3A5EA

Crystal structure of 5k rnase sa
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
96
structure length
96
Chain Sequence
b'KVSGTVCLSALPPEATKTLNLIASKGPFPYSQDGVVFQNRKSVLPTQSYGYYHEYTVITPGARTRGTRRIITGKATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanyl-specific ribonuclease Sa
publication title Urea denatured state ensembles contain extensive secondary structure that is increased in hydrophobic proteins
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 25
structure length 96
sequence length 96
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3a5eA00
3D5IA 1BSEA 4J5KA 2KF5A 1R4YA 1TRPA 7GSPA 2RNTA 1BRKA 1CH0A 2KAAA 3AHSA 1BRNL 2HOHA 1RNBA 1BU4A 1I2FA 2AAEA 1BVIA 1C54A 1RMSA 2C4BA 1RLSA 1AQZA 1B2MA 1BAOA 4RNTA 1FUSA 1RGCA 1RCLA 1BNGA 1I3IA 1GMPA 3DH2A 1GOUA 3DGYA 1B2XA 3SYUA 1X1WA 4GHOA 5GSPA 2BU4A 1I0VA 5HOHA 1FUTA 2F4YA 1B3SA 6RNTA 1RGHA 8RNTA 1UCLA 1I70A 1RGLA 1IYYA 1UCKA 1UCJA 1SARA 1BSBA 1G02A 2F5WA 1RGGA 3Q3FA 2F5MA 1BRIA 1GMRA 4GSPA 1YVSA 1JBTA 1BSAA 1FYSA 1PY3A 2KF3A 3D5GA 1LOVA 1BNSA 1RN1A 4BIRA 2AADA 1LOWA 2RBIA 1B27A 3HOHA 1YNVX 1UCIA 2BIRA 5RNTA 1BSCA 3WHOA 1RGFA 1RGKA 3RNTA 3BIRA 1BNEA 1B2ZA 1LNIA 1BNFA 1B2SA 1PYLA 1BNRA 3D4AA 1I8VA 1B2UA 4HOHA 1GOVA 2F56A 1FZUA 1MGRA 3WR2A 3BU4A 1RTUA 1LOYA 1I2EA 1TTOA 9RNTA 4BU4A 1DETA 5BU4A 1BNIA 1BRGA 1BGSA 1RN4A 1FW7A 1I2GA 1TRQA 1BRSA 1BRHA 1JBSA 3URPA 2KF6A 1BNJA 3KCHA 6GSPA 1HYFA 4HAAA 1RHLA 2KF4A 1GMQA 2GSPA 3A5EA 1T2HA 1ZGXA 1I3FA 5BIRA 1MGWA 1GSPA 1RGEA 1BRJA 1RCKA 4J5GA 1B20A 1X1XA 1HZ1A 1T2IA 1BSDA 1A2PA 3AGNA 1LRAA 1RGAA 1BUJA 1RDSA 1I0XA 3GSPA 1RNTA 1BANA 1GOYA 1JBRA 3AHWA 3AGOA 1B21A 1BOXA 1AY7A 1BIRA 1X1YA 1RSNA 1YGWA 2ZA4A 1Q9EA 7RNTA 1DE3A 2SARA 1X1UA
chains in the Genus database with same CATH superfamily
3LH4A 1TIJA 8CHOA 4HM0B 3NQYA 2KF5A 4HM1B 4WYKB 5DRVA 1ISKA 2FGTA 1UW1A 4N6MA 1ROAA 3AHSA 1QAKA 2CG0A 1JB5A 1BRNL 1VQO3 2HOHA 3EE1A 3FLJA 5KP4A 2GU1A 1RNBA 3HX8A 2FNQA 1DMMA 3MHEA 3WA2X 4X2OA 4R80A 5IG4A 2C4BA 3CU3A 4I4KA 5I97A 2FXTA 1BAOA 3FH1A 4RNTA 2Z76A 1FUSA 4NPBA 1RGCA 2HMJB 2XFTA 2PZVA 3DGYA 3EB8A 1B2XA 5ELJA 3CC43 2YFIB 3G8ZA 4EW5A 4WHAA 3BNCA 1FUTA 2F4YA 1OF5B 2P0XA 4MEIA 4XBXA 1A2VA 1QVG2 2H0HA 8RNTA 2E2VA 1AVLA 5AEWB 4KFDA 5FGOA 1AV4A 1IQ8A 3DZLA 2BMOB 3NV0A 1JB2A 4R1KA 2F98A 1IDPA 1TU5A 1IYYA 1UCJA 3LMLA 2OTL3 1SARA 3FGYA 3H51A 3HI7A 5DREA 4EBGA 1GMRA 1EQKA 1MWUA 3OWUA 4HYZA 1KD14 1Q40A 2W9PA 1LOVA 1UUWB 4IIAA 4RNYA 5FW5A 5CLKA 3Q1CA 2RBIA 3E99A 1YNVX 2WOHA 2OOVC 4K90B 1JRQA 3N9HA 4ZM8A 4RZMA 3WHOA 5BVBA 4XM4A 1HU9A 2YFJB 5IG3A 1K8A4 2HMNB 3RNTA 3EX9A 3LZAA 4FCZA 1IU7A 3D4AA 1RJOA 3DGMA 2W2CA 3MSOA 3DY5A 3HK4A 1FZUA 2JQ5A 1MGRA 3AMOB 3BU4A 1FUWA 1RTUA 4QWTA 1M1K4 1O7NB 3LT8A 3LTBA 9RNTA 1M9GA 2P05A 2XSOB 2OTJ3 2GEXA 4BTXA 3EBTA 2CWUA 4NHFA 1PFPA 2W0QA 2HMOB 2WOFA 1UUGB 4N6UA 5G1KA 2JDIH 5A0OB 5HGRA 1W6YA 4FMDA 4WP5A 2XGLA 3OV4A 3MYTA 3V99A 1RKYA 1HYFA 1VQP3 3PCRA 4H3UA 1D6YA 2GSPA 4HM3B 3N54B 4J8TA 3CCQ3 5BIRA 2CFKA 3CCS3 3L0RA 4X2HA 1F8NA 3IJEB 3LTDA 1MOLA 3K0ZA 1T2IA 3ER7A 1A2PA 1A67A 1VQK3 4MMZB 3X40A 1WMPA 2PNCA 3RDEA 1RNTA 1FGQA 3RGRA 1BANA 3H3HA 3K5TA 3AHWA 1ASKA 3F40A 3ECFA 1B21A 1FA3A 3T0UA 1S723 3F9SA 3JVCA 3RGAA 1YGWA 2RSXA 3HIGA 1DVCA 1FGMA 3F14A 1Q864 1E3RA 1Q7HA 3D5IA 2LYXA 2O3OA 1LNHA 1YVBI 2W56B 3GZYB 1NB3I 3GAXA 4J5KA 1TP6A 1R4YA 1IVWA 1D6UA 1T3BA 1S5AA 1WQLB 2CWVA 1TRPA 2E2UA 1SQWA 3LYGA 4LEHA 1OUNA 4O02B 3I0YA 5EQLA 2F86B 3SOYA 1GS3A 4K1UA 1VQ93 2CC3A 1O7GB 1V57A 2CW9A 2WGOA 1FGOA 4R9LA 1U8CB 1I2FA 3JUNA 2CFLA 3LOYA 5BXQA 1C54A 4CCVA 1A90A 4HBRA 4NREA 3WOFB 2HMMB 2B24B 2GBWB 5EVHA 1IV7A 2BNGA 1LVNA 3WDGB 2OQEC 1EUIC 1QALA 1DYUA 3DXOA 5AIFA 3JUPA 1MNLA 1X1WA 4CJNA 3BNEA 1LOXA 1R4CA 1WTHA 1I0VA 1N5HA 4JF8A 5HOHA 2BHMA 2L1SA 5IW9A 1YJ93 3QRDA 2YX9A 1OHPA 2KRTA 3KZTA 2UX0A 1O7HB 2WGQA 2QGUA 4OUQA 3CC23 1RRLA 3CPW2 3CMA3 2K3DA 5M18A 5IG5A 3T8NA 3GWRA 3FG3A 1G02A 3Q3FA 2KCDA 3U1WA 1BRIA 4L8OA 1IK3A 1TUHA 2UGIA 1JBTA 1FYSA 2KXGA 3IMAB 2XH9A 3NBJA 3DGNA 2AADA 4HKVB 3STDA 2CX0A 3HOHA 1IT7A 3OX9A 3S27A 3CCU3 3GRDA 4BTWA 2BIRA 1V74A 1WNHA 2W04A 2XF3A 3B4OA 3WA3A 1JN5A 3FG4A 3BIRA 4XB5A 3F7SA 1LNIA 5D82A 1BNRA 4GB5A 3K9MC 1B2UA 5KP1A 1NNVA 1YIJ3 3G0KA 3MWZA 3PGBA 2CH9A 3NX0A 1DMNA 2L4VA 4N6OB 1YJN3 1I2EA 1TTOA 4XBYA 5IENA 1K9M4 3G16A 1RN4A 4OVMA 3OWYA 2XSHB 1GY5A 1NU3A 3UJMA 3N8BA 4LGQA 3V92A 1JBSA 3URPA 4WYKA 2KF6A 1HKXA 3F7XA 1BNJA 3KSED 2CFDA 1MWRA 4K61A 4HZ9B 3J7Yd 1AVKA 3KCHA 3I553 4MMYB 2CG1A 6GSPA 3WOEB 1QJGA 3V98A 2RCDA 3ZG0A 1GMQA 4KZ1A 1ZGXA 4I5QA 2P0MA 5AI1A 3CCE3 3CC73 1Q814 1TFOA 1NO3A 1BRJA 2C10A 3PYJA 4EC6A 1CYVA 4J5GA 1HZ1A 1OHSA 3CCJ3 2IYJA 2C11A 4MMXB 4TX4A 3AGNA 3PS8A 5KP3A 2K0MA 1W6CA 3S5CA 2D42A 2Y73A 3F8HA 3X42A 4N6NB 1UUVB 4HM2B 1OF5A 2R4IA 1AR0A 1BOXA 2V1LA 3U97A 2QEX3 3B7CA 1BIRA 4AEQA 3CME3 3CNXA 3EHCA 5ELUA 1STFI 1US1A 2HMLB 1DE3A 3VF1A 1GY7A 2SARA 1SJWA 1VQ73 1KWIA 1QVF2 1Z1SA 3LTAA 3GZBA 4CPKA 1WMOA 1O7WB 4MJDA 5AYRB 3SLUA 1KQS2 3CCR3 1IV9A 1BRKA 2KAAA 3UL5A 1E97A 4HM4B 3ZFZA 1Q824 1VQL3 3BNDA 1GD4A 1W00A 1ZX2A 1PU4A 3JUQA 1VQQA 1O7MB 1W4NA 4RNZA 2XEPA 6STDA 1E3VA 3G4S3 1RMSA 1ROVA 2UUGC 1RLSA 3DUKA 2QIYA 1W7CA 1LQGC 2BMQB 4G1MB 3CPOA 4R4KA 1BNGA 1SPUA 3NQZA 1JNQA 1GMPA 1I3IA 2SBLA 3NM2A 4H61A 4JRFA 2MC8A 4LMIA 2M7OA 4XDWA 5D83A 4EYCA 2YFLB 1GYBA 1OACA 3AMOA 3GZRA 1JZDA 3NM7A 1JZOA 1B3SA 5IEPA 6RNTA 1RGHA 2K54A 4OK0A 1M904 4KVHA 1QAFA 2IY2A 4RBNA 1RGLA 4K1VA 4LZIA 4EV2A 4J9AA 1UCKA 1YGEA 4IT7A 1OHOA 1RGGA 5D81A 1MWTA 1JJ22 2F5MA 5CF2A 2MF7A 4GSPA 3ROBA 2XGNA 1W2B2 1DVDA 1BSAA 2KF3A 1PY3A 1RN1A 1DMQA 1RN7A 3JUOA 5M1AA 2GBXB 3K63A 3X41A 1NB5I 3MPHA 5AEUB 4HM7B 1UDII 1UCIA 1ULJB 5RNTA 4N6TA 1BSCA 3TDGA 1FGTA 3LTCA 3KE7A 4LYLB 3SVAA 1RGKA 3OXAA 1BNEA 1B2ZA 2GXFA 1BNFA 1B2SA 1PYLA 2CFGA 5LC7A 1W2ZA 1N8R4 4HOHA 2QA43 1ZO2A 4CDLA 2XRXB 3LXUX 1WMNA 2R41A 3KIIA 3F8XA 4HM6B 3HZPA 2Z7AA 1K734 2GEYA 3FCSB 2H0GA 4L7KA 4N3VA 4FMAA 1ZS7A 1Q42A 4BU4A 1DETA 1BNIA 3NV0B 1BRGA 1LXEA 1BGSA 3MG1A 2OQEA 1M1XB 3BNBA 3M8CA 1K41A 3Q90A 1TRQA 2W56A 5JPPA 1BRHA 2CKFB 1Y4KA 2IA7A 3EF8A 2RGQA 3LT9A 1G0TA 1EA2A 1Q40B 4PEJA 1ULIB 3DM8A 3FZWA 1G96A 4HAAA 2KF4A 3X3ZA 2O9UX 2P09A 3ALAA 3A5EA 1YJW3 3OWSA 3CCV3 3IPTA 1KSIA 1MGWA 5IEOA 3CCL3 3BLZA 1RGEA 2B1XB 1RCKA 3I563 1U5OA 1B20A 2ZDJA 3A76A 3EQQB 1LRAA 1J2BA 1BUJA 3EN8A 3D79A 3S28A 3KKGA 1BUQA 3GSPA 1EG9B 2Y74A 1GOYA 1STDA 2W9QA 4R9KA 1JV2B 3AGOA 1NJI4 1B2MA 1YIT3 1C7HA 1AY7A 3Q2PA 1RSNA 1W02A 1GD3A 3WODG 1OPYA 1RRHA 1UGHI 4ORLA 2ZL8A 4N6V0 2IMJA 1Q7Y4 1BSEA 3UNLA 1VQ53 3VSYA 1TJDA 2HMKB 4FMCA 4O3VA 2ML6A 2XR8B 3CCM3 1KC84 3CXC2 2RFRA 2IUKA 3MG3A 3X3YA 3NHXA 2RNTA 1CH0A 4FR9A 5AIIA 2WO0A 2CHCA 2CWTA 3QK9A 4EV5A 3UB1A 5AIHA 5JPUA 4KFFA 2CIUA 1BU4A 3ZG5A 1CYUA 2BO9B 1NWWA 2STDA 3EJVA 1OH0A 4BTYA 3NBRA 2AAEA 1BVIA 1N8QA 1OGZA 5IF6A 1V58A 4XDVA 4GL6A 4AKYA 1AQZA 3D9RA 2OWPA 3PXMA 4AKZA 2OOVA 1VQ43 3BB9A 1O7PB 1IQYA 1RCLA 3SOAA 3DH2A 3OW22 1GOUA 2J8XB 4STDA 1JB4A 3SYUA 2W03A 3CD63 3KFQC 1TFKA 4GHOA 2BU4A 3PZWA 5GSPA 3VGNA 2XFSA 1VZZA 1FGRA 2I9WA 4FMBA 1D6ZA 3PCSA 4HJLB 1UCLA 4HVNA 1I70A 2Z77A 4L8PA 3GZXB 2CFWA 4Q53A 3NUVA 3MG2A 3DMCA 1JKGB 5CXOA 1BSBA 2F5WA 2F99A 3B8LA 1CQSA 4HZBB 3EC9A 1N5PA 1YVSA 4WFOA 1VQN3 4HM8B 1EKMA 3G6E3 3D5GA 3JUMA 3WMDA 1BNSA 2CX1A 3B4PA 5AIGA 4BIRA 1NDOB 5TGNA 7GSPA 1T5YA 1LOWA 1B27A 1IT8A 1L5GB 2BMRB 5AYSC 1UGIA 4FCMA 1RGFA 3K7CA 4N6LA 2LQVA 4LSOA 1VQ83 3SXXA 1CEWI 4EXRA 1IQXA 1W6GA 5IERA 3T8UA 2IUJA 1N9EA 1VQ63 1I8VA 4O8SA 1SIIA 2A15A 1EEJA 5G1LA 1IVUA 1GOVA 2F56A 3WR2A 3KN4A 1N9JA 2ML5A 1LOYA 1YI23 4IPBA 1W01A 2ZHXB 3S29A 5EEOA 3UL6A 4U13A 3EBYA 1LQMB 3D3LA 4ILFA 2P38A 1SIHA 3SEDA 3MKIA 3SX1A 5BU4A 1FW7A 2GU3A 4BL2A 1QMAA 1I2GA 7STDA 4KFEA 3G713 3FSDA 1BRSA 1W5ZA 1GY6A 3FF2A 2Z6BA 3X3XA 3FKAA 1JKGA 5CF1A 1UI7A 1RHLA 2D1WA 1T2HA 2Q07A 3NBBA 1I3FA 4O2HA 5IG0A 3EN1B 4DKIA 3HIIA 4FCJA 1GSPA 2BT3A 3FF0A 1JN5B 2CK3H 1VQM3 1X1XA 1BSDA 1K28A 3O8YA 4XBTA 1YHQ3 1RGAA 3NXJA 4BL3A 1RDSA 1IVXA 5CK6A 2E2TA 1I0XA 5STDA 1OCVA 2W6JH 3CNMA 3FG1A 1OGXA 5G2GA 5JBSA 1JBRA 2H0IA 5M19A 1MWSA 1IVVA 3DGOA 5LC6A 2INXA 1X1YA 2ZA4A 3DGLA 3KSPA 1Q9EA 4WWUC 7RNTA 2OCTA 4HM5B 4KT3B 3S67A 1UI8A 1A2KA 1X1UA
chains in the Genus database with same CATH topology
3D5IA 1BSEA 4J5KA 2KF5A 1R4YA 1TRPA 7GSPA 2RNTA 1BRKA 1CH0A 2KAAA 3AHSA 1BRNL 2HOHA 1RNBA 1BU4A 1I2FA 2AAEA 1BVIA 1C54A 1RMSA 2C4BA 1RLSA 1AQZA 1B2MA 1BAOA 4RNTA 1FUSA 1RGCA 1RCLA 1BNGA 1I3IA 1GMPA 3DH2A 1GOUA 3DGYA 1B2XA 3SYUA 1X1WA 4GHOA 5GSPA 2BU4A 1I0VA 5HOHA 1FUTA 2F4YA 1B3SA 6RNTA 1RGHA 8RNTA 1UCLA 1I70A 1RGLA 1IYYA 1UCKA 1UCJA 1SARA 1BSBA 1G02A 2F5WA 1RGGA 3Q3FA 2F5MA 1BRIA 1GMRA 4GSPA 1YVSA 1JBTA 1BSAA 1FYSA 1PY3A 2KF3A 3D5GA 1LOVA 1BNSA 1RN1A 4BIRA 2AADA 1LOWA 2RBIA 1B27A 3HOHA 1YNVX 1UCIA 2BIRA 5RNTA 1BSCA 3WHOA 1RGFA 1RGKA 3RNTA 3BIRA 1BNEA 1B2ZA 1LNIA 1BNFA 1B2SA 1PYLA 1BNRA 3D4AA 1I8VA 1B2UA 4HOHA 1GOVA 2F56A 1FZUA 1MGRA 3WR2A 3BU4A 1RTUA 1LOYA 1I2EA 1TTOA 9RNTA 4BU4A 1DETA 5BU4A 1BNIA 1BRGA 1BGSA 1RN4A 1FW7A 1I2GA 1TRQA 1BRSA 1BRHA 1JBSA 3URPA 2KF6A 1BNJA 3KCHA 6GSPA 1HYFA 4HAAA 1RHLA 2KF4A 1GMQA 2GSPA 3A5EA 1T2HA 1ZGXA 1I3FA 5BIRA 1MGWA 1GSPA 1RGEA 1BRJA 1RCKA 4J5GA 1B20A 1X1XA 1HZ1A 1T2IA 1BSDA 1A2PA 3AGNA 1LRAA 1RGAA 1BUJA 1RDSA 1I0XA 3GSPA 1RNTA 1BANA 1GOYA 1JBRA 3AHWA 3AGOA 1B21A 1BOXA 1AY7A 1BIRA 1X1YA 1RSNA 1YGWA 2ZA4A 1Q9EA 7RNTA 1DE3A 2SARA 1X1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5I A;  1BSE A;  4J5K A;  2KF5 A;  1R4Y A;  1TRP A;  7GSP A;  2RNT A;  1BRK A;  1CH0 A;  2KAA A;  3AHS A;  1BRN L;  2HOH A;  1RNB A;  1BU4 A;  1I2F A;  2AAE A;  1BVI A;  1C54 A;  1RMS A;  2C4B A;  1RLS A;  1AQZ A;  1B2M A;  1BAO A;  4RNT A;  1FUS A;  1RGC A;  1RCL A;  1BNG A;  1I3I A;  1GMP A;  3DH2 A;  1GOU A;  3DGY A;  1B2X A;  3SYU A;  1X1W A;  4GHO A;  5GSP A;  2BU4 A;  1I0V A;  5HOH A;  1FUT A;  2F4Y A;  1B3S A;  6RNT A;  1RGH A;  8RNT A;  1UCL A;  1I70 A;  1RGL A;  1IYY A;  1UCK A;  1UCJ A;  1SAR A;  1BSB A;  1G02 A;  2F5W A;  1RGG A;  3Q3F A;  2F5M A;  1BRI A;  1GMR A;  4GSP A;  1YVS A;  1JBT A;  1BSA A;  1FYS A;  1PY3 A;  2KF3 A;  3D5G A;  1LOV A;  1BNS A;  1RN1 A;  4BIR A;  2AAD A;  1LOW A;  2RBI A;  1B27 A;  3HOH A;  1YNV X;  1UCI A;  2BIR A;  5RNT A;  1BSC A;  3WHO A;  1RGF A;  1RGK A;  3RNT A;  3BIR A;  1BNE A;  1B2Z A;  1LNI A;  1BNF A;  1B2S A;  1PYL A;  1BNR A;  3D4A A;  1I8V A;  1B2U A;  4HOH A;  1GOV A;  2F56 A;  1FZU A;  1MGR A;  3WR2 A;  3BU4 A;  1RTU A;  1LOY A;  1I2E A;  1TTO A;  9RNT A;  4BU4 A;  1DET A;  5BU4 A;  1BNI A;  1BRG A;  1BGS A;  1RN4 A;  1FW7 A;  1I2G A;  1TRQ A;  1BRS A;  1BRH A;  1JBS A;  3URP A;  2KF6 A;  1BNJ A;  3KCH A;  6GSP A;  1HYF A;  4HAA A;  1RHL A;  2KF4 A;  1GMQ A;  2GSP A;  3A5E A;  1T2H A;  1ZGX A;  1I3F A;  5BIR A;  1MGW A;  1GSP A;  1RGE A;  1BRJ A;  1RCK A;  4J5G A;  1B20 A;  1X1X A;  1HZ1 A;  1T2I A;  1BSD A;  1A2P A;  3AGN A;  1LRA A;  1RGA A;  1BUJ A;  1RDS A;  1I0X A;  3GSP A;  1RNT A;  1BAN A;  1GOY A;  1JBR A;  3AHW A;  3AGO A;  1B21 A;  1BOX A;  1AY7 A;  1BIR A;  1X1Y A;  1RSN A;  1YGW A;  2ZA4 A;  1Q9E A;  7RNT A;  1DE3 A;  2SAR A;  1X1U A; 
#chains in the Genus database with same CATH topology
 3LH4 A;  1TIJ A;  8CHO A;  4HM0 B;  3NQY A;  2KF5 A;  4HM1 B;  4WYK B;  5DRV A;  1ISK A;  2FGT A;  1UW1 A;  4N6M A;  1ROA A;  3AHS A;  1QAK A;  2CG0 A;  1JB5 A;  1BRN L;  1VQO 3;  2HOH A;  3EE1 A;  3FLJ A;  5KP4 A;  2GU1 A;  1RNB A;  3HX8 A;  2FNQ A;  1DMM A;  3MHE A;  3WA2 X;  4X2O A;  4R80 A;  5IG4 A;  2C4B A;  3CU3 A;  4I4K A;  5I97 A;  2FXT A;  1BAO A;  3FH1 A;  4RNT A;  2Z76 A;  1FUS A;  4NPB A;  1RGC A;  2HMJ B;  2XFT A;  2PZV A;  3DGY A;  3EB8 A;  1B2X A;  5ELJ A;  3CC4 3;  2YFI B;  3G8Z A;  4EW5 A;  4WHA A;  3BNC A;  1FUT A;  2F4Y A;  1OF5 B;  2P0X A;  4MEI A;  4XBX A;  1A2V A;  1QVG 2;  2H0H A;  8RNT A;  2E2V A;  1AVL A;  5AEW B;  4KFD A;  5FGO A;  1AV4 A;  1IQ8 A;  3DZL A;  2BMO B;  3NV0 A;  1JB2 A;  4R1K A;  2F98 A;  1IDP A;  1TU5 A;  1IYY A;  1UCJ A;  3LML A;  2OTL 3;  1SAR A;  3FGY A;  3H51 A;  3HI7 A;  5DRE A;  4EBG A;  1GMR A;  1EQK A;  1MWU A;  3OWU A;  4HYZ A;  1KD1 4;  1Q40 A;  2W9P A;  1LOV A;  1UUW B;  4IIA A;  4RNY A;  5FW5 A;  5CLK A;  3Q1C A;  2RBI A;  3E99 A;  1YNV X;  2WOH A;  2OOV C;  4K90 B;  1JRQ A;  3N9H A;  4ZM8 A;  4RZM A;  3WHO A;  5BVB A;  4XM4 A;  1HU9 A;  2YFJ B;  5IG3 A;  1K8A 4;  2HMN B;  3RNT A;  3EX9 A;  3LZA A;  4FCZ A;  1IU7 A;  3D4A A;  1RJO A;  3DGM A;  2W2C A;  3MSO A;  3DY5 A;  3HK4 A;  1FZU A;  2JQ5 A;  1MGR A;  3AMO B;  3BU4 A;  1FUW A;  1RTU A;  4QWT A;  1M1K 4;  1O7N B;  3LT8 A;  3LTB A;  9RNT A;  1M9G A;  2P05 A;  2XSO B;  2OTJ 3;  2GEX A;  4BTX A;  3EBT A;  2CWU A;  4NHF A;  1PFP A;  2W0Q A;  2HMO B;  2WOF A;  1UUG B;  4N6U A;  5G1K A;  2JDI H;  5A0O B;  5HGR A;  1W6Y A;  4FMD A;  4WP5 A;  2XGL A;  3OV4 A;  3MYT A;  3V99 A;  1RKY A;  1HYF A;  1VQP 3;  3PCR A;  4H3U A;  1D6Y A;  2GSP A;  4HM3 B;  3N54 B;  4J8T A;  3CCQ 3;  5BIR A;  2CFK A;  3CCS 3;  3L0R A;  4X2H A;  1F8N A;  3IJE B;  3LTD A;  1MOL A;  3K0Z A;  1T2I A;  3ER7 A;  1A2P A;  1A67 A;  1VQK 3;  4MMZ B;  3X40 A;  1WMP A;  2PNC A;  3RDE A;  1RNT A;  1FGQ A;  3RGR A;  1BAN A;  3H3H A;  3K5T A;  3AHW A;  1ASK A;  3F40 A;  3ECF A;  1B21 A;  1FA3 A;  3T0U A;  1S72 3;  3F9S A;  3JVC A;  3RGA A;  1YGW A;  2RSX A;  3HIG A;  1DVC A;  1FGM A;  3F14 A;  1Q86 4;  1E3R A;  1Q7H A;  3D5I A;  2LYX A;  2O3O A;  1LNH A;  1YVB I;  2W56 B;  3GZY B;  1NB3 I;  3GAX A;  4J5K A;  1TP6 A;  1R4Y A;  1IVW A;  1D6U A;  1T3B A;  1S5A A;  1WQL B;  2CWV A;  1TRP A;  2E2U A;  1SQW A;  3LYG A;  4LEH A;  1OUN A;  4O02 B;  3I0Y A;  5EQL A;  2F86 B;  3SOY A;  1GS3 A;  4K1U A;  1VQ9 3;  2CC3 A;  1O7G B;  1V57 A;  2CW9 A;  2WGO A;  1FGO A;  4R9L A;  1U8C B;  1I2F A;  3JUN A;  2CFL A;  3LOY A;  5BXQ A;  1C54 A;  4CCV A;  1A90 A;  4HBR A;  4NRE A;  3WOF B;  2HMM B;  2B24 B;  2GBW B;  5EVH A;  1IV7 A;  2BNG A;  1LVN A;  3WDG B;  2OQE C;  1EUI C;  1QAL A;  1DYU A;  3DXO A;  5AIF A;  3JUP A;  1MNL A;  1X1W A;  4CJN A;  3BNE A;  1LOX A;  1R4C A;  1WTH A;  1I0V A;  1N5H A;  4JF8 A;  5HOH A;  2BHM A;  2L1S A;  5IW9 A;  1YJ9 3;  3QRD A;  2YX9 A;  1OHP A;  2KRT A;  3KZT A;  2UX0 A;  1O7H B;  2WGQ A;  2QGU A;  4OUQ A;  3CC2 3;  1RRL A;  3CPW 2;  3CMA 3;  2K3D A;  5M18 A;  5IG5 A;  3T8N A;  3GWR A;  3FG3 A;  1G02 A;  3Q3F A;  2KCD A;  3U1W A;  1BRI A;  4L8O A;  1IK3 A;  1TUH A;  2UGI A;  1JBT A;  1FYS A;  2KXG A;  3IMA B;  2XH9 A;  3NBJ A;  3DGN A;  2AAD A;  4HKV B;  3STD A;  2CX0 A;  3HOH A;  1IT7 A;  3OX9 A;  3S27 A;  3CCU 3;  3GRD A;  4BTW A;  2BIR A;  1V74 A;  1WNH A;  2W04 A;  2XF3 A;  3B4O A;  3WA3 A;  1JN5 A;  3FG4 A;  3BIR A;  4XB5 A;  3F7S A;  1LNI A;  5D82 A;  1BNR A;  4GB5 A;  3K9M C;  1B2U A;  5KP1 A;  1NNV A;  1YIJ 3;  3G0K A;  3MWZ A;  3PGB A;  2CH9 A;  3NX0 A;  1DMN A;  2L4V A;  4N6O B;  1YJN 3;  1I2E A;  1TTO A;  4XBY A;  5IEN A;  1K9M 4;  3G16 A;  1RN4 A;  4OVM A;  3OWY A;  2XSH B;  1GY5 A;  1NU3 A;  3UJM A;  3N8B A;  4LGQ A;  3V92 A;  1JBS A;  3URP A;  4WYK A;  2KF6 A;  1HKX A;  3F7X A;  1BNJ A;  3KSE D;  2CFD A;  1MWR A;  4K61 A;  4HZ9 B;  3J7Y d;  1AVK A;  3KCH A;  3I55 3;  4MMY B;  2CG1 A;  6GSP A;  3WOE B;  1QJG A;  3V98 A;  2RCD A;  3ZG0 A;  1GMQ A;  4KZ1 A;  1ZGX A;  4I5Q A;  2P0M A;  5AI1 A;  3CCE 3;  3CC7 3;  1Q81 4;  1TFO A;  1NO3 A;  1BRJ A;  2C10 A;  3PYJ A;  4EC6 A;  1CYV A;  4J5G A;  1HZ1 A;  1OHS A;  3CCJ 3;  2IYJ A;  2C11 A;  4MMX B;  4TX4 A;  3AGN A;  3PS8 A;  5KP3 A;  2K0M A;  1W6C A;  3S5C A;  2D42 A;  2Y73 A;  3F8H A;  3X42 A;  4N6N B;  1UUV B;  4HM2 B;  1OF5 A;  2R4I A;  1AR0 A;  1BOX A;  2V1L A;  3U97 A;  2QEX 3;  3B7C A;  1BIR A;  4AEQ A;  3CME 3;  3CNX A;  3EHC A;  5ELU A;  1STF I;  1US1 A;  2HML B;  1DE3 A;  3VF1 A;  1GY7 A;  2SAR A;  1SJW A;  1VQ7 3;  1KWI A;  1QVF 2;  1Z1S A;  3LTA A;  3GZB A;  4CPK A;  1WMO A;  1O7W B;  4MJD A;  5AYR B;  3SLU A;  1KQS 2;  3CCR 3;  1IV9 A;  1BRK A;  2KAA A;  3UL5 A;  1E97 A;  4HM4 B;  3ZFZ A;  1Q82 4;  1VQL 3;  3BND A;  1GD4 A;  1W00 A;  1ZX2 A;  1PU4 A;  3JUQ A;  1VQQ A;  1O7M B;  1W4N A;  4RNZ A;  2XEP A;  6STD A;  1E3V A;  3G4S 3;  1RMS A;  1ROV A;  2UUG C;  1RLS A;  3DUK A;  2QIY A;  1W7C A;  1LQG C;  2BMQ B;  4G1M B;  3CPO A;  4R4K A;  1BNG A;  1SPU A;  3NQZ A;  1JNQ A;  1GMP A;  1I3I A;  2SBL A;  3NM2 A;  4H61 A;  4JRF A;  2MC8 A;  4LMI A;  2M7O A;  4XDW A;  5D83 A;  4EYC A;  2YFL B;  1GYB A;  1OAC A;  3AMO A;  3GZR A;  1JZD A;  3NM7 A;  1JZO A;  1B3S A;  5IEP A;  6RNT A;  1RGH A;  2K54 A;  4OK0 A;  1M90 4;  4KVH A;  1QAF A;  2IY2 A;  4RBN A;  1RGL A;  4K1V A;  4LZI A;  4EV2 A;  4J9A A;  1UCK A;  1YGE A;  4IT7 A;  1OHO A;  1RGG A;  5D81 A;  1MWT A;  1JJ2 2;  2F5M A;  5CF2 A;  2MF7 A;  4GSP A;  3ROB A;  2XGN A;  1W2B 2;  1DVD A;  1BSA A;  2KF3 A;  1PY3 A;  1RN1 A;  1DMQ A;  1RN7 A;  3JUO A;  5M1A A;  2GBX B;  3K63 A;  3X41 A;  1NB5 I;  3MPH A;  5AEU B;  4HM7 B;  1UDI I;  1UCI A;  1ULJ B;  5RNT A;  4N6T A;  1BSC A;  3TDG A;  1FGT A;  3LTC A;  3KE7 A;  4LYL B;  3SVA A;  1RGK A;  3OXA A;  1BNE A;  1B2Z A;  2GXF A;  1BNF A;  1B2S A;  1PYL A;  2CFG A;  5LC7 A;  1W2Z A;  1N8R 4;  4HOH A;  2QA4 3;  1ZO2 A;  4CDL A;  2XRX B;  3LXU X;  1WMN A;  2R41 A;  3KII A;  3F8X A;  4HM6 B;  3HZP A;  2Z7A A;  1K73 4;  2GEY A;  3FCS B;  2H0G A;  4L7K A;  4N3V A;  4FMA A;  1ZS7 A;  1Q42 A;  4BU4 A;  1DET A;  1BNI A;  3NV0 B;  1BRG A;  1LXE A;  1BGS A;  3MG1 A;  2OQE A;  1M1X B;  3BNB A;  3M8C A;  1K41 A;  3Q90 A;  1TRQ A;  2W56 A;  5JPP A;  1BRH A;  2CKF B;  1Y4K A;  2IA7 A;  3EF8 A;  2RGQ A;  3LT9 A;  1G0T A;  1EA2 A;  1Q40 B;  4PEJ A;  1ULI B;  3DM8 A;  3FZW A;  1G96 A;  4HAA A;  2KF4 A;  3X3Z A;  2O9U X;  2P09 A;  3ALA A;  3A5E A;  1YJW 3;  3OWS A;  3CCV 3;  3IPT A;  1KSI A;  1MGW A;  5IEO A;  3CCL 3;  3BLZ A;  1RGE A;  2B1X B;  1RCK A;  3I56 3;  1U5O A;  1B20 A;  2ZDJ A;  3A76 A;  3EQQ B;  1LRA A;  1J2B A;  1BUJ A;  3EN8 A;  3D79 A;  3S28 A;  3KKG A;  1BUQ A;  3GSP A;  1EG9 B;  2Y74 A;  1GOY A;  1STD A;  2W9Q A;  4R9K A;  1JV2 B;  3AGO A;  1NJI 4;  1B2M A;  1YIT 3;  1C7H A;  1AY7 A;  3Q2P A;  1RSN A;  1W02 A;  1GD3 A;  3WOD G;  1OPY A;  1RRH A;  1UGH I;  4ORL A;  2ZL8 A;  4N6V 0;  2IMJ A;  1Q7Y 4;  1BSE A;  3UNL A;  1VQ5 3;  3VSY A;  1TJD A;  2HMK B;  4FMC A;  4O3V A;  2ML6 A;  2XR8 B;  3CCM 3;  1KC8 4;  3CXC 2;  2RFR A;  2IUK A;  3MG3 A;  3X3Y A;  3NHX A;  2RNT A;  1CH0 A;  4FR9 A;  5AII A;  2WO0 A;  2CHC A;  2CWT A;  3QK9 A;  4EV5 A;  3UB1 A;  5AIH A;  5JPU A;  4KFF A;  2CIU A;  1BU4 A;  3ZG5 A;  1CYU A;  2BO9 B;  1NWW A;  2STD A;  3EJV A;  1OH0 A;  4BTY A;  3NBR A;  2AAE A;  1BVI A;  1N8Q A;  1OGZ A;  5IF6 A;  1V58 A;  4XDV A;  4GL6 A;  4AKY A;  1AQZ A;  3D9R A;  2OWP A;  3PXM A;  4AKZ A;  2OOV A;  1VQ4 3;  3BB9 A;  1O7P B;  1IQY A;  1RCL A;  3SOA A;  3DH2 A;  3OW2 2;  1GOU A;  2J8X B;  4STD A;  1JB4 A;  3SYU A;  2W03 A;  3CD6 3;  3KFQ C;  1TFK A;  4GHO A;  2BU4 A;  3PZW A;  5GSP A;  3VGN A;  2XFS A;  1VZZ A;  1FGR A;  2I9W A;  4FMB A;  1D6Z A;  3PCS A;  4HJL B;  1UCL A;  4HVN A;  1I70 A;  2Z77 A;  4L8P A;  3GZX B;  2CFW A;  4Q53 A;  3NUV A;  3MG2 A;  3DMC A;  1JKG B;  5CXO A;  1BSB A;  2F5W A;  2F99 A;  3B8L A;  1CQS A;  4HZB B;  3EC9 A;  1N5P A;  1YVS A;  4WFO A;  1VQN 3;  4HM8 B;  1EKM A;  3G6E 3;  3D5G A;  3JUM A;  3WMD A;  1BNS A;  2CX1 A;  3B4P A;  5AIG A;  4BIR A;  1NDO B;  5TGN A;  7GSP A;  1T5Y A;  1LOW A;  1B27 A;  1IT8 A;  1L5G B;  2BMR B;  5AYS C;  1UGI A;  4FCM A;  1RGF A;  3K7C A;  4N6L A;  2LQV A;  4LSO A;  1VQ8 3;  3SXX A;  1CEW I;  4EXR A;  1IQX A;  1W6G A;  5IER A;  3T8U A;  2IUJ A;  1N9E A;  1VQ6 3;  1I8V A;  4O8S A;  1SII A;  2A15 A;  1EEJ A;  5G1L A;  1IVU A;  1GOV A;  2F56 A;  3WR2 A;  3KN4 A;  1N9J A;  2ML5 A;  1LOY A;  1YI2 3;  4IPB A;  1W01 A;  2ZHX B;  3S29 A;  5EEO A;  3UL6 A;  4U13 A;  3EBY A;  1LQM B;  3D3L A;  4ILF A;  2P38 A;  1SIH A;  3SED A;  3MKI A;  3SX1 A;  5BU4 A;  1FW7 A;  2GU3 A;  4BL2 A;  1QMA A;  1I2G A;  7STD A;  4KFE A;  3G71 3;  3FSD A;  1BRS A;  1W5Z A;  1GY6 A;  3FF2 A;  2Z6B A;  3X3X A;  3FKA A;  1JKG A;  5CF1 A;  1UI7 A;  1RHL A;  2D1W A;  1T2H A;  2Q07 A;  3NBB A;  1I3F A;  4O2H A;  5IG0 A;  3EN1 B;  4DKI A;  3HII A;  4FCJ A;  1GSP A;  2BT3 A;  3FF0 A;  1JN5 B;  2CK3 H;  1VQM 3;  1X1X A;  1BSD A;  1K28 A;  3O8Y A;  4XBT A;  1YHQ 3;  1RGA A;  3NXJ A;  4BL3 A;  1RDS A;  1IVX A;  5CK6 A;  2E2T A;  1I0X A;  5STD A;  1OCV A;  2W6J H;  3CNM A;  3FG1 A;  1OGX A;  5G2G A;  5JBS A;  1JBR A;  2H0I A;  5M19 A;  1MWS A;  1IVV A;  3DGO A;  5LC6 A;  2INX A;  1X1Y A;  2ZA4 A;  3DGL A;  3KSP A;  1Q9E A;  4WWU C;  7RNT A;  2OCT A;  4HM5 B;  4KT3 B;  3S67 A;  1UI8 A;  1A2K A;  1X1U A; 
#chains in the Genus database with same CATH homology
 3D5I A;  1BSE A;  4J5K A;  2KF5 A;  1R4Y A;  1TRP A;  7GSP A;  2RNT A;  1BRK A;  1CH0 A;  2KAA A;  3AHS A;  1BRN L;  2HOH A;  1RNB A;  1BU4 A;  1I2F A;  2AAE A;  1BVI A;  1C54 A;  1RMS A;  2C4B A;  1RLS A;  1AQZ A;  1B2M A;  1BAO A;  4RNT A;  1FUS A;  1RGC A;  1RCL A;  1BNG A;  1I3I A;  1GMP A;  3DH2 A;  1GOU A;  3DGY A;  1B2X A;  3SYU A;  1X1W A;  4GHO A;  5GSP A;  2BU4 A;  1I0V A;  5HOH A;  1FUT A;  2F4Y A;  1B3S A;  6RNT A;  1RGH A;  8RNT A;  1UCL A;  1I70 A;  1RGL A;  1IYY A;  1UCK A;  1UCJ A;  1SAR A;  1BSB A;  1G02 A;  2F5W A;  1RGG A;  3Q3F A;  2F5M A;  1BRI A;  1GMR A;  4GSP A;  1YVS A;  1JBT A;  1BSA A;  1FYS A;  1PY3 A;  2KF3 A;  3D5G A;  1LOV A;  1BNS A;  1RN1 A;  4BIR A;  2AAD A;  1LOW A;  2RBI A;  1B27 A;  3HOH A;  1YNV X;  1UCI A;  2BIR A;  5RNT A;  1BSC A;  3WHO A;  1RGF A;  1RGK A;  3RNT A;  3BIR A;  1BNE A;  1B2Z A;  1LNI A;  1BNF A;  1B2S A;  1PYL A;  1BNR A;  3D4A A;  1I8V A;  1B2U A;  4HOH A;  1GOV A;  2F56 A;  1FZU A;  1MGR A;  3WR2 A;  3BU4 A;  1RTU A;  1LOY A;  1I2E A;  1TTO A;  9RNT A;  4BU4 A;  1DET A;  5BU4 A;  1BNI A;  1BRG A;  1BGS A;  1RN4 A;  1FW7 A;  1I2G A;  1TRQ A;  1BRS A;  1BRH A;  1JBS A;  3URP A;  2KF6 A;  1BNJ A;  3KCH A;  6GSP A;  1HYF A;  4HAA A;  1RHL A;  2KF4 A;  1GMQ A;  2GSP A;  3A5E A;  1T2H A;  1ZGX A;  1I3F A;  5BIR A;  1MGW A;  1GSP A;  1RGE A;  1BRJ A;  1RCK A;  4J5G A;  1B20 A;  1X1X A;  1HZ1 A;  1T2I A;  1BSD A;  1A2P A;  3AGN A;  1LRA A;  1RGA A;  1BUJ A;  1RDS A;  1I0X A;  3GSP A;  1RNT A;  1BAN A;  1GOY A;  1JBR A;  3AHW A;  3AGO A;  1B21 A;  1BOX A;  1AY7 A;  1BIR A;  1X1Y A;  1RSN A;  1YGW A;  2ZA4 A;  1Q9E A;  7RNT A;  1DE3 A;  2SAR A;  1X1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...