K A;  1SPU A;  3FZW A;  3NV0 A;  3FCS B;  4HKV B;  2W0Q A;  3D5G A;  1NU3 A;  1I3I A;  3MSO A;  1BSB A;  1WQL B;  1JB2 A;  2Y73 A;  5ELJ A;  4EYC A;  2GSP A;  1ZX2 A;  1RGL A;  2XFT A;  1GD3 A;  3HX8 A;  1RGA A;  1C54 A;  4HM7 B;  4N6U A;  1FGT A;  5AYR B;  1JBR A;  3ER7 A;  1YNV X;  3X3Y A;  1D6Z A;  5JPU A;  4N6N B;  4ZM8 A;  3LML A;  1B2X A;  1LOY A;  2HMM B;  3VGN A;  3D5I A;  3NUV A;  1IQ8 A;  3WR2 A;  3B4P A;  2QIY A;  2CK3 H;  4JRF A;  3CNX A;  1EEJ A;  1X1X A;  1BRH A;  8RNT A;  2RGQ A;  3G16 A;  2O9U X;  1V57 A;  1WNH A;  1PYL A;  1SJW A;  2Y74 A;  1BNJ A;  1IU7 A;  4GSP A;  1J2B A;  2K3D A;  1LXE A;  1BSE A;  1B3S A;  4LEH A;  5IW9 A;  3OWY A;  1BNS A;  1IT7 A;  1U8C B;  2BNG A;  2CW9 A;  1YHQ 3;  1T2H A;  1BAN A;  2CX1 A;  3N8B A;  3MG3 A;  1W5Z A;  4L8O A;  3IJE B;  1VQ6 3;  3AMO B;  3FSD A;  1RMS A;  1W2Z A;  2YFI B;  4HM3 B;  4O2H A;  4CPK A;  3UNL A;  1HYF A;  1TP6 A;  2RCD A;  3AGN A;  1OCV A;  3DH2 A;  3G0K A;  3M8C A;  4EV5 A;  2F5W A;  1A67 A;  3D9R A;  5G1L A;  4O02 B;  1B2Z A;  3AMO A;  5I97 A;  1NDO B;  1QAL A;  1UI7 A;  2IUJ A;  4AEQ A;  1JKG B;  2B1X B;  4WYK B;  1K41 A;  5JBS A;  3CME 3;  1G02 A;  5G1K A;  3SYU A;  4MMZ B;  2CWT A;  2XR8 B;  1JKG A;  4BL3 A;  2K54 A;  4WYK A;  1IVX A;  5IEN A;  1GOY A;  3AHS A;  1ULI B;  1BNR A;  1BUQ A;  3GZY B;  3CCQ 3;  3HOH A;  5HOH A;  1Q7Y 4;  4HM1 B;  1K73 4;  1SQW A;  5IER A;  4RBN A;  3F7S A;  2WGO A;  1DVC A;  2BMR B;  5G2G A;  2IY2 A;  1TRQ A;  5D82 A;  1TTO A;  1UCI A;  2XH9 A;  1QJG A;  1RDS A;  3EHC A;  3NBB A;  1CEW I;  4XDV A;  5DRE A;  1VQL 3;  1FUS A;  3MYT A;  4FMC A;  3QRD A;  2OOV A;  2H0H A;  3DXO A;  4EC6 A;  1CH0 A;  1YGW A;  2CFG A;  3S5C A;  1GMQ A;  1BNE A;  3U97 A;  1RKY A;  2E2V A;  3LH4 A;  3PYJ A;  3FG1 A;  3CC4 3;  3DY5 A;  1NWW A;  3FF0 A;  3OW2 2;  1RRL A;  3EB8 A;  3LTB A;  2BT3 A;  1SII A;  3S28 A;  3WA3 A;  2JQ5 A;  4J5K A;  3LTA A;  3GZX B;  4QWT A;  1QMA A;  1GMR A;  2OTJ 3;  1LOW A;  2FGT A;  1QAF A;  2HMO B;  3DGM A;  4KFD A;  3KZT A;  2GU1 A;  1BNG A;  1BUJ A;  4XDW A;  1UUW B;  5BU4 A;  1GOV A;  1HZ1 A;  4L7K A;  1VQM 3;  3CCJ 3;  1HKX A;  3Q90 A;  1LRA A;  2W56 B;  1TRP A;  1ZS7 A;  4J9A A;  1VQO 3;  1JRQ A;  1IQY A;  1W4N A;  4N6O B;  1FGM A;  1OGZ A;  1OUN A;  1NO3 A;  3DGO A;  2W6J H;  3VF1 A;  3LT8 A;  2P38 A;  4HYZ A;  5D81 A;  3KSP A;  1K9M 4;  1YJ9 3;  1N8R 4;  3FH1 A;  1PFP A;  1JJ2 2;  2HMN B;  4BTW A;  2W56 A;  1BNI A;  1OAC A;  3NHX A;  3BLZ A;  2W03 A;  4N6V 0;  3PCS A;  1T5Y A;  1M9G A;  1OH0 A;  4NHF A;  4WP5 A;  1IV9 A;  2BIR A;  3HIG A;  4HM2 B;  1O7W B;  3SLU A;  1RGG A;  4BTY A;  1N9J A;  2ZL8 A;  5BIR A;  1ISK A;  1UI8 A;  2GEX A;  1FA3 A;  1BRG A;  9RNT A;  1DMN A;  1ULJ B;  5GSP A;  2OCT A; 
#chains in the Genus database with same CATH homology
 3MWZ A;  1Q42 A;  2LQV A;  2YFL B;  3F8H A;  3BNC A;  3UJM A;  3WOE B;  2YX9 A;  1STF I;  2XFS A;  2RSX A;  3X40 A;  1N9E A;  1VQ9 3;  3IPT A;  3Q2P A;  1N8Q A;  4FMD A;  4OK0 A;  3S27 A;  1HU9 A;  2CWU A;  4OUQ A;  3HI7 A;  1FGO A;  4R9K A;  2GBW B;  3FF2 A;  4HZB B;  2O3O A;  1PU4 A;  4LSO A;  1IQX A;  2QA4 3;  1O7N B;  3F14 A;  3CCL 3;  2B24 B;  2IMJ A;  1OPY A;  2OWP A;  3EJV A;  3OV4 A;  2CWV A;  4FR9 A;  3T8N A;  1VQP 3;  1M1K 4;  1DVD A;  3CC7 3;  2GXF A;  4HBR A;  4O8S A;  3MG2 A;  4EBG A;  3CCV 3;  3FG4 A;  3K0Z A;  3NX0 A;  1RRH A;  3KII A;  1IV7 A;  3CPW 2;  1MOL A;  2UX0 A;  1WMN A;  2GEY A;  3V98 A;  5BXQ A;  7STD A;  1TFK A;  1OHP A;  3D3L A;  1N5H A;  1GY5 A;  4HVN A;  2XEP A;  4IPB A;  4KFF A;  1VQN 3;  1WTH A;  4J8T A;  1IVV A;  3G71 3;  2JDI H;  3X3X A;  2WO0 A;  4CCV A;  4MJD A;  3EX9 A;  1ASK A;  1EQK A;  2WOF A;  1OHO A;  3SVA A;  3G4S 3;  3OWS A;  1JV2 B;  5AEW B;  3FGY A;  5LC7 A;  2XRX B;  3LYG A;  1GY7 A;  4HZ9 B;  3NM2 A;  3KE7 A;  5HGR A;  1YVB I;  1MNL A;  3WMD A;  1CYU A;  4R1K A;  4EXR A;  5FW5 A;  3VSY A;  4R80 A;  4AKZ A;  3FG3 A;  2KCD A;  2C11 A;  4FCM A;  3DGL A;  1Q82 4;  4ORL A;  5AI1 A;  5KP1 A;  1RJO A;  3KFQ C;  3V92 A;  2R4I A;  2BMQ B;  1U5O A;  1LVN A;  3LXU X;  1VQ8 3;  1KWI A;  5CF2 A;  2STD A;  3S29 A;  1M90 4;  4GB5 A;  2QGU A;  1ROA A;  3RGA A;  3JUO A;  2INX A;  2CFW A;  1YIJ 3;  3DZL A;  5AIF A;  4STD A;  1QVG 2;  1IK3 A;  1JN5 B;  3CMA 3;  1IVW A;  2ML6 A;  2E2U A;  3F8X A;  4WHA A;  3E99 A;  1JN5 A;  1W02 A;  2F86 B;  3K9M C;  5D83 A;  2L4V A;  1FUW A;  1W6Y A;  4AKY A;  4FCZ A;  3LTD A;  3OXA A;  1OHS A;  3GZR A;  3LTC A;  1NB3 I;  3EE1 A;  3X41 A;  1EKM A;  2Z6B A;  3PZW A;  1NB5 I;  3A76 A;  1US1 A;  3MPH A;  1D6U A;  3K5T A;  2CKF B;  1IT8 A;  4MMX B;  2PZV A;  2Q07 A;  2XGN A;  2HMK B;  3HII A;  3QK9 A;  1DYU A;  3RGR A;  8CHO A;  2F99 A;  5AYS C;  2CFL A;  1S5A A;  5KP4 A;  1LNH A;  1YIT 3;  2C10 A;  3O8Y A;  4Q53 A;  3JVC A;  1OF5 A;  5BVB A;  4LGQ A;  3WA2 X;  3X42 A;  4LZI A;  4WWU C;  1W6C A;  4MMY B;  1E97 A;  3IMA B;  4H3U A;  2XSH B;  4NRE A;  2BO9 B;  2WGQ A;  3EBY A;  4XB5 A;  1YGE A;  3SED A;  3FKA A;  1Q81 4;  1O7P B;  1YJW 3;  1FGR A;  5TGN A;  4K1U A;  5FGO A;  2CIU A;  3F7X A;  4IIA A;  4JF8 A;  4HM6 B;  1W01 A;  1WMP A;  3V99 A;  1KQS 2;  5IG5 A;  5IF6 A;  1VQ7 3;  3MHE A;  3DGN A;  3DUK A;  1ZO2 A;  2CG0 A;  3K63 A;  1GD4 A;  3UL6 A;  3B8L A;  3ROB A;  3Q1C A;  4X2O A;  5STD A;  1Y4K A;  5CF1 A;  1LOX A;  2YFJ B;  1ROV A;  1STD A;  2CH9 A;  1NJI 4;  3NQZ A;  2XF3 A;  3JUM A;  3SOA A;  3NXJ A;  4HM4 B;  4MEI A;  4X2H A;  3NBR A;  3X3Z A;  3G6E 3;  1V74 A;  1JB5 A;  2MC8 A;  3CCS 3;  2WOH A;  1K28 A;  4HM0 B;  4CDL A;  1R4C A;  1QAK A;  5CK6 A;  3I56 3;  5JPP A;  1WMO A;  2CHC A;  3F9S A;  4LMI A;  3CCM 3;  5A0O B;  5IG4 A;  5AIH A;  3CC2 3;  1RN7 A;  1TUH A;  4BTX A;  3CCR 3;  1W00 A;  1E3V A;  2ML5 A;  4KZ1 A;  2V1L A;  5AEU B;  4XBX A;  4U13 A;  1VQK 3;  4FMA A;  4N6L A;  3EF8 A;  2I9W A;  2KXG A;  2XSO B;  3MG1 A;  4H61 A;  1JB4 A;  3B7C A;  1W7C A;  1Q86 4;  1D6Y A;  3DM8 A;  3JUP A;  3ALA A;  2P05 A;  2HMJ B;  4RNY A;  2CG1 A;  3FLJ A;  3EQQ B;  3B4O A;  3HZP A;  2CFD A;  5IG3 A;  3EC9 A;  3ECF A;  5EQL A;  2HML B;  1VZZ A;  3HK4 A;  2CFK A;  4FCJ A;  4EV2 A;  3PXM A;  2P0X A;  1JNQ A;  2BHM A;  3LZA A;  2IA7 A;  1YI2 3;  3CU3 A;  3OWU A;  2FNQ A;  3JUQ A;  5CXO A;  3T0U A;  1KD1 4;  1KC8 4;  1TIJ A;  3NBJ A;  2D1W A;  2SBL A;  1KSI A;  4PEJ A;  2GU3 A;  5IG0 A;  3PGB A;  4N3V A;  4N6T A;  5EEO A;  3UL5 A;  5IEP A;  1GY6 A;  2XGL A;  3NM7 A;  4HM8 B;  3CCE 3;  1E3R A;  3BB9 A;  2OTL 3;  2A15 A;  1CQS A;  3CNM A;  4HJL B;  3SOY A;  1OGX A;  1VQ5 3;  3CPO A;  1W2B 2;  2W9Q A;  3GRD A;  2RFR A;  1AVK A;  2P0M A;  1UUV B;  3I0Y A;  1FGQ A;  3LT9 A;  3BNE A;  3MKI A;  1Z1S A;  4G1M B;  1F8N A;  1AVL A;  1N5P A;  2Z76 A;  1GYB A;  1GS3 A;  3U1W A;  2GBX B;  3GAX A;  3NQY A;  3TDG A;  1YJN 3;  4HM5 B;  4R9L A;  1AR0 A;  2K0M A;  3KKG A;  4IT7 A;  4R4K A;  3LOY A;  3BND A;  4FMB A;  4WFO A;  3EN8 A;  1A90 A;  3WDG B;  4XBY A;  1O7H B;  3RDE A;  3H3H A;  2OOV C;  4XBT A;  2LYX A;  3BNB A;  5EVH A;  3SX1 A;  1DMQ A;  3K7C A;  4I4K A;  3I55 3;  4GL6 A;  2W9P A;  3T8U A;  4RZM A;  1OF5 B;  3PS8 A;  4O3V A;  3WOF B;  5AII A;  2F98 A;  3STD A;  3GZB A;  4OVM A;  1C7H A;  4K1V A;  1AV4 A;  4RNZ A;  1A2V A;  1O7M B;  1VQ4 3;  3EN1 B;  3KN4 A;  1IVU A;  2W04 A;  3CD6 3;  1W6G A;  2PNC A;  5DRV A;  4L8P A;  3CCU 3;  1EA2 A;  5CLK A;  5ELU A;  1CYV A;  2FXT A;  3CXC 2;  2OQE A;  3WOD G;  2OQE C;  1G96 A;  3G8Z A;  4K90 B;  1IDP A;  3H51 A;  2M7O A;  4KFE A;  5AIG A;  5IEO A;  5LC6 A;  1Q40 B;  2CC3 A;  2MF7 A;  2E2T A;  2KRT A;  1S72 3;  1TFO A;  1UW1 A;  2BMO B;  4K61 A;  2IUK A;  3J7Y d;  3SXX A;  1Q40 A;  3N9H A;  4N6M A;  2Z7A A;  2ZDJ A;  3DMC A;  2P09 A;  3EBT A;  5KP3 A;  1L5G B;  3PCR A;  1O7G B;  1DMM A;  3S67 A;  2QEX 3;  3OX9 A;  3N54 B;  6STD A;  1SIH A;  4KVH A;  3L0R A;  1QVF 2;  2Z77 A;  3NV0 B;  1M1X B;  3F40 A;  1EG9 B;  1TU5 A;  1K8A 4;  3KSE D;  4TX4 A;  2W2C A;  4XM4 A;  2D42 A;  3GWR A;  3JUN A;  1SPU A;  1A2K A;  3FZW A;  3NV0 A;  3FCS B;  4HKV B;  2W0Q A;  1NU3 A;  3MSO A;  1WQL B;  1JB2 A;  2Y73 A;  5ELJ A;  4EYC A;  2XFT A;  1ZX2 A;  1GD3 A;  3HX8 A;  4HM7 B;  4N6U A;  1FGT A;  5AYR B;  3ER7 A;  3X3Y A;  5JPU A;  1D6Z A;  4N6N B;  4ZM8 A;  3LML A;  2HMM B;  3VGN A;  3NUV A;  1IQ8 A;  3B4P A;  2QIY A;  2CK3 H;  4JRF A;  3CNX A;  2RGQ A;  3G16 A;  2O9U X;  1WNH A;  2Y74 A;  1SJW A;  1IU7 A;  1J2B A;  1LXE A;  4LEH A;  5IW9 A;  3OWY A;  1IT7 A;  1U8C B;  2BNG A;  2CW9 A;  1YHQ 3;  3N8B A;  3MG3 A;  1W5Z A;  4L8O A;  3IJE B;  1VQ6 3;  3AMO B;  3FSD A;  1W2Z A;  2YFI B;  4HM3 B;  4O2H A;  3UNL A;  1TP6 A;  2RCD A;  1OCV A;  3G0K A;  3M8C A;  4EV5 A;  1A67 A;  3D9R A;  4O02 B;  3AMO A;  5I97 A;  1NDO B;  1QAL A;  1UI7 A;  2IUJ A;  4AEQ A;  1JKG B;  2B1X B;  4WYK B;  1K41 A;  5JBS A;  3CME 3;  4MMZ B;  2CWT A;  2XR8 B;  1JKG A;  2K54 A;  4WYK A;  1IVX A;  5IEN A;  1ULI B;  1BUQ A;  3GZY B;  3CCQ 3;  1Q7Y 4;  4HM1 B;  1K73 4;  1SQW A;  5IER A;  4RBN A;  3F7S A;  2WGO A;  1DVC A;  2BMR B;  5G2G A;  5D82 A;  3UB1 A;  2XH9 A;  1QJG A;  3NBB A;  3EHC A;  4XDV A;  1CEW I;  5DRE A;  1VQL 3;  3MYT A;  4FMC A;  3QRD A;  2OOV A;  3DXO A;  4EC6 A;  2CFG A;  3S5C A;  3U97 A;  1RKY A;  2E2V A;  3LH4 A;  3PYJ A;  3FG1 A;  3CC4 3;  3DY5 A;  1NWW A;  3FF0 A;  3OW2 2;  1RRL A;  3EB8 A;  3LTB A;  2BT3 A;  1SII A;  3S28 A;  3WA3 A;  2JQ5 A;  3LTA A;  3GZX B;  4QWT A;  1QMA A;  2OTJ 3;  2FGT A;  2HMO B;  1QAF A;  3DGM A;  4KFD A;  3KZT A;  2GU1 A;  4XDW A;  1UUW B;  1VQM 3;  4L7K A;  3CCJ 3;  1HKX A;  3Q90 A;  2W56 B;  4J9A A;  1VQO 3;  1JRQ A;  1IQY A;  1W4N A;  4N6O B;  1FGM A;  1OGZ A;  1OUN A;  1NO3 A;  3DGO A;  2W6J H;  3VF1 A;  3LT8 A;  2P38 A;  4HYZ A;  5D81 A;  3KSP A;  1K9M 4;  1YJ9 3;  1N8R 4;  3FH1 A;  1PFP A;  1JJ2 2;  2HMN B;  4BTW A;  2W56 A;  1OAC A;  3NHX A;  3BLZ A;  2W03 A;  4N6V 0;  3PCS A;  1T5Y A;  1M9G A;  1OH0 A;  4NHF A;  4WP5 A;  1IV9 A;  3HIG A;  4HM2 B;  1O7W B;  3SLU A;  4BTY A;  1N9J A;  2ZL8 A;  1ISK A;  1UI8 A;  2GEX A;  1FA3 A;  1DMN A;  1ULJ B;  2OCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...