3A5EA

Crystal structure of 5k rnase sa
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
KVSGTVCLSALPPEATKTLNLIASKGPFPYSQDGVVFQNRKSVLPTQSYGYYHEYTVITPGARTRGTRRIITGKATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Guanyl-specific ribonuclease Sa
publication title Urea denatured state ensembles contain extensive secondary structure that is increased in hydrophobic proteins
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3a5eA00
1BNRA 1AQZA 1RTUA 1FUSA 1BSCA 1BUJA 5BU4A 9RNTA 1BAOA 2AADA 1X1YA 3AHSA 5GSPA 5BIRA 1IYYA 3KCHA 1RN4A 1BVIA 3DGYA 1BNSA 1I0VA 1BGSA 1LNIA 1R4YA 2SARA 1BIRA 1LOVA 2RNTA 1BSEA 1G02A 1X1UA 1FW7A 1YNVX 1C54A 1GSPA 1RCLA 2BU4A 1B21A 1B2XA 2ZA4A 1RCKA 1B2UA 1ZGXA 1BU4A 3WHOA 3BIRA 1BRIA 1BRNL 1FYSA 2BIRA 1RN1A 6GSPA 1GOUA 2GSPA 1RGFA 7RNTA 1CH0A 3D5GA 2KF6A 2F56A 2F5MA 1I70A 1BRSA 1BNIA 1JBTA 1FZUA 1GOVA 1I2EA 2KF5A 1T2IA 1RHLA 3SYUA 1BSDA 1B2SA 4BU4A 1RNTA 1UCIA 3HOHA 3D4AA 1PYLA 1RSNA 1MGRA 2HOHA 4J5KA 1TRQA 1UCLA 1BNFA 2F5WA 1RGHA 1BOXA 1A2PA 1RMSA 1YVSA 1PY3A 1BRGA 8RNTA 1BNGA 1X1XA 3Q3FA 3AHWA 1RNBA 1B3SA 1HYFA 1I3IA 1RGCA 1B27A 1TTOA 1BRKA 2KAAA 4J5GA 1I8VA 3D5IA 1JBRA 1B2MA 2C4BA 1TRPA 2KF4A 3AGOA 1I3FA 1I2FA 1T2HA 5RNTA 4HOHA 1BSAA 1SARA 2AAEA 3WR2A 6RNTA 1DETA 1Q9EA 1RGGA 1I2GA 1RLSA 1DE3A 1UCKA 4GHOA 1X1WA 1LRAA 1BRJA 1HZ1A 1RGAA 1GMQA 2F4YA 1LOWA 1MGWA 1RGLA 1GMRA 4BIRA 3BU4A 1GMPA 1I0XA 4GSPA 1BANA 1JBSA 1B2ZA 1RGEA 1RDSA 1YGWA 3GSPA 1BNJA 1LOYA 5HOHA 4RNTA 1B20A 3DH2A 4HAAA 2RBIA 2KF3A 3RNTA 3AGNA 3URPA 1RGKA 3A5EA 1FUTA 1UCJA 7GSPA 1BRHA 1BSBA 1GOYA 1BNEA 1AY7A
chains in the Genus database with same CATH superfamily
3X42A 2HMOB 1AQZA 4HM0B 3GZRA 2F86B 1M1XB 2H0HA 2KRTA 5ELJA 4EV2A 3FF0A 1UUVB 4K1UA 9RNTA 1S723 1IYYA 2Y74A 1Q40B 1YIT3 1RN4A 3HZPA 1BVIA 2YFJB 4R9KA 3CCV3 3DM8A 4N6OB 4FMAA 2SARA 4BL2A 1LOVA 2RNTA 3D3LA 3SVAA 2GXFA 1MWTA 3LTCA 3LTDA 2BU4A 1B21A 2ZA4A 1WMOA 1OUNA 1RCKA 3K63A 3MG1A 4CJNA 1E3RA 2GEYA 2CG0A 1R4CA 1QAKA 1GS3A 3BIRA 3WHOA 5AYSC 2OQEC 3F40A 5A0OB 3G4S3 4OVMA 1GOUA 1STDA 3V99A 1RGFA 4H3UA 1W2B2 3PCSA 3DXOA 1DMQA 4K1VA 3QRDA 1JRQA 4HKVB 2QA43 2IY2A 1M9GA 2H0IA 4HM5B 3ER7A 5I97A 3FG3A 2F56A 2F5MA 5JBSA 1I70A 4N6MA 3J7Yd 2W56B 4KFFA 1JBTA 5TGNA 4ORLA 1M1K4 4FMBA 4ZM8A 1RHLA 1JNQA 3OX9A 1BSDA 1B2SA 3CU3A 2IYJA 3G0KA 4NHFA 5AI1A 3UL6A 2FNQA 3CPOA 2OOVC 3NUVA 3KSPA 1FGMA 3BB9A 3EN1B 2RSXA 1VQM3 1MGRA 2FGTA 1BUQA 2HOHA 2IUJA 4N3VA 3EB8A 4N6UA 1RMSA 3KIIA 3KKGA 2H0GA 1BRGA 3JUOA 1VQK3 1TJDA 1DMNA 1RNBA 1W02A 3GWRA 3WA3A 3Q1CA 3KE7A 1IT7A 2CWTA 1I3IA 1RGCA 5FW5A 1K734 1B27A 1JB5A 2MF7A 4KZ1A 3LTBA 1IT8A 5AEUB 2XSOB 4AKYA 3CC73 1YJ93 3UL5A 2C4BA 1V74A 1N8QA 1Q7Y4 3HIGA 1K28A 1JZDA 3EF8A 3V98A 2R4IA 2E2UA 2HMLB 1I2FA 4LMIA 3EX9A 3MHEA 1D6YA 3CCU3 2YX9A 4HM7B 5AIGA 4MMZB 1QALA 3FG4A 1K8A4 1NB5I 4K61A 3I0YA 1Q9EA 5STDA 1RGGA 1I2GA 3AMOA 1VQN3 1DE3A 3ZG5A 3OV4A 5AYRB 3F8XA 4RBNA 3WMDA 1BRJA 5BXQA 1M904 1OF5A 3G713 1SPUA 2B1XB 1LQGC 3F7SA 1V58A 2BO9B 5AEWB 8CHOA 2P05A 3PGBA 1VQO3 1I0XA 1C7HA 2CX0A 1US1A 4GSPA 2ZDJA 3N54B 4HM6B 4ILFA 1RGEA 3CCQ3 3GSPA 2P0MA 3LMLA 1A2VA 3X3ZA 4HAAA 1A2KA 2KF3A 3X40A 2SBLA 3URPA 3G6E3 3NBJA 3CCL3 2Z76A 3EBYA 3A5EA 1LQMB 1WTHA 3GRDA 2QEX3 2HMNB 2W9QA 1AV4A 2C11A 3OXAA 3SXXA 2L4VA 4HVNA 4RZMA 4GB5A 1AY7A 4TX4A 1T5YA 1YVBI 5IG0A 5M1AA 1BSCA 1Q824 1QVG2 1VQQA 1YHQ3 4FMCA 3GZBA 2W0QA 4BL3A 3KCHA 4X2OA 2CX1A 3MWZA 2CHCA 3SEDA 3DGYA 1I0VA 1BGSA 1R4YA 2OWPA 3CCE3 3OWSA 3TDGA 4R1KA 1FW7A 1C54A 1RCLA 3F14A 1KWIA 1VQ63 1B2XA 3JUNA 1GYBA 3ALAA 4RNZA 3DUKA 2W2CA 3NBBA 1ZGXA 3JUPA 2QIYA 3ROBA 3B8LA 1BU4A 1N9EA 1VQ93 5BVBA 5G2GA 5D83A 3S5CA 4EW5A 4FCJA 1RN1A 2E2TA 3B4OA 2GSPA 1MWUA 5G1LA 7RNTA 2Z77A 1CH0A 4H61A 5CK6A 1N8R4 2CFGA 2IUKA 2WOHA 2BHMA 3HIIA 3NX0A 1Q7HA 1OGXA 3LXUX 1I2EA 3IMAB 3ZFZA 2O9UX 2GU1A 4JRFA 2CK3H 2CFWA 4KFEA 1GY6A 5FGOA 3SYUA 5JPUA 1RRHA 1YI23 3LT8A 3B7CA 1RNTA 1UCIA 1UUGB 3EE1A 1RRLA 3HOHA 5IENA 3EC9A 2OTJ3 1PU4A 1WNHA 2Y73A 3CCS3 2HMKB 2K0MA 4J9AA 4AEQA 1PFPA 4N6TA 1TUHA 5IG3A 1D6ZA 1JKGA 1RGHA 2M7OA 1UW1A 4MMYB 1BOXA 1EUIC 3KZTA 4X2HA 1A2PA 2XSHB 3A76A 1YGEA 3VGNA 2B24B 3UJMA 3V92A 1QVF2 1BNGA 3NXJA 2P38A 1YJN3 5CLKA 3MPHA 1TTOA 3BNCA 4NREA 1BRKA 2KAAA 2GBXB 1ROAA 3DGNA 3MG2A 5M19A 3MSOA 2YFLB 1O7MB 3UNLA 1B2MA 1W6CA 1JN5B 2R41A 5CF2A 5EEOA 2XH9A 1DYUA 1NO3A 3S28A 3STDA 4BTXA 3ZG0A 1FGRA 1I3FA 1W6YA 2L1SA 2V1LA 3NV0A 1KC84 5RNTA 1BSAA 1ISKA 1LXEA 3BNEA 4BTWA 5KP1A 5DRVA 1DETA 1RLSA 1FGOA 2Z6BA 1UCKA 1W01A 3LH4A 4O02B 1JV2B 1X1WA 3X3XA 2HMJB 3QK9A 1UDII 1HKXA 2E2VA 3CC23 4HM1B 1HZ1A 3I553 1YIJ3 4FMDA 3OWUA 1IDPA 4XBXA 1LOWA 3S67A 3F7XA 1N5PA 3LYGA 4LEHA 4BIRA 2UX0A 2ZL8A 1O7PB 3BU4A 4BTYA 1J2BA 1GMPA 4EV5A 1BANA 3KSED 4NPBA 1JBSA 2W6JH 1RDSA 1YGWA 1WQLB 4LZIA 4HM3B 3FF2A 1B20A 1EG9B 4FCZA 3UB1A 2KXGA 2XFTA 1AVLA 1LNHA 3DH2A 1Y4KA 2INXA 1TFOA 3CXC2 2K3DA 1FUTA 7GSPA 1BSBA 1VQP3 1GY7A 4LSOA 1GOYA 5KP4A 4I4KA 1FUWA 1BNRA 3LTAA 1FUSA 1W4NA 4WYKB 2CIUA 1BUJA 1OACA 3HK4A 2IA7A 4R9LA 2P0XA 1BAOA 2AADA 3NHXA 5GSPA 3K7CA 4I5QA 4IT7A 2WGQA 1YJW3 1AVKA 4G1MB 3FG1A 1BNSA 4LGQA 5HGRA 1G0TA 1G96A 1LNIA 3CNXA 2ML5A 3S27A 2HMMB 3E99A 1G02A 3WDGB 1X1UA 1YNVX 1GSPA 1KSIA 1W5ZA 1NNVA 3RGRA 3U1WA 4KVHA 1Q40A 5G1KA 4EC6A 5D81A 1IVXA 1O7WB 2XFSA 2XGNA 4U13A 2BIRA 2RGQA 5IF6A 1IQXA 3KFQC 1JJ22 1F8NA 2ZHXB 3F9SA 1LOXA 2LYXA 3CD63 3D5GA 1AR0A 3LT9A 1DVDA 2KF6A 1A67A 5EVHA 1BRSA 1W7CA 4N6LA 5AIIA 3WOFB 4GL6A 1FZUA 3EQQB 1OPYA 5D82A 1U8CB 5ELUA 2BMQB 1T2IA 4MJDA 7STDA 4O2HA 4HBRA 3BLZA 3D4AA 1PYLA 2GBWB 3N9HA 1O7GB 1OHPA 1RSNA 2F99A 1TRQA 1UCLA 2RFRA 2W56A 3CMA3 3FSDA 2CFKA 3IJEB 1YVSA 1PY3A 1NB3I 2LQVA 3DGOA 3KN4A 2XR8B 3PS8A 4Q53A 4EYCA 1JN5A 1VZZA 2OOVA 1VQ53 1X1XA 1A90A 2BNGA 2IMJA 4KFDA 1HYFA 3FZWA 1GD4A 4OK0A 3SOAA 4CDLA 1VQ73 1EQKA 1QAFA 3D79A 3Q2PA 1KD14 2OCTA 3MKIA 5KP3A 4XBYA 4HYZA 3GAXA 1EEJA 3D5IA 3AMOB 1ZX2A 1RJOA 3FCSB 4KT3B 1U5OA 4RNYA 5LC7A 1UGIA 3OW22 2Q07A 3AGOA 2OTL3 1OF5B 1O7HB 3EJVA 1LVNA 1JZOA 1T2HA 3PZWA 1SARA 3NBRA 3NM2A 3WR2A 4N6NB 1S5AA 3NQZA 1V57A 4GHOA 3GZXB 2UGIA 3CCM3 3CCR3 3ECFA 1D6UA 3B4PA 5LC6A 1RGAA 2F4YA 1W2ZA 1MWRA 5IERA 1GMRA 1NWWA 2CKFB 1TIJA 1STFI 5CF1A 4R4KA 2CH9A 1UGHI 4L7KA 3T8UA 1IVUA 4MEIA 1B2ZA 3T0UA 3BNDA 3SX1A 3N8BA 4STDA 4PEJA 4WYKA 1LOYA 1IK3A 4RNTA 1Q864 1N9JA 1WMPA 1E3VA 1MWSA 3AGNA 1L5GB 1RGKA 3DGMA 1IV7A 3FKAA 2XGLA 1CEWI 3U97A 1UCJA 3NM7A 4R80A 4JF8A 3FLJA 5AIHA 3CC43 2XRXB 4LYLB 4XDWA 1DMMA 1TFKA 3WA2X 6GSPA 2CC3A 1RTUA 2ML6A 1IVWA 4L8OA 1OGZA 5BU4A 1ZO2A 2W9PA 1K41A 3AHSA 1X1YA 3DMCA 2P09A 5BIRA 3DZLA 2BMRB 4XDVA 1SQWA 1DVCA 1VQL3 3D9RA 4HM8B 2CG1A 1BIRA 3L0RA 3G8ZA 3NQYA 1BSEA 4OUQA 3FH1A 3EN8A 1GY5A 1NU3A 2JQ5A 1Z1SA 3EBTA 1W6GA 4HZ9B 3VF1A 1CYUA 3I563 1B2UA 2C10A 4QWTA 2W03A 3LZAA 4CPKA 1FGQA 2K54A 5EQLA 4CCVA 2BT3A 1ASKA 2CWVA 1BRIA 2GEXA 5IG5A 1BRNL 1FYSA 4WWUC 2F98A 1O7NB 1UUWB 1MOLA 5IW9A 1MNLA 3IPTA 2WO0A 2O3OA 2CWUA 1OH0A 3CNMA 3FGYA 3PCRA 5CXOA 4EBGA 1IQYA 2I9WA 3JUMA 3VSYA 3G16A 4WP5A 1JKGB 1BNIA 4WHAA 3JUQA 4O8SA 1GOVA 3K0ZA 2KF5A 2STDA 3MG3A 3O8YA 1IQ8A 4WFOA 1ZS7A 1IU7A 3WODG 1OHOA 4BU4A 1Q814 1VQ43 2CFDA 2W04A 1OCVA 3SLUA 1JB4A 2D1WA 4XM4A 4L8PA 2PZVA 1EA2A 1N5HA 4N6V0 5JPPA 4J5KA 1QMAA 4O3VA 2F5WA 4AKZA 1BNFA 3EHCA 2XF3A 3HX8A 4J8TA 5IG4A 3H51A 2D42A 2KCDA 2QGUA 1ROVA 1Q42A 2YFIB 1SJWA 8RNTA 3GZYB 1SIIA 3Q3FA 3RGAA 3AHWA 3LOYA 4MMXB 4DKIA 1B3SA 2WOFA 1CYVA 1UI8A 3K9MC 3NV0B 4J5GA 1ULIB 2PNCA 3BNBA 2OQEA 3RDEA 1I8VA 1RN7A 1JBRA 3M8CA 1TU5A 1NDOB 3SOYA 2XEPA 4FCMA 5AIFA 1IV9A 3F8HA 1RKYA 3H3HA 1TRPA 2KF4A 1K9M4 1SIHA 3Q90A 1TP6A 2BMOB 4IIAA 3WOEB 1GD3A 1IVVA 1EKMA 4HM4B 4HOHA 5IEPA 3OWYA 4FR9A 3S29A 6STDA 2RCDA 1W00A 2GU3A 2AAEA 6RNTA 1VQ83 3CME3 5M18A 3JVCA 4EXRA 3DY5A 2CFLA 3CCJ3 2WGOA 5DREA 1LRAA 1NJI4 3CPW2 1UI7A 3PYJA 1GMQA 3PXMA 1T3BA 2J8XB 1MGWA 4XBTA 2UUGC 1RGLA 3T8NA 4IPBA 4XB5A 3K5TA 1ULJB 2Z7AA 4HM2B 2MC8A 1FGTA 2A15A 2JDIH 3MYTA 1E97A 1HU9A 4HJLB 1BNJA 5HOHA 4HZBB 4K90B 3RNTA 1QJGA 2RBIA 1KQS2 1WMNA 1CQSA 1FA3A 1JB2A 2CW9A 3DGLA 3X3YA 3HI7A 3X41A 1BRHA 2FXTA 5IEOA 1OHSA 1BNEA
chains in the Genus database with same CATH topology
1BNRA 1AQZA 1RTUA 1FUSA 1BSCA 1BUJA 5BU4A 9RNTA 1BAOA 2AADA 1X1YA 3AHSA 5GSPA 5BIRA 1IYYA 3KCHA 1RN4A 1BVIA 3DGYA 1BNSA 1I0VA 1BGSA 1LNIA 1R4YA 2SARA 1BIRA 1LOVA 2RNTA 1BSEA 1G02A 1X1UA 1FW7A 1YNVX 1C54A 1GSPA 1RCLA 2BU4A 1B21A 1B2XA 2ZA4A 1RCKA 1B2UA 1ZGXA 1BU4A 3WHOA 3BIRA 1BRIA 1BRNL 1FYSA 2BIRA 1RN1A 6GSPA 1GOUA 2GSPA 1RGFA 7RNTA 1CH0A 3D5GA 2KF6A 2F56A 2F5MA 1I70A 1BRSA 1BNIA 1JBTA 1FZUA 1GOVA 1I2EA 2KF5A 1T2IA 1RHLA 3SYUA 1BSDA 1B2SA 4BU4A 1RNTA 1UCIA 3HOHA 3D4AA 1PYLA 1RSNA 1MGRA 2HOHA 4J5KA 1TRQA 1UCLA 1BNFA 2F5WA 1RGHA 1BOXA 1A2PA 1RMSA 1YVSA 1PY3A 1BRGA 8RNTA 1BNGA 1X1XA 3Q3FA 3AHWA 1RNBA 1B3SA 1HYFA 1I3IA 1RGCA 1B27A 1TTOA 1BRKA 2KAAA 4J5GA 1I8VA 3D5IA 1JBRA 1B2MA 2C4BA 1TRPA 2KF4A 3AGOA 1I3FA 1I2FA 1T2HA 5RNTA 4HOHA 1BSAA 1SARA 2AAEA 3WR2A 6RNTA 1DETA 1Q9EA 1RGGA 1I2GA 1RLSA 1DE3A 1UCKA 4GHOA 1X1WA 1LRAA 1BRJA 1HZ1A 1RGAA 1GMQA 2F4YA 1LOWA 1MGWA 1RGLA 1GMRA 4BIRA 3BU4A 1GMPA 1I0XA 4GSPA 1BANA 1JBSA 1B2ZA 1RGEA 1RDSA 1YGWA 3GSPA 1BNJA 1LOYA 5HOHA 4RNTA 1B20A 3DH2A 4HAAA 2RBIA 2KF3A 3RNTA 3AGNA 3URPA 1RGKA 3A5EA 1FUTA 1UCJA 7GSPA 1BRHA 1BSBA 1GOYA 1BNEA 1AY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNR A;  1AQZ A;  1RTU A;  1FUS A;  1BSC A;  1BUJ A;  5BU4 A;  9RNT A;  1BAO A;  2AAD A;  1X1Y A;  3AHS A;  5GSP A;  5BIR A;  1IYY A;  3KCH A;  1RN4 A;  1BVI A;  3DGY A;  1BNS A;  1I0V A;  1BGS A;  1LNI A;  1R4Y A;  2SAR A;  1BIR A;  1LOV A;  2RNT A;  1BSE A;  1G02 A;  1X1U A;  1FW7 A;  1YNV X;  1C54 A;  1GSP A;  1RCL A;  2BU4 A;  1B21 A;  1B2X A;  2ZA4 A;  1RCK A;  1B2U A;  1ZGX A;  1BU4 A;  3WHO A;  3BIR A;  1BRI A;  1BRN L;  1FYS A;  2BIR A;  1RN1 A;  6GSP A;  1GOU A;  2GSP A;  1RGF A;  7RNT A;  1CH0 A;  3D5G A;  2KF6 A;  2F56 A;  2F5M A;  1I70 A;  1BRS A;  1BNI A;  1JBT A;  1FZU A;  1GOV A;  1I2E A;  2KF5 A;  1T2I A;  1RHL A;  3SYU A;  1BSD A;  1B2S A;  4BU4 A;  1RNT A;  1UCI A;  3HOH A;  3D4A A;  1PYL A;  1RSN A;  1MGR A;  2HOH A;  4J5K A;  1TRQ A;  1UCL A;  1BNF A;  2F5W A;  1RGH A;  1BOX A;  1A2P A;  1RMS A;  1YVS A;  1PY3 A;  1BRG A;  8RNT A;  1BNG A;  1X1X A;  3Q3F A;  3AHW A;  1RNB A;  1B3S A;  1HYF A;  1I3I A;  1RGC A;  1B27 A;  1TTO A;  1BRK A;  2KAA A;  4J5G A;  1I8V A;  3D5I A;  1JBR A;  1B2M A;  2C4B A;  1TRP A;  2KF4 A;  3AGO A;  1I3F A;  1I2F A;  1T2H A;  5RNT A;  4HOH A;  1BSA A;  1SAR A;  2AAE A;  3WR2 A;  6RNT A;  1DET A;  1Q9E A;  1RGG A;  1I2G A;  1RLS A;  1DE3 A;  1UCK A;  4GHO A;  1X1W A;  1LRA A;  1BRJ A;  1HZ1 A;  1RGA A;  1GMQ A;  2F4Y A;  1LOW A;  1MGW A;  1RGL A;  1GMR A;  4BIR A;  3BU4 A;  1GMP A;  1I0X A;  4GSP A;  1BAN A;  1JBS A;  1B2Z A;  1RGE A;  1RDS A;  1YGW A;  3GSP A;  1BNJ A;  1LOY A;  5HOH A;  4RNT A;  1B20 A;  3DH2 A;  4HAA A;  2RBI A;  2KF3 A;  3RNT A;  3AGN A;  3URP A;  1RGK A;  3A5E A;  1FUT A;  1UCJ A;  7GSP A;  1BRH A;  1BSB A;  1GOY A;  1BNE A;  1AY7 A; 
#chains in the Genus database with same CATH topology
 3X42 A;  2HMO B;  1AQZ A;  4HM0 B;  3GZR A;  2F86 B;  1M1X B;  2H0H A;  2KRT A;  5ELJ A;  4EV2 A;  3FF0 A;  1UUV B;  4K1U A;  9RNT A;  1S72 3;  1IYY A;  2Y74 A;  1Q40 B;  1YIT 3;  1RN4 A;  3HZP A;  1BVI A;  2YFJ B;  4R9K A;  3CCV 3;  3DM8 A;  4N6O B;  4FMA A;  2SAR A;  4BL2 A;  1LOV A;  2RNT A;  3D3L A;  3SVA A;  2GXF A;  1MWT A;  3LTC A;  3LTD A;  2BU4 A;  1B21 A;  2ZA4 A;  1WMO A;  1OUN A;  1RCK A;  3K63 A;  3MG1 A;  4CJN A;  1E3R A;  2GEY A;  2CG0 A;  1R4C A;  1QAK A;  1GS3 A;  3BIR A;  3WHO A;  5AYS C;  2OQE C;  3F40 A;  5A0O B;  3G4S 3;  4OVM A;  1GOU A;  1STD A;  3V99 A;  1RGF A;  4H3U A;  1W2B 2;  3PCS A;  3DXO A;  1DMQ A;  4K1V A;  3QRD A;  1JRQ A;  4HKV B;  2QA4 3;  2IY2 A;  1M9G A;  2H0I A;  4HM5 B;  3ER7 A;  5I97 A;  3FG3 A;  2F56 A;  2F5M A;  5JBS A;  1I70 A;  4N6M A;  3J7Y d;  2W56 B;  4KFF A;  1JBT A;  5TGN A;  4ORL A;  1M1K 4;  4FMB A;  4ZM8 A;  1RHL A;  1JNQ A;  3OX9 A;  1BSD A;  1B2S A;  3CU3 A;  2IYJ A;  3G0K A;  4NHF A;  5AI1 A;  3UL6 A;  2FNQ A;  3CPO A;  2OOV C;  3NUV A;  3KSP A;  1FGM A;  3BB9 A;  3EN1 B;  2RSX A;  1VQM 3;  1MGR A;  2FGT A;  1BUQ A;  2HOH A;  2IUJ A;  4N3V A;  3EB8 A;  4N6U A;  1RMS A;  3KII A;  3KKG A;  2H0G A;  1BRG A;  3JUO A;  1VQK 3;  1TJD A;  1DMN A;  1RNB A;  1W02 A;  3GWR A;  3WA3 A;  3Q1C A;  3KE7 A;  1IT7 A;  2CWT A;  1I3I A;  1RGC A;  5FW5 A;  1K73 4;  1B27 A;  1JB5 A;  2MF7 A;  4KZ1 A;  3LTB A;  1IT8 A;  5AEU B;  2XSO B;  4AKY A;  3CC7 3;  1YJ9 3;  3UL5 A;  2C4B A;  1V74 A;  1N8Q A;  1Q7Y 4;  3HIG A;  1K28 A;  1JZD A;  3EF8 A;  3V98 A;  2R4I A;  2E2U A;  2HML B;  1I2F A;  4LMI A;  3EX9 A;  3MHE A;  1D6Y A;  3CCU 3;  2YX9 A;  4HM7 B;  5AIG A;  4MMZ B;  1QAL A;  3FG4 A;  1K8A 4;  1NB5 I;  4K61 A;  3I0Y A;  1Q9E A;  5STD A;  1RGG A;  1I2G A;  3AMO A;  1VQN 3;  1DE3 A;  3ZG5 A;  3OV4 A;  5AYR B;  3F8X A;  4RBN A;  3WMD A;  1BRJ A;  5BXQ A;  1M90 4;  1OF5 A;  3G71 3;  1SPU A;  2B1X B;  1LQG C;  3F7S A;  1V58 A;  2BO9 B;  5AEW B;  8CHO A;  2P05 A;  3PGB A;  1VQO 3;  1I0X A;  1C7H A;  2CX0 A;  1US1 A;  4GSP A;  2ZDJ A;  3N54 B;  4HM6 B;  4ILF A;  1RGE A;  3CCQ 3;  3GSP A;  2P0M A;  3LML A;  1A2V A;  3X3Z A;  4HAA A;  1A2K A;  2KF3 A;  3X40 A;  2SBL A;  3URP A;  3G6E 3;  3NBJ A;  3CCL 3;  2Z76 A;  3EBY A;  3A5E A;  1LQM B;  1WTH A;  3GRD A;  2QEX 3;  2HMN B;  2W9Q A;  1AV4 A;  2C11 A;  3OXA A;  3SXX A;  2L4V A;  4HVN A;  4RZM A;  4GB5 A;  1AY7 A;  4TX4 A;  1T5Y A;  1YVB I;  5IG0 A;  5M1A A;  1BSC A;  1Q82 4;  1QVG 2;  1VQQ A;  1YHQ 3;  4FMC A;  3GZB A;  2W0Q A;  4BL3 A;  3KCH A;  4X2O A;  2CX1 A;  3MWZ A;  2CHC A;  3SED A;  3DGY A;  1I0V A;  1BGS A;  1R4Y A;  2OWP A;  3CCE 3;  3OWS A;  3TDG A;  4R1K A;  1FW7 A;  1C54 A;  1RCL A;  3F14 A;  1KWI A;  1VQ6 3;  1B2X A;  3JUN A;  1GYB A;  3ALA A;  4RNZ A;  3DUK A;  2W2C A;  3NBB A;  1ZGX A;  3JUP A;  2QIY A;  3ROB A;  3B8L A;  1BU4 A;  1N9E A;  1VQ9 3;  5BVB A;  5G2G A;  5D83 A;  3S5C A;  4EW5 A;  4FCJ A;  1RN1 A;  2E2T A;  3B4O A;  2GSP A;  1MWU A;  5G1L A;  7RNT A;  2Z77 A;  1CH0 A;  4H61 A;  5CK6 A;  1N8R 4;  2CFG A;  2IUK A;  2WOH A;  2BHM A;  3HII A;  3NX0 A;  1Q7H A;  1OGX A;  3LXU X;  1I2E A;  3IMA B;  3ZFZ A;  2O9U X;  2GU1 A;  4JRF A;  2CK3 H;  2CFW A;  4KFE A;  1GY6 A;  5FGO A;  3SYU A;  5JPU A;  1RRH A;  1YI2 3;  3LT8 A;  3B7C A;  1RNT A;  1UCI A;  1UUG B;  3EE1 A;  1RRL A;  3HOH A;  5IEN A;  3EC9 A;  2OTJ 3;  1PU4 A;  1WNH A;  2Y73 A;  3CCS 3;  2HMK B;  2K0M A;  4J9A A;  4AEQ A;  1PFP A;  4N6T A;  1TUH A;  5IG3 A;  1D6Z A;  1JKG A;  1RGH A;  2M7O A;  1UW1 A;  4MMY B;  1BOX A;  1EUI C;  3KZT A;  4X2H A;  1A2P A;  2XSH B;  3A76 A;  1YGE A;  3VGN A;  2B24 B;  3UJM A;  3V92 A;  1QVF 2;  1BNG A;  3NXJ A;  2P38 A;  1YJN 3;  5CLK A;  3MPH A;  1TTO A;  3BNC A;  4NRE A;  1BRK A;  2KAA A;  2GBX B;  1ROA A;  3DGN A;  3MG2 A;  5M19 A;  3MSO A;  2YFL B;  1O7M B;  3UNL A;  1B2M A;  1W6C A;  1JN5 B;  2R41 A;  5CF2 A;  5EEO A;  2XH9 A;  1DYU A;  1NO3 A;  3S28 A;  3STD A;  4BTX A;  3ZG0 A;  1FGR A;  1I3F A;  1W6Y A;  2L1S A;  2V1L A;  3NV0 A;  1KC8 4;  5RNT A;  1BSA A;  1ISK A;  1LXE A;  3BNE A;  4BTW A;  5KP1 A;  5DRV A;  1DET A;  1RLS A;  1FGO A;  2Z6B A;  1UCK A;  1W01 A;  3LH4 A;  4O02 B;  1JV2 B;  1X1W A;  3X3X A;  2HMJ B;  3QK9 A;  1UDI I;  1HKX A;  2E2V A;  3CC2 3;  4HM1 B;  1HZ1 A;  3I55 3;  1YIJ 3;  4FMD A;  3OWU A;  1IDP A;  4XBX A;  1LOW A;  3S67 A;  3F7X A;  1N5P A;  3LYG A;  4LEH A;  4BIR A;  2UX0 A;  2ZL8 A;  1O7P B;  3BU4 A;  4BTY A;  1J2B A;  1GMP A;  4EV5 A;  1BAN A;  3KSE D;  4NPB A;  1JBS A;  2W6J H;  1RDS A;  1YGW A;  1WQL B;  4LZI A;  4HM3 B;  3FF2 A;  1B20 A;  1EG9 B;  4FCZ A;  3UB1 A;  2KXG A;  2XFT A;  1AVL A;  1LNH A;  3DH2 A;  1Y4K A;  2INX A;  1TFO A;  3CXC 2;  2K3D A;  1FUT A;  7GSP A;  1BSB A;  1VQP 3;  1GY7 A;  4LSO A;  1GOY A;  5KP4 A;  4I4K A;  1FUW A;  1BNR A;  3LTA A;  1FUS A;  1W4N A;  4WYK B;  2CIU A;  1BUJ A;  1OAC A;  3HK4 A;  2IA7 A;  4R9L A;  2P0X A;  1BAO A;  2AAD A;  3NHX A;  5GSP A;  3K7C A;  4I5Q A;  4IT7 A;  2WGQ A;  1YJW 3;  1AVK A;  4G1M B;  3FG1 A;  1BNS A;  4LGQ A;  5HGR A;  1G0T A;  1G96 A;  1LNI A;  3CNX A;  2ML5 A;  3S27 A;  2HMM B;  3E99 A;  1G02 A;  3WDG B;  1X1U A;  1YNV X;  1GSP A;  1KSI A;  1W5Z A;  1NNV A;  3RGR A;  3U1W A;  4KVH A;  1Q40 A;  5G1K A;  4EC6 A;  5D81 A;  1IVX A;  1O7W B;  2XFS A;  2XGN A;  4U13 A;  2BIR A;  2RGQ A;  5IF6 A;  1IQX A;  3KFQ C;  1JJ2 2;  1F8N A;  2ZHX B;  3F9S A;  1LOX A;  2LYX A;  3CD6 3;  3D5G A;  1AR0 A;  3LT9 A;  1DVD A;  2KF6 A;  1A67 A;  5EVH A;  1BRS A;  1W7C A;  4N6L A;  5AII A;  3WOF B;  4GL6 A;  1FZU A;  3EQQ B;  1OPY A;  5D82 A;  1U8C B;  5ELU A;  2BMQ B;  1T2I A;  4MJD A;  7STD A;  4O2H A;  4HBR A;  3BLZ A;  3D4A A;  1PYL A;  2GBW B;  3N9H A;  1O7G B;  1OHP A;  1RSN A;  2F99 A;  1TRQ A;  1UCL A;  2RFR A;  2W56 A;  3CMA 3;  3FSD A;  2CFK A;  3IJE B;  1YVS A;  1PY3 A;  1NB3 I;  2LQV A;  3DGO A;  3KN4 A;  2XR8 B;  3PS8 A;  4Q53 A;  4EYC A;  1JN5 A;  1VZZ A;  2OOV A;  1VQ5 3;  1X1X A;  1A90 A;  2BNG A;  2IMJ A;  4KFD A;  1HYF A;  3FZW A;  1GD4 A;  4OK0 A;  3SOA A;  4CDL A;  1VQ7 3;  1EQK A;  1QAF A;  3D79 A;  3Q2P A;  1KD1 4;  2OCT A;  3MKI A;  5KP3 A;  4XBY A;  4HYZ A;  3GAX A;  1EEJ A;  3D5I A;  3AMO B;  1ZX2 A;  1RJO A;  3FCS B;  4KT3 B;  1U5O A;  4RNY A;  5LC7 A;  1UGI A;  3OW2 2;  2Q07 A;  3AGO A;  2OTL 3;  1OF5 B;  1O7H B;  3EJV A;  1LVN A;  1JZO A;  1T2H A;  3PZW A;  1SAR A;  3NBR A;  3NM2 A;  3WR2 A;  4N6N B;  1S5A A;  3NQZ A;  1V57 A;  4GHO A;  3GZX B;  2UGI A;  3CCM 3;  3CCR 3;  3ECF A;  1D6U A;  3B4P A;  5LC6 A;  1RGA A;  2F4Y A;  1W2Z A;  1MWR A;  5IER A;  1GMR A;  1NWW A;  2CKF B;  1TIJ A;  1STF I;  5CF1 A;  4R4K A;  2CH9 A;  1UGH I;  4L7K A;  3T8U A;  1IVU A;  4MEI A;  1B2Z A;  3T0U A;  3BND A;  3SX1 A;  3N8B A;  4STD A;  4PEJ A;  4WYK A;  1LOY A;  1IK3 A;  4RNT A;  1Q86 4;  1N9J A;  1WMP A;  1E3V A;  1MWS A;  3AGN A;  1L5G B;  1RGK A;  3DGM A;  1IV7 A;  3FKA A;  2XGL A;  1CEW I;  3U97 A;  1UCJ A;  3NM7 A;  4R80 A;  4JF8 A;  3FLJ A;  5AIH A;  3CC4 3;  2XRX B;  4LYL B;  4XDW A;  1DMM A;  1TFK A;  3WA2 X;  6GSP A;  2CC3 A;  1RTU A;  2ML6 A;  1IVW A;  4L8O A;  1OGZ A;  5BU4 A;  1ZO2 A;  2W9P A;  1K41 A;  3AHS A;  1X1Y A;  3DMC A;  2P09 A;  5BIR A;  3DZL A;  2BMR B;  4XDV A;  1SQW A;  1DVC A;  1VQL 3;  3D9R A;  4HM8 B;  2CG1 A;  1BIR A;  3L0R A;  3G8Z A;  3NQY A;  1BSE A;  4OUQ A;  3FH1 A;  3EN8 A;  1GY5 A;  1NU3 A;  2JQ5 A;  1Z1S A;  3EBT A;  1W6G A;  4HZ9 B;  3VF1 A;  1CYU A;  3I56 3;  1B2U A;  2C10 A;  4QWT A;  2W03 A;  3LZA A;  4CPK A;  1FGQ A;  2K54 A;  5EQL A;  4CCV A;  2BT3 A;  1ASK A;  2CWV A;  1BRI A;  2GEX A;  5IG5 A;  1BRN L;  1FYS A;  4WWU C;  2F98 A;  1O7N B;  1UUW B;  1MOL A;  5IW9 A;  1MNL A;  3IPT A;  2WO0 A;  2O3O A;  2CWU A;  1OH0 A;  3CNM A;  3FGY A;  3PCR A;  5CXO A;  4EBG A;  1IQY A;  2I9W A;  3JUM A;  3VSY A;  3G16 A;  4WP5 A;  1JKG B;  1BNI A;  4WHA A;  3JUQ A;  4O8S A;  1GOV A;  3K0Z A;  2KF5 A;  2STD A;  3MG3 A;  3O8Y A;  1IQ8 A;  4WFO A;  1ZS7 A;  1IU7 A;  3WOD G;  1OHO A;  4BU4 A;  1Q81 4;  1VQ4 3;  2CFD A;  2W04 A;  1OCV A;  3SLU A;  1JB4 A;  2D1W A;  4XM4 A;  4L8P A;  2PZV A;  1EA2 A;  1N5H A;  4N6V 0;  5JPP A;  4J5K A;  1QMA A;  4O3V A;  2F5W A;  4AKZ A;  1BNF A;  3EHC A;  2XF3 A;  3HX8 A;  4J8T A;  5IG4 A;  3H51 A;  2D42 A;  2KCD A;  2QGU A;  1ROV A;  1Q42 A;  2YFI B;  1SJW A;  8RNT A;  3GZY B;  1SII A;  3Q3F A;  3RGA A;  3AHW A;  3LOY A;  4MMX B;  4DKI A;  1B3S A;  2WOF A;  1CYV A;  1UI8 A;  3K9M C;  3NV0 B;  4J5G A;  1ULI B;  2PNC A;  3BNB A;  2OQE A;  3RDE A;  1I8V A;  1RN7 A;  1JBR A;  3M8C A;  1TU5 A;  1NDO B;  3SOY A;  2XEP A;  4FCM A;  5AIF A;  1IV9 A;  3F8H A;  1RKY A;  3H3H A;  1TRP A;  2KF4 A;  1K9M 4;  1SIH A;  3Q90 A;  1TP6 A;  2BMO B;  4IIA A;  3WOE B;  1GD3 A;  1IVV A;  1EKM A;  4HM4 B;  4HOH A;  5IEP A;  3OWY A;  4FR9 A;  3S29 A;  6STD A;  2RCD A;  1W00 A;  2GU3 A;  2AAE A;  6RNT A;  1VQ8 3;  3CME 3;  5M18 A;  3JVC A;  4EXR A;  3DY5 A;  2CFL A;  3CCJ 3;  2WGO A;  5DRE A;  1LRA A;  1NJI 4;  3CPW 2;  1UI7 A;  3PYJ A;  1GMQ A;  3PXM A;  1T3B A;  2J8X B;  1MGW A;  4XBT A;  2UUG C;  1RGL A;  3T8N A;  4IPB A;  4XB5 A;  3K5T A;  1ULJ B;  2Z7A A;  4HM2 B;  2MC8 A;  1FGT A;  2A15 A;  2JDI H;  3MYT A;  1E97 A;  1HU9 A;  4HJL B;  1BNJ A;  5HOH A;  4HZB B;  4K90 B;  3RNT A;  1QJG A;  2RBI A;  1KQS 2;  1WMN A;  1CQS A;  1FA3 A;  1JB2 A;  2CW9 A;  3DGL A;  3X3Y A;  3HI7 A;  3X41 A;  1BRH A;  2FXT A;  5IEO A;  1OHS A;  1BNE A; 
#chains in the Genus database with same CATH homology
 1BNR A;  1AQZ A;  1RTU A;  1FUS A;  1BSC A;  1BUJ A;  5BU4 A;  9RNT A;  1BAO A;  2AAD A;  1X1Y A;  3AHS A;  5GSP A;  5BIR A;  1IYY A;  3KCH A;  1RN4 A;  1BVI A;  3DGY A;  1BNS A;  1I0V A;  1BGS A;  1LNI A;  1R4Y A;  2SAR A;  1BIR A;  1LOV A;  2RNT A;  1BSE A;  1G02 A;  1X1U A;  1FW7 A;  1YNV X;  1C54 A;  1GSP A;  1RCL A;  2BU4 A;  1B21 A;  1B2X A;  2ZA4 A;  1RCK A;  1B2U A;  1ZGX A;  1BU4 A;  3WHO A;  3BIR A;  1BRI A;  1BRN L;  1FYS A;  2BIR A;  1RN1 A;  6GSP A;  1GOU A;  2GSP A;  1RGF A;  7RNT A;  1CH0 A;  3D5G A;  2KF6 A;  2F56 A;  2F5M A;  1I70 A;  1BRS A;  1BNI A;  1JBT A;  1FZU A;  1GOV A;  1I2E A;  2KF5 A;  1T2I A;  1RHL A;  3SYU A;  1BSD A;  1B2S A;  4BU4 A;  1RNT A;  1UCI A;  3HOH A;  3D4A A;  1PYL A;  1RSN A;  1MGR A;  2HOH A;  4J5K A;  1TRQ A;  1UCL A;  1BNF A;  2F5W A;  1RGH A;  1BOX A;  1A2P A;  1RMS A;  1YVS A;  1PY3 A;  1BRG A;  8RNT A;  1BNG A;  1X1X A;  3Q3F A;  3AHW A;  1RNB A;  1B3S A;  1HYF A;  1I3I A;  1RGC A;  1B27 A;  1TTO A;  1BRK A;  2KAA A;  4J5G A;  1I8V A;  3D5I A;  1JBR A;  1B2M A;  2C4B A;  1TRP A;  2KF4 A;  3AGO A;  1I3F A;  1I2F A;  1T2H A;  5RNT A;  4HOH A;  1BSA A;  1SAR A;  2AAE A;  3WR2 A;  6RNT A;  1DET A;  1Q9E A;  1RGG A;  1I2G A;  1RLS A;  1DE3 A;  1UCK A;  4GHO A;  1X1W A;  1LRA A;  1BRJ A;  1HZ1 A;  1RGA A;  1GMQ A;  2F4Y A;  1LOW A;  1MGW A;  1RGL A;  1GMR A;  4BIR A;  3BU4 A;  1GMP A;  1I0X A;  4GSP A;  1BAN A;  1JBS A;  1B2Z A;  1RGE A;  1RDS A;  1YGW A;  3GSP A;  1BNJ A;  1LOY A;  5HOH A;  4RNT A;  1B20 A;  3DH2 A;  4HAA A;  2RBI A;  2KF3 A;  3RNT A;  3AGN A;  3URP A;  1RGK A;  3A5E A;  1FUT A;  1UCJ A;  7GSP A;  1BRH A;  1BSB A;  1GOY A;  1BNE A;  1AY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...