4U13A

Crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
FQSMDLPDIVNMYFDADSCNDTDALSETFAPDAVVEDEGARHQGVVAILRWWVAAKKAASYVAEPLESTVDGDKALVRAKVSGRFPGSPVTLTYSFTIKDGRIARLEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative polyketide cyclase SMa1630
publication title Crystal structure of a putative polyketide cyclase (protein SMa1630) from Sinorhizobium meliloti at 2.3 A resolution
rcsb
source organism Sinorhizobium meliloti 1021
total genus 27
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4u13A00
4MJDA 2W2CA 3NUVA 2Z76A 4PEJA 2GEYA 2PZVA 3SEDA 5D83A 3B4PA 4HZBB 4N3VA 2BMQB 3F9SA 3OX9A 2GBWB 4U13A 1GY6A 3DXOA 6STDA 1ULIB 3OXAA 4XDWA 5AIHA 1UUVB 3F40A 3KZTA 3STDA 4GB5A 2QIYA 1OF5A 3GWRA 3NV0B 3G16A 1TUHA 4KVHA 1E3RA 4HM7B 3FKAA 3B8LA 1GY7A 4XM4A 3FSDA 3GZXB 1EA2A 2HMKB 5DRVA 5AEUB 1OUNA 3MG2A 3KE7A 4HM6B 3JUOA 2YFLB 3MYTA 3OWSA 1ASKA 3GRDA 1STDA 5KP1A 1JN5B 1OHOA 3NM2A 4HVNA 1ULJB 1DMQA 3A76A 3EJVA 5IEPA 8CHOA 5BXQA 5IENA 2BNGA 3EN8A 2INXA 5IF6A 5KP4A 2B1XB 3VGNA 3NBRA 1HKXA 4OUQA 2K54A 3BB9A 1Q40B 1EG9B 1C7HA 1O7WB 1O7PB 2B24B 2GXFA 3F7SA 3LZAA 1JKGA 3EF8A 5JPPA 1SJWA 1WQLB 3MG3A 2BMOB 3SOYA 3JUMA 1JB2A 3NXJA 3FF0A 4IIAA 3GZBA 5D81A 1O7HB 3B4OA 1W01A 5TGNA 5STDA 3HZPA 3KKGA 4LEHA 1Q42A 3ROBA 1GYBA 2HMJB 1ZO2A 1E97A 4X2HA 3EBYA 1IDPA 1W6YA 1TP6A 5CLKA 4HM1B 5FW5A 3DUKA 1W00A 3EN1B 5CF2A 4HM4B 3GZYB 3OWUA 5KP3A 1A2KA 4I4KA 5CK6A 2CKFB 4L8PA 2JQ5A 4WYKB 3JUPA 4LGQA 3Q90A 4FCJA 1QJGA 4Q53A 4R9LA 4HZ9B 1E3VA 1NU3A 3IPTA 1DMNA 3D9RA 1OHPA 4HM2B 3NHXA 1ISKA 4HM8B 3FZWA 4OVMA 5IEOA 3HX8A 4R1KA 1CQSA 2IMJA 1ZX2A 5IG5A 1GS3A 1S5AA 2OWPA 2BMRB 1JB4A 3FLJA 4R9KA 4L7KA 1GY5A 2F86B 1JKGB 3UNLA 3T8NA 5IERA 3G0KA 3G8ZA 3HK4A 3LYGA 3F8HA 3EBTA 3CU3A 3I0YA 2XR8B 3F7XA 2F98A 1OPYA 2QGUA 1OHSA 4HM0B 1OGXA 3SOAA 3DMCA 1U5OA 3EX9A 2STDA 7STDA 2RCDA 2RFRA 5JPUA 2CHCA 5IG3A 3BLZA 2GBXB 1AR0A 5AIIA 2HMMB 1OCVA 3F8XA 3OWYA 3H51A 2Z77A 2A15A 4WP5A 3MG1A 3RGRA 3K0ZA 4H3UA 4HM5B 3EHCA 2R4IA 3K7CA 4RZMA 3GZRA 5AEWB 4HM3B 1OF5B 5AIFA 2HMLB 2XSOB 4HJLB 3DZLA 3UJMA 5CXOA 3EQQB 5IG0A 4XDVA 4STDA 2I9WA 2XRXB 2HMOB 4J9AA 3S5CA 5AIGA 2HMNB 3OV4A 3JUNA 1JB5A 4ORLA 4XB5A 4WWUC 3KSPA 3MSOA 2Z7AA 3FH1A 3FGYA 1NDOB 3EC9A 3E99A 5D82A 4XBYA 3JUQA 4HKVB 3FF2A 3H3HA 5HGRA 3RGAA 4WYKA 4X2OA 5BVBA 3NV0A 3ECFA 3MHEA 1BUQA 3WMDA 3T8UA 1O7MB 1W02A 2GEXA 5EVHA 2XSHB 4LMIA 1O7NB 2RGQA 3F14A 3VSYA 4FCMA 4K1VA 4XBXA 2YFJB 3DM8A 1JN5A 4L8OA 3CPOA 3ER7A 1OH0A 2F99A 2UX0A 5G2GA 1K41A 1NWWA 1VZZA 3CNMA 4CDLA 4XBTA 3M8CA 1QMAA 5DREA 5AI1A 5IG4A 3B7CA 1O7GB 1Q40A 3MKIA 1OGZA 5CF1A 3CNXA 1Z1SA 1DMMA 4J8TA 1UUWB 4K1UA 2YFIB
chains in the Genus database with same CATH superfamily
4MJDA 1CH0A 1FW7A 2W2CA 3PCSA 3NUVA 1CYUA 1FYSA 2Z76A 3LT8A 4FMBA 1A90A 4O2HA 3V92A 1PFPA 4PEJA 1A2VA 1ZGXA 3X3ZA 1YNVX 2GEYA 1FGRA 3PYJA 2XF3A 4NPBA 1KWIA 3V98A 2UGIA 1BNRA 1BNGA 3NBBA 1VQ93 2PZVA 3UL6A 2CFLA 2LQVA 3X3YA 1RRLA 5EQLA 3BNEA 3G713 2C11A 2C4BA 2CWTA 1LQGC 3DY5A 3HIIA 3LT9A 3SEDA 5D83A 2QA43 3B4PA 4HZBB 4N3VA 1S723 1IV7A 2BMQB 3F9SA 3OX9A 2UUGC 2GBWB 1BRIA 3D79A 4N6LA 4U13A 5GSPA 4EV2A 1GY6A 1JZOA 3BIRA 3DXOA 6STDA 3Q2PA 3X40A 1ULIB 3OXAA 1EEJA 1VQ53 1R4YA 1BANA 4XDWA 1B2UA 1UUVB 1BRHA 3F40A 3NM7A 5AIHA 3S28A 1YJ93 3KZTA 2K3DA 5ELJA 1LVNA 3UL5A 3STDA 2RNTA 2LYXA 3O8YA 4GB5A 4O02B 3CPW2 2P05A 1JJ22 2QIYA 1RN1A 1NB3I 2WGOA 1AVLA 1OF5A 1X1XA 3GWRA 2CFKA 3NV0B 3G16A 1TUHA 4KVHA 1J2BA 2OOVA 1E3RA 1NB5I 4IPBA 4FMDA 3CC73 4HM7B 3J7Yd 3FKAA 4K61A 3B8LA 1BNJA 2O9UX 1GY7A 2D1WA 4XM4A 2CWVA 1YVBI 4QWTA 2ZL8A 3FSDA 2M7OA 1N9JA 1YJN3 3GZXB 4ZM8A 3DGYA 2BHMA 3UB1A 4LYLB 1WNHA 3PCRA 4J5KA 1VQK3 1EA2A 2HMKB 5DRVA 5G1KA 1L5GB 1IT8A 1M9GA 2E2VA 4RNZA 5AEUB 2GU3A 2AAEA 4HYZA 1OUNA 1TTOA 3MG2A 4BIRA 3I563 3KE7A 3NQZA 3ZG0A 2KF5A 3AHWA 3JUOA 4HM6B 1IVUA 3DGLA 1LOXA 2YFLB 2W6JH 3MYTA 3OWSA 4CPKA 1A67A 3LOYA 3IJEB 1ASKA 1IU7A 2Q07A 3GRDA 1STDA 5KP1A 1JN5B 1OHOA 1V74A 3NM2A 4HVNA 1ULJB 1BRJA 1LNIA 2KXGA 1DMQA 3A76A 2XEPA 3EJVA 5IEPA 5LC7A 1CEWI 1D6YA 2XGNA 3HI7A 8CHOA 5BXQA 5IENA 1W2ZA 2BNGA 2OQEA 3EN8A 5FGOA 3CCL3 3OW22 1W2B2 1BRKA 3X3XA 2INXA 3BNDA 4EBGA 5IF6A 1FGMA 3WR2A 2BIRA 2ML5A 3CCJ3 2Z6BA 2B1XB 4IT7A 3VGNA 5KP4A 3VF1A 1JBSA 1BNIA 5RNTA 4N6MA 3CD63 5IW9A 3NBRA 1SPUA 1MWTA 1HKXA 4OUQA 2K54A 1IVWA 3BB9A 1Q40B 2FXTA 2W03A 1WMPA 1EG9B 1YJW3 1O7WB 1O7PB 1C7HA 2B24B 1RTUA 3IMAB 3BNBA 2GXFA 3F7SA 3LZAA 4DKIA 1JKGA 1R4CA 1A2PA 3EF8A 5JPPA 2OTJ3 1VQ83 1SJWA 1WQLB 4MEIA 3CC23 3MG3A 3WA3A 1BUJA 1IQXA 1RJOA 2FGTA 3FG4A 1W7CA 1QAFA 2BMOB 2XFTA 3AMOA 3JUMA 3SOYA 1YHQ3 1FGOA 1JB2A 1B2MA 2J8XB 3NXJA 3FF0A 4IIAA 3GZBA 5D81A 4BTYA 4N6NB 1O7HB 3B4OA 3NBJA 1B3SA 1W01A 4GL6A 1FUWA 5TGNA 5STDA 1N8R4 1Q9EA 2L1SA 4JRFA 2YX9A 3CMA3 3HZPA 3KKGA 1I2EA 4MMXB 1BRSA 4LEHA 2BU4A 2W9PA 2ZHXB 3ZFZA 1GD3A 1T2IA 1JV2B 1Q42A 3ROBA 1I3IA 3LTBA 1GOVA 1GYBA 3WDGB 1VQM3 1Q814 1X1YA 2WOHA 1SIHA 2HMJB 2KF6A 1TIJA 1ZO2A 1E97A 1YGEA 1RHLA 5BU4A 3MWZA 3CCM3 2R41A 3LH4A 1N8QA 4I5QA 2L4VA 4X2HA 1LOVA 1FUTA 1DVDA 1I2GA 4N6OB 1VQ73 1X1UA 5M18A 1MOLA 4FCZA 3EBYA 1IDPA 2IY2A 1LOWA 1T2HA 3LTAA 2OCTA 1W6YA 2F4YA 5HOHA 2ZDJA 1TP6A 4RNYA 5CLKA 4HM1B 5FW5A 1QVF2 2H0GA 1BOXA 1JZDA 3DUKA 1W00A 3EN1B 3PXMA 1VQP3 1B2ZA 1BSDA 1RDSA 3HIGA 3U1WA 4BU4A 2AADA 4BTWA 1Y4KA 5CF2A 4HM4B 1RGHA 3GZYB 4RNTA 1I2FA 3OWUA 3BNCA 5KP3A 3WHOA 1WMOA 1N5PA 1A2KA 2PNCA 4HAAA 4I4KA 5CK6A 4EW5A 6GSPA 1BRGA 4ILFA 2CKFB 4L8PA 1AVKA 1RGLA 2OOVC 2JQ5A 1F8NA 1AY7A 4NREA 1VQ43 1YIT3 1K734 5LC6A 4WYKB 1EUIC 3JUPA 3Q90A 4LGQA 4FCJA 1QJGA 4Q53A 3KN4A 4R9LA 1VQ63 4KT3B 4HZ9B 1E3VA 1NU3A 1ROAA 4K90B 3IPTA 3PGBA 1DMNA 2XGLA 4GHOA 3CCV3 3D9RA 2CFWA 3CCU3 1JBRA 1N9EA 4WFOA 1QALA 1OHPA 1PYLA 4OK0A 3NQYA 1QVG2 1UCJA 1B2SA 4HM2B 3NHXA 1ROVA 1N5HA 3SVAA 4AKZA 1ISKA 3CC43 4MMZB 1TU5A 1US1A 1M904 3KFQC 4HM8B 3FZWA 4N6TA 1GMRA 3FG3A 1UDII 4OVMA 3CCR3 5IEOA 3HX8A 2P0XA 4R1KA 1I0XA 1CQSA 1STFI 2KCDA 3DGNA 2IMJA 1EQKA 1ZX2A 3LTCA 5IG5A 1LRAA 2OQEC 1GS3A 1S5AA 1IT7A 2OWPA 3X42A 3ZG5A 1BVIA 1YGWA 2BMRB 1JB4A 2SARA 9RNTA 1GOYA 3FLJA 3S29A 2CWUA 3MPHA 1TRQA 4R9KA 1BAOA 4JF8A 1GY5A 2BT3A 2F86B 4L7KA 1BNSA 1I70A 1KQS2 1JKGB 1GMPA 3UNLA 3T8NA 1NNVA 1RGKA 1U8CB 1YVSA 3G0KA 5IERA 1NJI4 4BTXA 3WODG 4TX4A 3Q1CA 1SIIA 3AMOB 3G8ZA 3HK4A 3LYGA 3F8HA 3EBTA 1RCLA 3X41A 3CU3A 1IK3A 1DYUA 1ZS7A 1I8VA 3I0YA 2XR8B 3F7XA 1IQ8A 2F98A 2H0IA 5I97A 1OPYA 4EV5A 2GU1A 1YI23 2KRTA 4KFDA 5AYSC 5A0OB 2QGUA 3V99A 1IVVA 1DE3A 3G4S3 2XFSA 1OHSA 4HM0B 1OGXA 3SOAA 1OACA 3DMCA 3L0RA 1MNLA 2SBLA 1GSPA 1U5OA 3EX9A 2F56A 3SXXA 1FGTA 2WO0A 2W0QA 2STDA 3JVCA 7STDA 1RN7A 2RCDA 4H61A 1MGWA 1W5ZA 1RGEA 1TRPA 1D6ZA 4MMYB 3WOFB 4EYCA 3CCQ3 2RFRA 5JPUA 1BNEA 1Q7Y4 2CHCA 5IG3A 3BLZA 4AKYA 2GBXB 3DGOA 1AR0A 1RNTA 5AIIA 3CXC2 1TFKA 1WTHA 2HMMB 1OCVA 1UUGB 3F8XA 1KC84 1AQZA 3OWYA 1M1K4 3KCHA 3H51A 2Z77A 2A15A 2GSPA 4R4KA 5BIRA 1BGSA 4WP5A 1FUSA 1BU4A 1I0VA 3PS8A 2CG0A 5EEOA 3MG1A 3QRDA 3RGRA 3KSED 1B21A 3K0ZA 2E2UA 4H3UA 2W04A 3DGMA 1RMSA 4HM5B 3EHCA 1RLSA 5G1LA 1W6CA 3S67A 3S27A 1MWUA 1TJDA 4FMCA 2R4IA 3K7CA 3GSPA 4RZMA 3QK9A 4EC6A 3GZRA 3CME3 3PZWA 1BSCA 5AEWB 2CX1A 2P09A 4HM3B 2HOHA 3BU4A 1HU9A 3LXUX 3SX1A 3A5EA 2CH9A 1GD4A 1OF5B 2Y73A 3N9HA 2W56A 1PU4A 5AIFA 2YFIB 3WOEB 5AYRB 2QEX3 2HMLB 2D42A 3D5GA 2XSOB 2ML6A 1VQO3 4HJLB 1B27A 1VQN3 3DZLA 1JBTA 1HYFA 3FCSB 3AGNA 3UJMA 5CXOA 5ELUA 2P0MA 3T0UA 1G02A 2CX0A 3K9MC 4R80A 3K5TA 1BRNL 3CCS3 3EQQB 1SARA 2CIUA 1RGGA 2JDIH 1B2XA 2CFGA 4NHFA 4STDA 4XDVA 5IG0A 1LOYA 1IQYA 1M1XB 4FMAA 4RBNA 1B20A 1UI8A 2MF7A 2V1LA 1HZ1A 1GMQA 1UGIA 1LQMB 2I9WA 1FZUA 2XRXB 4LSOA 2HMOB 1UCKA 4J9AA 1PY3A 3S5CA 1RSNA 3N54B 1JRQA 2BO9B 4O8SA 5AIGA 1BNFA 2HMNB 3JUNA 3OV4A 1JB5A 4ORLA 4XB5A 2K0MA 3LMLA 4WWUC 3KSPA 2RSXA 3MSOA 1UGHI 3KIIA 5M19A 2Z7AA 1KD14 3FH1A 1CYVA 1C54A 4O3VA 1QAKA 1Q7HA 3FGYA 1V58A 3AGOA 1NDOB 1D6UA 2CC3A 2F5WA 3EC9A 2IYJA 3E99A 4KFEA 3Q3FA 1K28A 4HBRA 1V57A 1FA3A 5D82A 2Y74A 2FNQA 1WMNA 2C10A 1X1WA 4XBYA 3JUQA 4HKVB 3I553 3FF2A 3H3HA 1BIRA 4WHAA 5HGRA 3RGAA 1RNBA 1KSIA 4HOHA 1AV4A 1GOUA 2W9QA 3K63A 3AHSA 3NX0A 2CFDA 1MGRA 1MWSA 2O3OA 4WYKA 4X2OA 1UCLA 4BL2A 3NV0A 5BVBA 3ECFA 3MHEA 1BUQA 3SYUA 3WMDA 3T8UA 1O7MB 4CCVA 4AEQA 7GSPA 1BSEA 2ZA4A 1DETA 1W02A 2GEXA 3LTDA 2XH9A 4N6V0 5EVHA 2XSHB 2MC8A 4LMIA 1UI7A 5JBSA 1W6GA 1I3FA 1YIJ3 4KZ1A 1G96A 1O7NB 1RGCA 2RGQA 1T3BA 2WOFA 3D3LA 1RRHA 3F14A 1Q864 2F5MA 1K8A4 4N6UA 1G0TA 3DH2A 3VSYA 4FCMA 4K1VA 2E2TA 3D5IA 3D4AA 8RNTA 1IYYA 4XBXA 4EXRA 2YFJB 4BL3A 3U97A 3DM8A 1JN5A 4L8OA 1IVXA 2KAAA 1VQQA 1UW1A 3CPOA 3ER7A 1DVCA 1OH0A 2F99A 3RDEA 1BSBA 2IA7A 2UX0A 3TDGA 5G2GA 7RNTA 1K41A 1NWWA 2IUKA 4G1MB 1VQL3 1RCKA 1VZZA 1RGFA 1Q824 5M1AA 3SLUA 1TFOA 3EB8A 4CJNA 2H0HA 2CG1A 2CW9A 1FGQA 3CCE3 3CNMA 4CDLA 4XBTA 1K9M4 2WGQA 3RNTA 2RBIA 1QMAA 3M8CA 2IUJA 5DREA 1JNQA 1NO3A 5AI1A 5IG4A 3G6E3 3WA2X 3URPA 1LXEA 2CK3H 3B7CA 1RN4A 3GAXA 3HOHA 3N8BA 1SQWA 2KF3A 3EE1A 1O7GB 1Q40A 3MKIA 4GSPA 4KFFA 2OTL3 1T5YA 1OGZA 1UCIA 3CNXA 5CF1A 6RNTA 4J5GA 2P38A 3ALAA 1Z1SA 2W56B 1BSAA 1DMMA 2KF4A 4FR9A 4J8TA 1W4NA 4LZIA 1RKYA 1IV9A 1UUWB 4K1UA 1MWRA 1EKMA 1LNHA 1RGAA 3FG1A
chains in the Genus database with same CATH topology
4MJDA 2W2CA 3PCSA 3NUVA 1CYUA 2Z76A 3LT8A 4FMBA 1A90A 4O2HA 3V92A 1PFPA 4PEJA 1A2VA 3X3ZA 2GEYA 1FGRA 3PYJA 2XF3A 1KWIA 3V98A 3NBBA 1VQ93 2PZVA 3UL6A 2CFLA 2LQVA 3X3YA 1RRLA 5EQLA 3BNEA 3G713 2C11A 2CWTA 3LT9A 3DY5A 3HIIA 3SEDA 5D83A 2QA43 3B4PA 4HZBB 4N3VA 1S723 1IV7A 2BMQB 3F9SA 3OX9A 2GBWB 4U13A 4N6LA 4EV2A 1GY6A 3DXOA 6STDA 3Q2PA 3X40A 1ULIB 3OXAA 1VQ53 4XDWA 5AIHA 1UUVB 3F40A 3NM7A 3S28A 1YJ93 3KZTA 5ELJA 1LVNA 3UL5A 3STDA 2LYXA 3O8YA 4GB5A 4O02B 3CPW2 2P05A 1JJ22 2QIYA 2WGOA 1NB3I 1AVLA 1OF5A 3GWRA 2CFKA 3NV0B 3G16A 1TUHA 4KVHA 1J2BA 2OOVA 1E3RA 1NB5I 4IPBA 4FMDA 3CC73 4HM7B 3J7Yd 3FKAA 4K61A 3B8LA 2O9UX 1GY7A 2D1WA 4XM4A 2CWVA 1YVBI 4QWTA 2ZL8A 3FSDA 2M7OA 1N9JA 1YJN3 3GZXB 4ZM8A 2BHMA 3UB1A 1WNHA 3PCRA 1VQK3 1EA2A 2HMKB 5DRVA 1L5GB 1IT8A 1M9GA 2E2VA 4RNZA 5AEUB 2GU3A 4HYZA 1OUNA 3MG2A 3I563 3KE7A 3NQZA 4HM6B 3JUOA 1IVUA 3DGLA 1LOXA 2YFLB 2W6JH 3MYTA 3OWSA 1A67A 3LOYA 3IJEB 1ASKA 1IU7A 2Q07A 3GRDA 1STDA 5KP1A 1JN5B 1OHOA 1V74A 3NM2A 4HVNA 1ULJB 2KXGA 1DMQA 3A76A 2XEPA 3EJVA 5IEPA 5LC7A 1CEWI 1D6YA 2XGNA 3HI7A 8CHOA 5BXQA 5IENA 1W2ZA 2BNGA 2OQEA 3EN8A 5FGOA 3CCL3 3OW22 1W2B2 3X3XA 2INXA 3BNDA 4EBGA 5IF6A 1FGMA 2ML5A 3CCJ3 2Z6BA 2B1XB 4IT7A 3VGNA 5KP4A 3VF1A 4N6MA 3CD63 5IW9A 3NBRA 1SPUA 1HKXA 4OUQA 2K54A 1IVWA 3BB9A 1Q40B 2FXTA 2W03A 1WMPA 1EG9B 1YJW3 1O7WB 1O7PB 1C7HA 2B24B 3IMAB 3BNBA 2GXFA 3F7SA 3LZAA 1JKGA 1R4CA 3EF8A 5JPPA 2OTJ3 1VQ83 1SJWA 1WQLB 4MEIA 3CC23 3MG3A 3WA3A 1IQXA 1RJOA 2FGTA 3FG4A 1W7CA 1QAFA 2BMOB 2XFTA 3AMOA 3JUMA 3SOYA 1YHQ3 1FGOA 1JB2A 3NXJA 3FF0A 4IIAA 3GZBA 5D81A 4BTYA 4N6NB 1O7HB 3B4OA 3NBJA 1W01A 4GL6A 1FUWA 5TGNA 5STDA 1N8R4 4JRFA 3CMA3 2YX9A 3HZPA 3KKGA 4MMXB 4LEHA 2W9PA 1GD3A 1JV2B 1Q42A 3ROBA 3LTBA 3WDGB 1GYBA 1VQM3 1Q814 2WOHA 1SIHA 2HMJB 1TIJA 1ZO2A 1E97A 1YGEA 3CCM3 3MWZA 3LH4A 4X2HA 1N8QA 2L4VA 1DVDA 4N6OB 1VQ73 1MOLA 4FCZA 3EBYA 1IDPA 3LTAA 2OCTA 1W6YA 2ZDJA 1TP6A 4RNYA 5CLKA 4HM1B 5FW5A 1QVF2 3DUKA 1W00A 3EN1B 3PXMA 1VQP3 3HIGA 3U1WA 4BTWA 1Y4KA 5CF2A 4HM4B 3GZYB 3OWUA 3BNCA 5KP3A 1WMOA 1N5PA 1A2KA 2PNCA 4I4KA 5CK6A 2CKFB 4L8PA 1AVKA 2OOVC 2JQ5A 1F8NA 4NREA 1VQ43 1YIT3 1K734 5LC6A 4WYKB 3JUPA 4LGQA 3Q90A 4FCJA 1QJGA 4Q53A 3KN4A 4R9LA 1VQ63 4HZ9B 1E3VA 1NU3A 1ROAA 4K90B 3IPTA 3PGBA 1DMNA 2XGLA 3CCV3 3D9RA 2CFWA 3CCU3 1N9EA 4WFOA 1QALA 1OHPA 4OK0A 3NQYA 1QVG2 4HM2B 3NHXA 1ROVA 1N5HA 3SVAA 4AKZA 1ISKA 3CC43 4MMZB 1TU5A 1US1A 1M904 3KFQC 4HM8B 3FZWA 4N6TA 3FG3A 4OVMA 3CCR3 5IEOA 3HX8A 2P0XA 4R1KA 1STFI 1CQSA 2KCDA 3DGNA 2IMJA 1EQKA 1ZX2A 3LTCA 5IG5A 2OQEC 1GS3A 1S5AA 1IT7A 2OWPA 3X42A 2BMRB 1JB4A 3S29A 3FLJA 2CWUA 3MPHA 4R9KA 4L7KA 4JF8A 1GY5A 2BT3A 2F86B 1KQS2 1JKGB 3UNLA 3T8NA 1U8CB 5IERA 3G0KA 1NJI4 3WODG 4TX4A 3Q1CA 1SIIA 3AMOB 3G8ZA 3HK4A 3LYGA 3F8HA 3EBTA 3X41A 3CU3A 1IK3A 1DYUA 3I0YA 2XR8B 3F7XA 1IQ8A 2F98A 5I97A 1OPYA 4EV5A 2GU1A 1YI23 2KRTA 4KFDA 5AYSC 5A0OB 2QGUA 3V99A 1IVVA 3G4S3 2XFSA 1OHSA 4HM0B 1OGXA 3SOAA 1OACA 3DMCA 3L0RA 1MNLA 2SBLA 1U5OA 3EX9A 3SXXA 1FGTA 2WO0A 2W0QA 2STDA 3JVCA 7STDA 1RN7A 2RCDA 4H61A 1W5ZA 1D6ZA 4MMYB 3WOFB 4EYCA 3CCQ3 2RFRA 5JPUA 1Q7Y4 2CHCA 5IG3A 3BLZA 4AKYA 2GBXB 3DGOA 1AR0A 5AIIA 3CXC2 1TFKA 1WTHA 2HMMB 1OCVA 3F8XA 1KC84 3OWYA 1M1K4 3H51A 2Z77A 2A15A 4R4KA 5EEOA 4WP5A 3PS8A 2CG0A 3MG1A 3QRDA 3RGRA 3KSED 3K0ZA 4H3UA 2E2UA 2W04A 3DGMA 4HM5B 3EHCA 3S67A 1W6CA 3S27A 4FMCA 2R4IA 3K7CA 4RZMA 3QK9A 4EC6A 3GZRA 3CME3 3PZWA 5AEWB 2P09A 4HM3B 1HU9A 3LXUX 3SX1A 2CH9A 1GD4A 1OF5B 2Y73A 3N9HA 2W56A 1PU4A 5AIFA 3WOEB 5AYRB 2QEX3 2HMLB 2D42A 2XSOB 2ML6A 1VQO3 4HJLB 1VQN3 3DZLA 3FCSB 3UJMA 5CXOA 5ELUA 2P0MA 3T0UA 3K9MC 4R80A 3K5TA 3CCS3 3EQQB 2CIUA 4XDVA 4NHFA 2JDIH 4STDA 2CFGA 5IG0A 4BTXA 1IQYA 1M1XB 4FMAA 4RBNA 1UI8A 2MF7A 2V1LA 2I9WA 2XRXB 4LSOA 2HMOB 4J9AA 3S5CA 3N54B 1JRQA 2BO9B 4O8SA 5AIGA 2HMNB 3OV4A 3JUNA 1JB5A 4ORLA 4XB5A 2K0MA 3LMLA 4WWUC 3KSPA 2RSXA 3MSOA 3KIIA 1KD14 2Z7AA 3FH1A 1CYVA 4O3VA 1QAKA 3FGYA 1NDOB 1D6UA 2CC3A 3EC9A 3E99A 4KFEA 1K28A 4HBRA 1FA3A 5D82A 2Y74A 2FNQA 1WMNA 2C10A 4XBYA 3JUQA 4HKVB 3I553 3FF2A 3H3HA 5HGRA 4WHAA 3RGAA 1KSIA 1AV4A 2W9QA 3K63A 3NX0A 2CFDA 2O3OA 4WYKA 4X2OA 5BVBA 3NV0A 3ECFA 3MHEA 1BUQA 3WMDA 3T8UA 1O7MB 4CCVA 4AEQA 1W02A 2GEXA 3LTDA 2XH9A 4N6V0 5EVHA 2XSHB 2MC8A 4LMIA 1UI7A 5JBSA 1W6GA 1YIJ3 4KZ1A 1G96A 1O7NB 2WOFA 2RGQA 3D3LA 1Q864 3F14A 1RRHA 1K8A4 4N6UA 3VSYA 4FCMA 4K1VA 2E2TA 4XBXA 4EXRA 2YFJB 3U97A 3DM8A 1JN5A 4L8OA 1IVXA 1UW1A 3CPOA 3ER7A 1DVCA 1OH0A 2F99A 3RDEA 2IA7A 2UX0A 3TDGA 5G2GA 1K41A 1NWWA 2IUKA 4G1MB 1VQL3 1VZZA 1Q824 3SLUA 1TFOA 3EB8A 2CG1A 2CW9A 1FGQA 3CCE3 3CNMA 4CDLA 4XBTA 1K9M4 2WGQA 3M8CA 1QMAA 2IUJA 5DREA 1JNQA 1NO3A 5AI1A 5IG4A 3G6E3 3WA2X 1LXEA 2CK3H 3B7CA 3GAXA 3N8BA 1SQWA 3EE1A 1O7GB 1Q40A 3MKIA 4KFFA 2OTL3 1T5YA 1OGZA 5CF1A 3CNXA 2P38A 3ALAA 1Z1SA 2W56B 4FR9A 1DMMA 4J8TA 4LZIA 1W4NA 1RKYA 1IV9A 1UUWB 4K1UA 1EKMA 1LNHA 2YFIB 3FG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJD A;  2W2C A;  3NUV A;  2Z76 A;  4PEJ A;  2GEY A;  2PZV A;  3SED A;  5D83 A;  3B4P A;  4HZB B;  4N3V A;  2BMQ B;  3F9S A;  3OX9 A;  2GBW B;  4U13 A;  1GY6 A;  3DXO A;  6STD A;  1ULI B;  3OXA A;  4XDW A;  5AIH A;  1UUV B;  3F40 A;  3KZT A;  3STD A;  4GB5 A;  2QIY A;  1OF5 A;  3GWR A;  3NV0 B;  3G16 A;  1TUH A;  4KVH A;  1E3R A;  4HM7 B;  3FKA A;  3B8L A;  1GY7 A;  4XM4 A;  3FSD A;  3GZX B;  1EA2 A;  2HMK B;  5DRV A;  5AEU B;  1OUN A;  3MG2 A;  3KE7 A;  4HM6 B;  3JUO A;  2YFL B;  3MYT A;  3OWS A;  1ASK A;  3GRD A;  1STD A;  5KP1 A;  1JN5 B;  1OHO A;  3NM2 A;  4HVN A;  1ULJ B;  1DMQ A;  3A76 A;  3EJV A;  5IEP A;  8CHO A;  5BXQ A;  5IEN A;  2BNG A;  3EN8 A;  2INX A;  5IF6 A;  5KP4 A;  2B1X B;  3VGN A;  3NBR A;  1HKX A;  4OUQ A;  2K54 A;  3BB9 A;  1Q40 B;  1EG9 B;  1C7H A;  1O7W B;  1O7P B;  2B24 B;  2GXF A;  3F7S A;  3LZA A;  1JKG A;  3EF8 A;  5JPP A;  1SJW A;  1WQL B;  3MG3 A;  2BMO B;  3SOY A;  3JUM A;  1JB2 A;  3NXJ A;  3FF0 A;  4IIA A;  3GZB A;  5D81 A;  1O7H B;  3B4O A;  1W01 A;  5TGN A;  5STD A;  3HZP A;  3KKG A;  4LEH A;  1Q42 A;  3ROB A;  1GYB A;  2HMJ B;  1ZO2 A;  1E97 A;  4X2H A;  3EBY A;  1IDP A;  1W6Y A;  1TP6 A;  5CLK A;  4HM1 B;  5FW5 A;  3DUK A;  1W00 A;  3EN1 B;  5CF2 A;  4HM4 B;  3GZY B;  3OWU A;  5KP3 A;  1A2K A;  4I4K A;  5CK6 A;  2CKF B;  4L8P A;  2JQ5 A;  4WYK B;  3JUP A;  4LGQ A;  3Q90 A;  4FCJ A;  1QJG A;  4Q53 A;  4R9L A;  4HZ9 B;  1E3V A;  1NU3 A;  3IPT A;  1DMN A;  3D9R A;  1OHP A;  4HM2 B;  3NHX A;  1ISK A;  4HM8 B;  3FZW A;  4OVM A;  5IEO A;  3HX8 A;  4R1K A;  1CQS A;  2IMJ A;  1ZX2 A;  5IG5 A;  1GS3 A;  1S5A A;  2OWP A;  2BMR B;  1JB4 A;  3FLJ A;  4R9K A;  4L7K A;  1GY5 A;  2F86 B;  1JKG B;  3UNL A;  3T8N A;  5IER A;  3G0K A;  3G8Z A;  3HK4 A;  3LYG A;  3F8H A;  3EBT A;  3CU3 A;  3I0Y A;  2XR8 B;  3F7X A;  2F98 A;  1OPY A;  2QGU A;  1OHS A;  4HM0 B;  1OGX A;  3SOA A;  3DMC A;  1U5O A;  3EX9 A;  2STD A;  7STD A;  2RCD A;  2RFR A;  5JPU A;  2CHC A;  5IG3 A;  3BLZ A;  2GBX B;  1AR0 A;  5AII A;  2HMM B;  1OCV A;  3F8X A;  3OWY A;  3H51 A;  2Z77 A;  2A15 A;  4WP5 A;  3MG1 A;  3RGR A;  3K0Z A;  4H3U A;  4HM5 B;  3EHC A;  2R4I A;  3K7C A;  4RZM A;  3GZR A;  5AEW B;  4HM3 B;  1OF5 B;  5AIF A;  2HML B;  2XSO B;  4HJL B;  3DZL A;  3UJM A;  5CXO A;  3EQQ B;  5IG0 A;  4XDV A;  4STD A;  2I9W A;  2XRX B;  2HMO B;  4J9A A;  3S5C A;  5AIG A;  2HMN B;  3OV4 A;  3JUN A;  1JB5 A;  4ORL A;  4XB5 A;  4WWU C;  3KSP A;  3MSO A;  2Z7A A;  3FH1 A;  3FGY A;  1NDO B;  3EC9 A;  3E99 A;  5D82 A;  4XBY A;  3JUQ A;  4HKV B;  3FF2 A;  3H3H A;  5HGR A;  3RGA A;  4WYK A;  4X2O A;  5BVB A;  3NV0 A;  3ECF A;  3MHE A;  1BUQ A;  3WMD A;  3T8U A;  1O7M B;  1W02 A;  2GEX A;  5EVH A;  2XSH B;  4LMI A;  1O7N B;  2RGQ A;  3F14 A;  3VSY A;  4FCM A;  4K1V A;  4XBX A;  2YFJ B;  3DM8 A;  1JN5 A;  4L8O A;  3CPO A;  3ER7 A;  1OH0 A;  2F99 A;  2UX0 A;  5G2G A;  1K41 A;  1NWW A;  1VZZ A;  3CNM A;  4CDL A;  4XBT A;  3M8C A;  1QMA A;  5DRE A;  5AI1 A;  5IG4 A;  3B7C A;  1O7G B;  1Q40 A;  3MKI A;  1OGZ A;  5CF1 A;  3CNX A;  1Z1S A;  1DMM A;  4J8T A;  1UUW B;  4K1U A;  2YFI B; 
#chains in the Genus database with same CATH topology
 4MJD A;  1CH0 A;  1FW7 A;  2W2C A;  3PCS A;  3NUV A;  1CYU A;  1FYS A;  2Z76 A;  3LT8 A;  4FMB A;  1A90 A;  4O2H A;  3V92 A;  1PFP A;  4PEJ A;  1A2V A;  1ZGX A;  3X3Z A;  1YNV X;  2GEY A;  1FGR A;  3PYJ A;  2XF3 A;  4NPB A;  1KWI A;  3V98 A;  2UGI A;  1BNR A;  1BNG A;  3NBB A;  1VQ9 3;  2PZV A;  3UL6 A;  2CFL A;  2LQV A;  3X3Y A;  1RRL A;  5EQL A;  3BNE A;  3G71 3;  2C11 A;  2C4B A;  2CWT A;  1LQG C;  3DY5 A;  3HII A;  3LT9 A;  3SED A;  5D83 A;  2QA4 3;  3B4P A;  4HZB B;  4N3V A;  1S72 3;  1IV7 A;  2BMQ B;  3F9S A;  3OX9 A;  2UUG C;  2GBW B;  1BRI A;  3D79 A;  4N6L A;  4U13 A;  5GSP A;  4EV2 A;  1GY6 A;  1JZO A;  3BIR A;  3DXO A;  6STD A;  3Q2P A;  3X40 A;  1ULI B;  3OXA A;  1EEJ A;  1VQ5 3;  1R4Y A;  1BAN A;  4XDW A;  1B2U A;  1UUV B;  1BRH A;  3F40 A;  3NM7 A;  5AIH A;  3S28 A;  1YJ9 3;  3KZT A;  2K3D A;  5ELJ A;  1LVN A;  3UL5 A;  3STD A;  2RNT A;  2LYX A;  3O8Y A;  4GB5 A;  4O02 B;  3CPW 2;  2P05 A;  1JJ2 2;  2QIY A;  1RN1 A;  1NB3 I;  2WGO A;  1AVL A;  1OF5 A;  1X1X A;  3GWR A;  2CFK A;  3NV0 B;  3G16 A;  1TUH A;  4KVH A;  1J2B A;  2OOV A;  1E3R A;  1NB5 I;  4IPB A;  4FMD A;  3CC7 3;  4HM7 B;  3J7Y d;  3FKA A;  4K61 A;  3B8L A;  1BNJ A;  2O9U X;  1GY7 A;  2D1W A;  4XM4 A;  2CWV A;  1YVB I;  4QWT A;  2ZL8 A;  3FSD A;  2M7O A;  1N9J A;  1YJN 3;  3GZX B;  4ZM8 A;  3DGY A;  2BHM A;  3UB1 A;  4LYL B;  1WNH A;  3PCR A;  4J5K A;  1VQK 3;  1EA2 A;  2HMK B;  5DRV A;  5G1K A;  1L5G B;  1IT8 A;  1M9G A;  2E2V A;  4RNZ A;  5AEU B;  2GU3 A;  2AAE A;  4HYZ A;  1OUN A;  1TTO A;  3MG2 A;  4BIR A;  3I56 3;  3KE7 A;  3NQZ A;  3ZG0 A;  2KF5 A;  3AHW A;  3JUO A;  4HM6 B;  1IVU A;  3DGL A;  1LOX A;  2YFL B;  2W6J H;  3MYT A;  3OWS A;  4CPK A;  1A67 A;  3LOY A;  3IJE B;  1ASK A;  1IU7 A;  2Q07 A;  3GRD A;  1STD A;  5KP1 A;  1JN5 B;  1OHO A;  1V74 A;  3NM2 A;  4HVN A;  1ULJ B;  1BRJ A;  1LNI A;  2KXG A;  1DMQ A;  3A76 A;  2XEP A;  3EJV A;  5IEP A;  5LC7 A;  1CEW I;  1D6Y A;  2XGN A;  3HI7 A;  8CHO A;  5BXQ A;  5IEN A;  1W2Z A;  2BNG A;  2OQE A;  3EN8 A;  5FGO A;  3CCL 3;  3OW2 2;  1W2B 2;  1BRK A;  3X3X A;  2INX A;  3BND A;  4EBG A;  5IF6 A;  1FGM A;  3WR2 A;  2BIR A;  2ML5 A;  3CCJ 3;  2Z6B A;  2B1X B;  4IT7 A;  3VGN A;  5KP4 A;  3VF1 A;  1JBS A;  1BNI A;  5RNT A;  4N6M A;  3CD6 3;  5IW9 A;  3NBR A;  1SPU A;  1MWT A;  1HKX A;  4OUQ A;  2K54 A;  1IVW A;  3BB9 A;  1Q40 B;  2FXT A;  2W03 A;  1WMP A;  1EG9 B;  1YJW 3;  1O7W B;  1O7P B;  1C7H A;  2B24 B;  1RTU A;  3IMA B;  3BNB A;  2GXF A;  3F7S A;  3LZA A;  4DKI A;  1JKG A;  1R4C A;  1A2P A;  3EF8 A;  5JPP A;  2OTJ 3;  1VQ8 3;  1SJW A;  1WQL B;  4MEI A;  3CC2 3;  3MG3 A;  3WA3 A;  1BUJ A;  1IQX A;  1RJO A;  2FGT A;  3FG4 A;  1W7C A;  1QAF A;  2BMO B;  2XFT A;  3AMO A;  3JUM A;  3SOY A;  1YHQ 3;  1FGO A;  1JB2 A;  1B2M A;  2J8X B;  3NXJ A;  3FF0 A;  4IIA A;  3GZB A;  5D81 A;  4BTY A;  4N6N B;  1O7H B;  3B4O A;  3NBJ A;  1B3S A;  1W01 A;  4GL6 A;  1FUW A;  5TGN A;  5STD A;  1N8R 4;  1Q9E A;  2L1S A;  4JRF A;  2YX9 A;  3CMA 3;  3HZP A;  3KKG A;  1I2E A;  4MMX B;  1BRS A;  4LEH A;  2BU4 A;  2W9P A;  2ZHX B;  3ZFZ A;  1GD3 A;  1T2I A;  1JV2 B;  1Q42 A;  3ROB A;  1I3I A;  3LTB A;  1GOV A;  1GYB A;  3WDG B;  1VQM 3;  1Q81 4;  1X1Y A;  2WOH A;  1SIH A;  2HMJ B;  2KF6 A;  1TIJ A;  1ZO2 A;  1E97 A;  1YGE A;  1RHL A;  5BU4 A;  3MWZ A;  3CCM 3;  2R41 A;  3LH4 A;  1N8Q A;  4I5Q A;  2L4V A;  4X2H A;  1LOV A;  1FUT A;  1DVD A;  1I2G A;  4N6O B;  1VQ7 3;  1X1U A;  5M18 A;  1MOL A;  4FCZ A;  3EBY A;  1IDP A;  2IY2 A;  1LOW A;  1T2H A;  3LTA A;  2OCT A;  1W6Y A;  2F4Y A;  5HOH A;  2ZDJ A;  1TP6 A;  4RNY A;  5CLK A;  4HM1 B;  5FW5 A;  1QVF 2;  2H0G A;  1BOX A;  1JZD A;  3DUK A;  1W00 A;  3EN1 B;  3PXM A;  1VQP 3;  1B2Z A;  1BSD A;  1RDS A;  3HIG A;  3U1W A;  4BU4 A;  2AAD A;  4BTW A;  1Y4K A;  5CF2 A;  4HM4 B;  1RGH A;  3GZY B;  4RNT A;  1I2F A;  3OWU A;  3BNC A;  5KP3 A;  3WHO A;  1WMO A;  1N5P A;  1A2K A;  2PNC A;  4HAA A;  4I4K A;  5CK6 A;  4EW5 A;  6GSP A;  1BRG A;  4ILF A;  2CKF B;  4L8P A;  1AVK A;  1RGL A;  2OOV C;  2JQ5 A;  1F8N A;  1AY7 A;  4NRE A;  1VQ4 3;  1YIT 3;  1K73 4;  5LC6 A;  4WYK B;  1EUI C;  3JUP A;  3Q90 A;  4LGQ A;  4FCJ A;  1QJG A;  4Q53 A;  3KN4 A;  4R9L A;  1VQ6 3;  4KT3 B;  4HZ9 B;  1E3V A;  1NU3 A;  1ROA A;  4K90 B;  3IPT A;  3PGB A;  1DMN A;  2XGL A;  4GHO A;  3CCV 3;  3D9R A;  2CFW A;  3CCU 3;  1JBR A;  1N9E A;  4WFO A;  1QAL A;  1OHP A;  1PYL A;  4OK0 A;  3NQY A;  1QVG 2;  1UCJ A;  1B2S A;  4HM2 B;  3NHX A;  1ROV A;  1N5H A;  3SVA A;  4AKZ A;  1ISK A;  3CC4 3;  4MMZ B;  1TU5 A;  1US1 A;  1M90 4;  3KFQ C;  4HM8 B;  3FZW A;  4N6T A;  1GMR A;  3FG3 A;  1UDI I;  4OVM A;  3CCR 3;  5IEO A;  3HX8 A;  2P0X A;  4R1K A;  1I0X A;  1CQS A;  1STF I;  2KCD A;  3DGN A;  2IMJ A;  1EQK A;  1ZX2 A;  3LTC A;  5IG5 A;  1LRA A;  2OQE C;  1GS3 A;  1S5A A;  1IT7 A;  2OWP A;  3X42 A;  3ZG5 A;  1BVI A;  1YGW A;  2BMR B;  1JB4 A;  2SAR A;  9RNT A;  1GOY A;  3FLJ A;  3S29 A;  2CWU A;  3MPH A;  1TRQ A;  4R9K A;  1BAO A;  4JF8 A;  1GY5 A;  2BT3 A;  2F86 B;  4L7K A;  1BNS A;  1I70 A;  1KQS 2;  1JKG B;  1GMP A;  3UNL A;  3T8N A;  1NNV A;  1RGK A;  1U8C B;  1YVS A;  3G0K A;  5IER A;  1NJI 4;  4BTX A;  3WOD G;  4TX4 A;  3Q1C A;  1SII A;  3AMO B;  3G8Z A;  3HK4 A;  3LYG A;  3F8H A;  3EBT A;  1RCL A;  3X41 A;  3CU3 A;  1IK3 A;  1DYU A;  1ZS7 A;  1I8V A;  3I0Y A;  2XR8 B;  3F7X A;  1IQ8 A;  2F98 A;  2H0I A;  5I97 A;  1OPY A;  4EV5 A;  2GU1 A;  1YI2 3;  2KRT A;  4KFD A;  5AYS C;  5A0O B;  2QGU A;  3V99 A;  1IVV A;  1DE3 A;  3G4S 3;  2XFS A;  1OHS A;  4HM0 B;  1OGX A;  3SOA A;  1OAC A;  3DMC A;  3L0R A;  1MNL A;  2SBL A;  1GSP A;  1U5O A;  3EX9 A;  2F56 A;  3SXX A;  1FGT A;  2WO0 A;  2W0Q A;  2STD A;  3JVC A;  7STD A;  1RN7 A;  2RCD A;  4H61 A;  1MGW A;  1W5Z A;  1RGE A;  1TRP A;  1D6Z A;  4MMY B;  3WOF B;  4EYC A;  3CCQ 3;  2RFR A;  5JPU A;  1BNE A;  1Q7Y 4;  2CHC A;  5IG3 A;  3BLZ A;  4AKY A;  2GBX B;  3DGO A;  1AR0 A;  1RNT A;  5AII A;  3CXC 2;  1TFK A;  1WTH A;  2HMM B;  1OCV A;  1UUG B;  3F8X A;  1KC8 4;  1AQZ A;  3OWY A;  1M1K 4;  3KCH A;  3H51 A;  2Z77 A;  2A15 A;  2GSP A;  4R4K A;  5BIR A;  1BGS A;  4WP5 A;  1FUS A;  1BU4 A;  1I0V A;  3PS8 A;  2CG0 A;  5EEO A;  3MG1 A;  3QRD A;  3RGR A;  3KSE D;  1B21 A;  3K0Z A;  2E2U A;  4H3U A;  2W04 A;  3DGM A;  1RMS A;  4HM5 B;  3EHC A;  1RLS A;  5G1L A;  1W6C A;  3S67 A;  3S27 A;  1MWU A;  1TJD A;  4FMC A;  2R4I A;  3K7C A;  3GSP A;  4RZM A;  3QK9 A;  4EC6 A;  3GZR A;  3CME 3;  3PZW A;  1BSC A;  5AEW B;  2CX1 A;  2P09 A;  4HM3 B;  2HOH A;  3BU4 A;  1HU9 A;  3LXU X;  3SX1 A;  3A5E A;  2CH9 A;  1GD4 A;  1OF5 B;  2Y73 A;  3N9H A;  2W56 A;  1PU4 A;  5AIF A;  2YFI B;  3WOE B;  5AYR B;  2QEX 3;  2HML B;  2D42 A;  3D5G A;  2XSO B;  2ML6 A;  1VQO 3;  4HJL B;  1B27 A;  1VQN 3;  3DZL A;  1JBT A;  1HYF A;  3FCS B;  3AGN A;  3UJM A;  5CXO A;  5ELU A;  2P0M A;  3T0U A;  1G02 A;  2CX0 A;  3K9M C;  4R80 A;  3K5T A;  1BRN L;  3CCS 3;  3EQQ B;  1SAR A;  2CIU A;  1RGG A;  2JDI H;  1B2X A;  2CFG A;  4NHF A;  4STD A;  4XDV A;  5IG0 A;  1LOY A;  1IQY A;  1M1X B;  4FMA A;  4RBN A;  1B20 A;  1UI8 A;  2MF7 A;  2V1L A;  1HZ1 A;  1GMQ A;  1UGI A;  1LQM B;  2I9W A;  1FZU A;  2XRX B;  4LSO A;  2HMO B;  1UCK A;  4J9A A;  1PY3 A;  3S5C A;  1RSN A;  3N54 B;  1JRQ A;  2BO9 B;  4O8S A;  5AIG A;  1BNF A;  2HMN B;  3JUN A;  3OV4 A;  1JB5 A;  4ORL A;  4XB5 A;  2K0M A;  3LML A;  4WWU C;  3KSP A;  2RSX A;  3MSO A;  1UGH I;  3KII A;  5M19 A;  2Z7A A;  1KD1 4;  3FH1 A;  1CYV A;  1C54 A;  4O3V A;  1QAK A;  1Q7H A;  3FGY A;  1V58 A;  3AGO A;  1NDO B;  1D6U A;  2CC3 A;  2F5W A;  3EC9 A;  2IYJ A;  3E99 A;  4KFE A;  3Q3F A;  1K28 A;  4HBR A;  1V57 A;  1FA3 A;  5D82 A;  2Y74 A;  2FNQ A;  1WMN A;  2C10 A;  1X1W A;  4XBY A;  3JUQ A;  4HKV B;  3I55 3;  3FF2 A;  3H3H A;  1BIR A;  4WHA A;  5HGR A;  3RGA A;  1RNB A;  1KSI A;  4HOH A;  1AV4 A;  1GOU A;  2W9Q A;  3K63 A;  3AHS A;  3NX0 A;  2CFD A;  1MGR A;  1MWS A;  2O3O A;  4WYK A;  4X2O A;  1UCL A;  4BL2 A;  3NV0 A;  5BVB A;  3ECF A;  3MHE A;  1BUQ A;  3SYU A;  3WMD A;  3T8U A;  1O7M B;  4CCV A;  4AEQ A;  7GSP A;  1BSE A;  2ZA4 A;  1DET A;  1W02 A;  2GEX A;  3LTD A;  2XH9 A;  4N6V 0;  5EVH A;  2XSH B;  2MC8 A;  4LMI A;  1UI7 A;  5JBS A;  1W6G A;  1I3F A;  1YIJ 3;  4KZ1 A;  1G96 A;  1O7N B;  1RGC A;  2RGQ A;  1T3B A;  2WOF A;  3D3L A;  1RRH A;  3F14 A;  1Q86 4;  2F5M A;  1K8A 4;  4N6U A;  1G0T A;  3DH2 A;  3VSY A;  4FCM A;  4K1V A;  2E2T A;  3D5I A;  3D4A A;  8RNT A;  1IYY A;  4XBX A;  4EXR A;  2YFJ B;  4BL3 A;  3U97 A;  3DM8 A;  1JN5 A;  4L8O A;  1IVX A;  2KAA A;  1VQQ A;  1UW1 A;  3CPO A;  3ER7 A;  1DVC A;  1OH0 A;  2F99 A;  3RDE A;  1BSB A;  2IA7 A;  2UX0 A;  3TDG A;  5G2G A;  7RNT A;  1K41 A;  1NWW A;  2IUK A;  4G1M B;  1VQL 3;  1RCK A;  1VZZ A;  1RGF A;  1Q82 4;  5M1A A;  3SLU A;  1TFO A;  3EB8 A;  4CJN A;  2H0H A;  2CG1 A;  2CW9 A;  1FGQ A;  3CCE 3;  3CNM A;  4CDL A;  4XBT A;  1K9M 4;  2WGQ A;  3RNT A;  2RBI A;  1QMA A;  3M8C A;  2IUJ A;  5DRE A;  1JNQ A;  1NO3 A;  5AI1 A;  5IG4 A;  3G6E 3;  3WA2 X;  3URP A;  1LXE A;  2CK3 H;  3B7C A;  1RN4 A;  3GAX A;  3HOH A;  3N8B A;  1SQW A;  2KF3 A;  3EE1 A;  1O7G B;  1Q40 A;  3MKI A;  4GSP A;  4KFF A;  2OTL 3;  1T5Y A;  1OGZ A;  1UCI A;  3CNX A;  5CF1 A;  6RNT A;  4J5G A;  2P38 A;  3ALA A;  1Z1S A;  2W56 B;  1BSA A;  1DMM A;  2KF4 A;  4FR9 A;  4J8T A;  1W4N A;  4LZI A;  1RKY A;  1IV9 A;  1UUW B;  4K1U A;  1MWR A;  1EKM A;  1LNH A;  1RGA A;  3FG1 A; 
#chains in the Genus database with same CATH homology
 4MJD A;  2W2C A;  3PCS A;  3NUV A;  1CYU A;  2Z76 A;  3LT8 A;  4FMB A;  1A90 A;  4O2H A;  3V92 A;  1PFP A;  4PEJ A;  1A2V A;  3X3Z A;  2GEY A;  1FGR A;  3PYJ A;  2XF3 A;  1KWI A;  3V98 A;  3NBB A;  1VQ9 3;  2PZV A;  3UL6 A;  2CFL A;  2LQV A;  3X3Y A;  1RRL A;  5EQL A;  3BNE A;  3G71 3;  2C11 A;  2CWT A;  3LT9 A;  3DY5 A;  3HII A;  3SED A;  5D83 A;  2QA4 3;  3B4P A;  4HZB B;  4N3V A;  1S72 3;  1IV7 A;  2BMQ B;  3F9S A;  3OX9 A;  2GBW B;  4U13 A;  4N6L A;  4EV2 A;  1GY6 A;  3DXO A;  6STD A;  3Q2P A;  3X40 A;  1ULI B;  3OXA A;  1VQ5 3;  4XDW A;  5AIH A;  1UUV B;  3F40 A;  3NM7 A;  3S28 A;  1YJ9 3;  3KZT A;  5ELJ A;  1LVN A;  3UL5 A;  3STD A;  2LYX A;  3O8Y A;  4GB5 A;  4O02 B;  3CPW 2;  2P05 A;  1JJ2 2;  2QIY A;  2WGO A;  1NB3 I;  1AVL A;  1OF5 A;  3GWR A;  2CFK A;  3NV0 B;  3G16 A;  1TUH A;  4KVH A;  1J2B A;  2OOV A;  1E3R A;  1NB5 I;  4IPB A;  4FMD A;  3CC7 3;  4HM7 B;  3J7Y d;  3FKA A;  4K61 A;  3B8L A;  2O9U X;  1GY7 A;  2D1W A;  4XM4 A;  2CWV A;  1YVB I;  4QWT A;  2ZL8 A;  3FSD A;  2M7O A;  1N9J A;  1YJN 3;  3GZX B;  4ZM8 A;  2BHM A;  3UB1 A;  1WNH A;  3PCR A;  1VQK 3;  1EA2 A;  2HMK B;  5DRV A;  1L5G B;  1IT8 A;  1M9G A;  2E2V A;  4RNZ A;  5AEU B;  2GU3 A;  4HYZ A;  1OUN A;  3MG2 A;  3I56 3;  3KE7 A;  3NQZ A;  4HM6 B;  3JUO A;  1IVU A;  3DGL A;  1LOX A;  2YFL B;  2W6J H;  3MYT A;  3OWS A;  1A67 A;  3LOY A;  3IJE B;  1ASK A;  1IU7 A;  2Q07 A;  3GRD A;  1STD A;  5KP1 A;  1JN5 B;  1OHO A;  1V74 A;  3NM2 A;  4HVN A;  1ULJ B;  2KXG A;  1DMQ A;  3A76 A;  2XEP A;  3EJV A;  5IEP A;  5LC7 A;  1CEW I;  1D6Y A;  2XGN A;  3HI7 A;  8CHO A;  5BXQ A;  5IEN A;  1W2Z A;  2BNG A;  2OQE A;  3EN8 A;  5FGO A;  3CCL 3;  3OW2 2;  1W2B 2;  3X3X A;  2INX A;  3BND A;  4EBG A;  5IF6 A;  1FGM A;  2ML5 A;  3CCJ 3;  2Z6B A;  2B1X B;  4IT7 A;  3VGN A;  5KP4 A;  3VF1 A;  4N6M A;  3CD6 3;  5IW9 A;  3NBR A;  1SPU A;  1HKX A;  4OUQ A;  2K54 A;  1IVW A;  3BB9 A;  1Q40 B;  2FXT A;  2W03 A;  1WMP A;  1EG9 B;  1YJW 3;  1O7W B;  1O7P B;  1C7H A;  2B24 B;  3IMA B;  3BNB A;  2GXF A;  3F7S A;  3LZA A;  1JKG A;  1R4C A;  3EF8 A;  5JPP A;  2OTJ 3;  1VQ8 3;  1SJW A;  1WQL B;  4MEI A;  3CC2 3;  3MG3 A;  3WA3 A;  1IQX A;  1RJO A;  2FGT A;  3FG4 A;  1W7C A;  1QAF A;  2BMO B;  2XFT A;  3AMO A;  3JUM A;  3SOY A;  1YHQ 3;  1FGO A;  1JB2 A;  3NXJ A;  3FF0 A;  4IIA A;  3GZB A;  5D81 A;  4BTY A;  4N6N B;  1O7H B;  3B4O A;  3NBJ A;  1W01 A;  4GL6 A;  1FUW A;  5TGN A;  5STD A;  1N8R 4;  4JRF A;  3CMA 3;  2YX9 A;  3HZP A;  3KKG A;  4MMX B;  4LEH A;  2W9P A;  1GD3 A;  1JV2 B;  1Q42 A;  3ROB A;  3LTB A;  3WDG B;  1GYB A;  1VQM 3;  1Q81 4;  2WOH A;  1SIH A;  2HMJ B;  1TIJ A;  1ZO2 A;  1E97 A;  1YGE A;  3CCM 3;  3MWZ A;  3LH4 A;  4X2H A;  1N8Q A;  2L4V A;  1DVD A;  4N6O B;  1VQ7 3;  1MOL A;  4FCZ A;  3EBY A;  1IDP A;  3LTA A;  2OCT A;  1W6Y A;  2ZDJ A;  1TP6 A;  4RNY A;  5CLK A;  4HM1 B;  5FW5 A;  1QVF 2;  3DUK A;  1W00 A;  3EN1 B;  3PXM A;  1VQP 3;  3HIG A;  3U1W A;  4BTW A;  1Y4K A;  5CF2 A;  4HM4 B;  3GZY B;  3OWU A;  3BNC A;  5KP3 A;  1WMO A;  1N5P A;  1A2K A;  2PNC A;  4I4K A;  5CK6 A;  2CKF B;  4L8P A;  1AVK A;  2OOV C;  2JQ5 A;  1F8N A;  4NRE A;  1VQ4 3;  1YIT 3;  1K73 4;  5LC6 A;  4WYK B;  3JUP A;  4LGQ A;  3Q90 A;  4FCJ A;  1QJG A;  4Q53 A;  3KN4 A;  4R9L A;  1VQ6 3;  4HZ9 B;  1E3V A;  1NU3 A;  1ROA A;  4K90 B;  3IPT A;  3PGB A;  1DMN A;  2XGL A;  3CCV 3;  3D9R A;  2CFW A;  3CCU 3;  1N9E A;  4WFO A;  1QAL A;  1OHP A;  4OK0 A;  3NQY A;  1QVG 2;  4HM2 B;  3NHX A;  1ROV A;  1N5H A;  3SVA A;  4AKZ A;  1ISK A;  3CC4 3;  4MMZ B;  1TU5 A;  1US1 A;  1M90 4;  3KFQ C;  4HM8 B;  3FZW A;  4N6T A;  3FG3 A;  4OVM A;  3CCR 3;  5IEO A;  3HX8 A;  2P0X A;  4R1K A;  1STF I;  1CQS A;  2KCD A;  3DGN A;  2IMJ A;  1EQK A;  1ZX2 A;  3LTC A;  5IG5 A;  2OQE C;  1GS3 A;  1S5A A;  1IT7 A;  2OWP A;  3X42 A;  2BMR B;  1JB4 A;  3S29 A;  3FLJ A;  2CWU A;  3MPH A;  4R9K A;  4L7K A;  4JF8 A;  1GY5 A;  2BT3 A;  2F86 B;  1KQS 2;  1JKG B;  3UNL A;  3T8N A;  1U8C B;  5IER A;  3G0K A;  1NJI 4;  3WOD G;  4TX4 A;  3Q1C A;  1SII A;  3AMO B;  3G8Z A;  3HK4 A;  3LYG A;  3F8H A;  3EBT A;  3X41 A;  3CU3 A;  1IK3 A;  1DYU A;  3I0Y A;  2XR8 B;  3F7X A;  1IQ8 A;  2F98 A;  5I97 A;  1OPY A;  4EV5 A;  2GU1 A;  1YI2 3;  2KRT A;  4KFD A;  5AYS C;  5A0O B;  2QGU A;  3V99 A;  1IVV A;  3G4S 3;  2XFS A;  1OHS A;  4HM0 B;  1OGX A;  3SOA A;  1OAC A;  3DMC A;  3L0R A;  1MNL A;  2SBL A;  1U5O A;  3EX9 A;  3SXX A;  1FGT A;  2WO0 A;  2W0Q A;  2STD A;  3JVC A;  7STD A;  1RN7 A;  2RCD A;  4H61 A;  1W5Z A;  1D6Z A;  4MMY B;  3WOF B;  4EYC A;  3CCQ 3;  2RFR A;  5JPU A;  1Q7Y 4;  2CHC A;  5IG3 A;  3BLZ A;  4AKY A;  2GBX B;  3DGO A;  1AR0 A;  5AII A;  3CXC 2;  1TFK A;  1WTH A;  2HMM B;  1OCV A;  3F8X A;  1KC8 4;  3OWY A;  1M1K 4;  3H51 A;  2Z77 A;  2A15 A;  4R4K A;  5EEO A;  4WP5 A;  3PS8 A;  2CG0 A;  3MG1 A;  3QRD A;  3RGR A;  3KSE D;  3K0Z A;  4H3U A;  2E2U A;  2W04 A;  3DGM A;  4HM5 B;  3EHC A;  3S67 A;  1W6C A;  3S27 A;  4FMC A;  2R4I A;  3K7C A;  4RZM A;  3QK9 A;  4EC6 A;  3GZR A;  3CME 3;  3PZW A;  5AEW B;  2P09 A;  4HM3 B;  1HU9 A;  3LXU X;  3SX1 A;  2CH9 A;  1GD4 A;  1OF5 B;  2Y73 A;  3N9H A;  2W56 A;  1PU4 A;  5AIF A;  3WOE B;  5AYR B;  2QEX 3;  2HML B;  2D42 A;  2XSO B;  2ML6 A;  1VQO 3;  4HJL B;  1VQN 3;  3DZL A;  3FCS B;  3UJM A;  5CXO A;  5ELU A;  2P0M A;  3T0U A;  3K9M C;  4R80 A;  3K5T A;  3CCS 3;  3EQQ B;  2CIU A;  4XDV A;  4NHF A;  2JDI H;  4STD A;  2CFG A;  5IG0 A;  4BTX A;  1IQY A;  1M1X B;  4FMA A;  4RBN A;  1UI8 A;  2MF7 A;  2V1L A;  2I9W A;  2XRX B;  4LSO A;  2HMO B;  4J9A A;  3S5C A;  3N54 B;  1JRQ A;  2BO9 B;  4O8S A;  5AIG A;  2HMN B;  3OV4 A;  3JUN A;  1JB5 A;  4ORL A;  4XB5 A;  2K0M A;  3LML A;  4WWU C;  3KSP A;  2RSX A;  3MSO A;  3KII A;  1KD1 4;  2Z7A A;  3FH1 A;  1CYV A;  4O3V A;  1QAK A;  3FGY A;  1NDO B;  1D6U A;  2CC3 A;  3EC9 A;  3E99 A;  4KFE A;  1K28 A;  4HBR A;  1FA3 A;  5D82 A;  2Y74 A;  2FNQ A;  1WMN A;  2C10 A;  4XBY A;  3JUQ A;  4HKV B;  3I55 3;  3FF2 A;  3H3H A;  5HGR A;  4WHA A;  3RGA A;  1KSI A;  1AV4 A;  2W9Q A;  3K63 A;  3NX0 A;  2CFD A;  2O3O A;  4WYK A;  4X2O A;  5BVB A;  3NV0 A;  3ECF A;  3MHE A;  1BUQ A;  3WMD A;  3T8U A;  1O7M B;  4CCV A;  4AEQ A;  1W02 A;  2GEX A;  3LTD A;  2XH9 A;  4N6V 0;  5EVH A;  2XSH B;  2MC8 A;  4LMI A;  1UI7 A;  5JBS A;  1W6G A;  1YIJ 3;  4KZ1 A;  1G96 A;  1O7N B;  2WOF A;  2RGQ A;  3D3L A;  1Q86 4;  3F14 A;  1RRH A;  1K8A 4;  4N6U A;  3VSY A;  4FCM A;  4K1V A;  2E2T A;  4XBX A;  4EXR A;  2YFJ B;  3U97 A;  3DM8 A;  1JN5 A;  4L8O A;  1IVX A;  1UW1 A;  3CPO A;  3ER7 A;  1DVC A;  1OH0 A;  2F99 A;  3RDE A;  2IA7 A;  2UX0 A;  3TDG A;  5G2G A;  1K41 A;  1NWW A;  2IUK A;  4G1M B;  1VQL 3;  1VZZ A;  1Q82 4;  3SLU A;  1TFO A;  3EB8 A;  2CG1 A;  2CW9 A;  1FGQ A;  3CCE 3;  3CNM A;  4CDL A;  4XBT A;  1K9M 4;  2WGQ A;  3M8C A;  1QMA A;  2IUJ A;  5DRE A;  1JNQ A;  1NO3 A;  5AI1 A;  5IG4 A;  3G6E 3;  3WA2 X;  1LXE A;  2CK3 H;  3B7C A;  3GAX A;  3N8B A;  1SQW A;  3EE1 A;  1O7G B;  1Q40 A;  3MKI A;  4KFF A;  2OTL 3;  1T5Y A;  1OGZ A;  5CF1 A;  3CNX A;  2P38 A;  3ALA A;  1Z1S A;  2W56 B;  4FR9 A;  1DMM A;  4J8T A;  4LZI A;  1W4N A;  1RKY A;  1IV9 A;  1UUW B;  4K1U A;  1EKM A;  1LNH A;  2YFI B;  3FG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...