3T8NA

Crystal structure of ketosteroid isomerase y16ad103a from pseudomonas putida
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'NLPTAQEVQGLMARAIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIAVMRFDEHGRIQTMQAYWSEVNLSVREP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, D, F
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8nA00
1A2KA 5CLKA 3EF8A 1W01A 4HM8B 3JUNA 3DXOA 5IG0A 1VZZA 5JPPA 3EQQB 3KSPA 3WMDA 1OHSA 4R1KA 5STDA 5CK6A 3H3HA 3KZTA 1O7MB 3MG3A 5KP3A 3SOYA 2BMOB 4R9LA 3GZYB 3FF0A 5IG4A 1E97A 1Z1SA 3KE7A 1O7WB 4HM7B 2IMJA 3FF2A 1W6YA 5KP4A 5G2GA 2GBWB 5IERA 2RFRA 4X2OA 2XR8B 5AEWB 3OXAA 2Z7AA 3G16A 3JUOA 5D83A 3JUPA 3Q90A 1W02A 1Q40B 3OWYA 2XSOB 3NHXA 4K1UA 2RCDA 3HX8A 3JUMA 4HZ9B 1CQSA 1OGXA 3FGYA 3D9RA 1E3RA 1JB4A 4HZBB 2I9WA 3VGNA 2QIYA 5AIIA 2HMMB 2BMQB 5IEOA 4XBTA 6STDA 3F9SA 3B4OA 3BB9A 5IENA 4CDLA 2GXFA 3MHEA 2BNGA 1TUHA 3NM2A 4RZMA 5AIFA 4XBXA 4XDVA 1OF5A 2GEXA 3M8CA 3VSYA 4U13A 3STDA 4N3VA 1AR0A 4L8PA 1K41A 4OUQA 3KKGA 3RGRA 4WWUC 3NXJA 3OV4A 1JKGB 3NV0A 4L7KA 4Q53A 2CHCA 1QMAA 2YFLB 1GY5A 4LEHA 1JB5A 3CPOA 2INXA 1NDOB 3MG2A 1EG9B 3GZRA 1JN5A 3K7CA 3GZBA 3FSDA 4XM4A 3I0YA 3MKIA 1ULJB 3EJVA 4KVHA 5IEPA 1C7HA 1GS3A 8CHOA 1OUNA 3CNMA 3S5CA 2HMLB 5KP1A 3GZXB 1ULIB 2OWPA 3NBRA 3ECFA 2XSHB 4WP5A 2JQ5A 4K1VA 5FW5A 3F40A 1OHOA 4HM0B 4FCJA 1W00A 3SEDA 2YFJB 3T8UA 3HK4A 1O7HB 3OX9A 1DMMA 1TP6A 5IG5A 3MYTA 3B8LA 3CU3A 5AIGA 1STDA 1O7PB 5AIHA 1UUWB 1WQLB 4HM5B 1GY7A 3HZPA 1DMNA 2BMRB 5TGNA 3RGAA 3CNXA 5IF6A 4WYKA 5D81A 2F86B 2Z77A 3LYGA 4HM2B 2YFIB 3F14A 3A76A 1IDPA 4XBYA 5IG3A 1QJGA 1GY6A 4HKVB 3OWSA 3MSOA 4J8TA 1Q42A 4HM1B 4STDA 3BLZA 4XB5A 3EN1B 2R4IA 1U5OA 4FCMA 3FZWA 4R9KA 3ER7A 1HKXA 3G0KA 3UJMA 3GWRA 4MJDA 4LGQA 3EC9A 3H51A 1S5AA 1GYBA 1ZO2A 1EA2A 5BXQA 1DMQA 5AI1A 1ASKA 3DUKA 4H3UA 2W2CA 2XRXB 3OWUA 1O7GB 3F8HA 2B24B 2GEYA 3NUVA 2F98A 4WYKB 3T8NA 1OGZA 2HMKB 2HMNB 3F8XA 1OF5B 4HM6B 3FLJA 1OH0A 3UNLA 4XDWA 3EHCA 2K54A 4OVMA 3JUQA 5CF2A 3NV0B 5CXOA 3EBTA 4PEJA 4LMIA 1JKGA 4HM4B 2PZVA 3DZLA 3E99A 3MG1A 3F7SA 1NWWA 2A15A 4ORLA 2HMOB 5AEUB 4J9AA 1ISKA 4GB5A 2GBXB 1JN5B 3DMCA 3EN8A 1ZX2A 4IIAA 2HMJB 2CKFB 4HJLB 7STDA 5HGRA 1OPYA 2UX0A 1OCVA 2RGQA 3B7CA 2F99A 2B1XB 1E3VA 1O7NB 5CF1A 3GRDA 3FH1A 3F7XA 1OHPA 3K0ZA 2STDA 3FKAA 1NU3A 3B4PA 4L8OA 5DREA 2Z76A 3SOAA 5JPUA 4I4KA 5DRVA 5BVBA 1UUVB 1BUQA 3LZAA 3IPTA 3ROBA 3EX9A 3EBYA 4HM3B 1Q40A 1SJWA 4HVNA 5D82A 3G8ZA 2QGUA 3DM8A 4X2HA 5EVHA 1JB2A
chains in the Genus database with same CATH superfamily
1A2KA 2XEPA 3S27A 1B2SA 1MNLA 1CEWI 1UI8A 5CLKA 2BU4A 1S723 1D6UA 3RDEA 2CIUA 1GD4A 3EF8A 1BRKA 1W01A 4HM8B 2MC8A 2XFSA 3JUNA 4BIRA 3DXOA 2W56A 5IG0A 1CH0A 1IK3A 1VZZA 3V98A 5JPPA 1N5HA 3EQQB 5AYSC 1B20A 3G4S3 1L5GB 1YGWA 1Q814 1DVDA 3KSPA 3WMDA 1FGTA 2F5WA 1UI7A 1VQK3 1M9GA 1OHSA 4R1KA 1JBRA 5STDA 5CK6A 3H3HA 3KZTA 4LYLB 3DY5A 4AKYA 4MEIA 1VQ83 1D6YA 3LOYA 3NX0A 1QVG2 1NB3I 1BGSA 2YX9A 4KFDA 2CK3H 1O7MB 3MG3A 1GMQA 5KP3A 3SOYA 3PYJA 5EQLA 2BMOB 1B27A 1FUWA 2HOHA 1T2IA 3FG1A 4R9LA 3GZYB 3FF0A 4O02B 5IG4A 1IV9A 3BNDA 2UUGC 3FG4A 1E97A 1Z1SA 3KE7A 3CCM3 1LVNA 1O7WB 3X3YA 3AHSA 4BU4A 3T0UA 4HM7B 1G96A 2IMJA 3SXXA 3FF2A 1IT7A 1WMOA 2QA43 3CPW2 3MPHA 1VQ73 1W6YA 1Q864 1IVWA 9RNTA 2IUJA 5KP4A 5G2GA 1IQXA 2H0IA 1B2XA 1RJOA 3WA2X 1B2ZA 1BNIA 2GBWB 5IERA 4LZIA 5M1AA 1GOUA 1WMNA 2Z6BA 1GOYA 4QWTA 2RFRA 2GSPA 4X2OA 2IA7A 4EC6A 1M1K4 2XR8B 2CX0A 4FMDA 2CFKA 3QRDA 3WA3A 3LH4A 3OW22 8RNTA 2O3OA 1AY7A 2FXTA 3S29A 5AEWB 3OXAA 1TU5A 1TRPA 4FR9A 4RNTA 3SVAA 2Z7AA 3G16A 3JUOA 5D83A 3JUPA 2H0HA 3DGLA 2KCDA 2P0MA 3Q90A 2CWUA 1W02A 3LT8A 1IVXA 1Q40B 3OWYA 1VQQA 2XSOB 1BRHA 3NHXA 4K1UA 1KD14 2RCDA 1W4NA 2RSXA 3KSED 3HX8A 3JUMA 1BSBA 1QAKA 2K3DA 4HZ9B 4ZM8A 1CQSA 4HAAA 1OGXA 3X3XA 1PFPA 3N54B 3UB1A 1YJN3 3FGYA 1JZDA 3NQYA 2PNCA 3D9RA 1E3RA 1JB4A 1YVBI 2I9WA 4HZBB 1BSEA 3VGNA 1KC84 5FGOA 1JNQA 4O8SA 2QIYA 2O9UX 4ILFA 2Y73A 5AIIA 1OACA 1RGCA 2IYJA 2XGNA 1US1A 2HMMB 2WGOA 2BMQB 1A67A 1MOLA 1EQKA 1T3BA 3NQZA 4XBTA 5IEOA 3CMA3 3NM7A 6STDA 3F9SA 3B4OA 3BB9A 5IENA 4KZ1A 4CDLA 4K90B 2GXFA 1NO3A 1VQM3 2QEX3 3MHEA 1G0TA 2BNGA 1PU4A 4JRFA 4CPKA 3CCR3 1D6ZA 1M904 2RNTA 1TUHA 4KFFA 3NM2A 4RZMA 2OQEC 4OK0A 4XBXA 5AIFA 1LOXA 1GOVA 3BU4A 3UL5A 2KF3A 2WO0A 4HBRA 4XDVA 2MF7A 1OF5A 3V99A 3WHOA 2OCTA 2CWVA 1BU4A 2GEXA 3M8CA 1MWUA 3VSYA 4BL2A 1PYLA 4U13A 3STDA 4N3VA 2LYXA 1AR0A 4L8PA 1MWTA 1RGHA 3WOEB 3IMAB 1K41A 1AVKA 3BNCA 4OUQA 3KKGA 4CCVA 3RGRA 4WWUC 3NXJA 3OV4A 1UCJA 3DGMA 3TDGA 2E2VA 1B2MA 1JKGB 5ELJA 2WOHA 1N8QA 3NV0A 4TX4A 3O8YA 3LTCA 4L7KA 4R80A 3KN4A 5LC6A 1VQ43 4Q53A 3K9MC 3QK9A 4N6MA 4EV5A 1BRSA 2CHCA 1QMAA 1DVCA 4NPBA 1VQL3 3CME3 2YFLB 1N8R4 3EE1A 3AMOA 1N9JA 4CJNA 1GY5A 2C4BA 1HYFA 4LEHA 4EYCA 1JB5A 1VQN3 1ROAA 1LNHA 2CG1A 1MWRA 3CPOA 2INXA 1NDOB 1RLSA 2ZL8A 1I3FA 3MG2A 1EG9B 3PCRA 3Q1CA 3GZRA 6GSPA 1JN5A 1JV2B 3K7CA 2KF4A 1IQYA 1X1YA 3GZBA 1BSDA 4EV2A 1UCIA 3ZG5A 1YJ93 3PCSA 1VQ93 3FSDA 4XM4A 3I0YA 5LC7A 3MKIA 1ULJB 1LOYA 1RGEA 1YNVX 3EJVA 4KVHA 1J2BA 5IEPA 1C7HA 1GS3A 1SPUA 2GU1A 1OUNA 8CHOA 1JBTA 1BSCA 1RTUA 2CW9A 1UCKA 2XH9A 3CNMA 4HOHA 3PS8A 2XFTA 3S5CA 3LTDA 1TRQA 2HMLB 5KP1A 3CC23 2H0GA 3AHWA 3GZXB 1A90A 1STFI 3G6E3 1FZUA 1RDSA 1ULIB 2D42A 2OWPA 1ROVA 1EKMA 1TIJA 3NBRA 1W7CA 2E2TA 2L4VA 4HYZA 1LNIA 3ECFA 1MWSA 2XSHB 2C10A 4WP5A 4NREA 3WODG 1QAFA 1RN7A 1UUGB 2JQ5A 2W6JH 1RSNA 4K1VA 1CYVA 1I0XA 2CG0A 5FW5A 3F40A 2FNQA 4EBGA 1KSIA 1WTHA 3PZWA 1UCLA 3I563 1OHOA 4HM0B 2LQVA 4FCJA 1UW1A 2W9PA 3EB8A 1W00A 4BTWA 5BU4A 1K9M4 3SEDA 2YFJB 3T8UA 1RCKA 3HK4A 4N6UA 1O7HB 3OX9A 1I2GA 1DMMA 3KFQC 1A2VA 1TP6A 5IG5A 3MYTA 4G1MB 4RBNA 5EVHA 3J7Yd 1YIT3 1T2HA 3B8LA 3CU3A 1IVUA 4N6TA 3D79A 3GAXA 5AIGA 1NJI4 1I0VA 1STDA 1R4YA 3PGBA 2WGQA 1O7PB 2ML6A 2W04A 2OOVA 1Y4KA 5AIHA 1BRIA 1SIHA 1LOWA 1UUWB 5BIRA 1FUSA 1W2B2 2W56B 3AGOA 1WQLB 4HM5B 1IT8A 1K734 1GY7A 3HZPA 5EEOA 2P38A 5IW9A 1DMNA 2BMRB 5A0OB 1BNFA 4WFOA 1X1XA 3GSPA 1AQZA 5TGNA 3RGAA 4BTXA 3CNXA 4JF8A 5IF6A 3Q3FA 2KXGA 3ALAA 1B21A 4WYKA 1MGRA 1RGGA 2BT3A 3NBBA 2P0XA 4RNZA 3G713 1R4CA 5D81A 1RKYA 2F86B 1ZGXA 3U97A 2Y74A 3V92A 3PXMA 3K5TA 2Z77A 2XGLA 1RN4A 1EEJA 3LYGA 1HZ1A 4N6LA 1FGMA 1B3SA 2CWTA 4HM2B 1U8CB 2YFIB 2ZDJA 1BRGA 2K0MA 2CX1A 3F14A 4RNYA 1GMPA 2WOFA 3LXUX 3U1WA 3A76A 4GSPA 1IDPA 5RNTA 1QVF2 1VQP3 4XBYA 5IG3A 1QJGA 2CC3A 1BNRA 1GY6A 4K61A 3HIGA 4HKVB 1BANA 2L1SA 3OWSA 3JVCA 1FGQA 1RGKA 1GMRA 1RRLA 5HOHA 2F56A 3MSOA 4J8TA 3SX1A 1Q42A 4HM1B 4STDA 2BIRA 1W6CA 2SBLA 2SARA 3BLZA 3S28A 4XB5A 3EN1B 1EUIC 2KRTA 1KQS2 3SYUA 2R4IA 1U5OA 2FGTA 4FCMA 4GHOA 5M18A 3Q2PA 4LSOA 3FZWA 4R9KA 3CCL3 3ER7A 1GSPA 1HKXA 1LQGC 3G0KA 3UJMA 3CXC2 4FMAA 3X40A 3WDGB 4BTYA 1RCLA 3GWRA 4MJDA 4LGQA 1BNGA 1SIIA 5G1KA 1RNTA 3EC9A 3HIIA 3H51A 1S5AA 1FGRA 1GYBA 1RMSA 1V74A 1ZO2A 1JJ22 1EA2A 2P09A 2W0QA 4MMXB 5BXQA 3BNBA 1DMQA 1RRHA 1BVIA 3MWZA 5AI1A 1JBSA 1ASKA 3DUKA 1RGAA 1X1UA 4H3UA 1YHQ3 4GL6A 1LOVA 1W5ZA 2W2CA 2AAEA 2XRXB 3HOHA 1O7GB 2KAAA 3OWUA 4BL3A 4WHAA 4FMCA 3F8HA 1YJW3 4O3VA 2B24B 3KCHA 3DH2A 4FMBA 1V58A 2GEYA 4J5GA 3CC73 3NUVA 2F98A 1ZS7A 4WYKB 1TJDA 1RN1A 3UL6A 1DE3A 3T8NA 1OGZA 1QALA 1LRAA 2HMKB 2XF3A 1Q7HA 1RGFA 3LTAA 1MGWA 2HMNB 1TFOA 1IU7A 3F8XA 1CYUA 2ML5A 1OF5B 3AGNA 3BIRA 5JBSA 1KWIA 4HM6B 3FLJA 3FCSB 4NHFA 1AVLA 1OH0A 5ELUA 1K28A 4IPBA 3UNLA 4XDWA 2Q07A 3EHCA 1X1WA 2IUKA 2K54A 2C11A 3X42A 3CCE3 2V1LA 3FG3A 4OVMA 4N6V0 1FA3A 1TFKA 3CC43 1T5YA 2M7OA 2AADA 3K63A 1YIJ3 1IYYA 1BSAA 2JDIH 1WMPA 3JUQA 5CF2A 2ZA4A 3ZFZA 4KT3B 2CFGA 3NV0B 1BIRA 4FCZA 3DGOA 5CXOA 3EBTA 4AKZA 1HU9A 4PEJA 1F8NA 3HI7A 4LMIA 2ZHXB 1JKGA 1JB2A 1C54A 1I2FA 1VQO3 1GD3A 1VQ53 4HM4B 2PZVA 1V57A 3DZLA 4EW5A 3AMOB 3E99A 2OTJ3 1BRJA 4AEQA 3MG1A 4N6NB 3WR2A 3CD63 3F7SA 1NWWA 2A15A 4ORLA 1DYUA 2HMOB 1LQMB 5AEUB 1BRNL 1JZOA 3CCV3 4J9AA 1DETA 1SARA 4H61A 3VF1A 6RNTA 1ISKA 4GB5A 3IJEB 2GBXB 1SQWA 3LMLA 1JN5B 1PY3A 1FYSA 3ZG0A 2CFDA 1WNHA 1Q9EA 3N8BA 4EXRA 3DMCA 3EN8A 1ZX2A 1FGOA 1RHLA 3A5EA 5G1LA 4DKIA 2OOVC 1BNSA 2D1WA 1Q7Y4 2F5MA 1N5PA 5AYRB 3DGYA 2KF5A 2CFWA 3CCS3 4IIAA 1W2ZA 1B2UA 2HMJB 7RNTA 2CKFB 4HJLB 1JRQA 2F4YA 7STDA 3D5GA 4MMZB 5HGRA 1BOXA 1IV7A 1OPYA 2UX0A 2W9QA 2OQEA 1OCVA 7GSPA 1A2PA 2J8XB 2RGQA 4MMYB 4R4KA 3D5IA 3B7CA 2OTL3 2F99A 2B1XB 3X41A 5GSPA 1E3VA 1BNEA 3BNEA 3LTBA 1O7NB 5I97A 3CCU3 3D4AA 1RNBA 2GU3A 5CF1A 3GRDA 3FH1A 1RGLA 3F7XA 1M1XB 1BAOA 1I70A 1OHPA 3K0ZA 3WOFB 5M19A 1Q824 3N9HA 2STDA 4KFEA 2CFLA 2UGIA 3FKAA 1NU3A 3B4PA 3RNTA 4N6OB 2E2UA 1YVSA 1I8VA 1NNVA 4L8OA 5DREA 1IQ8A 2Z76A 3SOAA 1AV4A 4I5QA 3DGNA 2R41A 3SLUA 1N9EA 5JPUA 4I4KA 3CCQ3 1FW7A 5DRVA 1I2EA 1IVVA 3LT9A 3X3ZA 5BVBA 1I3IA 1UUVB 3L0RA 1VQ63 1BUQA 3LZAA 3IPTA 1YI23 2W03A 1LXEA 2CH9A 3EBYA 3EX9A 3ROBA 4HM3B 3S67A 2BO9B 1TTOA 4J5KA 3I553 1BUJA 1NB5I 3URPA 3KIIA 1Q40A 1SJWA 4HVNA 5D82A 2KF6A 2P05A 3NBJA 3G8ZA 1UDII 4O2HA 1UGIA 1YGEA 2QGUA 1G02A 3DM8A 2IY2A 4IT7A 1BNJA 1FUTA 4X2HA 3CCJ3 1K8A4 3D3LA 1W6GA 1UGHI 2RBIA 2BHMA
chains in the Genus database with same CATH topology
1A2KA 2XEPA 3S27A 1MNLA 1CEWI 1UI8A 5CLKA 1S723 1D6UA 3RDEA 2CIUA 1GD4A 3EF8A 1W01A 4HM8B 2MC8A 2XFSA 3JUNA 3DXOA 2W56A 5IG0A 1IK3A 1VZZA 3V98A 5JPPA 1N5HA 3EQQB 5AYSC 3G4S3 1L5GB 1Q814 1DVDA 3KSPA 3WMDA 1FGTA 1UI7A 1VQK3 1M9GA 1OHSA 4R1KA 5STDA 5CK6A 3H3HA 3KZTA 3DY5A 4AKYA 4MEIA 1VQ83 1D6YA 3LOYA 3NX0A 1QVG2 1NB3I 4KFDA 2YX9A 2CK3H 1O7MB 3MG3A 5KP3A 3SOYA 3PYJA 5EQLA 2BMOB 1FUWA 3FG1A 4R9LA 3GZYB 3FF0A 4O02B 5IG4A 1IV9A 3BNDA 3FG4A 1E97A 1Z1SA 3KE7A 3CCM3 1LVNA 1O7WB 3X3YA 3T0UA 4HM7B 1G96A 2IMJA 3SXXA 3FF2A 1IT7A 1WMOA 2QA43 3CPW2 3MPHA 1VQ73 1W6YA 1Q864 1IVWA 5KP4A 2IUJA 5G2GA 1IQXA 1RJOA 3WA2X 2GBWB 5IERA 4LZIA 1WMNA 2Z6BA 4QWTA 2RFRA 4X2OA 2IA7A 4EC6A 1M1K4 2XR8B 4FMDA 2CFKA 3QRDA 3WA3A 3LH4A 3OW22 2O3OA 2FXTA 3S29A 5AEWB 3OXAA 1TU5A 4FR9A 3SVAA 2Z7AA 3G16A 3JUOA 5D83A 3JUPA 3DGLA 2KCDA 2P0MA 3Q90A 2CWUA 1W02A 3LT8A 1IVXA 1Q40B 3OWYA 2XSOB 3NHXA 4K1UA 1KD14 2RCDA 1W4NA 2RSXA 3KSED 3HX8A 3JUMA 1QAKA 4HZ9B 4ZM8A 1CQSA 1OGXA 3X3XA 1PFPA 3N54B 3UB1A 1YJN3 3FGYA 3NQYA 2PNCA 3D9RA 1E3RA 1JB4A 1YVBI 2I9WA 4HZBB 3VGNA 1KC84 5FGOA 1JNQA 4O8SA 2QIYA 2O9UX 2Y73A 5AIIA 1OACA 2XGNA 1US1A 2HMMB 2WGOA 2BMQB 1A67A 1MOLA 1EQKA 3NQZA 5IEOA 4XBTA 3CMA3 3NM7A 6STDA 3F9SA 3B4OA 3BB9A 5IENA 4KZ1A 4CDLA 4K90B 2GXFA 1NO3A 1VQM3 2QEX3 3MHEA 2BNGA 3CCR3 1PU4A 4JRFA 1M904 1D6ZA 1TUHA 4KFFA 3NM2A 4RZMA 2OQEC 4OK0A 4XBXA 5AIFA 1LOXA 3UL5A 2WO0A 4HBRA 3V99A 4XDVA 2MF7A 1OF5A 2OCTA 2CWVA 2GEXA 3M8CA 3VSYA 4U13A 3STDA 4N3VA 2LYXA 1AR0A 4L8PA 3WOEB 3IMAB 1K41A 1AVKA 3BNCA 4OUQA 3KKGA 4CCVA 3RGRA 4WWUC 3NXJA 3OV4A 3DGMA 3TDGA 2E2VA 1JKGB 5ELJA 2WOHA 1N8QA 3NV0A 4TX4A 3O8YA 3LTCA 4L7KA 4R80A 3KN4A 5LC6A 1VQ43 4Q53A 3K9MC 3QK9A 4N6MA 4EV5A 2CHCA 1QMAA 1DVCA 1VQL3 3CME3 2YFLB 1N8R4 3EE1A 3AMOA 1N9JA 1GY5A 4LEHA 4EYCA 1JB5A 1VQN3 1ROAA 1LNHA 2CG1A 3CPOA 2INXA 1NDOB 2ZL8A 3MG2A 3PCRA 1EG9B 3Q1CA 3GZRA 1JN5A 1JV2B 3K7CA 1IQYA 4EV2A 3GZBA 1YJ93 3PCSA 1VQ93 3FSDA 4XM4A 3I0YA 5LC7A 3MKIA 1ULJB 3EJVA 4KVHA 1J2BA 5IEPA 1C7HA 1GS3A 1SPUA 2GU1A 1OUNA 8CHOA 2CW9A 2XH9A 3CNMA 3PS8A 2XFTA 3S5CA 3LTDA 2HMLB 5KP1A 3CC23 3GZXB 1A90A 1STFI 3G6E3 1ULIB 2D42A 2OWPA 1ROVA 1EKMA 1TIJA 3NBRA 1W7CA 2E2TA 2L4VA 4HYZA 3ECFA 2XSHB 2C10A 4WP5A 4NREA 3WODG 1QAFA 1RN7A 2JQ5A 2W6JH 4K1VA 1CYVA 2CG0A 5FW5A 3F40A 2FNQA 4EBGA 1KSIA 1WTHA 3PZWA 3I563 1OHOA 4HM0B 2LQVA 4FCJA 1UW1A 2W9PA 3EB8A 1W00A 4BTWA 1K9M4 3SEDA 2YFJB 3T8UA 3HK4A 4N6UA 1O7HB 3OX9A 1DMMA 3KFQC 1A2VA 1TP6A 5IG5A 3MYTA 4G1MB 4RBNA 3J7Yd 2OTL3 1YIT3 1NJI4 3B8LA 3CU3A 1IVUA 4N6TA 3GAXA 5AIGA 1STDA 3PGBA 2WGQA 1O7PB 2ML6A 2W04A 2OOVA 1Y4KA 5AIHA 1SIHA 1UUWB 1W2B2 2W56B 1WQLB 4HM5B 1IT8A 1K734 1GY7A 3HZPA 5EEOA 2P38A 5IW9A 1DMNA 2BMRB 5A0OB 4WFOA 5TGNA 3RGAA 4BTXA 3CNXA 4JF8A 5IF6A 2KXGA 3ALAA 4WYKA 2BT3A 3NBBA 2P0XA 4RNZA 3G713 1R4CA 5D81A 1RKYA 2F86B 3U97A 2Y74A 3V92A 3PXMA 3K5TA 2Z77A 2XGLA 3LYGA 4N6LA 1FGMA 4HM2B 2CWTA 1U8CB 2YFIB 2ZDJA 2K0MA 3F14A 4RNYA 2WOFA 3LXUX 3U1WA 3A76A 1IDPA 1QVF2 1VQP3 4XBYA 5IG3A 1QJGA 2CC3A 1GY6A 4K61A 3HIGA 4HKVB 3OWSA 3JVCA 1FGQA 1RRLA 3MSOA 4J8TA 3SX1A 1Q42A 4HM1B 4STDA 2SBLA 1W6CA 3BLZA 3S28A 4XB5A 3EN1B 2KRTA 1KQS2 2R4IA 1U5OA 2FGTA 4FCMA 3Q2PA 4LSOA 3FZWA 4R9KA 3CCL3 3ER7A 1HKXA 3G0KA 3UJMA 3CXC2 4FMAA 3X40A 3WDGB 4BTYA 3GWRA 4MJDA 4LGQA 1SIIA 3EC9A 3HIIA 3H51A 1S5AA 1FGRA 1GYBA 1V74A 1ZO2A 1JJ22 1EA2A 2P09A 2W0QA 4MMXB 5BXQA 3BNBA 1DMQA 1RRHA 3MWZA 5AI1A 1ASKA 3DUKA 4H3UA 1YHQ3 4GL6A 1W5ZA 2W2CA 2XRXB 3OWUA 1O7GB 4WHAA 4FMCA 3F8HA 1YJW3 4O3VA 2B24B 4FMBA 2GEYA 3CC73 3NUVA 2F98A 4WYKB 3UL6A 3T8NA 1OGZA 1QALA 2HMKB 2XF3A 3LTAA 2HMNB 1TFOA 1IU7A 3F8XA 1CYUA 2ML5A 1OF5B 5JBSA 1KWIA 4HM6B 3FLJA 3FCSB 4NHFA 1AVLA 1OH0A 5ELUA 1K28A 4IPBA 3UNLA 4XDWA 2Q07A 3EHCA 2K54A 2IUKA 1FA3A 2C11A 3X42A 3CCE3 2V1LA 3FG3A 4OVMA 4N6V0 1TFKA 3CC43 1T5YA 2M7OA 3K63A 1YIJ3 2JDIH 3JUQA 1WMPA 5CF2A 2CFGA 3NV0B 4FCZA 3DGOA 5CXOA 3EBTA 4AKZA 1HU9A 4PEJA 1F8NA 3HI7A 4LMIA 1JKGA 1JB2A 1VQO3 1GD3A 1VQ53 4HM4B 2PZVA 3DZLA 3AMOB 3E99A 2OTJ3 4AEQA 3MG1A 4N6NB 3CD63 3F7SA 1NWWA 2A15A 4ORLA 1DYUA 2HMOB 5AEUB 3CCV3 4J9AA 4H61A 3VF1A 1ISKA 4GB5A 3IJEB 2GBXB 1SQWA 3LMLA 1JN5B 2CFDA 1WNHA 3N8BA 4EXRA 3DMCA 3EN8A 1ZX2A 1FGOA 2OOVC 2D1WA 1Q7Y4 5AYRB 1N5PA 3CCS3 2CFWA 4IIAA 1W2ZA 2HMJB 2CKFB 4HJLB 1JRQA 7STDA 4MMZB 5HGRA 2OQEA 1IV7A 1OPYA 2UX0A 2W9QA 1OCVA 4R4KA 2RGQA 4MMYB 3B7CA 2F99A 2B1XB 3X41A 1E3VA 3BNEA 3LTBA 1O7NB 5I97A 3CCU3 2GU3A 5CF1A 3GRDA 3FH1A 3F7XA 1M1XB 1OHPA 3WOFB 3K0ZA 1Q824 3N9HA 2STDA 4KFEA 2CFLA 3FKAA 1NU3A 3B4PA 4N6OB 2E2UA 4L8OA 5DREA 1IQ8A 2Z76A 3SOAA 1AV4A 3DGNA 3SLUA 1N9EA 5JPUA 4I4KA 3CCQ3 5DRVA 1IVVA 3LT9A 3X3ZA 5BVBA 1UUVB 3L0RA 1VQ63 1BUQA 3LZAA 3IPTA 1YI23 2W03A 1LXEA 2CH9A 3EBYA 3EX9A 3ROBA 4HM3B 3S67A 2BO9B 3I553 1NB5I 3KIIA 1Q40A 1SJWA 4HVNA 5D82A 2P05A 3NBJA 3G8ZA 4O2HA 2QGUA 1YGEA 3DM8A 4X2HA 5EVHA 3CCJ3 4IT7A 1K8A4 3D3LA 1W6GA 2BHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2K A;  5CLK A;  3EF8 A;  1W01 A;  4HM8 B;  3JUN A;  3DXO A;  5IG0 A;  1VZZ A;  5JPP A;  3EQQ B;  3KSP A;  3WMD A;  1OHS A;  4R1K A;  5STD A;  5CK6 A;  3H3H A;  3KZT A;  1O7M B;  3MG3 A;  5KP3 A;  3SOY A;  2BMO B;  4R9L A;  3GZY B;  3FF0 A;  5IG4 A;  1E97 A;  1Z1S A;  3KE7 A;  1O7W B;  4HM7 B;  2IMJ A;  3FF2 A;  1W6Y A;  5KP4 A;  5G2G A;  2GBW B;  5IER A;  2RFR A;  4X2O A;  2XR8 B;  5AEW B;  3OXA A;  2Z7A A;  3G16 A;  3JUO A;  5D83 A;  3JUP A;  3Q90 A;  1W02 A;  1Q40 B;  3OWY A;  2XSO B;  3NHX A;  4K1U A;  2RCD A;  3HX8 A;  3JUM A;  4HZ9 B;  1CQS A;  1OGX A;  3FGY A;  3D9R A;  1E3R A;  1JB4 A;  4HZB B;  2I9W A;  3VGN A;  2QIY A;  5AII A;  2HMM B;  2BMQ B;  5IEO A;  4XBT A;  6STD A;  3F9S A;  3B4O A;  3BB9 A;  5IEN A;  4CDL A;  2GXF A;  3MHE A;  2BNG A;  1TUH A;  3NM2 A;  4RZM A;  5AIF A;  4XBX A;  4XDV A;  1OF5 A;  2GEX A;  3M8C A;  3VSY A;  4U13 A;  3STD A;  4N3V A;  1AR0 A;  4L8P A;  1K41 A;  4OUQ A;  3KKG A;  3RGR A;  4WWU C;  3NXJ A;  3OV4 A;  1JKG B;  3NV0 A;  4L7K A;  4Q53 A;  2CHC A;  1QMA A;  2YFL B;  1GY5 A;  4LEH A;  1JB5 A;  3CPO A;  2INX A;  1NDO B;  3MG2 A;  1EG9 B;  3GZR A;  1JN5 A;  3K7C A;  3GZB A;  3FSD A;  4XM4 A;  3I0Y A;  3MKI A;  1ULJ B;  3EJV A;  4KVH A;  5IEP A;  1C7H A;  1GS3 A;  8CHO A;  1OUN A;  3CNM A;  3S5C A;  2HML B;  5KP1 A;  3GZX B;  1ULI B;  2OWP A;  3NBR A;  3ECF A;  2XSH B;  4WP5 A;  2JQ5 A;  4K1V A;  5FW5 A;  3F40 A;  1OHO A;  4HM0 B;  4FCJ A;  1W00 A;  3SED A;  2YFJ B;  3T8U A;  3HK4 A;  1O7H B;  3OX9 A;  1DMM A;  1TP6 A;  5IG5 A;  3MYT A;  3B8L A;  3CU3 A;  5AIG A;  1STD A;  1O7P B;  5AIH A;  1UUW B;  1WQL B;  4HM5 B;  1GY7 A;  3HZP A;  1DMN A;  2BMR B;  5TGN A;  3RGA A;  3CNX A;  5IF6 A;  4WYK A;  5D81 A;  2F86 B;  2Z77 A;  3LYG A;  4HM2 B;  2YFI B;  3F14 A;  3A76 A;  1IDP A;  4XBY A;  5IG3 A;  1QJG A;  1GY6 A;  4HKV B;  3OWS A;  3MSO A;  4J8T A;  1Q42 A;  4HM1 B;  4STD A;  3BLZ A;  4XB5 A;  3EN1 B;  2R4I A;  1U5O A;  4FCM A;  3FZW A;  4R9K A;  3ER7 A;  1HKX A;  3G0K A;  3UJM A;  3GWR A;  4MJD A;  4LGQ A;  3EC9 A;  3H51 A;  1S5A A;  1GYB A;  1ZO2 A;  1EA2 A;  5BXQ A;  1DMQ A;  5AI1 A;  1ASK A;  3DUK A;  4H3U A;  2W2C A;  2XRX B;  3OWU A;  1O7G B;  3F8H A;  2B24 B;  2GEY A;  3NUV A;  2F98 A;  4WYK B;  3T8N A;  1OGZ A;  2HMK B;  2HMN B;  3F8X A;  1OF5 B;  4HM6 B;  3FLJ A;  1OH0 A;  3UNL A;  4XDW A;  3EHC A;  2K54 A;  4OVM A;  3JUQ A;  5CF2 A;  3NV0 B;  5CXO A;  3EBT A;  4PEJ A;  4LMI A;  1JKG A;  4HM4 B;  2PZV A;  3DZL A;  3E99 A;  3MG1 A;  3F7S A;  1NWW A;  2A15 A;  4ORL A;  2HMO B;  5AEU B;  4J9A A;  1ISK A;  4GB5 A;  2GBX B;  1JN5 B;  3DMC A;  3EN8 A;  1ZX2 A;  4IIA A;  2HMJ B;  2CKF B;  4HJL B;  7STD A;  5HGR A;  1OPY A;  2UX0 A;  1OCV A;  2RGQ A;  3B7C A;  2F99 A;  2B1X B;  1E3V A;  1O7N B;  5CF1 A;  3GRD A;  3FH1 A;  3F7X A;  1OHP A;  3K0Z A;  2STD A;  3FKA A;  1NU3 A;  3B4P A;  4L8O A;  5DRE A;  2Z76 A;  3SOA A;  5JPU A;  4I4K A;  5DRV A;  5BVB A;  1UUV B;  1BUQ A;  3LZA A;  3IPT A;  3ROB A;  3EX9 A;  3EBY A;  4HM3 B;  1Q40 A;  1SJW A;  4HVN A;  5D82 A;  3G8Z A;  2QGU A;  3DM8 A;  4X2H A;  5EVH A;  1JB2 A; 
#chains in the Genus database with same CATH topology
 1A2K A;  2XEP A;  3S27 A;  1B2S A;  1MNL A;  1CEW I;  1UI8 A;  5CLK A;  2BU4 A;  1S72 3;  1D6U A;  3RDE A;  2CIU A;  1GD4 A;  3EF8 A;  1BRK A;  1W01 A;  4HM8 B;  2MC8 A;  2XFS A;  3JUN A;  4BIR A;  3DXO A;  2W56 A;  5IG0 A;  1CH0 A;  1IK3 A;  1VZZ A;  3V98 A;  5JPP A;  1N5H A;  3EQQ B;  5AYS C;  1B20 A;  3G4S 3;  1L5G B;  1YGW A;  1Q81 4;  1DVD A;  3KSP A;  3WMD A;  1FGT A;  2F5W A;  1UI7 A;  1VQK 3;  1M9G A;  1OHS A;  4R1K A;  1JBR A;  5STD A;  5CK6 A;  3H3H A;  3KZT A;  4LYL B;  3DY5 A;  4AKY A;  4MEI A;  1VQ8 3;  1D6Y A;  3LOY A;  3NX0 A;  1QVG 2;  1NB3 I;  1BGS A;  2YX9 A;  4KFD A;  2CK3 H;  1O7M B;  3MG3 A;  1GMQ A;  5KP3 A;  3SOY A;  3PYJ A;  5EQL A;  2BMO B;  1B27 A;  1FUW A;  2HOH A;  1T2I A;  3FG1 A;  4R9L A;  3GZY B;  3FF0 A;  4O02 B;  5IG4 A;  1IV9 A;  3BND A;  2UUG C;  3FG4 A;  1E97 A;  1Z1S A;  3KE7 A;  3CCM 3;  1LVN A;  1O7W B;  3X3Y A;  3AHS A;  4BU4 A;  3T0U A;  4HM7 B;  1G96 A;  2IMJ A;  3SXX A;  3FF2 A;  1IT7 A;  1WMO A;  2QA4 3;  3CPW 2;  3MPH A;  1VQ7 3;  1W6Y A;  1Q86 4;  1IVW A;  9RNT A;  2IUJ A;  5KP4 A;  5G2G A;  1IQX A;  2H0I A;  1B2X A;  1RJO A;  3WA2 X;  1B2Z A;  1BNI A;  2GBW B;  5IER A;  4LZI A;  5M1A A;  1GOU A;  1WMN A;  2Z6B A;  1GOY A;  4QWT A;  2RFR A;  2GSP A;  4X2O A;  2IA7 A;  4EC6 A;  1M1K 4;  2XR8 B;  2CX0 A;  4FMD A;  2CFK A;  3QRD A;  3WA3 A;  3LH4 A;  3OW2 2;  8RNT A;  2O3O A;  1AY7 A;  2FXT A;  3S29 A;  5AEW B;  3OXA A;  1TU5 A;  1TRP A;  4FR9 A;  4RNT A;  3SVA A;  2Z7A A;  3G16 A;  3JUO A;  5D83 A;  3JUP A;  2H0H A;  3DGL A;  2KCD A;  2P0M A;  3Q90 A;  2CWU A;  1W02 A;  3LT8 A;  1IVX A;  1Q40 B;  3OWY A;  1VQQ A;  2XSO B;  1BRH A;  3NHX A;  4K1U A;  1KD1 4;  2RCD A;  1W4N A;  2RSX A;  3KSE D;  3HX8 A;  3JUM A;  1BSB A;  1QAK A;  2K3D A;  4HZ9 B;  4ZM8 A;  1CQS A;  4HAA A;  1OGX A;  3X3X A;  1PFP A;  3N54 B;  3UB1 A;  1YJN 3;  3FGY A;  1JZD A;  3NQY A;  2PNC A;  3D9R A;  1E3R A;  1JB4 A;  1YVB I;  2I9W A;  4HZB B;  1BSE A;  3VGN A;  1KC8 4;  5FGO A;  1JNQ A;  4O8S A;  2QIY A;  2O9U X;  4ILF A;  2Y73 A;  5AII A;  1OAC A;  1RGC A;  2IYJ A;  2XGN A;  1US1 A;  2HMM B;  2WGO A;  2BMQ B;  1A67 A;  1MOL A;  1EQK A;  1T3B A;  3NQZ A;  4XBT A;  5IEO A;  3CMA 3;  3NM7 A;  6STD A;  3F9S A;  3B4O A;  3BB9 A;  5IEN A;  4KZ1 A;  4CDL A;  4K90 B;  2GXF A;  1NO3 A;  1VQM 3;  2QEX 3;  3MHE A;  1G0T A;  2BNG A;  1PU4 A;  4JRF A;  4CPK A;  3CCR 3;  1D6Z A;  1M90 4;  2RNT A;  1TUH A;  4KFF A;  3NM2 A;  4RZM A;  2OQE C;  4OK0 A;  4XBX A;  5AIF A;  1LOX A;  1GOV A;  3BU4 A;  3UL5 A;  2KF3 A;  2WO0 A;  4HBR A;  4XDV A;  2MF7 A;  1OF5 A;  3V99 A;  3WHO A;  2OCT A;  2CWV A;  1BU4 A;  2GEX A;  3M8C A;  1MWU A;  3VSY A;  4BL2 A;  1PYL A;  4U13 A;  3STD A;  4N3V A;  2LYX A;  1AR0 A;  4L8P A;  1MWT A;  1RGH A;  3WOE B;  3IMA B;  1K41 A;  1AVK A;  3BNC A;  4OUQ A;  3KKG A;  4CCV A;  3RGR A;  4WWU C;  3NXJ A;  3OV4 A;  1UCJ A;  3DGM A;  3TDG A;  2E2V A;  1B2M A;  1JKG B;  5ELJ A;  2WOH A;  1N8Q A;  3NV0 A;  4TX4 A;  3O8Y A;  3LTC A;  4L7K A;  4R80 A;  3KN4 A;  5LC6 A;  1VQ4 3;  4Q53 A;  3K9M C;  3QK9 A;  4N6M A;  4EV5 A;  1BRS A;  2CHC A;  1QMA A;  1DVC A;  4NPB A;  1VQL 3;  3CME 3;  2YFL B;  1N8R 4;  3EE1 A;  3AMO A;  1N9J A;  4CJN A;  1GY5 A;  2C4B A;  1HYF A;  4LEH A;  4EYC A;  1JB5 A;  1VQN 3;  1ROA A;  1LNH A;  2CG1 A;  1MWR A;  3CPO A;  2INX A;  1NDO B;  1RLS A;  2ZL8 A;  1I3F A;  3MG2 A;  1EG9 B;  3PCR A;  3Q1C A;  3GZR A;  6GSP A;  1JN5 A;  1JV2 B;  3K7C A;  2KF4 A;  1IQY A;  1X1Y A;  3GZB A;  1BSD A;  4EV2 A;  1UCI A;  3ZG5 A;  1YJ9 3;  3PCS A;  1VQ9 3;  3FSD A;  4XM4 A;  3I0Y A;  5LC7 A;  3MKI A;  1ULJ B;  1LOY A;  1RGE A;  1YNV X;  3EJV A;  4KVH A;  1J2B A;  5IEP A;  1C7H A;  1GS3 A;  1SPU A;  2GU1 A;  1OUN A;  8CHO A;  1JBT A;  1BSC A;  1RTU A;  2CW9 A;  1UCK A;  2XH9 A;  3CNM A;  4HOH A;  3PS8 A;  2XFT A;  3S5C A;  3LTD A;  1TRQ A;  2HML B;  5KP1 A;  3CC2 3;  2H0G A;  3AHW A;  3GZX B;  1A90 A;  1STF I;  3G6E 3;  1FZU A;  1RDS A;  1ULI B;  2D42 A;  2OWP A;  1ROV A;  1EKM A;  1TIJ A;  3NBR A;  1W7C A;  2E2T A;  2L4V A;  4HYZ A;  1LNI A;  3ECF A;  1MWS A;  2XSH B;  2C10 A;  4WP5 A;  4NRE A;  3WOD G;  1QAF A;  1RN7 A;  1UUG B;  2JQ5 A;  2W6J H;  1RSN A;  4K1V A;  1CYV A;  1I0X A;  2CG0 A;  5FW5 A;  3F40 A;  2FNQ A;  4EBG A;  1KSI A;  1WTH A;  3PZW A;  1UCL A;  3I56 3;  1OHO A;  4HM0 B;  2LQV A;  4FCJ A;  1UW1 A;  2W9P A;  3EB8 A;  1W00 A;  4BTW A;  5BU4 A;  1K9M 4;  3SED A;  2YFJ B;  3T8U A;  1RCK A;  3HK4 A;  4N6U A;  1O7H B;  3OX9 A;  1I2G A;  1DMM A;  3KFQ C;  1A2V A;  1TP6 A;  5IG5 A;  3MYT A;  4G1M B;  4RBN A;  5EVH A;  3J7Y d;  1YIT 3;  1T2H A;  3B8L A;  3CU3 A;  1IVU A;  4N6T A;  3D79 A;  3GAX A;  5AIG A;  1NJI 4;  1I0V A;  1STD A;  1R4Y A;  3PGB A;  2WGQ A;  1O7P B;  2ML6 A;  2W04 A;  2OOV A;  1Y4K A;  5AIH A;  1BRI A;  1SIH A;  1LOW A;  1UUW B;  5BIR A;  1FUS A;  1W2B 2;  2W56 B;  3AGO A;  1WQL B;  4HM5 B;  1IT8 A;  1K73 4;  1GY7 A;  3HZP A;  5EEO A;  2P38 A;  5IW9 A;  1DMN A;  2BMR B;  5A0O B;  1BNF A;  4WFO A;  1X1X A;  3GSP A;  1AQZ A;  5TGN A;  3RGA A;  4BTX A;  3CNX A;  4JF8 A;  5IF6 A;  3Q3F A;  2KXG A;  3ALA A;  1B21 A;  4WYK A;  1MGR A;  1RGG A;  2BT3 A;  3NBB A;  2P0X A;  4RNZ A;  3G71 3;  1R4C A;  5D81 A;  1RKY A;  2F86 B;  1ZGX A;  3U97 A;  2Y74 A;  3V92 A;  3PXM A;  3K5T A;  2Z77 A;  2XGL A;  1RN4 A;  1EEJ A;  3LYG A;  1HZ1 A;  4N6L A;  1FGM A;  1B3S A;  2CWT A;  4HM2 B;  1U8C B;  2YFI B;  2ZDJ A;  1BRG A;  2K0M A;  2CX1 A;  3F14 A;  4RNY A;  1GMP A;  2WOF A;  3LXU X;  3U1W A;  3A76 A;  4GSP A;  1IDP A;  5RNT A;  1QVF 2;  1VQP 3;  4XBY A;  5IG3 A;  1QJG A;  2CC3 A;  1BNR A;  1GY6 A;  4K61 A;  3HIG A;  4HKV B;  1BAN A;  2L1S A;  3OWS A;  3JVC A;  1FGQ A;  1RGK A;  1GMR A;  1RRL A;  5HOH A;  2F56 A;  3MSO A;  4J8T A;  3SX1 A;  1Q42 A;  4HM1 B;  4STD A;  2BIR A;  1W6C A;  2SBL A;  2SAR A;  3BLZ A;  3S28 A;  4XB5 A;  3EN1 B;  1EUI C;  2KRT A;  1KQS 2;  3SYU A;  2R4I A;  1U5O A;  2FGT A;  4FCM A;  4GHO A;  5M18 A;  3Q2P A;  4LSO A;  3FZW A;  4R9K A;  3CCL 3;  3ER7 A;  1GSP A;  1HKX A;  1LQG C;  3G0K A;  3UJM A;  3CXC 2;  4FMA A;  3X40 A;  3WDG B;  4BTY A;  1RCL A;  3GWR A;  4MJD A;  4LGQ A;  1BNG A;  1SII A;  5G1K A;  1RNT A;  3EC9 A;  3HII A;  3H51 A;  1S5A A;  1FGR A;  1GYB A;  1RMS A;  1V74 A;  1ZO2 A;  1JJ2 2;  1EA2 A;  2P09 A;  2W0Q A;  4MMX B;  5BXQ A;  3BNB A;  1DMQ A;  1RRH A;  1BVI A;  3MWZ A;  5AI1 A;  1JBS A;  1ASK A;  3DUK A;  1RGA A;  1X1U A;  4H3U A;  1YHQ 3;  4GL6 A;  1LOV A;  1W5Z A;  2W2C A;  2AAE A;  2XRX B;  3HOH A;  1O7G B;  2KAA A;  3OWU A;  4BL3 A;  4WHA A;  4FMC A;  3F8H A;  1YJW 3;  4O3V A;  2B24 B;  3KCH A;  3DH2 A;  4FMB A;  1V58 A;  2GEY A;  4J5G A;  3CC7 3;  3NUV A;  2F98 A;  1ZS7 A;  4WYK B;  1TJD A;  1RN1 A;  3UL6 A;  1DE3 A;  3T8N A;  1OGZ A;  1QAL A;  1LRA A;  2HMK B;  2XF3 A;  1Q7H A;  1RGF A;  3LTA A;  1MGW A;  2HMN B;  1TFO A;  1IU7 A;  3F8X A;  1CYU A;  2ML5 A;  1OF5 B;  3AGN A;  3BIR A;  5JBS A;  1KWI A;  4HM6 B;  3FLJ A;  3FCS B;  4NHF A;  1AVL A;  1OH0 A;  5ELU A;  1K28 A;  4IPB A;  3UNL A;  4XDW A;  2Q07 A;  3EHC A;  1X1W A;  2IUK A;  2K54 A;  2C11 A;  3X42 A;  3CCE 3;  2V1L A;  3FG3 A;  4OVM A;  4N6V 0;  1FA3 A;  1TFK A;  3CC4 3;  1T5Y A;  2M7O A;  2AAD A;  3K63 A;  1YIJ 3;  1IYY A;  1BSA A;  2JDI H;  1WMP A;  3JUQ A;  5CF2 A;  2ZA4 A;  3ZFZ A;  4KT3 B;  2CFG A;  3NV0 B;  1BIR A;  4FCZ A;  3DGO A;  5CXO A;  3EBT A;  4AKZ A;  1HU9 A;  4PEJ A;  1F8N A;  3HI7 A;  4LMI A;  2ZHX B;  1JKG A;  1JB2 A;  1C54 A;  1I2F A;  1VQO 3;  1GD3 A;  1VQ5 3;  4HM4 B;  2PZV A;  1V57 A;  3DZL A;  4EW5 A;  3AMO B;  3E99 A;  2OTJ 3;  1BRJ A;  4AEQ A;  3MG1 A;  4N6N B;  3WR2 A;  3CD6 3;  3F7S A;  1NWW A;  2A15 A;  4ORL A;  1DYU A;  2HMO B;  1LQM B;  5AEU B;  1BRN L;  1JZO A;  3CCV 3;  4J9A A;  1DET A;  1SAR A;  4H61 A;  3VF1 A;  6RNT A;  1ISK A;  4GB5 A;  3IJE B;  2GBX B;  1SQW A;  3LML A;  1JN5 B;  1PY3 A;  1FYS A;  3ZG0 A;  2CFD A;  1WNH A;  1Q9E A;  3N8B A;  4EXR A;  3DMC A;  3EN8 A;  1ZX2 A;  1FGO A;  1RHL A;  3A5E A;  5G1L A;  4DKI A;  2OOV C;  1BNS A;  2D1W A;  1Q7Y 4;  2F5M A;  1N5P A;  5AYR B;  3DGY A;  2KF5 A;  2CFW A;  3CCS 3;  4IIA A;  1W2Z A;  1B2U A;  2HMJ B;  7RNT A;  2CKF B;  4HJL B;  1JRQ A;  2F4Y A;  7STD A;  3D5G A;  4MMZ B;  5HGR A;  1BOX A;  1IV7 A;  1OPY A;  2UX0 A;  2W9Q A;  2OQE A;  1OCV A;  7GSP A;  1A2P A;  2J8X B;  2RGQ A;  4MMY B;  4R4K A;  3D5I A;  3B7C A;  2OTL 3;  2F99 A;  2B1X B;  3X41 A;  5GSP A;  1E3V A;  1BNE A;  3BNE A;  3LTB A;  1O7N B;  5I97 A;  3CCU 3;  3D4A A;  1RNB A;  2GU3 A;  5CF1 A;  3GRD A;  3FH1 A;  1RGL A;  3F7X A;  1M1X B;  1BAO A;  1I70 A;  1OHP A;  3K0Z A;  3WOF B;  5M19 A;  1Q82 4;  3N9H A;  2STD A;  4KFE A;  2CFL A;  2UGI A;  3FKA A;  1NU3 A;  3B4P A;  3RNT A;  4N6O B;  2E2U A;  1YVS A;  1I8V A;  1NNV A;  4L8O A;  5DRE A;  1IQ8 A;  2Z76 A;  3SOA A;  1AV4 A;  4I5Q A;  3DGN A;  2R41 A;  3SLU A;  1N9E A;  5JPU A;  4I4K A;  3CCQ 3;  1FW7 A;  5DRV A;  1I2E A;  1IVV A;  3LT9 A;  3X3Z A;  5BVB A;  1I3I A;  1UUV B;  3L0R A;  1VQ6 3;  1BUQ A;  3LZA A;  3IPT A;  1YI2 3;  2W03 A;  1LXE A;  2CH9 A;  3EBY A;  3EX9 A;  3ROB A;  4HM3 B;  3S67 A;  2BO9 B;  1TTO A;  4J5K A;  3I55 3;  1BUJ A;  1NB5 I;  3URP A;  3KII A;  1Q40 A;  1SJW A;  4HVN A;  5D82 A;  2KF6 A;  2P05 A;  3NBJ A;  3G8Z A;  1UDI I;  4O2H A;  1UGI A;  1YGE A;  2QGU A;  1G02 A;  3DM8 A;  2IY2 A;  4IT7 A;  1BNJ A;  1FUT A;  4X2H A;  3CCJ 3;  1K8A 4;  3D3L A;  1W6G A;  1UGH I;  2RBI A;  2BHM A; 
#chains in the Genus database with same CATH homology
 1A2K A;  2XEP A;  3S27 A;  1MNL A;  1CEW I;  1UI8 A;  5CLK A;  1S72 3;  1D6U A;  3RDE A;  2CIU A;  1GD4 A;  3EF8 A;  1W01 A;  4HM8 B;  2MC8 A;  2XFS A;  3JUN A;  3DXO A;  2W56 A;  5IG0 A;  1IK3 A;  1VZZ A;  3V98 A;  5JPP A;  1N5H A;  3EQQ B;  5AYS C;  3G4S 3;  1L5G B;  1Q81 4;  1DVD A;  3KSP A;  3WMD A;  1FGT A;  1UI7 A;  1VQK 3;  1M9G A;  1OHS A;  4R1K A;  5STD A;  5CK6 A;  3H3H A;  3KZT A;  3DY5 A;  4AKY A;  4MEI A;  1VQ8 3;  1D6Y A;  3LOY A;  3NX0 A;  1QVG 2;  1NB3 I;  4KFD A;  2YX9 A;  2CK3 H;  1O7M B;  3MG3 A;  5KP3 A;  3SOY A;  3PYJ A;  5EQL A;  2BMO B;  1FUW A;  3FG1 A;  4R9L A;  3GZY B;  3FF0 A;  4O02 B;  5IG4 A;  1IV9 A;  3BND A;  3FG4 A;  1E97 A;  1Z1S A;  3KE7 A;  3CCM 3;  1LVN A;  1O7W B;  3X3Y A;  3T0U A;  4HM7 B;  1G96 A;  2IMJ A;  3SXX A;  3FF2 A;  1IT7 A;  1WMO A;  2QA4 3;  3CPW 2;  3MPH A;  1VQ7 3;  1W6Y A;  1Q86 4;  1IVW A;  5KP4 A;  2IUJ A;  5G2G A;  1IQX A;  1RJO A;  3WA2 X;  2GBW B;  5IER A;  4LZI A;  1WMN A;  2Z6B A;  4QWT A;  2RFR A;  4X2O A;  2IA7 A;  4EC6 A;  1M1K 4;  2XR8 B;  4FMD A;  2CFK A;  3QRD A;  3WA3 A;  3LH4 A;  3OW2 2;  2O3O A;  2FXT A;  3S29 A;  5AEW B;  3OXA A;  1TU5 A;  4FR9 A;  3SVA A;  2Z7A A;  3G16 A;  3JUO A;  5D83 A;  3JUP A;  3DGL A;  2KCD A;  2P0M A;  3Q90 A;  2CWU A;  1W02 A;  3LT8 A;  1IVX A;  1Q40 B;  3OWY A;  2XSO B;  3NHX A;  4K1U A;  1KD1 4;  2RCD A;  1W4N A;  2RSX A;  3KSE D;  3HX8 A;  3JUM A;  1QAK A;  4HZ9 B;  4ZM8 A;  1CQS A;  1OGX A;  3X3X A;  1PFP A;  3N54 B;  3UB1 A;  1YJN 3;  3FGY A;  3NQY A;  2PNC A;  3D9R A;  1E3R A;  1JB4 A;  1YVB I;  2I9W A;  4HZB B;  3VGN A;  1KC8 4;  5FGO A;  1JNQ A;  4O8S A;  2QIY A;  2O9U X;  2Y73 A;  5AII A;  1OAC A;  2XGN A;  1US1 A;  2HMM B;  2WGO A;  2BMQ B;  1A67 A;  1MOL A;  1EQK A;  3NQZ A;  5IEO A;  4XBT A;  3CMA 3;  3NM7 A;  6STD A;  3F9S A;  3B4O A;  3BB9 A;  5IEN A;  4KZ1 A;  4CDL A;  4K90 B;  2GXF A;  1NO3 A;  1VQM 3;  2QEX 3;  3MHE A;  2BNG A;  3CCR 3;  1PU4 A;  4JRF A;  1M90 4;  1D6Z A;  1TUH A;  4KFF A;  3NM2 A;  4RZM A;  2OQE C;  4OK0 A;  4XBX A;  5AIF A;  1LOX A;  3UL5 A;  2WO0 A;  4HBR A;  3V99 A;  4XDV A;  2MF7 A;  1OF5 A;  2OCT A;  2CWV A;  2GEX A;  3M8C A;  3VSY A;  4U13 A;  3STD A;  4N3V A;  2LYX A;  1AR0 A;  4L8P A;  3WOE B;  3IMA B;  1K41 A;  1AVK A;  3BNC A;  4OUQ A;  3KKG A;  4CCV A;  3RGR A;  4WWU C;  3NXJ A;  3OV4 A;  3DGM A;  3TDG A;  2E2V A;  1JKG B;  5ELJ A;  2WOH A;  1N8Q A;  3NV0 A;  4TX4 A;  3O8Y A;  3LTC A;  4L7K A;  4R80 A;  3KN4 A;  5LC6 A;  1VQ4 3;  4Q53 A;  3K9M C;  3QK9 A;  4N6M A;  4EV5 A;  2CHC A;  1QMA A;  1DVC A;  1VQL 3;  3CME 3;  2YFL B;  1N8R 4;  3EE1 A;  3AMO A;  1N9J A;  1GY5 A;  4LEH A;  4EYC A;  1JB5 A;  1VQN 3;  1ROA A;  1LNH A;  2CG1 A;  3CPO A;  2INX A;  1NDO B;  2ZL8 A;  3MG2 A;  3PCR A;  1EG9 B;  3Q1C A;  3GZR A;  1JN5 A;  1JV2 B;  3K7C A;  1IQY A;  4EV2 A;  3GZB A;  1YJ9 3;  3PCS A;  1VQ9 3;  3FSD A;  4XM4 A;  3I0Y A;  5LC7 A;  3MKI A;  1ULJ B;  3EJV A;  4KVH A;  1J2B A;  5IEP A;  1C7H A;  1GS3 A;  1SPU A;  2GU1 A;  1OUN A;  8CHO A;  2CW9 A;  2XH9 A;  3CNM A;  3PS8 A;  2XFT A;  3S5C A;  3LTD A;  2HML B;  5KP1 A;  3CC2 3;  3GZX B;  1A90 A;  1STF I;  3G6E 3;  1ULI B;  2D42 A;  2OWP A;  1ROV A;  1EKM A;  1TIJ A;  3NBR A;  1W7C A;  2E2T A;  2L4V A;  4HYZ A;  3ECF A;  2XSH B;  2C10 A;  4WP5 A;  4NRE A;  3WOD G;  1QAF A;  1RN7 A;  2JQ5 A;  2W6J H;  4K1V A;  1CYV A;  2CG0 A;  5FW5 A;  3F40 A;  2FNQ A;  4EBG A;  1KSI A;  1WTH A;  3PZW A;  3I56 3;  1OHO A;  4HM0 B;  2LQV A;  4FCJ A;  1UW1 A;  2W9P A;  3EB8 A;  1W00 A;  4BTW A;  1K9M 4;  3SED A;  2YFJ B;  3T8U A;  3HK4 A;  4N6U A;  1O7H B;  3OX9 A;  1DMM A;  3KFQ C;  1A2V A;  1TP6 A;  5IG5 A;  3MYT A;  4G1M B;  4RBN A;  3J7Y d;  2OTL 3;  1YIT 3;  1NJI 4;  3B8L A;  3CU3 A;  1IVU A;  4N6T A;  3GAX A;  5AIG A;  1STD A;  3PGB A;  2WGQ A;  1O7P B;  2ML6 A;  2W04 A;  2OOV A;  1Y4K A;  5AIH A;  1SIH A;  1UUW B;  1W2B 2;  2W56 B;  1WQL B;  4HM5 B;  1IT8 A;  1K73 4;  1GY7 A;  3HZP A;  5EEO A;  2P38 A;  5IW9 A;  1DMN A;  2BMR B;  5A0O B;  4WFO A;  5TGN A;  3RGA A;  4BTX A;  3CNX A;  4JF8 A;  5IF6 A;  2KXG A;  3ALA A;  4WYK A;  2BT3 A;  3NBB A;  2P0X A;  4RNZ A;  3G71 3;  1R4C A;  5D81 A;  1RKY A;  2F86 B;  3U97 A;  2Y74 A;  3V92 A;  3PXM A;  3K5T A;  2Z77 A;  2XGL A;  3LYG A;  4N6L A;  1FGM A;  4HM2 B;  2CWT A;  1U8C B;  2YFI B;  2ZDJ A;  2K0M A;  3F14 A;  4RNY A;  2WOF A;  3LXU X;  3U1W A;  3A76 A;  1IDP A;  1QVF 2;  1VQP 3;  4XBY A;  5IG3 A;  1QJG A;  2CC3 A;  1GY6 A;  4K61 A;  3HIG A;  4HKV B;  3OWS A;  3JVC A;  1FGQ A;  1RRL A;  3MSO A;  4J8T A;  3SX1 A;  1Q42 A;  4HM1 B;  4STD A;  2SBL A;  1W6C A;  3BLZ A;  3S28 A;  4XB5 A;  3EN1 B;  2KRT A;  1KQS 2;  2R4I A;  1U5O A;  2FGT A;  4FCM A;  3Q2P A;  4LSO A;  3FZW A;  4R9K A;  3CCL 3;  3ER7 A;  1HKX A;  3G0K A;  3UJM A;  3CXC 2;  4FMA A;  3X40 A;  3WDG B;  4BTY A;  3GWR A;  4MJD A;  4LGQ A;  1SII A;  3EC9 A;  3HII A;  3H51 A;  1S5A A;  1FGR A;  1GYB A;  1V74 A;  1ZO2 A;  1JJ2 2;  1EA2 A;  2P09 A;  2W0Q A;  4MMX B;  5BXQ A;  3BNB A;  1DMQ A;  1RRH A;  3MWZ A;  5AI1 A;  1ASK A;  3DUK A;  4H3U A;  1YHQ 3;  4GL6 A;  1W5Z A;  2W2C A;  2XRX B;  3OWU A;  1O7G B;  4WHA A;  4FMC A;  3F8H A;  1YJW 3;  4O3V A;  2B24 B;  4FMB A;  2GEY A;  3CC7 3;  3NUV A;  2F98 A;  4WYK B;  3UL6 A;  3T8N A;  1OGZ A;  1QAL A;  2HMK B;  2XF3 A;  3LTA A;  2HMN B;  1TFO A;  1IU7 A;  3F8X A;  1CYU A;  2ML5 A;  1OF5 B;  5JBS A;  1KWI A;  4HM6 B;  3FLJ A;  3FCS B;  4NHF A;  1AVL A;  1OH0 A;  5ELU A;  1K28 A;  4IPB A;  3UNL A;  4XDW A;  2Q07 A;  3EHC A;  2K54 A;  2IUK A;  1FA3 A;  2C11 A;  3X42 A;  3CCE 3;  2V1L A;  3FG3 A;  4OVM A;  4N6V 0;  1TFK A;  3CC4 3;  1T5Y A;  2M7O A;  3K63 A;  1YIJ 3;  2JDI H;  3JUQ A;  1WMP A;  5CF2 A;  2CFG A;  3NV0 B;  4FCZ A;  3DGO A;  5CXO A;  3EBT A;  4AKZ A;  1HU9 A;  4PEJ A;  1F8N A;  3HI7 A;  4LMI A;  1JKG A;  1JB2 A;  1VQO 3;  1GD3 A;  1VQ5 3;  4HM4 B;  2PZV A;  3DZL A;  3AMO B;  3E99 A;  2OTJ 3;  4AEQ A;  3MG1 A;  4N6N B;  3CD6 3;  3F7S A;  1NWW A;  2A15 A;  4ORL A;  1DYU A;  2HMO B;  5AEU B;  3CCV 3;  4J9A A;  4H61 A;  3VF1 A;  1ISK A;  4GB5 A;  3IJE B;  2GBX B;  1SQW A;  3LML A;  1JN5 B;  2CFD A;  1WNH A;  3N8B A;  4EXR A;  3DMC A;  3EN8 A;  1ZX2 A;  1FGO A;  2OOV C;  2D1W A;  1Q7Y 4;  5AYR B;  1N5P A;  3CCS 3;  2CFW A;  4IIA A;  1W2Z A;  2HMJ B;  2CKF B;  4HJL B;  1JRQ A;  7STD A;  4MMZ B;  5HGR A;  2OQE A;  1IV7 A;  1OPY A;  2UX0 A;  2W9Q A;  1OCV A;  4R4K A;  2RGQ A;  4MMY B;  3B7C A;  2F99 A;  2B1X B;  3X41 A;  1E3V A;  3BNE A;  3LTB A;  1O7N B;  5I97 A;  3CCU 3;  2GU3 A;  5CF1 A;  3GRD A;  3FH1 A;  3F7X A;  1M1X B;  1OHP A;  3WOF B;  3K0Z A;  1Q82 4;  3N9H A;  2STD A;  4KFE A;  2CFL A;  3FKA A;  1NU3 A;  3B4P A;  4N6O B;  2E2U A;  4L8O A;  5DRE A;  1IQ8 A;  2Z76 A;  3SOA A;  1AV4 A;  3DGN A;  3SLU A;  1N9E A;  5JPU A;  4I4K A;  3CCQ 3;  5DRV A;  1IVV A;  3LT9 A;  3X3Z A;  5BVB A;  1UUV B;  3L0R A;  1VQ6 3;  1BUQ A;  3LZA A;  3IPT A;  1YI2 3;  2W03 A;  1LXE A;  2CH9 A;  3EBY A;  3EX9 A;  3ROB A;  4HM3 B;  3S67 A;  2BO9 B;  3I55 3;  1NB5 I;  3KII A;  1Q40 A;  1SJW A;  4HVN A;  5D82 A;  2P05 A;  3NBJ A;  3G8Z A;  4O2H A;  2QGU A;  1YGE A;  3DM8 A;  4X2H A;  5EVH A;  3CCJ 3;  4IT7 A;  1K8A 4;  3D3L A;  1W6G A;  2BHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...