4U13A

Crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
FQSMDLPDIVNMYFDADSCNDTDALSETFAPDAVVEDEGARHQGVVAILRWWVAAKKAASYVAEPLESTVDGDKALVRAKVSGRFPGSPVTLTYSFTIKDGRIARLEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative polyketide cyclase (protein SMa1630) from Sinorhizobium meliloti at 2.3 A resolution
rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Transferase
molecule keywords putative polyketide cyclase SMa1630
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4u13A00
1OGXA 1S5AA 2INXA 3B7CA 4HM8B 3KE7A 2HMLB 1IDPA 1EG9B 4WWUC 1W6YA 1HKXA 2BMOB 1OH0A 2HMJB 1JB2A 2K54A 1OHSA 3ECFA 1O7WB 3FSDA 3MHEA 4HM2B 4HM0B 4Q53A 7STDA 5IENA 1UUVB 3JUMA 1JKGB 1GYBA 4XBYA 5IG4A 3MG3A 3FF2A 1GY5A 3B4PA 2GEXA 4HM1B 3SEDA 1GS3A 3OWYA 3KKGA 3RGAA 8CHOA 4HM4B 3MSOA 1NWWA 4HVNA 3UNLA 1OF5B 1JKGA 3MKIA 2R4IA 4L7KA 5KP1A 1ISKA 3DXOA 1STDA 2HMKB 1OUNA 1WQLB 3CU3A 1C7HA 3NV0A 1U5OA 3B4OA 3SOYA 4L8OA 3OX9A 1QMAA 1ZO2A 2B1XB 3MG1A 3BB9A 5EVHA 3F8HA 2F99A 1EA2A 3GZYB 4OUQA 5AI1A 5IF6A 1BUQA 1DMQA 3EHCA 4J9AA 4H3UA 4I4KA 3MG2A 3NM2A 4R1KA 3DUKA 4STDA 2Z77A 3STDA 1GY6A 3EC9A 3KSPA 3LZAA 4HM7B 3CNMA 3EBYA 4WYKB 2CHCA 3DZLA 3ER7A 4K1VA 3EJVA 3FH1A 3I0YA 4FCJA 5CF2A 2GXFA 1O7MB 3H3HA 5IG0A 3NXJA 3JUPA 3KZTA 1GY7A 4HZ9B 5AIFA 5DRVA 4N3VA 5TGNA 5IEOA 5IERA 3SOAA 4OVMA 1ZX2A 2GBXB 2QGUA 3F40A 3FGYA 3OV4A 5AIGA 1TP6A 2QIYA 1O7HB 4HZBB 5AEUB 5BXQA 3FZWA 5KP4A 1W01A 1ASKA 1Q40B 2GEYA 3LYGA 3Q90A 1UUWB 2BNGA 5CK6A 3JUOA 4IIAA 4XB5A 2UX0A 3CNXA 3HZPA 4K1UA 1E97A 1A2KA 1CQSA 4WYKA 1NU3A 2PZVA 1DMNA 5CLKA 3GZRA 5AIHA 4R9LA 1ULJB 1SJWA 2HMNB 4J8TA 5AIIA 3D9RA 1OPYA 4LMIA 4RZMA 5JPPA 4MJDA 4XM4A 1Q42A 4WP5A 1OGZA 2RGQA 4HM5B 5KP3A 3F14A 3ROBA 2A15A 1E3RA 5FW5A 3S5CA 2XRXB 3EN1B 3JUQA 1NDOB 3G8ZA 2BMQB 1Q40A 2STDA 4X2OA 3T8NA 1TUHA 1JB5A 1OCVA 1OF5A 3DMCA 3EN8A 3A76A 1DMMA 2OWPA 3VSYA 3F7SA 3IPTA 4X2HA 3RGRA 4CDLA 3H51A 3NV0B 1OHPA 2I9WA 3EF8A 3OWUA 3GZBA 2HMMB 2RFRA 2B24B 1QJGA 3BLZA 3K7CA 5G2GA 3T8UA 4LGQA 2F98A 1JN5A 1K41A 1OHOA 3F9SA 1E3VA 4U13A 4XDWA 3NBRA 4KVHA 3HX8A 4ORLA 5STDA 5IG5A 2JQ5A 3GWRA 5D83A 4LEHA 1JB4A 3FF0A 3EQQB 2IMJA 1AR0A 5CXOA 3E99A 3EX9A 3WMDA 3GRDA 5D82A 4HM3B 2YFIB 5HGRA 3OWSA 4GB5A 2W2CA 2YFLB 4HM6B 4L8PA 5DREA 5AEWB 5CF1A 2XR8B 3NUVA 4FCMA 2Z7AA 4XDVA 3VGNA 5JPUA 3OXAA 2GBWB 1W00A 1O7NB 2F86B 2BMRB 3B8LA 3GZXB 5IEPA 1ULIB 2XSOB 1VZZA 3JUNA 3M8CA 3F8XA 1JN5B 2CKFB 2XSHB 3CPOA 4PEJA 3MYTA 5BVBA 1W02A 4HJLB 5D81A 3F7XA 4R9KA 3HK4A 4HKVB 2RCDA 3UJMA 1O7GB 3G0KA 2Z76A 6STDA 5IG3A 3FKAA 2HMOB 3FLJA 1Z1SA 4XBXA 3EBTA 3NHXA 3G16A 1O7PB 3DM8A 2YFJB 4XBTA 3K0ZA
chains in the Genus database with same CATH superfamily
1OGXA 1US1A 2F5WA 5ELJA 5EEOA 4HM8B 3SYUA 2HMLB 3X3ZA 8RNTA 1FA3A 1RKYA 1EG9B 4FMAA 4WWUC 4BL2A 1YVSA 3AHSA 3MHEA 1VQL3 1B2ZA 1HZ1A 4J5KA 1OHSA 1O7WB 2BO9B 4KFFA 2YX9A 1AVKA 4HAAA 5FGOA 3CC43 3AGOA 3G6E3 1BSCA 1I2GA 3FF2A 1UDII 2OOVA 3S28A 3CCJ3 1BSEA 1RGLA 1IT8A 3MSOA 3UNLA 4HVNA 3V99A 4FCZA 2W9PA 1W4NA 1WQLB 3CU3A 1C7HA 3UL6A 1WNHA 2GU1A 3Q1CA 3MG1A 3BB9A 4LYLB 3F8HA 2F99A 2ML5A 1BUQA 3LTCA 3CC73 3J7Yd 1TRQA 1FYSA 3NM2A 4R1KA 1A67A 3WOEB 1RLSA 3BNDA 1IQ8A 3EBYA 4WYKB 1VQ53 2W0QA 3LTBA 3I0YA 3URPA 1S723 1BIRA 1RGFA 2GXFA 1FGOA 2Q07A 1LQMB 5BU4A 2CFKA 2ZL8A 2P0XA 3NXJA 5TGNA 5DRVA 1MGWA 5M1AA 3CCU3 2CWTA 2QGUA 1PU4A 3S67A 3ZFZA 4N6MA 1RHLA 1JRQA 2IY2A 3D79A 1W01A 3K63A 4NHFA 1BRJA 4TX4A 2CFGA 1IV9A 4XB5A 3DY5A 1DE3A 1VQQA 3HZPA 3KSED 4K1UA 2ZHXB 2P0MA 3CPW2 4WYKA 3PCRA 1DMNA 3X42A 1J2BA 3DH2A 1BVIA 4LMIA 1IVWA 4XM4A 2Y73A 3X3YA 2RGQA 2XGLA 4N6V0 5KP3A 3X41A 1BAOA 1E3RA 3S5CA 1GMPA 3EN1B 3G4S3 3G8ZA 5ELUA 1VQ93 4BTXA 3T8NA 1OCVA 3DMCA 3A76A 1DMMA 2OWPA 3VSYA 1AY7A 1B2SA 3IPTA 3KCHA 3GSPA 2HOHA 3GZBA 1U8CB 2HMMB 2B24B 3T8UA 1JBTA 3ZG5A 1IYYA 2F98A 1K41A 1BU4A 4KVHA 3WODG 5JBSA 3GWRA 2CG1A 4LEHA 3FCSB 1G02A 4N6OB 1N8R4 2IMJA 3CCE3 3D5GA 2CC3A 1FZUA 1GSPA 3DGNA 3GRDA 3GAXA 4HM3B 2K3DA 3WMDA 3WR2A 3LTDA 1F8NA 4BL3A 1BNRA 5DREA 4GB5A 2W2CA 2W9QA 4L8PA 4NPBA 5CF1A 1IK3A 4FCMA 3VGNA 1N5PA 3WOFB 1WMPA 2F86B 5IEPA 1UCJA 3SLUA 2XSHB 1LOYA 1W2B2 1W02A 4HJLB 1X1WA 4MEIA 1YIT3 3FG1A 1ZS7A 4HKVB 5IG3A 1O7GB 4I5QA 1BNGA 1GMQA 4G1MB 1TIJA 1WTHA 3G713 1RSNA 4CPKA 2P09A 1QALA 1TU5A 1CYVA 3WA2X 3G16A 3B7CA 1S5AA 1RNTA 2INXA 4R80A 1BUJA 2L4VA 3SX1A 1W6YA 1AV4A 2K54A 1OH0A 2CX0A 1JB2A 1I3IA 1W6GA 3MWZA 4Q53A 3CCR3 5IENA 2P38A 3JUMA 1GYBA 4XBYA 5IG4A 3B4PA 1RGGA 1GS3A 2R41A 1VQM3 1RGCA 3KKGA 8CHOA 3PCSA 1IQXA 4L7KA 1ISKA 3PGBA 2D1WA 3AMOB 1OUNA 4KFDA 3N54B 1QMAA 4R4KA 5EVHA 3NQYA 1K8A4 3U97A 1RTUA 2WGQA 1BSBA 1RCLA 1FGRA 1RRLA 2Z77A 3KSPA 2CFWA 3LZAA 3DGOA 1N9JA 3CMA3 4K1VA 3EJVA 4EXRA 3LT9A 4KT3B 4HZ9B 5IERA 4N3VA 3K9MC 1IT7A 1BSDA 2CWVA 3NX0A 1BRNL 1ZX2A 1HYFA 2GBXB 1JNQA 5AEUB 1O7HB 2GU3A 4O3VA 3FZWA 2BHMA 3CC23 4CJNA 2IA7A 2Y74A 1ASKA 5CK6A 2GEYA 3LYGA 1KQS2 3JUOA 3WDGB 5LC6A 1E97A 2O9UX 2WO0A 1C54A 1RN1A 1MGRA 1UGHI 3GZRA 1LXEA 2XFTA 5AIHA 1ULJB 1SQWA 4HYZA 1RGAA 2HMNB 1A2PA 1NB5I 1TTOA 1W2ZA 3AHWA 4RZMA 5HOHA 1YJW3 1MNLA 1RDSA 2OTJ3 1AQZA 4ZM8A 1V74A 4HM5B 5G1KA 2OQEC 3K5TA 1LNHA 3JUQA 2WOFA 3HIGA 1B27A 1NO3A 1VQK3 1M904 3F7SA 3AMOA 5BIRA 4CDLA 2C10A 1KSIA 2C11A 3OWUA 4DKIA 2RFRA 1RGHA 4N6LA 1EUIC 2P05A 3D3LA 3QK9A 4ORLA 3LXUX 1B2UA 5D83A 3UL5A 3V92A 1IV7A 1JB4A 3EQQB 3UB1A 4CCVA 1FUWA 5M18A 1NB3I 5HGRA 2QEX3 3CME3 9RNTA 1W5ZA 1IU7A 2K0MA 3NUVA 3TDGA 2Z7AA 4O2HA 4XDVA 1VQ43 3OXAA 1RMSA 3B8LA 3DGYA 1X1XA 1JZDA 1VZZA 2XSOB 4PEJA 2CKFB 5BVBA 3CPOA 2GSPA 3PS8A 4K61A 1NJI4 3F7XA 4R9KA 3AGNA 3UJMA 6STDA 4RBNA 1DVCA 1YHQ3 2SARA 2HMOB 3WHOA 3FLJA 1Q7HA 1RN4A 4LSOA 2BIRA 1KD14 1I70A 1TFOA 2MC8A 4KZ1A 1VQ63 4X2OA 3DM8A 1K9M4 4XBTA 2LQVA 4AKZA 4KFEA 2H0GA 3IJEB 3BNBA 3I563 3Q3FA 5I97A 2KRTA 3SOAA 4EYCA 1CYUA 1QAFA 1FGQA 5AYRB 1I0VA 4GHOA 4QWTA 7STDA 3LTAA 1LQGC 1VQO3 5STDA 1YI23 4BTYA 1JKGB 2KF4A 4N6UA 1MWSA 1GY5A 2GEXA 1D6YA 4MMYB 1DVDA 3OWYA 2KCDA 3A5EA 1EKMA 1MWRA 1MWTA 1NWWA 4FMBA 4HBRA 2ML6A 1JKGA 3MKIA 1EEJA 2AADA 2R4IA 2W04A 4IT7A 3X3XA 3DXOA 4AEQA 1STDA 1QVG2 2OCTA 1IVVA 1LRAA 3SOYA 1U5OA 3CCQ3 3PZWA 3BNCA 1RGEA 3EE1A 1MOLA 5IF6A 1B20A 1BNIA 5M19A 1W7CA 1DMQA 3EHCA 1B3SA 3T0UA 4FR9A 3OW22 1TRPA 1TJDA 3DUKA 2CH9A 2IUJA 2CFDA 1GY6A 2KXGA 3BNEA 3EC9A 1M1XB 1Q9EA 3ALAA 3CNMA 3STDA 5IW9A 3DZLA 1Y4KA 2F56A 5CF2A 2MF7A 4FMDA 3QRDA 3RNTA 3H3HA 1GOVA 2FXTA 5IG0A 3DGLA 3JUPA 3KZTA 1GY7A 2E2VA 1BGSA 5AIFA 1JBSA 5IEOA 7RNTA 3FGYA 3OV4A 3D4AA 5AIGA 1TP6A 3Q2PA 5BXQA 2RSXA 1K28A 3HIIA 5KP4A 1UI7A 3JVCA 3NM7A 2XGNA 3DGMA 1UCKA 4IIAA 3LMLA 1BNEA 2UX0A 1A2KA 6RNTA 2PZVA 1I0XA 2W56A 1BNSA 3CCL3 1BNFA 1YJN3 3D9RA 1BRKA 1OPYA 4EC6A 5JPPA 1N5HA 2ZA4A 1GOYA 1Q42A 4WP5A 1T3BA 1OGZA 3CCM3 1Q864 1I2FA 3F14A 1L5GB 2A15A 5FW5A 3ZG0A 1W6CA 6GSPA 2V1LA 3U1WA 2CWUA 2STDA 1Q40A 2D42A 1BOXA 1JB5A 1OF5A 1TUHA 4EW5A 3EN8A 3CD63 1GD4A 1N8QA 2FGTA 4X2HA 3NV0B 1X1UA 1PYLA 4J5GA 2I9WA 3NBJA 3SVAA 1B21A 3K7CA 1QJGA 2KF3A 3WA3A 4LGQA 4U13A 1OHOA 3SXXA 1N9EA 1E3VA 3S27A 3NBRA 4JRFA 1AR0A 3E99A 3IMAB 1R4YA 1T5YA 5D82A 2KF5A 1UW1A 1PY3A 3KIIA 2YFLB 4WFOA 1NNVA 1LOVA 1W00A 4EV5A 1O7NB 4OK0A 4GSPA 2J8XB 1G96A 3GZXB 1YJ93 1SARA 5G1LA 2CG0A 3MYTA 2JDIH 3HK4A 1RRHA 1Q824 3G0KA 2Z76A 1VQ83 3FKAA 4RNTA 4BTWA 4LZIA 4EV2A 3CCV3 1UCIA 1Z1SA 4XBXA 1RJOA 2CK3H 1FGTA 2SBLA 4K90B 1JZOA 3EBTA 1JBRA 3L0RA 3X40A 3NHXA 1RNBA 7GSPA 1BRHA 2OOVC 2XEPA 1KC84 1YGWA 3K0ZA 1Q7Y4 1Q814 3KE7A 1X1YA 3KN4A 1B2MA 1IDPA 1IVUA 1QVF2 1KWIA 2BMOB 1HKXA 2HMJB 4HM2B 3ECFA 4J8TA 3FSDA 1WMNA 3V98A 1AVLA 1SIIA 1T2IA 1YNVX 4HM0B 4NREA 4MMXB 1SPUA 2QA43 1ZGXA 1BRGA 1STFI 5EQLA 1UUVB 2M7OA 3RDEA 4MMZB 3MG3A 2XF3A 4BIRA 3HOHA 4HM1B 3SEDA 1RGKA 1I3FA 2IUKA 2OTL3 3RGAA 3D5IA 4HM4B 3BU4A 1OF5B 1B2XA 2CX1A 5KP1A 4ILFA 1CH0A 2HMKB 1GD3A 5A0OB 1G0TA 3NV0A 1I2EA 2KAAA 2RBIA 1I8VA 3B4OA 2CFLA 4L8OA 1MWUA 3OX9A 2FNQA 1ZO2A 2B1XB 3EB8A 4OUQA 3GZYB 1EA2A 5AI1A 3NBBA 1JJ22 4RNYA 4J9AA 3LH4A 4H3UA 4I4KA 1YIJ3 2E2TA 1A2VA 3MG2A 4STDA 4RNZA 4HM7B 3N8BA 2ZDJA 2CHCA 3ER7A 3FH1A 2W56B 4FCJA 1O7MB 5LC7A 1K734 2AAEA 2H0HA 2IYJA 3NQZA 2W6JH 4N6NB 3ROBA 3I553 3O8YA 4O02B 4OVMA 2RNTA 1V57A 1IQYA 2O3OA 2XFSA 3F40A 1M1K4 2BU4A 2QIYA 4HZBB 1BANA 1D6UA 2LYXA 4JF8A 1LNIA 1BSAA 1Q40B 3Q90A 3FG4A 1UUWB 2BNGA 1A90A 4EBGA 4FMCA 3CNXA 2PNCA 1CQSA 1NU3A 5CLKA 1FUTA 4R9LA 1SJWA 1CEWI 1UCLA 1UGIA 2H0IA 1WMOA 3N9HA 4GL6A 4N6TA 5AIIA 2OQEA 3VF1A 1EQKA 5RNTA 1SIHA 3LT8A 4MJDA 4O8SA 1LOWA 1BRSA 2KF6A 4BU4A 3CCS3 2XRXB 1NDOB 2Z6BA 1DETA 2BMQB 4HOHA 4H61A 1D6ZA 2C4BA 3RGRA 3H51A 2W03A 3PXMA 1OHPA 2BT3A 1V58A 3EF8A 4WHAA 1RCKA 3BLZA 4IPBA 5G2GA 1FGMA 1JN5A 4XDWA 3HI7A 3F9SA 5IG5A 1R4CA 1DYUA 1QAKA 1YGEA 1FUSA 2E2UA 1PFPA 2JQ5A 2WGOA 3HX8A 1JV2B 5GSPA 3FF0A 1GOUA 1ROAA 1UI8A 2F4YA 3EX9A 3KFQC 1TFKA 5CXOA 2YFIB 3MPHA 3OWSA 5AEWB 2CIUA 4HM6B 1BRIA 2XR8B 5JPUA 1LVNA 2GBWB 1VQ73 2L1SA 4AKYA 1M9GA 1HU9A 3CXC2 2BMRB 1ULIB 1T2HA 3JUNA 3M8CA 3F8XA 1JN5B 2F5MA 5AYSC 3LOYA 3BIRA 2UGIA 5D81A 1UUGB 3PYJA 3S29A 2RCDA 1VQP3 3FG3A 1LOXA 2CW9A 1BNJA 2UUGC 1VQN3 1ROVA 1RN7A 1GMRA 1YVBI 1OACA 1FW7A 1IVXA 2XH9A 2WOHA 1O7PB 2YFJB
chains in the Genus database with same CATH topology
1OGXA 1US1A 1FA3A 5ELJA 5EEOA 4HM8B 2HMLB 3X3ZA 1RKYA 1EG9B 4FMAA 4WWUC 1VQL3 3MHEA 1OHSA 1O7WB 2BO9B 4KFFA 2YX9A 1AVKA 5FGOA 3CC43 3G6E3 3FF2A 3S28A 2OOVA 3CCJ3 1IT8A 3MSOA 3UNLA 4HVNA 3V99A 4FCZA 2W9PA 1W4NA 1WQLB 3CU3A 1C7HA 3UL6A 1WNHA 2GU1A 3Q1CA 3MG1A 3BB9A 3F8HA 2F99A 2ML5A 1BUQA 3LTCA 3CC73 3J7Yd 3NM2A 4R1KA 1A67A 3WOEB 3BNDA 1IQ8A 3EBYA 4WYKB 1VQ53 2W0QA 3LTBA 3I0YA 1S723 2GXFA 2Q07A 1FGOA 2CFKA 2ZL8A 2P0XA 3NXJA 5TGNA 5DRVA 3CCU3 2CWTA 2QGUA 1PU4A 3S67A 4N6MA 1JRQA 1W01A 3K63A 4NHFA 4TX4A 2CFGA 1IV9A 4XB5A 3DY5A 4K1UA 3HZPA 3KSED 2P0MA 3CPW2 4WYKA 3PCRA 1DMNA 3X42A 1J2BA 4LMIA 1IVWA 4XM4A 2Y73A 3X3YA 2RGQA 2XGLA 4N6V0 5KP3A 3X41A 1E3RA 3S5CA 3EN1B 3G4S3 3G8ZA 5ELUA 1VQ93 4BTXA 3T8NA 1OCVA 3DMCA 3A76A 1DMMA 2OWPA 3VSYA 3IPTA 3GZBA 1U8CB 2HMMB 2B24B 3T8UA 2F98A 1K41A 3WODG 4KVHA 5JBSA 3GWRA 2CG1A 4LEHA 3FCSB 1N8R4 4N6OB 2IMJA 3CCE3 3WMDA 2CC3A 3DGNA 3GRDA 3GAXA 4HM3B 3LTDA 1F8NA 5DREA 4GB5A 2W2CA 2W9QA 4L8PA 5CF1A 1IK3A 4FCMA 3VGNA 1N5PA 3WOFB 1WMPA 2F86B 5IEPA 3SLUA 2XSHB 1W2B2 1W02A 4HJLB 4MEIA 1YIT3 3FG1A 4HKVB 5IG3A 1O7GB 4G1MB 1TIJA 1WTHA 3G713 2P09A 1QALA 1TU5A 1CYVA 3WA2X 3G16A 3B7CA 1S5AA 2INXA 4R80A 2L4VA 3SX1A 1W6YA 1AV4A 2K54A 1OH0A 1JB2A 1W6GA 3MWZA 4Q53A 3CCR3 5IENA 2P38A 3JUMA 1GYBA 4XBYA 5IG4A 3B4PA 1GS3A 1VQM3 3KKGA 8CHOA 3PCSA 1IQXA 4L7KA 1ISKA 3PGBA 2D1WA 3AMOB 1OUNA 4KFDA 3N54B 1QMAA 4R4KA 5EVHA 3NQYA 1K8A4 3U97A 2WGQA 1FGRA 1RRLA 2Z77A 3KSPA 2CFWA 3LZAA 3DGOA 1N9JA 3CMA3 4K1VA 3EJVA 4EXRA 3LT9A 4HZ9B 5IERA 4N3VA 3K9MC 1IT7A 2CWVA 3NX0A 1ZX2A 2GBXB 1JNQA 5AEUB 1O7HB 2GU3A 4O3VA 3FZWA 2BHMA 3CC23 2IA7A 2Y74A 1ASKA 5CK6A 2GEYA 3LYGA 1KQS2 3JUOA 3WDGB 5LC6A 1E97A 2O9UX 2WO0A 3GZRA 1LXEA 2XFTA 5AIHA 1ULJB 1SQWA 4HYZA 2HMNB 1NB5I 1W2ZA 1YJW3 4RZMA 1MNLA 2OTJ3 4ZM8A 1V74A 4HM5B 2OQEC 3K5TA 1LNHA 3JUQA 2WOFA 3HIGA 1NO3A 1VQK3 1M904 3F7SA 3AMOA 4CDLA 2C10A 1KSIA 2C11A 3OWUA 2RFRA 4N6LA 2P05A 3D3LA 3QK9A 4ORLA 3LXUX 5D83A 3UL5A 1JB4A 1IV7A 3EQQB 3UB1A 4CCVA 1FUWA 1NB3I 5HGRA 2QEX3 3CME3 1W5ZA 1IU7A 2K0MA 3NUVA 3TDGA 2Z7AA 4O2HA 4XDVA 1VQ43 3OXAA 3B8LA 2XSOB 1VZZA 4PEJA 2CKFB 5BVBA 3CPOA 3PS8A 4K61A 1NJI4 3F7XA 4R9KA 6STDA 3UJMA 4RBNA 1DVCA 1YHQ3 2HMOB 3FLJA 4LSOA 1KD14 1TFOA 2MC8A 4KZ1A 1VQ63 4X2OA 3DM8A 1K9M4 4XBTA 2LQVA 4AKZA 4KFEA 3IJEB 3BNBA 3I563 5I97A 1CYUA 2KRTA 3SOAA 4EYCA 1QAFA 1FGQA 5AYRB 4QWTA 7STDA 3LTAA 1VQO3 1YI23 4BTYA 1JKGB 4N6UA 1GY5A 2GEXA 1D6YA 4MMYB 1DVDA 3OWYA 2KCDA 1EKMA 4FMBA 1NWWA 3SXXA 4HBRA 2ML6A 1JKGA 3MKIA 2R4IA 4IT7A 3X3XA 2W04A 4AEQA 1QVG2 3DXOA 1STDA 2OCTA 1IVVA 3SOYA 1U5OA 3CCQ3 3PZWA 3BNCA 3EE1A 1MOLA 5IF6A 1W7CA 1DMQA 3EHCA 3T0UA 4FR9A 3OW22 3DUKA 2CH9A 2IUJA 2CFDA 1GY6A 2KXGA 3BNEA 3EC9A 1M1XB 3ALAA 3CNMA 3STDA 5IW9A 1EQKA 3DZLA 1Y4KA 5CF2A 2MF7A 4FMDA 3QRDA 3H3HA 2FXTA 5IG0A 3DGLA 3JUPA 3KZTA 1GY7A 2E2VA 5AIFA 5IEOA 3FGYA 3OV4A 5BXQA 5AIGA 1TP6A 3Q2PA 2RSXA 1K28A 3HIIA 5KP4A 1UI7A 3JVCA 3NM7A 2XGNA 3DGMA 4IIAA 3LMLA 2UX0A 1A2KA 2PZVA 2W56A 3CCL3 1YJN3 3D9RA 1OPYA 4EC6A 5JPPA 1N5HA 1Q42A 1Q864 4WP5A 3CCM3 1OGZA 3F14A 1L5GB 2A15A 5FW5A 1W6CA 2V1LA 3U1WA 2CWUA 2STDA 1Q40A 2D42A 1TUHA 1JB5A 1OF5A 3EN8A 3CD63 1GD4A 1N8QA 2FGTA 4X2HA 3NV0B 3SVAA 2I9WA 3NBJA 3K7CA 1QJGA 3WA3A 4LGQA 4U13A 1OHOA 1N9EA 1E3VA 3S27A 3NBRA 4JRFA 1AR0A 3E99A 3IMAB 1T5YA 5D82A 1UW1A 3KIIA 2YFLB 4WFOA 1W00A 4EV5A 1O7NB 4OK0A 1G96A 3GZXB 1YJ93 2CG0A 3MYTA 2JDIH 3HK4A 1RRHA 1Q824 3G0KA 2Z76A 1VQ83 3FKAA 4BTWA 4LZIA 4EV2A 3CCV3 1Z1SA 4XBXA 1RJOA 2CK3H 1FGTA 2SBLA 4K90B 3EBTA 3L0RA 3X40A 3NHXA 2OOVC 2XEPA 1KC84 3K0ZA 1Q7Y4 1Q814 3KE7A 3KN4A 1IDPA 1IVUA 1QVF2 1KWIA 2BMOB 1HKXA 2HMJB 4HM2B 3ECFA 4J8TA 3FSDA 1WMNA 3V98A 1AVLA 1SIIA 4HM0B 4NREA 4MMXB 1SPUA 2QA43 1STFI 5EQLA 1UUVB 2M7OA 3RDEA 4MMZB 3MG3A 2XF3A 4HM1B 3SEDA 2IUKA 2OTL3 3RGAA 4HM4B 1OF5B 5KP1A 2HMKB 1GD3A 5A0OB 3NV0A 3B4OA 2CFLA 4L8OA 3OX9A 2FNQA 1ZO2A 2B1XB 3EB8A 4OUQA 3GZYB 1EA2A 5AI1A 3NBBA 1JJ22 4RNYA 4J9AA 3LH4A 4H3UA 4I4KA 1YIJ3 2E2TA 1A2VA 3MG2A 4STDA 4RNZA 4HM7B 3N8BA 2ZDJA 2CHCA 3ER7A 3FH1A 2W56B 4FCJA 1O7MB 5LC7A 1K734 4N6NB 3ROBA 3NQZA 2W6JH 3I553 3O8YA 4O02B 4OVMA 2O3OA 1IQYA 2XFSA 3F40A 1M1K4 2QIYA 4HZBB 1D6UA 2LYXA 4JF8A 1Q40B 3Q90A 3FG4A 1UUWB 2BNGA 1A90A 4EBGA 4FMCA 3CNXA 2PNCA 1CQSA 1NU3A 5CLKA 4R9LA 1SJWA 1CEWI 3N9HA 4GL6A 4N6TA 1WMOA 5AIIA 2OQEA 3V92A 3VF1A 1SIHA 3LT8A 4MJDA 4O8SA 3CCS3 2XRXB 1NDOB 2Z6BA 2BMQB 4H61A 1D6ZA 3RGRA 3H51A 2W03A 3PXMA 1OHPA 2BT3A 3EF8A 4WHAA 3BLZA 4IPBA 5G2GA 1FGMA 1JN5A 4XDWA 3HI7A 3F9SA 5IG5A 1R4CA 1DYUA 1QAKA 1YGEA 2E2UA 2WGOA 1PFPA 2JQ5A 3HX8A 5STDA 1JV2B 3FF0A 1ROAA 1UI8A 3KFQC 3EX9A 5CXOA 1TFKA 2YFIB 3MPHA 3OWSA 5AEWB 2CIUA 4HM6B 2XR8B 5JPUA 1LVNA 2GBWB 1VQ73 4AKYA 1M9GA 1HU9A 3CXC2 2BMRB 1ULIB 3JUNA 3M8CA 3F8XA 1JN5B 5AYSC 3LOYA 5D81A 3PYJA 3S29A 2RCDA 1VQP3 3FG3A 1LOXA 2CW9A 1VQN3 1ROVA 1RN7A 1YVBI 1OACA 1IVXA 2XH9A 2WOHA 1O7PB 2YFJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGX A;  1S5A A;  2INX A;  3B7C A;  4HM8 B;  3KE7 A;  2HML B;  1IDP A;  1EG9 B;  4WWU C;  1W6Y A;  1HKX A;  2BMO B;  1OH0 A;  2HMJ B;  1JB2 A;  2K54 A;  1OHS A;  3ECF A;  1O7W B;  3FSD A;  3MHE A;  4HM2 B;  4HM0 B;  4Q53 A;  7STD A;  5IEN A;  1UUV B;  3JUM A;  1JKG B;  1GYB A;  4XBY A;  5IG4 A;  3MG3 A;  3FF2 A;  1GY5 A;  3B4P A;  2GEX A;  4HM1 B;  3SED A;  1GS3 A;  3OWY A;  3KKG A;  3RGA A;  8CHO A;  4HM4 B;  3MSO A;  1NWW A;  4HVN A;  3UNL A;  1OF5 B;  1JKG A;  3MKI A;  2R4I A;  4L7K A;  5KP1 A;  1ISK A;  3DXO A;  1STD A;  2HMK B;  1OUN A;  1WQL B;  3CU3 A;  1C7H A;  3NV0 A;  1U5O A;  3B4O A;  3SOY A;  4L8O A;  3OX9 A;  1QMA A;  1ZO2 A;  2B1X B;  3MG1 A;  3BB9 A;  5EVH A;  3F8H A;  2F99 A;  1EA2 A;  3GZY B;  4OUQ A;  5AI1 A;  5IF6 A;  1BUQ A;  1DMQ A;  3EHC A;  4J9A A;  4H3U A;  4I4K A;  3MG2 A;  3NM2 A;  4R1K A;  3DUK A;  4STD A;  2Z77 A;  3STD A;  1GY6 A;  3EC9 A;  3KSP A;  3LZA A;  4HM7 B;  3CNM A;  3EBY A;  4WYK B;  2CHC A;  3DZL A;  3ER7 A;  4K1V A;  3EJV A;  3FH1 A;  3I0Y A;  4FCJ A;  5CF2 A;  2GXF A;  1O7M B;  3H3H A;  5IG0 A;  3NXJ A;  3JUP A;  3KZT A;  1GY7 A;  4HZ9 B;  5AIF A;  5DRV A;  4N3V A;  5TGN A;  5IEO A;  5IER A;  3SOA A;  4OVM A;  1ZX2 A;  2GBX B;  2QGU A;  3F40 A;  3FGY A;  3OV4 A;  5AIG A;  1TP6 A;  2QIY A;  1O7H B;  4HZB B;  5AEU B;  5BXQ A;  3FZW A;  5KP4 A;  1W01 A;  1ASK A;  1Q40 B;  2GEY A;  3LYG A;  3Q90 A;  1UUW B;  2BNG A;  5CK6 A;  3JUO A;  4IIA A;  4XB5 A;  2UX0 A;  3CNX A;  3HZP A;  4K1U A;  1E97 A;  1A2K A;  1CQS A;  4WYK A;  1NU3 A;  2PZV A;  1DMN A;  5CLK A;  3GZR A;  5AIH A;  4R9L A;  1ULJ B;  1SJW A;  2HMN B;  4J8T A;  5AII A;  3D9R A;  1OPY A;  4LMI A;  4RZM A;  5JPP A;  4MJD A;  4XM4 A;  1Q42 A;  4WP5 A;  1OGZ A;  2RGQ A;  4HM5 B;  5KP3 A;  3F14 A;  3ROB A;  2A15 A;  1E3R A;  5FW5 A;  3S5C A;  2XRX B;  3EN1 B;  3JUQ A;  1NDO B;  3G8Z A;  2BMQ B;  1Q40 A;  2STD A;  4X2O A;  3T8N A;  1TUH A;  1JB5 A;  1OCV A;  1OF5 A;  3DMC A;  3EN8 A;  3A76 A;  1DMM A;  2OWP A;  3VSY A;  3F7S A;  3IPT A;  4X2H A;  3RGR A;  4CDL A;  3H51 A;  3NV0 B;  1OHP A;  2I9W A;  3EF8 A;  3OWU A;  3GZB A;  2HMM B;  2RFR A;  2B24 B;  1QJG A;  3BLZ A;  3K7C A;  5G2G A;  3T8U A;  4LGQ A;  2F98 A;  1JN5 A;  1K41 A;  1OHO A;  3F9S A;  1E3V A;  4U13 A;  4XDW A;  3NBR A;  4KVH A;  3HX8 A;  4ORL A;  5STD A;  5IG5 A;  2JQ5 A;  3GWR A;  5D83 A;  4LEH A;  1JB4 A;  3FF0 A;  3EQQ B;  2IMJ A;  1AR0 A;  5CXO A;  3E99 A;  3EX9 A;  3WMD A;  3GRD A;  5D82 A;  4HM3 B;  2YFI B;  5HGR A;  3OWS A;  4GB5 A;  2W2C A;  2YFL B;  4HM6 B;  4L8P A;  5DRE A;  5AEW B;  5CF1 A;  2XR8 B;  3NUV A;  4FCM A;  2Z7A A;  4XDV A;  3VGN A;  5JPU A;  3OXA A;  2GBW B;  1W00 A;  1O7N B;  2F86 B;  2BMR B;  3B8L A;  3GZX B;  5IEP A;  1ULI B;  2XSO B;  1VZZ A;  3JUN A;  3M8C A;  3F8X A;  1JN5 B;  2CKF B;  2XSH B;  3CPO A;  4PEJ A;  3MYT A;  5BVB A;  1W02 A;  4HJL B;  5D81 A;  3F7X A;  4R9K A;  3HK4 A;  4HKV B;  2RCD A;  3UJM A;  1O7G B;  3G0K A;  2Z76 A;  6STD A;  5IG3 A;  3FKA A;  2HMO B;  3FLJ A;  1Z1S A;  4XBX A;  3EBT A;  3NHX A;  3G16 A;  1O7P B;  3DM8 A;  2YFJ B;  4XBT A;  3K0Z A; 
#chains in the Genus database with same CATH topology
 1OGX A;  1US1 A;  2F5W A;  5ELJ A;  5EEO A;  4HM8 B;  3SYU A;  2HML B;  3X3Z A;  8RNT A;  1FA3 A;  1RKY A;  1EG9 B;  4FMA A;  4WWU C;  4BL2 A;  1YVS A;  3AHS A;  3MHE A;  1VQL 3;  1B2Z A;  1HZ1 A;  4J5K A;  1OHS A;  1O7W B;  2BO9 B;  4KFF A;  2YX9 A;  1AVK A;  4HAA A;  5FGO A;  3CC4 3;  3AGO A;  3G6E 3;  1BSC A;  1I2G A;  3FF2 A;  1UDI I;  2OOV A;  3S28 A;  3CCJ 3;  1BSE A;  1RGL A;  1IT8 A;  3MSO A;  3UNL A;  4HVN A;  3V99 A;  4FCZ A;  2W9P A;  1W4N A;  1WQL B;  3CU3 A;  1C7H A;  3UL6 A;  1WNH A;  2GU1 A;  3Q1C A;  3MG1 A;  3BB9 A;  4LYL B;  3F8H A;  2F99 A;  2ML5 A;  1BUQ A;  3LTC A;  3CC7 3;  3J7Y d;  1TRQ A;  1FYS A;  3NM2 A;  4R1K A;  1A67 A;  3WOE B;  1RLS A;  3BND A;  1IQ8 A;  3EBY A;  4WYK B;  1VQ5 3;  2W0Q A;  3LTB A;  3I0Y A;  3URP A;  1S72 3;  1BIR A;  1RGF A;  2GXF A;  1FGO A;  2Q07 A;  1LQM B;  5BU4 A;  2CFK A;  2ZL8 A;  2P0X A;  3NXJ A;  5TGN A;  5DRV A;  1MGW A;  5M1A A;  3CCU 3;  2CWT A;  2QGU A;  1PU4 A;  3S67 A;  3ZFZ A;  4N6M A;  1RHL A;  1JRQ A;  2IY2 A;  3D79 A;  1W01 A;  3K63 A;  4NHF A;  1BRJ A;  4TX4 A;  2CFG A;  1IV9 A;  4XB5 A;  3DY5 A;  1DE3 A;  1VQQ A;  3HZP A;  3KSE D;  4K1U A;  2ZHX B;  2P0M A;  3CPW 2;  4WYK A;  3PCR A;  1DMN A;  3X42 A;  1J2B A;  3DH2 A;  1BVI A;  4LMI A;  1IVW A;  4XM4 A;  2Y73 A;  3X3Y A;  2RGQ A;  2XGL A;  4N6V 0;  5KP3 A;  3X41 A;  1BAO A;  1E3R A;  3S5C A;  1GMP A;  3EN1 B;  3G4S 3;  3G8Z A;  5ELU A;  1VQ9 3;  4BTX A;  3T8N A;  1OCV A;  3DMC A;  3A76 A;  1DMM A;  2OWP A;  3VSY A;  1AY7 A;  1B2S A;  3IPT A;  3KCH A;  3GSP A;  2HOH A;  3GZB A;  1U8C B;  2HMM B;  2B24 B;  3T8U A;  1JBT A;  3ZG5 A;  1IYY A;  2F98 A;  1K41 A;  1BU4 A;  4KVH A;  3WOD G;  5JBS A;  3GWR A;  2CG1 A;  4LEH A;  3FCS B;  1G02 A;  4N6O B;  1N8R 4;  2IMJ A;  3CCE 3;  3D5G A;  2CC3 A;  1FZU A;  1GSP A;  3DGN A;  3GRD A;  3GAX A;  4HM3 B;  2K3D A;  3WMD A;  3WR2 A;  3LTD A;  1F8N A;  4BL3 A;  1BNR A;  5DRE A;  4GB5 A;  2W2C A;  2W9Q A;  4L8P A;  4NPB A;  5CF1 A;  1IK3 A;  4FCM A;  3VGN A;  1N5P A;  3WOF B;  1WMP A;  2F86 B;  5IEP A;  1UCJ A;  3SLU A;  2XSH B;  1LOY A;  1W2B 2;  1W02 A;  4HJL B;  1X1W A;  4MEI A;  1YIT 3;  3FG1 A;  1ZS7 A;  4HKV B;  5IG3 A;  1O7G B;  4I5Q A;  1BNG A;  1GMQ A;  4G1M B;  1TIJ A;  1WTH A;  3G71 3;  1RSN A;  4CPK A;  2P09 A;  1QAL A;  1TU5 A;  1CYV A;  3WA2 X;  3G16 A;  3B7C A;  1S5A A;  1RNT A;  2INX A;  4R80 A;  1BUJ A;  2L4V A;  3SX1 A;  1W6Y A;  1AV4 A;  2K54 A;  1OH0 A;  2CX0 A;  1JB2 A;  1I3I A;  1W6G A;  3MWZ A;  4Q53 A;  3CCR 3;  5IEN A;  2P38 A;  3JUM A;  1GYB A;  4XBY A;  5IG4 A;  3B4P A;  1RGG A;  1GS3 A;  2R41 A;  1VQM 3;  1RGC A;  3KKG A;  8CHO A;  3PCS A;  1IQX A;  4L7K A;  1ISK A;  3PGB A;  2D1W A;  3AMO B;  1OUN A;  4KFD A;  3N54 B;  1QMA A;  4R4K A;  5EVH A;  3NQY A;  1K8A 4;  3U97 A;  1RTU A;  2WGQ A;  1BSB A;  1RCL A;  1FGR A;  1RRL A;  2Z77 A;  3KSP A;  2CFW A;  3LZA A;  3DGO A;  1N9J A;  3CMA 3;  4K1V A;  3EJV A;  4EXR A;  3LT9 A;  4KT3 B;  4HZ9 B;  5IER A;  4N3V A;  3K9M C;  1IT7 A;  1BSD A;  2CWV A;  3NX0 A;  1BRN L;  1ZX2 A;  1HYF A;  2GBX B;  1JNQ A;  5AEU B;  1O7H B;  2GU3 A;  4O3V A;  3FZW A;  2BHM A;  3CC2 3;  4CJN A;  2IA7 A;  2Y74 A;  1ASK A;  5CK6 A;  2GEY A;  3LYG A;  1KQS 2;  3JUO A;  3WDG B;  5LC6 A;  1E97 A;  2O9U X;  2WO0 A;  1C54 A;  1RN1 A;  1MGR A;  1UGH I;  3GZR A;  1LXE A;  2XFT A;  5AIH A;  1ULJ B;  1SQW A;  4HYZ A;  1RGA A;  2HMN B;  1A2P A;  1NB5 I;  1TTO A;  1W2Z A;  3AHW A;  4RZM A;  5HOH A;  1YJW 3;  1MNL A;  1RDS A;  2OTJ 3;  1AQZ A;  4ZM8 A;  1V74 A;  4HM5 B;  5G1K A;  2OQE C;  3K5T A;  1LNH A;  3JUQ A;  2WOF A;  3HIG A;  1B27 A;  1NO3 A;  1VQK 3;  1M90 4;  3F7S A;  3AMO A;  5BIR A;  4CDL A;  2C10 A;  1KSI A;  2C11 A;  3OWU A;  4DKI A;  2RFR A;  1RGH A;  4N6L A;  1EUI C;  2P05 A;  3D3L A;  3QK9 A;  4ORL A;  3LXU X;  1B2U A;  5D83 A;  3UL5 A;  3V92 A;  1IV7 A;  1JB4 A;  3EQQ B;  3UB1 A;  4CCV A;  1FUW A;  5M18 A;  1NB3 I;  5HGR A;  2QEX 3;  3CME 3;  9RNT A;  1W5Z A;  1IU7 A;  2K0M A;  3NUV A;  3TDG A;  2Z7A A;  4O2H A;  4XDV A;  1VQ4 3;  3OXA A;  1RMS A;  3B8L A;  3DGY A;  1X1X A;  1JZD A;  1VZZ A;  2XSO B;  4PEJ A;  2CKF B;  5BVB A;  3CPO A;  2GSP A;  3PS8 A;  4K61 A;  1NJI 4;  3F7X A;  4R9K A;  3AGN A;  3UJM A;  6STD A;  4RBN A;  1DVC A;  1YHQ 3;  2SAR A;  2HMO B;  3WHO A;  3FLJ A;  1Q7H A;  1RN4 A;  4LSO A;  2BIR A;  1KD1 4;  1I70 A;  1TFO A;  2MC8 A;  4KZ1 A;  1VQ6 3;  4X2O A;  3DM8 A;  1K9M 4;  4XBT A;  2LQV A;  4AKZ A;  4KFE A;  2H0G A;  3IJE B;  3BNB A;  3I56 3;  3Q3F A;  5I97 A;  2KRT A;  3SOA A;  4EYC A;  1CYU A;  1QAF A;  1FGQ A;  5AYR B;  1I0V A;  4GHO A;  4QWT A;  7STD A;  3LTA A;  1LQG C;  1VQO 3;  5STD A;  1YI2 3;  4BTY A;  1JKG B;  2KF4 A;  4N6U A;  1MWS A;  1GY5 A;  2GEX A;  1D6Y A;  4MMY B;  1DVD A;  3OWY A;  2KCD A;  3A5E A;  1EKM A;  1MWR A;  1MWT A;  1NWW A;  4FMB A;  4HBR A;  2ML6 A;  1JKG A;  3MKI A;  1EEJ A;  2AAD A;  2R4I A;  2W04 A;  4IT7 A;  3X3X A;  3DXO A;  4AEQ A;  1STD A;  1QVG 2;  2OCT A;  1IVV A;  1LRA A;  3SOY A;  1U5O A;  3CCQ 3;  3PZW A;  3BNC A;  1RGE A;  3EE1 A;  1MOL A;  5IF6 A;  1B20 A;  1BNI A;  5M19 A;  1W7C A;  1DMQ A;  3EHC A;  1B3S A;  3T0U A;  4FR9 A;  3OW2 2;  1TRP A;  1TJD A;  3DUK A;  2CH9 A;  2IUJ A;  2CFD A;  1GY6 A;  2KXG A;  3BNE A;  3EC9 A;  1M1X B;  1Q9E A;  3ALA A;  3CNM A;  3STD A;  5IW9 A;  3DZL A;  1Y4K A;  2F56 A;  5CF2 A;  2MF7 A;  4FMD A;  3QRD A;  3RNT A;  3H3H A;  1GOV A;  2FXT A;  5IG0 A;  3DGL A;  3JUP A;  3KZT A;  1GY7 A;  2E2V A;  1BGS A;  5AIF A;  1JBS A;  5IEO A;  7RNT A;  3FGY A;  3OV4 A;  3D4A A;  5AIG A;  1TP6 A;  3Q2P A;  5BXQ A;  2RSX A;  1K28 A;  3HII A;  5KP4 A;  1UI7 A;  3JVC A;  3NM7 A;  2XGN A;  3DGM A;  1UCK A;  4IIA A;  3LML A;  1BNE A;  2UX0 A;  1A2K A;  6RNT A;  2PZV A;  1I0X A;  2W56 A;  1BNS A;  3CCL 3;  1BNF A;  1YJN 3;  3D9R A;  1BRK A;  1OPY A;  4EC6 A;  5JPP A;  1N5H A;  2ZA4 A;  1GOY A;  1Q42 A;  4WP5 A;  1T3B A;  1OGZ A;  3CCM 3;  1Q86 4;  1I2F A;  3F14 A;  1L5G B;  2A15 A;  5FW5 A;  3ZG0 A;  1W6C A;  6GSP A;  2V1L A;  3U1W A;  2CWU A;  2STD A;  1Q40 A;  2D42 A;  1BOX A;  1JB5 A;  1OF5 A;  1TUH A;  4EW5 A;  3EN8 A;  3CD6 3;  1GD4 A;  1N8Q A;  2FGT A;  4X2H A;  3NV0 B;  1X1U A;  1PYL A;  4J5G A;  2I9W A;  3NBJ A;  3SVA A;  1B21 A;  3K7C A;  1QJG A;  2KF3 A;  3WA3 A;  4LGQ A;  4U13 A;  1OHO A;  3SXX A;  1N9E A;  1E3V A;  3S27 A;  3NBR A;  4JRF A;  1AR0 A;  3E99 A;  3IMA B;  1R4Y A;  1T5Y A;  5D82 A;  2KF5 A;  1UW1 A;  1PY3 A;  3KII A;  2YFL B;  4WFO A;  1NNV A;  1LOV A;  1W00 A;  4EV5 A;  1O7N B;  4OK0 A;  4GSP A;  2J8X B;  1G96 A;  3GZX B;  1YJ9 3;  1SAR A;  5G1L A;  2CG0 A;  3MYT A;  2JDI H;  3HK4 A;  1RRH A;  1Q82 4;  3G0K A;  2Z76 A;  1VQ8 3;  3FKA A;  4RNT A;  4BTW A;  4LZI A;  4EV2 A;  3CCV 3;  1UCI A;  1Z1S A;  4XBX A;  1RJO A;  2CK3 H;  1FGT A;  2SBL A;  4K90 B;  1JZO A;  3EBT A;  1JBR A;  3L0R A;  3X40 A;  3NHX A;  1RNB A;  7GSP A;  1BRH A;  2OOV C;  2XEP A;  1KC8 4;  1YGW A;  3K0Z A;  1Q7Y 4;  1Q81 4;  3KE7 A;  1X1Y A;  3KN4 A;  1B2M A;  1IDP A;  1IVU A;  1QVF 2;  1KWI A;  2BMO B;  1HKX A;  2HMJ B;  4HM2 B;  3ECF A;  4J8T A;  3FSD A;  1WMN A;  3V98 A;  1AVL A;  1SII A;  1T2I A;  1YNV X;  4HM0 B;  4NRE A;  4MMX B;  1SPU A;  2QA4 3;  1ZGX A;  1BRG A;  1STF I;  5EQL A;  1UUV B;  2M7O A;  3RDE A;  4MMZ B;  3MG3 A;  2XF3 A;  4BIR A;  3HOH A;  4HM1 B;  3SED A;  1RGK A;  1I3F A;  2IUK A;  2OTL 3;  3RGA A;  3D5I A;  4HM4 B;  3BU4 A;  1OF5 B;  1B2X A;  2CX1 A;  5KP1 A;  4ILF A;  1CH0 A;  2HMK B;  1GD3 A;  5A0O B;  1G0T A;  3NV0 A;  1I2E A;  2KAA A;  2RBI A;  1I8V A;  3B4O A;  2CFL A;  4L8O A;  1MWU A;  3OX9 A;  2FNQ A;  1ZO2 A;  2B1X B;  3EB8 A;  4OUQ A;  3GZY B;  1EA2 A;  5AI1 A;  3NBB A;  1JJ2 2;  4RNY A;  4J9A A;  3LH4 A;  4H3U A;  4I4K A;  1YIJ 3;  2E2T A;  1A2V A;  3MG2 A;  4STD A;  4RNZ A;  4HM7 B;  3N8B A;  2ZDJ A;  2CHC A;  3ER7 A;  3FH1 A;  2W56 B;  4FCJ A;  1O7M B;  5LC7 A;  1K73 4;  2AAE A;  2H0H A;  2IYJ A;  3NQZ A;  2W6J H;  4N6N B;  3ROB A;  3I55 3;  3O8Y A;  4O02 B;  4OVM A;  2RNT A;  1V57 A;  1IQY A;  2O3O A;  2XFS A;  3F40 A;  1M1K 4;  2BU4 A;  2QIY A;  4HZB B;  1BAN A;  1D6U A;  2LYX A;  4JF8 A;  1LNI A;  1BSA A;  1Q40 B;  3Q90 A;  3FG4 A;  1UUW B;  2BNG A;  1A90 A;  4EBG A;  4FMC A;  3CNX A;  2PNC A;  1CQS A;  1NU3 A;  5CLK A;  1FUT A;  4R9L A;  1SJW A;  1CEW I;  1UCL A;  1UGI A;  2H0I A;  1WMO A;  3N9H A;  4GL6 A;  4N6T A;  5AII A;  2OQE A;  3VF1 A;  1EQK A;  5RNT A;  1SIH A;  3LT8 A;  4MJD A;  4O8S A;  1LOW A;  1BRS A;  2KF6 A;  4BU4 A;  3CCS 3;  2XRX B;  1NDO B;  2Z6B A;  1DET A;  2BMQ B;  4HOH A;  4H61 A;  1D6Z A;  2C4B A;  3RGR A;  3H51 A;  2W03 A;  3PXM A;  1OHP A;  2BT3 A;  1V58 A;  3EF8 A;  4WHA A;  1RCK A;  3BLZ A;  4IPB A;  5G2G A;  1FGM A;  1JN5 A;  4XDW A;  3HI7 A;  3F9S A;  5IG5 A;  1R4C A;  1DYU A;  1QAK A;  1YGE A;  1FUS A;  2E2U A;  1PFP A;  2JQ5 A;  2WGO A;  3HX8 A;  1JV2 B;  5GSP A;  3FF0 A;  1GOU A;  1ROA A;  1UI8 A;  2F4Y A;  3EX9 A;  3KFQ C;  1TFK A;  5CXO A;  2YFI B;  3MPH A;  3OWS A;  5AEW B;  2CIU A;  4HM6 B;  1BRI A;  2XR8 B;  5JPU A;  1LVN A;  2GBW B;  1VQ7 3;  2L1S A;  4AKY A;  1M9G A;  1HU9 A;  3CXC 2;  2BMR B;  1ULI B;  1T2H A;  3JUN A;  3M8C A;  3F8X A;  1JN5 B;  2F5M A;  5AYS C;  3LOY A;  3BIR A;  2UGI A;  5D81 A;  1UUG B;  3PYJ A;  3S29 A;  2RCD A;  1VQP 3;  3FG3 A;  1LOX A;  2CW9 A;  1BNJ A;  2UUG C;  1VQN 3;  1ROV A;  1RN7 A;  1GMR A;  1YVB I;  1OAC A;  1FW7 A;  1IVX A;  2XH9 A;  2WOH A;  1O7P B;  2YFJ B; 
#chains in the Genus database with same CATH homology
 1OGX A;  1US1 A;  1FA3 A;  5ELJ A;  5EEO A;  4HM8 B;  2HML B;  3X3Z A;  1RKY A;  1EG9 B;  4FMA A;  4WWU C;  1VQL 3;  3MHE A;  1OHS A;  1O7W B;  2BO9 B;  4KFF A;  2YX9 A;  1AVK A;  5FGO A;  3CC4 3;  3G6E 3;  3FF2 A;  3S28 A;  2OOV A;  3CCJ 3;  1IT8 A;  3MSO A;  3UNL A;  4HVN A;  3V99 A;  4FCZ A;  2W9P A;  1W4N A;  1WQL B;  3CU3 A;  1C7H A;  3UL6 A;  1WNH A;  2GU1 A;  3Q1C A;  3MG1 A;  3BB9 A;  3F8H A;  2F99 A;  2ML5 A;  1BUQ A;  3LTC A;  3CC7 3;  3J7Y d;  3NM2 A;  4R1K A;  1A67 A;  3WOE B;  3BND A;  1IQ8 A;  3EBY A;  4WYK B;  1VQ5 3;  2W0Q A;  3LTB A;  3I0Y A;  1S72 3;  2GXF A;  2Q07 A;  1FGO A;  2CFK A;  2ZL8 A;  2P0X A;  3NXJ A;  5TGN A;  5DRV A;  3CCU 3;  2CWT A;  2QGU A;  1PU4 A;  3S67 A;  4N6M A;  1JRQ A;  1W01 A;  3K63 A;  4NHF A;  4TX4 A;  2CFG A;  1IV9 A;  4XB5 A;  3DY5 A;  4K1U A;  3HZP A;  3KSE D;  2P0M A;  3CPW 2;  4WYK A;  3PCR A;  1DMN A;  3X42 A;  1J2B A;  4LMI A;  1IVW A;  4XM4 A;  2Y73 A;  3X3Y A;  2RGQ A;  2XGL A;  4N6V 0;  5KP3 A;  3X41 A;  1E3R A;  3S5C A;  3EN1 B;  3G4S 3;  3G8Z A;  5ELU A;  1VQ9 3;  4BTX A;  3T8N A;  1OCV A;  3DMC A;  3A76 A;  1DMM A;  2OWP A;  3VSY A;  3IPT A;  3GZB A;  1U8C B;  2HMM B;  2B24 B;  3T8U A;  2F98 A;  1K41 A;  3WOD G;  4KVH A;  5JBS A;  3GWR A;  2CG1 A;  4LEH A;  3FCS B;  1N8R 4;  4N6O B;  2IMJ A;  3CCE 3;  3WMD A;  2CC3 A;  3DGN A;  3GRD A;  3GAX A;  4HM3 B;  3LTD A;  1F8N A;  5DRE A;  4GB5 A;  2W2C A;  2W9Q A;  4L8P A;  5CF1 A;  1IK3 A;  4FCM A;  3VGN A;  1N5P A;  3WOF B;  1WMP A;  2F86 B;  5IEP A;  3SLU A;  2XSH B;  1W2B 2;  1W02 A;  4HJL B;  4MEI A;  1YIT 3;  3FG1 A;  4HKV B;  5IG3 A;  1O7G B;  4G1M B;  1TIJ A;  1WTH A;  3G71 3;  2P09 A;  1QAL A;  1TU5 A;  1CYV A;  3WA2 X;  3G16 A;  3B7C A;  1S5A A;  2INX A;  4R80 A;  2L4V A;  3SX1 A;  1W6Y A;  1AV4 A;  2K54 A;  1OH0 A;  1JB2 A;  1W6G A;  3MWZ A;  4Q53 A;  3CCR 3;  5IEN A;  2P38 A;  3JUM A;  1GYB A;  4XBY A;  5IG4 A;  3B4P A;  1GS3 A;  1VQM 3;  3KKG A;  8CHO A;  3PCS A;  1IQX A;  4L7K A;  1ISK A;  3PGB A;  2D1W A;  3AMO B;  1OUN A;  4KFD A;  3N54 B;  1QMA A;  4R4K A;  5EVH A;  3NQY A;  1K8A 4;  3U97 A;  2WGQ A;  1FGR A;  1RRL A;  2Z77 A;  3KSP A;  2CFW A;  3LZA A;  3DGO A;  1N9J A;  3CMA 3;  4K1V A;  3EJV A;  4EXR A;  3LT9 A;  4HZ9 B;  5IER A;  4N3V A;  3K9M C;  1IT7 A;  2CWV A;  3NX0 A;  1ZX2 A;  2GBX B;  1JNQ A;  5AEU B;  1O7H B;  2GU3 A;  4O3V A;  3FZW A;  2BHM A;  3CC2 3;  2IA7 A;  2Y74 A;  1ASK A;  5CK6 A;  2GEY A;  3LYG A;  1KQS 2;  3JUO A;  3WDG B;  5LC6 A;  1E97 A;  2O9U X;  2WO0 A;  3GZR A;  1LXE A;  2XFT A;  5AIH A;  1ULJ B;  1SQW A;  4HYZ A;  2HMN B;  1NB5 I;  1W2Z A;  1YJW 3;  4RZM A;  1MNL A;  2OTJ 3;  4ZM8 A;  1V74 A;  4HM5 B;  2OQE C;  3K5T A;  1LNH A;  3JUQ A;  2WOF A;  3HIG A;  1NO3 A;  1VQK 3;  1M90 4;  3F7S A;  3AMO A;  4CDL A;  2C10 A;  1KSI A;  2C11 A;  3OWU A;  2RFR A;  4N6L A;  2P05 A;  3D3L A;  3QK9 A;  4ORL A;  3LXU X;  5D83 A;  3UL5 A;  1JB4 A;  1IV7 A;  3EQQ B;  3UB1 A;  4CCV A;  1FUW A;  1NB3 I;  5HGR A;  2QEX 3;  3CME 3;  1W5Z A;  1IU7 A;  2K0M A;  3NUV A;  3TDG A;  2Z7A A;  4O2H A;  4XDV A;  1VQ4 3;  3OXA A;  3B8L A;  2XSO B;  1VZZ A;  4PEJ A;  2CKF B;  5BVB A;  3CPO A;  3PS8 A;  4K61 A;  1NJI 4;  3F7X A;  4R9K A;  6STD A;  3UJM A;  4RBN A;  1DVC A;  1YHQ 3;  2HMO B;  3FLJ A;  4LSO A;  1KD1 4;  1TFO A;  2MC8 A;  4KZ1 A;  1VQ6 3;  4X2O A;  3DM8 A;  1K9M 4;  4XBT A;  2LQV A;  4AKZ A;  4KFE A;  3IJE B;  3BNB A;  3I56 3;  5I97 A;  1CYU A;  2KRT A;  3SOA A;  4EYC A;  1QAF A;  1FGQ A;  5AYR B;  4QWT A;  7STD A;  3LTA A;  1VQO 3;  1YI2 3;  4BTY A;  1JKG B;  4N6U A;  1GY5 A;  2GEX A;  1D6Y A;  4MMY B;  1DVD A;  3OWY A;  2KCD A;  1EKM A;  4FMB A;  1NWW A;  3SXX A;  4HBR A;  2ML6 A;  1JKG A;  3MKI A;  2R4I A;  4IT7 A;  3X3X A;  2W04 A;  4AEQ A;  1QVG 2;  3DXO A;  1STD A;  2OCT A;  1IVV A;  3SOY A;  1U5O A;  3CCQ 3;  3PZW A;  3BNC A;  3EE1 A;  1MOL A;  5IF6 A;  1W7C A;  1DMQ A;  3EHC A;  3T0U A;  4FR9 A;  3OW2 2;  3DUK A;  2CH9 A;  2IUJ A;  2CFD A;  1GY6 A;  2KXG A;  3BNE A;  3EC9 A;  1M1X B;  3ALA A;  3CNM A;  3STD A;  5IW9 A;  1EQK A;  3DZL A;  1Y4K A;  5CF2 A;  2MF7 A;  4FMD A;  3QRD A;  3H3H A;  2FXT A;  5IG0 A;  3DGL A;  3JUP A;  3KZT A;  1GY7 A;  2E2V A;  5AIF A;  5IEO A;  3FGY A;  3OV4 A;  5BXQ A;  5AIG A;  1TP6 A;  3Q2P A;  2RSX A;  1K28 A;  3HII A;  5KP4 A;  1UI7 A;  3JVC A;  3NM7 A;  2XGN A;  3DGM A;  4IIA A;  3LML A;  2UX0 A;  1A2K A;  2PZV A;  2W56 A;  3CCL 3;  1YJN 3;  3D9R A;  1OPY A;  4EC6 A;  5JPP A;  1N5H A;  1Q42 A;  1Q86 4;  4WP5 A;  3CCM 3;  1OGZ A;  3F14 A;  1L5G B;  2A15 A;  5FW5 A;  1W6C A;  2V1L A;  3U1W A;  2CWU A;  2STD A;  1Q40 A;  2D42 A;  1TUH A;  1JB5 A;  1OF5 A;  3EN8 A;  3CD6 3;  1GD4 A;  1N8Q A;  2FGT A;  4X2H A;  3NV0 B;  3SVA A;  2I9W A;  3NBJ A;  3K7C A;  1QJG A;  3WA3 A;  4LGQ A;  4U13 A;  1OHO A;  1N9E A;  1E3V A;  3S27 A;  3NBR A;  4JRF A;  1AR0 A;  3E99 A;  3IMA B;  1T5Y A;  5D82 A;  1UW1 A;  3KII A;  2YFL B;  4WFO A;  1W00 A;  4EV5 A;  1O7N B;  4OK0 A;  1G96 A;  3GZX B;  1YJ9 3;  2CG0 A;  3MYT A;  2JDI H;  3HK4 A;  1RRH A;  1Q82 4;  3G0K A;  2Z76 A;  1VQ8 3;  3FKA A;  4BTW A;  4LZI A;  4EV2 A;  3CCV 3;  1Z1S A;  4XBX A;  1RJO A;  2CK3 H;  1FGT A;  2SBL A;  4K90 B;  3EBT A;  3L0R A;  3X40 A;  3NHX A;  2OOV C;  2XEP A;  1KC8 4;  3K0Z A;  1Q7Y 4;  1Q81 4;  3KE7 A;  3KN4 A;  1IDP A;  1IVU A;  1QVF 2;  1KWI A;  2BMO B;  1HKX A;  2HMJ B;  4HM2 B;  3ECF A;  4J8T A;  3FSD A;  1WMN A;  3V98 A;  1AVL A;  1SII A;  4HM0 B;  4NRE A;  4MMX B;  1SPU A;  2QA4 3;  1STF I;  5EQL A;  1UUV B;  2M7O A;  3RDE A;  4MMZ B;  3MG3 A;  2XF3 A;  4HM1 B;  3SED A;  2IUK A;  2OTL 3;  3RGA A;  4HM4 B;  1OF5 B;  5KP1 A;  2HMK B;  1GD3 A;  5A0O B;  3NV0 A;  3B4O A;  2CFL A;  4L8O A;  3OX9 A;  2FNQ A;  1ZO2 A;  2B1X B;  3EB8 A;  4OUQ A;  3GZY B;  1EA2 A;  5AI1 A;  3NBB A;  1JJ2 2;  4RNY A;  4J9A A;  3LH4 A;  4H3U A;  4I4K A;  1YIJ 3;  2E2T A;  1A2V A;  3MG2 A;  4STD A;  4RNZ A;  4HM7 B;  3N8B A;  2ZDJ A;  2CHC A;  3ER7 A;  3FH1 A;  2W56 B;  4FCJ A;  1O7M B;  5LC7 A;  1K73 4;  4N6N B;  3ROB A;  3NQZ A;  2W6J H;  3I55 3;  3O8Y A;  4O02 B;  4OVM A;  2O3O A;  1IQY A;  2XFS A;  3F40 A;  1M1K 4;  2QIY A;  4HZB B;  1D6U A;  2LYX A;  4JF8 A;  1Q40 B;  3Q90 A;  3FG4 A;  1UUW B;  2BNG A;  1A90 A;  4EBG A;  4FMC A;  3CNX A;  2PNC A;  1CQS A;  1NU3 A;  5CLK A;  4R9L A;  1SJW A;  1CEW I;  3N9H A;  4GL6 A;  4N6T A;  1WMO A;  5AII A;  2OQE A;  3V92 A;  3VF1 A;  1SIH A;  3LT8 A;  4MJD A;  4O8S A;  3CCS 3;  2XRX B;  1NDO B;  2Z6B A;  2BMQ B;  4H61 A;  1D6Z A;  3RGR A;  3H51 A;  2W03 A;  3PXM A;  1OHP A;  2BT3 A;  3EF8 A;  4WHA A;  3BLZ A;  4IPB A;  5G2G A;  1FGM A;  1JN5 A;  4XDW A;  3HI7 A;  3F9S A;  5IG5 A;  1R4C A;  1DYU A;  1QAK A;  1YGE A;  2E2U A;  2WGO A;  1PFP A;  2JQ5 A;  3HX8 A;  5STD A;  1JV2 B;  3FF0 A;  1ROA A;  1UI8 A;  3KFQ C;  3EX9 A;  5CXO A;  1TFK A;  2YFI B;  3MPH A;  3OWS A;  5AEW B;  2CIU A;  4HM6 B;  2XR8 B;  5JPU A;  1LVN A;  2GBW B;  1VQ7 3;  4AKY A;  1M9G A;  1HU9 A;  3CXC 2;  2BMR B;  1ULI B;  3JUN A;  3M8C A;  3F8X A;  1JN5 B;  5AYS C;  3LOY A;  5D81 A;  3PYJ A;  3S29 A;  2RCD A;  1VQP 3;  3FG3 A;  1LOX A;  2CW9 A;  1VQN 3;  1ROV A;  1RN7 A;  1YVB I;  1OAC A;  1IVX A;  2XH9 A;  2WOH A;  1O7P B;  2YFJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...