3T8NA

Crystal structure of ketosteroid isomerase y16ad103a from pseudomonas putida
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
NLPTAQEVQGLMARAIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIAVMRFDEHGRIQTMQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, D, F
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8nA00
4STDA 1OHOA 7STDA 3B4OA 3ECFA 2Z77A 1W6YA 2STDA 5IEOA 5BVBA 1QMAA 3DMCA 3E99A 4R9KA 1O7HB 3G16A 4PEJA 3T8NA 2HMKB 2HMOB 3NBRA 4HZ9B 3EBYA 3F7SA 1U5OA 4Q53A 3FH1A 3NM2A 3FF0A 5CXOA 1IDPA 3EX9A 5AEWB 1STDA 4J9AA 5IG3A 1NDOB 5DRVA 3FF2A 2K54A 4H3UA 4XDWA 4HM8B 1Z1SA 3F14A 1VZZA 3NV0B 2YFJB 3GZXB 2INXA 4GB5A 2PZVA 1JKGA 5AEUB 3NHXA 2CHCA 2YFIB 1CQSA 3T8UA 3EN1B 1W02A 8CHOA 1OF5B 1OUNA 3OWUA 2CKFB 3GZYB 5TGNA 5IF6A 1OGXA 4XB5A 2YFLB 5IENA 4XBYA 1E97A 1OH0A 3CPOA 1K41A 4KVHA 3IPTA 1Q40B 3DUKA 5IEPA 1ISKA 3EHCA 3M8CA 1OPYA 4HM3B 2UX0A 3LZAA 3HZPA 3JUQA 3JUNA 5JPPA 3OXAA 1DMQA 1ASKA 4HKVB 4K1VA 4I4KA 1ZX2A 3UNLA 5CF1A 1S5AA 4U13A 4HM7B 4FCMA 1OF5A 3FZWA 2B24B 5STDA 4IIAA 2GEXA 3GRDA 1GY6A 1DMMA 4CDLA 2GBWB 2XSOB 5IG4A 3Q90A 5KP4A 3B8LA 1JB4A 1EA2A 5FW5A 2W2CA 3STDA 5CLKA 1EG9B 3GWRA 4X2OA 4LMIA 2I9WA 5IG0A 2BMQB 3G0KA 3H3HA 3DZLA 4HM5B 3CU3A 3SOAA 2F98A 2R4IA 4XBTA 1E3RA 2JQ5A 3MHEA 1W01A 5AIIA 2Z76A 4HM0B 2GBXB 3ROBA 3MYTA 5CK6A 3MKIA 2RGQA 3VSYA 2BNGA 3EN8A 3EF8A 5HGRA 1O7WB 1OGZA 1JB5A 3JUPA 4WWUC 6STDA 5D82A 3OWSA 4N3VA 1GYBA 3BB9A 3NUVA 5AIHA 2B1XB 5JPUA 2GXFA 3KZTA 4HM2B 3DM8A 1JN5B 1JB2A 2BMRB 3B4PA 2QIYA 3VGNA 2OWPA 3RGAA 5AIGA 3D9RA 1BUQA 5KP1A 1QJGA 4XBXA 1ZO2A 4WYKB 3GZRA 1A2KA 4HM6B 3NV0A 5G2GA 3G8ZA 3FSDA 4R9LA 1GY7A 1OHSA 5CF2A 3MG2A 3HX8A 3RGRA 4XDVA 5EVHA 1E3VA 2RFRA 3F40A 4X2HA 2HMNB 4R1KA 1OCVA 3FGYA 1HKXA 5D81A 4LGQA 3I0YA 3CNXA 1Q40A 3GZBA 3MG3A 3HK4A 5DREA 2F99A 4HM1B 5AIFA 3K7CA 4XM4A 1TUHA 3DXOA 3EC9A 1Q42A 3KSPA 3ER7A 1SJWA 4MJDA 1JKGB 1O7GB 5IG5A 2XRXB 3FLJA 2Z7AA 1ULIB 2HMLB 3F8XA 4L7KA 2XR8B 3F9SA 3OX9A 3H51A 2BMOB 3MSOA 4OUQA 3LYGA 5KP3A 1O7MB 1O7PB 1NWWA 3SOYA 4WP5A 4HJLB 3WMDA 2HMJB 4L8OA 2GEYA 3B7CA 3JUMA 4LEHA 3S5CA 1DMNA 2A15A 3OV4A 1GY5A 1TP6A 1UUWB 1WQLB 2RCDA 3OWYA 1GS3A 3KKGA 1AR0A 5D83A 3MG1A 3UJMA 4L8PA 2QGUA 5AI1A 3SEDA 1O7NB 3EBTA 2XSHB 3BLZA 1ULJB 4K1UA 3A76A 5IERA 2IMJA 3FKAA 4HZBB 4HVNA 3JUOA 2HMMB 4RZMA 3KE7A 3CNMA 4HM4B 1JN5A 4J8TA 3NXJA 3EJVA 3EQQB 3F7XA 1W00A 1UUVB 4OVMA 4FCJA 1C7HA 1OHPA 2F86B 5BXQA 1NU3A 4ORLA 4WYKA 3K0ZA 3F8HA
chains in the Genus database with same CATH superfamily
4STDA 1OHOA 3D5IA 4IPBA 7STDA 2XH9A 1AY7A 2UGIA 3B4OA 4LZIA 3ECFA 2Z77A 1W6YA 4GHOA 2STDA 1RGFA 5IEOA 5BVBA 4G1MB 1QMAA 2HOHA 3WA3A 1BU4A 2O3OA 1K734 1RNTA 1I3FA 4K61A 1BOXA 3DMCA 1YJN3 3WOEB 3E99A 7RNTA 5FGOA 5I97A 3ZG0A 3AGOA 4R9KA 1GOUA 1O7HB 2Y73A 3G16A 4J5GA 4PEJA 3T8NA 3PGBA 3G4S3 3BNBA 1TRPA 2D1WA 2XGNA 2HMKB 2F56A 1TU5A 1GMQA 2HMOB 3NBRA 4HZ9B 2ZDJA 3EBYA 3F7SA 4O8SA 1IV7A 1U5OA 4Q53A 2MF7A 4KFEA 3FH1A 2ZHXB 5LC6A 1IQ8A 1N9JA 2OOVA 3NM2A 1KWIA 2IUKA 3FF0A 5CXOA 1IDPA 1YVBI 2W0QA 3EX9A 2OTL3 3PS8A 2P38A 1BGSA 5AEWB 1I8VA 1UCLA 1OACA 1D6YA 1UI7A 2FGTA 3BU4A 3TDGA 2BIRA 2F5WA 1STDA 2JDIH 4J9AA 3X40A 5IG3A 1NDOB 3QK9A 1X1WA 1RRHA 2P0XA 3D3LA 5DRVA 5EEOA 1PYLA 3FF2A 1WTHA 1PY3A 2K54A 1BAOA 1BSEA 4H3UA 2UUGC 4HM8B 4MEIA 1Z1SA 2CIUA 3F14A 4XDWA 3BNCA 1VZZA 3NV0B 1GSPA 2E2VA 2YFJB 3GZXB 3Q2PA 2INXA 3DGMA 4GB5A 2PZVA 2Q07A 1G96A 1JKGA 1WMOA 5AEUB 4FMCA 3X41A 3LH4A 3NHXA 2CFGA 2CHCA 2YFIB 1CQSA 1GOVA 3AGNA 3EN1B 3N54B 3T8UA 1DE3A 1SQWA 1SARA 1UGIA 1RN1A 1W02A 3I563 2RSXA 8CHOA 1OF5B 1GD4A 1OUNA 2XGLA 1AVKA 4DKIA 4JRFA 1LOXA 3K5TA 3OWUA 2C11A 1D6UA 1EKMA 2CKFB 1KC84 3GZYB 4I5QA 4FR9A 5TGNA 3LT8A 4O2HA 2KAAA 5IF6A 1VQM3 1OGXA 4XB5A 1N5HA 2YFLB 4BL2A 1MWRA 1B3SA 1FGTA 5IENA 3CPW2 1YIJ3 4XBYA 1E97A 1OH0A 3BNDA 9RNTA 3CPOA 1NJI4 1Y4KA 1Q7Y4 1IT8A 1VQ83 3SXXA 1K41A 1UGHI 3LMLA 3IPTA 1Q40B 4KVHA 3DUKA 3NBJA 5IEPA 1VQP3 1D6ZA 1ISKA 2WGOA 1BSDA 1JBTA 3CXC2 2QEX3 2CW9A 3EHCA 3M8CA 1FUTA 1OPYA 1QVG2 2P09A 1I3IA 1DVCA 1RJOA 4HM3B 1RGKA 2BT3A 1KSIA 2UX0A 3SLUA 3LZAA 3HZPA 3ZG5A 5AYRB 1A90A 2W9PA 3JUQA 3JUNA 4LSOA 3OXAA 5JPPA 1DMQA 1ASKA 1W4NA 1I0VA 1B20A 4HKVB 4N6MA 5IW9A 4K1VA 3K9MC 1FGOA 4I4KA 3SVAA 1AQZA 1MWTA 1ZX2A 2KCDA 3UNLA 1JBSA 3O8YA 5CF1A 1RHLA 1S5AA 4U13A 2WGQA 4HAAA 2V1LA 3DGLA 1B2MA 2RBIA 1IT7A 4HM7B 3AMOA 4FCMA 1OF5A 6RNTA 3FZWA 2B24B 2KF5A 1BNJA 1T2IA 5STDA 3CC43 4IIAA 1FW7A 1BSAA 1V57A 3J7Yd 1NO3A 1V58A 2CWTA 2GEXA 3GRDA 4NPBA 4GL6A 1GY6A 2RNTA 1YJW3 4HOHA 1DMMA 4CDLA 3X3YA 1TFKA 2GBWB 3D4AA 3LTBA 1RDSA 4N6NB 2XSOB 5IG4A 3Q90A 5KP4A 3B8LA 5EQLA 1WNHA 1JB4A 1EA2A 5FW5A 1RN7A 2W2CA 4N6OB 3STDA 5CLKA 1FA3A 3DGYA 3FCSB 4KT3B 7GSPA 1EG9B 3CME3 3GWRA 4X2OA 4LMIA 2I9WA 5IG0A 2BMQB 3PZWA 3G0KA 3H3HA 1YHQ3 3A5EA 2GU1A 2SARA 3DZLA 1RGCA 4HM5B 1W6GA 3CU3A 3SOAA 4JF8A 4EV2A 3N8BA 3HI7A 2F98A 2R4IA 1NB3I 4XBTA 1E3RA 2W9QA 1RGAA 2IA7A 2JQ5A 2ZL8A 3IMAB 3MHEA 1Q814 1W01A 5AIIA 2Z76A 4HM0B 2W03A 1B27A 4GSPA 4O3VA 1FGQA 2GBXB 1US1A 5AYSC 3ROBA 3GSPA 2OTJ3 2K0MA 2CFDA 3MYTA 2AADA 3LTDA 2RGQA 3MKIA 4MMYB 2C4BA 5CK6A 3VSYA 3CC23 2BNGA 3WODG 2GU3A 2W56A 1LVNA 3X3XA 4CCVA 2WOHA 3Q3FA 2CWUA 2OQEA 3EN8A 3AHSA 3EF8A 1R4YA 1W6CA 1FZUA 2H0GA 5HGRA 4EC6A 1MWSA 4WHAA 1FGRA 1W2ZA 3CCV3 3WR2A 1O7WB 1OGZA 4N6V0 1JB5A 3PCSA 3V98A 3JUPA 4H61A 4WWUC 6STDA 3KCHA 5D82A 3OWSA 1CEWI 1JBRA 1VQ43 4N3VA 2OCTA 1GYBA 1TJDA 3BB9A 2CFWA 3NUVA 2P0MA 5AIHA 2B1XB 5JPUA 2GXFA 1J2BA 1DYUA 1QVF2 5GSPA 3KZTA 1I2EA 4HM2B 3FG1A 1S723 1M1XB 2BHMA 3DM8A 5ELUA 5ELJA 4EV5A 1GMPA 2L1SA 2PNCA 1RNBA 3LTAA 1JN5B 1JB2A 4RNZA 3DY5A 1IU7A 1RGEA 2BMRB 3RNTA 2KF4A 6GSPA 5HOHA 1UI8A 1VQN3 1BIRA 3KN4A 3B4PA 3KSED 2QIYA 3LOYA 3VGNA 1I2FA 3KFQC 5BIRA 1IVVA 1TRQA 2OWPA 4HYZA 3RGAA 5AIGA 2F5MA 3N9HA 4IT7A 3RDEA 3D9RA 1NB5I 1BUQA 5KP1A 1VQ53 4K90B 4FMDA 3MPHA 1A67A 1IVUA 3PXMA 2H0IA 1PU4A 1QJGA 3S28A 2YX9A 3BIRA 1LQMB 4MMZB 1IQXA 2KXGA 3FG3A 3CCJ3 3NM7A 1HU9A 4FMAA 4XBXA 1ZO2A 4FMBA 4WYKB 1A2PA 2SBLA 1FGMA 2C10A 3GZRA 3NBBA 3WOFB 1BRJA 5A0OB 1A2KA 1BRKA 4EW5A 1AVLA 1UUGB 2IYJA 2LQVA 3JVCA 3NV0A 4HM6B 1RTUA 5G2GA 3WHOA 3NQYA 3G8ZA 3HIGA 1B2ZA 1BVIA 3FSDA 1GY7A 1OHSA 4R9LA 3LTCA 4TX4A 4AKYA 3DGOA 1I0XA 5CF2A 1MWUA 3DH2A 3MG2A 2CG0A 3HX8A 3RGRA 1LOWA 1YGWA 4XDVA 5EVHA 1EUIC 3ALAA 1BSCA 1E3VA 4R4KA 1EQKA 2QA43 3CCQ3 2RFRA 3F40A 2L4VA 2E2TA 4X2HA 1A2VA 2HMNB 2IY2A 1HYFA 1IVWA 2O9UX 4R1KA 1ROVA 2FNQA 4R80A 1OCVA 2CG1A 1VQL3 1X1XA 1T5YA 3CCM3 1JRQA 4KZ1A 3FGYA 1LOVA 4CJNA 1HKXA 3SX1A 3OW22 5D81A 1L5GB 4MMXB 2KF6A 4LGQA 3I0YA 3CNXA 1BANA 1Q40A 2ML6A 1BNRA 3GZBA 4AEQA 2BO9B 3MG3A 1FYSA 3HK4A 3ZFZA 1F8NA 2WO0A 2F99A 5DREA 1W2B2 2H0HA 2ZA4A 4HM1B 2FXTA 1ZGXA 1WMPA 3D5GA 5AIFA 2R41A 4BL3A 1DVDA 1BRSA 1B2SA 4KFDA 1VQ93 1VQ63 1RCKA 3K7CA 1K9M4 1RMSA 1IK3A 1M9GA 1NNVA 4CPKA 4XM4A 3UL6A 3BNEA 1TUHA 3DXOA 3IJEB 3U97A 1JJ22 1UCKA 3EC9A 1Q7HA 1ROAA 3MWZA 1GMRA 4J5KA 3CMA3 1Q42A 3KSPA 3UL5A 1R4CA 4RNTA 3ER7A 1SJWA 1X1UA 2CFKA 3S27A 1IQYA 4OK0A 1BUJA 5G1LA 4MJDA 1JKGB 3X42A 1RGHA 4BIRA 1O7GB 1U8CB 5IG5A 1N8QA 2XRXB 3FLJA 1SIHA 2Z7AA 1ULIB 1CYVA 2HMLB 4N6TA 3F8XA 1IYYA 3NQZA 4KFFA 4L7KA 2BU4A 3PYJA 2XR8B 4EBGA 3G6E3 1FUSA 3F9SA 2CK3H 2M7OA 3AHWA 1BNEA 2WOFA 3UB1A 3WA2X 1CYUA 1JV2B 2OOVC 1TTOA 1STFI 1RSNA 2KRTA 1BRHA 3OX9A 3PCRA 3H51A 3V92A 1UCIA 2BMOB 3D79A 5M1AA 1KQS2 2OQEC 1AV4A 3MSOA 4OUQA 3VF1A 3LYGA 5KP3A 1O7MB 1O7PB 1NWWA 1UW1A 2J8XB 3SOYA 2CC3A 3SYUA 5JBSA 4WP5A 1UDII 2CFLA 4HJLB 1GD3A 3WMDA 2HMJB 1MNLA 1QAFA 3I553 4L8OA 2GEYA 2MC8A 5G1KA 3B7CA 2IUJA 1M1K4 1IV9A 3JUMA 4AKZA 5RNTA 1Q864 1K8A4 1W5ZA 1RN4A 3X3ZA 4LEHA 3V99A 1M904 3S5CA 1DMNA 1EEJA 1BRGA 1YNVX 2A15A 3OV4A 1VQQA 1VQO3 8RNTA 4BTYA 1FUWA 1GY5A 2E2UA 4BTXA 1YIT3 3U1WA 4LYLB 1BNIA 1TP6A 1UUWB 1WQLB 3LXUX 5M19A 1PFPA 1C54A 3Q1CA 2XFTA 2RCDA 2KF3A 5LC7A 3G713 4N6UA 3T0UA 1IVXA 1JZOA 2W6JH 3OWYA 3K63A 3URPA 4BTWA 1YJ93 1Q9EA 1LXEA 3CCS3 1GS3A 3KKGA 1AR0A 2CH9A 5D83A 2CX1A 1BNSA 3AMOB 5M18A 1I2GA 3MG1A 1RKYA 3CCU3 1KD14 3UJMA 1LNIA 4RBNA 1RCLA 4ILFA 4L8PA 2QGUA 5AI1A 2P05A 3CC73 2CX0A 3SEDA 1O7NB 3EBTA 2XSHB 3BLZA 1BNFA 1ULJB 4K1UA 1SIIA 4ZM8A 1LOYA 3A76A 1SPUA 2XEPA 1LRAA 1N5PA 2IMJA 3FKAA 5IERA 4HZBB 3L0RA 4WFOA 4FCZA 2W04A 4HVNA 1HZ1A 2XF3A 3JUOA 2F4YA 1I70A 2HMMB 4RZMA 1BRIA 3EB8A 3HOHA 3KE7A 1QAKA 2GSPA 1TFOA 1WMNA 1T3BA 1JZDA 1QALA 1CH0A 1TIJA 3CNMA 1RGGA 4EXRA 2XFSA 4HM4B 1GOYA 1B21A 3EE1A 4O02B 1UCJA 1RGLA 1JN5A 2Z6BA 3WDGB 4J8TA 4QWTA 3CCR3 1DETA 1N9EA 2LYXA 1V74A 1BRNL 3NXJA 1X1YA 1T2HA 1W7CA 2D42A 1RRLA 3NX0A 3HIIA 3EJVA 3EQQB 1N8R4 4HBRA 4NREA 4NHFA 3CCE3 3DGNA 3F7XA 2CWVA 1W00A 1G02A 1UUVB 5BU4A 4OVMA 1G0TA 3S29A 4FCJA 1YVSA 2Y74A 3QRDA 4RNYA 1VQ73 3S67A 1JNQA 1BSBA 4N6LA 1C7HA 1OHPA 2ML5A 2F86B 5BXQA 1NU3A 1B2UA 2W56B 3LT9A 4ORLA 1ZS7A 3KIIA 1LQGC 3CCL3 3GAXA 1MOLA 1BNGA 3FG4A 4BU4A 1B2XA 1LNHA 1YGEA 1RLSA 2K3DA 1K28A 3CD63 4WYKA 2AAEA 3K0ZA 1MGWA 3F8HA 4EYCA 1VQK3 1YI23 1MGRA 1Q824
chains in the Genus database with same CATH topology
4STDA 1OHOA 4IPBA 7STDA 2XH9A 4LZIA 3B4OA 3ECFA 2Z77A 1W6YA 2STDA 5IEOA 5BVBA 4G1MB 1QMAA 3WA3A 2O3OA 1K734 4K61A 3DMCA 1YJN3 3WOEB 3E99A 5FGOA 5I97A 4R9KA 1O7HB 2Y73A 3G16A 4PEJA 3T8NA 3PGBA 3G4S3 3BNBA 2D1WA 2XGNA 2HMKB 1TU5A 2HMOB 3NBRA 4HZ9B 2ZDJA 3EBYA 3F7SA 4O8SA 1IV7A 1U5OA 4Q53A 2MF7A 4KFEA 3FH1A 5LC6A 1IQ8A 1N9JA 2OOVA 3NM2A 1KWIA 2IUKA 3FF0A 5CXOA 1IDPA 1YVBI 2W0QA 3EX9A 2OTL3 3PS8A 2P38A 5AEWB 1OACA 1D6YA 1UI7A 2FGTA 3TDGA 1STDA 2JDIH 4J9AA 3X40A 5IG3A 1NDOB 3QK9A 1RRHA 2P0XA 3D3LA 5DRVA 5EEOA 3FF2A 1WTHA 2K54A 4H3UA 4MEIA 4XDWA 4HM8B 1Z1SA 2CIUA 3F14A 3BNCA 1VZZA 3NV0B 2E2VA 2YFJB 3GZXB 3Q2PA 2INXA 3DGMA 4GB5A 2PZVA 2Q07A 1G96A 1JKGA 1WMOA 5AEUB 4FMCA 3X41A 3LH4A 3NHXA 2CFGA 2CHCA 2YFIB 1CQSA 3N54B 3EN1B 3T8UA 1SQWA 3I563 1W02A 2RSXA 8CHOA 1OF5B 1GD4A 1OUNA 2XGLA 1AVKA 4JRFA 1LOXA 3K5TA 3OWUA 2C11A 1D6UA 1EKMA 2CKFB 1KC84 3GZYB 4FR9A 5TGNA 3LT8A 4O2HA 5IF6A 1VQM3 1OGXA 4XB5A 1N5HA 2YFLB 5IENA 1FGTA 3CPW2 1YIJ3 4XBYA 1E97A 1OH0A 3BNDA 1NJI4 3CPOA 1Y4KA 1Q7Y4 1IT8A 1VQ83 3SXXA 1K41A 4KVHA 3LMLA 3IPTA 1Q40B 3DUKA 3NBJA 5IEPA 1VQP3 1D6ZA 1ISKA 2WGOA 3CXC2 2QEX3 2CW9A 3EHCA 3M8CA 1OPYA 1QVG2 2P09A 1RJOA 1DVCA 4HM3B 2BT3A 1KSIA 2UX0A 3SLUA 3LZAA 3HZPA 5AYRB 1A90A 2W9PA 3JUQA 3JUNA 4LSOA 3OXAA 5JPPA 1DMQA 1ASKA 1W4NA 4HKVB 4N6MA 5IW9A 4K1VA 3K9MC 1FGOA 4I4KA 3SVAA 1ZX2A 2KCDA 3UNLA 3O8YA 5CF1A 1S5AA 4U13A 2WGQA 2V1LA 3DGLA 4HM7B 1IT7A 3AMOA 4FCMA 1OF5A 3FZWA 2B24B 5STDA 3CC43 4IIAA 3J7Yd 1NO3A 2GEXA 2CWTA 1YJW3 3GRDA 4GL6A 1GY6A 1DMMA 4CDLA 3X3YA 1TFKA 2GBWB 3LTBA 4N6NB 2XSOB 5IG4A 3Q90A 5KP4A 3B8LA 5EQLA 1WNHA 1JB4A 1EA2A 5FW5A 1RN7A 2W2CA 4N6OB 3STDA 5CLKA 1FA3A 3FCSB 1EG9B 3CME3 3GWRA 4X2OA 4LMIA 2I9WA 5IG0A 2BMQB 3PZWA 3G0KA 3H3HA 1YHQ3 2GU1A 3DZLA 4HM5B 1W6GA 3CU3A 3SOAA 4JF8A 4EV2A 3N8BA 3HI7A 2F98A 2R4IA 1NB3I 4XBTA 1E3RA 2ZL8A 2W9QA 2IA7A 2JQ5A 3IMAB 3MHEA 1Q814 1W01A 5AIIA 2Z76A 4HM0B 2W03A 4O3VA 1FGQA 2GBXB 1US1A 5AYSC 3ROBA 2OTJ3 2K0MA 2CFDA 3MYTA 3LTDA 3MKIA 2RGQA 4MMYB 5CK6A 3VSYA 3CC23 2BNGA 3WODG 2GU3A 2W56A 1LVNA 3X3XA 4CCVA 2WOHA 2CWUA 2OQEA 3EN8A 3EF8A 1W6CA 4EC6A 3CCV3 5HGRA 4WHAA 1FGRA 1W2ZA 1O7WB 1OGZA 4N6V0 1JB5A 3PCSA 3V98A 3JUPA 4H61A 4WWUC 6STDA 5D82A 3OWSA 1CEWI 1VQ43 4N3VA 2OCTA 1GYBA 3BB9A 2CFWA 3NUVA 2P0MA 5AIHA 2B1XB 5JPUA 2GXFA 1J2BA 1DYUA 1QVF2 3KZTA 4HM2B 3FG1A 1S723 1M1XB 2BHMA 3DM8A 5ELUA 5ELJA 4EV5A 2PNCA 3LTAA 1JN5B 1JB2A 4RNZA 3DY5A 1IU7A 2BMRB 1UI8A 1VQN3 3KN4A 3B4PA 3KSED 2QIYA 3LOYA 3VGNA 3KFQC 1IVVA 2OWPA 4HYZA 3RGAA 5AIGA 3N9HA 4IT7A 3RDEA 1NB5I 3D9RA 1BUQA 5KP1A 1VQ53 4K90B 4FMDA 3MPHA 1A67A 1IVUA 3PXMA 1PU4A 1QJGA 3S28A 2YX9A 4MMZB 1IQXA 2KXGA 3FG3A 3CCJ3 3NM7A 1HU9A 4FMAA 4XBXA 1ZO2A 4FMBA 4WYKB 2SBLA 3NBBA 1FGMA 2C10A 3GZRA 3WOFB 5A0OB 1A2KA 1AVLA 3JVCA 4HM6B 2LQVA 3NV0A 5G2GA 3NQYA 3G8ZA 3HIGA 3FSDA 4R9LA 4TX4A 1GY7A 1OHSA 4AKYA 3LTCA 3DGOA 5CF2A 3MG2A 2CG0A 3HX8A 3RGRA 4XDVA 5EVHA 3ALAA 1E3VA 4R4KA 1EQKA 2QA43 3CCQ3 2RFRA 3F40A 2L4VA 2E2TA 4X2HA 1A2VA 2HMNB 1IVWA 2O9UX 4R1KA 1ROVA 2FNQA 4R80A 1OCVA 2CG1A 1VQL3 1T5YA 3CCM3 1JRQA 4KZ1A 3FGYA 1HKXA 3SX1A 3OW22 5D81A 1L5GB 4MMXB 4LGQA 3I0YA 3CNXA 1Q40A 2ML6A 3GZBA 4AEQA 2BO9B 3MG3A 3HK4A 1F8NA 2WO0A 2F99A 5DREA 1W2B2 4HM1B 2FXTA 1WMPA 5AIFA 1DVDA 4KFDA 1VQ93 1VQ63 3K7CA 1K9M4 1IK3A 1M9GA 4XM4A 3UL6A 3BNEA 1TUHA 3DXOA 3IJEB 3U97A 1JJ22 3MWZA 3EC9A 1ROAA 3CMA3 1Q42A 3KSPA 3UL5A 1R4CA 3ER7A 1SJWA 2CFKA 3S27A 1IQYA 4OK0A 4MJDA 1JKGB 3X42A 1O7GB 1U8CB 5IG5A 1N8QA 2XRXB 3FLJA 1SIHA 2Z7AA 1ULIB 1CYVA 2HMLB 4N6TA 3F8XA 3NQZA 4KFFA 4L7KA 3PYJA 2XR8B 4EBGA 3G6E3 3F9SA 2CK3H 2M7OA 2WOFA 3UB1A 3WA2X 1CYUA 2OOVC 1JV2B 1STFI 2KRTA 3OX9A 3PCRA 3H51A 3V92A 2BMOB 1KQS2 2OQEC 1AV4A 3MSOA 4OUQA 3VF1A 3LYGA 5KP3A 1O7MB 1O7PB 1NWWA 1UW1A 3SOYA 2CC3A 5JBSA 4WP5A 2CFLA 4HJLB 1GD3A 3WMDA 2HMJB 1MNLA 1QAFA 3I553 4L8OA 2GEYA 2MC8A 1M1K4 3B7CA 2IUJA 1IV9A 3JUMA 4AKZA 1Q864 1K8A4 1W5ZA 3X3ZA 4LEHA 3V99A 1M904 3S5CA 1DMNA 2A15A 3OV4A 1VQO3 4BTYA 1FUWA 1GY5A 2E2UA 4BTXA 1YIT3 3U1WA 1TP6A 1UUWB 1WQLB 3LXUX 1PFPA 3Q1CA 2XFTA 2RCDA 5LC7A 3G713 4N6UA 3T0UA 1IVXA 2W6JH 3OWYA 3K63A 4BTWA 1YJ93 1LXEA 3CCS3 1GS3A 3KKGA 1AR0A 2CH9A 5D83A 3AMOB 1RKYA 3CCU3 3MG1A 1KD14 3UJMA 4RBNA 4L8PA 2QGUA 5AI1A 2P05A 3CC73 3SEDA 1O7NB 3EBTA 2XSHB 3BLZA 1ULJB 4K1UA 1SIIA 4ZM8A 3A76A 1SPUA 2XEPA 5IERA 1N5PA 2IMJA 3FKAA 4HZBB 3L0RA 4WFOA 4FCZA 2W04A 4HVNA 2XF3A 3JUOA 2HMMB 4RZMA 3EB8A 3KE7A 1QAKA 1TFOA 1WMNA 1QALA 1TIJA 3CNMA 4EXRA 2XFSA 4HM4B 4O02B 3EE1A 2Z6BA 1JN5A 3WDGB 4J8TA 4QWTA 3CCR3 1N9EA 2LYXA 1V74A 3NXJA 1W7CA 2D42A 1RRLA 3NX0A 3HIIA 3EJVA 3EQQB 1N8R4 4HBRA 4NREA 4NHFA 3CCE3 3DGNA 3F7XA 2CWVA 1W00A 1UUVB 4OVMA 3S29A 4FCJA 2Y74A 3QRDA 4RNYA 1VQ73 3S67A 1JNQA 4N6LA 1C7HA 1OHPA 2ML5A 2F86B 5BXQA 1NU3A 2W56B 3LT9A 4ORLA 3KIIA 3CCL3 3GAXA 1MOLA 3FG4A 1YGEA 1LNHA 1K28A 3CD63 4WYKA 3K0ZA 4EYCA 3F8HA 1VQK3 1YI23 1Q824
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4STD A;  1OHO A;  7STD A;  3B4O A;  3ECF A;  2Z77 A;  1W6Y A;  2STD A;  5IEO A;  5BVB A;  1QMA A;  3DMC A;  3E99 A;  4R9K A;  1O7H B;  3G16 A;  4PEJ A;  3T8N A;  2HMK B;  2HMO B;  3NBR A;  4HZ9 B;  3EBY A;  3F7S A;  1U5O A;  4Q53 A;  3FH1 A;  3NM2 A;  3FF0 A;  5CXO A;  1IDP A;  3EX9 A;  5AEW B;  1STD A;  4J9A A;  5IG3 A;  1NDO B;  5DRV A;  3FF2 A;  2K54 A;  4H3U A;  4XDW A;  4HM8 B;  1Z1S A;  3F14 A;  1VZZ A;  3NV0 B;  2YFJ B;  3GZX B;  2INX A;  4GB5 A;  2PZV A;  1JKG A;  5AEU B;  3NHX A;  2CHC A;  2YFI B;  1CQS A;  3T8U A;  3EN1 B;  1W02 A;  8CHO A;  1OF5 B;  1OUN A;  3OWU A;  2CKF B;  3GZY B;  5TGN A;  5IF6 A;  1OGX A;  4XB5 A;  2YFL B;  5IEN A;  4XBY A;  1E97 A;  1OH0 A;  3CPO A;  1K41 A;  4KVH A;  3IPT A;  1Q40 B;  3DUK A;  5IEP A;  1ISK A;  3EHC A;  3M8C A;  1OPY A;  4HM3 B;  2UX0 A;  3LZA A;  3HZP A;  3JUQ A;  3JUN A;  5JPP A;  3OXA A;  1DMQ A;  1ASK A;  4HKV B;  4K1V A;  4I4K A;  1ZX2 A;  3UNL A;  5CF1 A;  1S5A A;  4U13 A;  4HM7 B;  4FCM A;  1OF5 A;  3FZW A;  2B24 B;  5STD A;  4IIA A;  2GEX A;  3GRD A;  1GY6 A;  1DMM A;  4CDL A;  2GBW B;  2XSO B;  5IG4 A;  3Q90 A;  5KP4 A;  3B8L A;  1JB4 A;  1EA2 A;  5FW5 A;  2W2C A;  3STD A;  5CLK A;  1EG9 B;  3GWR A;  4X2O A;  4LMI A;  2I9W A;  5IG0 A;  2BMQ B;  3G0K A;  3H3H A;  3DZL A;  4HM5 B;  3CU3 A;  3SOA A;  2F98 A;  2R4I A;  4XBT A;  1E3R A;  2JQ5 A;  3MHE A;  1W01 A;  5AII A;  2Z76 A;  4HM0 B;  2GBX B;  3ROB A;  3MYT A;  5CK6 A;  3MKI A;  2RGQ A;  3VSY A;  2BNG A;  3EN8 A;  3EF8 A;  5HGR A;  1O7W B;  1OGZ A;  1JB5 A;  3JUP A;  4WWU C;  6STD A;  5D82 A;  3OWS A;  4N3V A;  1GYB A;  3BB9 A;  3NUV A;  5AIH A;  2B1X B;  5JPU A;  2GXF A;  3KZT A;  4HM2 B;  3DM8 A;  1JN5 B;  1JB2 A;  2BMR B;  3B4P A;  2QIY A;  3VGN A;  2OWP A;  3RGA A;  5AIG A;  3D9R A;  1BUQ A;  5KP1 A;  1QJG A;  4XBX A;  1ZO2 A;  4WYK B;  3GZR A;  1A2K A;  4HM6 B;  3NV0 A;  5G2G A;  3G8Z A;  3FSD A;  4R9L A;  1GY7 A;  1OHS A;  5CF2 A;  3MG2 A;  3HX8 A;  3RGR A;  4XDV A;  5EVH A;  1E3V A;  2RFR A;  3F40 A;  4X2H A;  2HMN B;  4R1K A;  1OCV A;  3FGY A;  1HKX A;  5D81 A;  4LGQ A;  3I0Y A;  3CNX A;  1Q40 A;  3GZB A;  3MG3 A;  3HK4 A;  5DRE A;  2F99 A;  4HM1 B;  5AIF A;  3K7C A;  4XM4 A;  1TUH A;  3DXO A;  3EC9 A;  1Q42 A;  3KSP A;  3ER7 A;  1SJW A;  4MJD A;  1JKG B;  1O7G B;  5IG5 A;  2XRX B;  3FLJ A;  2Z7A A;  1ULI B;  2HML B;  3F8X A;  4L7K A;  2XR8 B;  3F9S A;  3OX9 A;  3H51 A;  2BMO B;  3MSO A;  4OUQ A;  3LYG A;  5KP3 A;  1O7M B;  1O7P B;  1NWW A;  3SOY A;  4WP5 A;  4HJL B;  3WMD A;  2HMJ B;  4L8O A;  2GEY A;  3B7C A;  3JUM A;  4LEH A;  3S5C A;  1DMN A;  2A15 A;  3OV4 A;  1GY5 A;  1TP6 A;  1UUW B;  1WQL B;  2RCD A;  3OWY A;  1GS3 A;  3KKG A;  1AR0 A;  5D83 A;  3MG1 A;  3UJM A;  4L8P A;  2QGU A;  5AI1 A;  3SED A;  1O7N B;  3EBT A;  2XSH B;  3BLZ A;  1ULJ B;  4K1U A;  3A76 A;  5IER A;  2IMJ A;  3FKA A;  4HZB B;  4HVN A;  3JUO A;  2HMM B;  4RZM A;  3KE7 A;  3CNM A;  4HM4 B;  1JN5 A;  4J8T A;  3NXJ A;  3EJV A;  3EQQ B;  3F7X A;  1W00 A;  1UUV B;  4OVM A;  4FCJ A;  1C7H A;  1OHP A;  2F86 B;  5BXQ A;  1NU3 A;  4ORL A;  4WYK A;  3K0Z A;  3F8H A; 
#chains in the Genus database with same CATH topology
 4STD A;  1OHO A;  3D5I A;  4IPB A;  7STD A;  2XH9 A;  1AY7 A;  2UGI A;  3B4O A;  4LZI A;  3ECF A;  2Z77 A;  1W6Y A;  4GHO A;  2STD A;  1RGF A;  5IEO A;  5BVB A;  4G1M B;  1QMA A;  2HOH A;  3WA3 A;  1BU4 A;  2O3O A;  1K73 4;  1RNT A;  1I3F A;  4K61 A;  1BOX A;  3DMC A;  1YJN 3;  3WOE B;  3E99 A;  7RNT A;  5FGO A;  5I97 A;  3ZG0 A;  3AGO A;  4R9K A;  1GOU A;  1O7H B;  2Y73 A;  3G16 A;  4J5G A;  4PEJ A;  3T8N A;  3PGB A;  3G4S 3;  3BNB A;  1TRP A;  2D1W A;  2XGN A;  2HMK B;  2F56 A;  1TU5 A;  1GMQ A;  2HMO B;  3NBR A;  4HZ9 B;  2ZDJ A;  3EBY A;  3F7S A;  4O8S A;  1IV7 A;  1U5O A;  4Q53 A;  2MF7 A;  4KFE A;  3FH1 A;  2ZHX B;  5LC6 A;  1IQ8 A;  1N9J A;  2OOV A;  3NM2 A;  1KWI A;  2IUK A;  3FF0 A;  5CXO A;  1IDP A;  1YVB I;  2W0Q A;  3EX9 A;  2OTL 3;  3PS8 A;  2P38 A;  1BGS A;  5AEW B;  1I8V A;  1UCL A;  1OAC A;  1D6Y A;  1UI7 A;  2FGT A;  3BU4 A;  3TDG A;  2BIR A;  2F5W A;  1STD A;  2JDI H;  4J9A A;  3X40 A;  5IG3 A;  1NDO B;  3QK9 A;  1X1W A;  1RRH A;  2P0X A;  3D3L A;  5DRV A;  5EEO A;  1PYL A;  3FF2 A;  1WTH A;  1PY3 A;  2K54 A;  1BAO A;  1BSE A;  4H3U A;  2UUG C;  4HM8 B;  4MEI A;  1Z1S A;  2CIU A;  3F14 A;  4XDW A;  3BNC A;  1VZZ A;  3NV0 B;  1GSP A;  2E2V A;  2YFJ B;  3GZX B;  3Q2P A;  2INX A;  3DGM A;  4GB5 A;  2PZV A;  2Q07 A;  1G96 A;  1JKG A;  1WMO A;  5AEU B;  4FMC A;  3X41 A;  3LH4 A;  3NHX A;  2CFG A;  2CHC A;  2YFI B;  1CQS A;  1GOV A;  3AGN A;  3EN1 B;  3N54 B;  3T8U A;  1DE3 A;  1SQW A;  1SAR A;  1UGI A;  1RN1 A;  1W02 A;  3I56 3;  2RSX A;  8CHO A;  1OF5 B;  1GD4 A;  1OUN A;  2XGL A;  1AVK A;  4DKI A;  4JRF A;  1LOX A;  3K5T A;  3OWU A;  2C11 A;  1D6U A;  1EKM A;  2CKF B;  1KC8 4;  3GZY B;  4I5Q A;  4FR9 A;  5TGN A;  3LT8 A;  4O2H A;  2KAA A;  5IF6 A;  1VQM 3;  1OGX A;  4XB5 A;  1N5H A;  2YFL B;  4BL2 A;  1MWR A;  1B3S A;  1FGT A;  5IEN A;  3CPW 2;  1YIJ 3;  4XBY A;  1E97 A;  1OH0 A;  3BND A;  9RNT A;  3CPO A;  1NJI 4;  1Y4K A;  1Q7Y 4;  1IT8 A;  1VQ8 3;  3SXX A;  1K41 A;  1UGH I;  3LML A;  3IPT A;  1Q40 B;  4KVH A;  3DUK A;  3NBJ A;  5IEP A;  1VQP 3;  1D6Z A;  1ISK A;  2WGO A;  1BSD A;  1JBT A;  3CXC 2;  2QEX 3;  2CW9 A;  3EHC A;  3M8C A;  1FUT A;  1OPY A;  1QVG 2;  2P09 A;  1I3I A;  1DVC A;  1RJO A;  4HM3 B;  1RGK A;  2BT3 A;  1KSI A;  2UX0 A;  3SLU A;  3LZA A;  3HZP A;  3ZG5 A;  5AYR B;  1A90 A;  2W9P A;  3JUQ A;  3JUN A;  4LSO A;  3OXA A;  5JPP A;  1DMQ A;  1ASK A;  1W4N A;  1I0V A;  1B20 A;  4HKV B;  4N6M A;  5IW9 A;  4K1V A;  3K9M C;  1FGO A;  4I4K A;  3SVA A;  1AQZ A;  1MWT A;  1ZX2 A;  2KCD A;  3UNL A;  1JBS A;  3O8Y A;  5CF1 A;  1RHL A;  1S5A A;  4U13 A;  2WGQ A;  4HAA A;  2V1L A;  3DGL A;  1B2M A;  2RBI A;  1IT7 A;  4HM7 B;  3AMO A;  4FCM A;  1OF5 A;  6RNT A;  3FZW A;  2B24 B;  2KF5 A;  1BNJ A;  1T2I A;  5STD A;  3CC4 3;  4IIA A;  1FW7 A;  1BSA A;  1V57 A;  3J7Y d;  1NO3 A;  1V58 A;  2CWT A;  2GEX A;  3GRD A;  4NPB A;  4GL6 A;  1GY6 A;  2RNT A;  1YJW 3;  4HOH A;  1DMM A;  4CDL A;  3X3Y A;  1TFK A;  2GBW B;  3D4A A;  3LTB A;  1RDS A;  4N6N B;  2XSO B;  5IG4 A;  3Q90 A;  5KP4 A;  3B8L A;  5EQL A;  1WNH A;  1JB4 A;  1EA2 A;  5FW5 A;  1RN7 A;  2W2C A;  4N6O B;  3STD A;  5CLK A;  1FA3 A;  3DGY A;  3FCS B;  4KT3 B;  7GSP A;  1EG9 B;  3CME 3;  3GWR A;  4X2O A;  4LMI A;  2I9W A;  5IG0 A;  2BMQ B;  3PZW A;  3G0K A;  3H3H A;  1YHQ 3;  3A5E A;  2GU1 A;  2SAR A;  3DZL A;  1RGC A;  4HM5 B;  1W6G A;  3CU3 A;  3SOA A;  4JF8 A;  4EV2 A;  3N8B A;  3HI7 A;  2F98 A;  2R4I A;  1NB3 I;  4XBT A;  1E3R A;  2W9Q A;  1RGA A;  2IA7 A;  2JQ5 A;  2ZL8 A;  3IMA B;  3MHE A;  1Q81 4;  1W01 A;  5AII A;  2Z76 A;  4HM0 B;  2W03 A;  1B27 A;  4GSP A;  4O3V A;  1FGQ A;  2GBX B;  1US1 A;  5AYS C;  3ROB A;  3GSP A;  2OTJ 3;  2K0M A;  2CFD A;  3MYT A;  2AAD A;  3LTD A;  2RGQ A;  3MKI A;  4MMY B;  2C4B A;  5CK6 A;  3VSY A;  3CC2 3;  2BNG A;  3WOD G;  2GU3 A;  2W56 A;  1LVN A;  3X3X A;  4CCV A;  2WOH A;  3Q3F A;  2CWU A;  2OQE A;  3EN8 A;  3AHS A;  3EF8 A;  1R4Y A;  1W6C A;  1FZU A;  2H0G A;  5HGR A;  4EC6 A;  1MWS A;  4WHA A;  1FGR A;  1W2Z A;  3CCV 3;  3WR2 A;  1O7W B;  1OGZ A;  4N6V 0;  1JB5 A;  3PCS A;  3V98 A;  3JUP A;  4H61 A;  4WWU C;  6STD A;  3KCH A;  5D82 A;  3OWS A;  1CEW I;  1JBR A;  1VQ4 3;  4N3V A;  2OCT A;  1GYB A;  1TJD A;  3BB9 A;  2CFW A;  3NUV A;  2P0M A;  5AIH A;  2B1X B;  5JPU A;  2GXF A;  1J2B A;  1DYU A;  1QVF 2;  5GSP A;  3KZT A;  1I2E A;  4HM2 B;  3FG1 A;  1S72 3;  1M1X B;  2BHM A;  3DM8 A;  5ELU A;  5ELJ A;  4EV5 A;  1GMP A;  2L1S A;  2PNC A;  1RNB A;  3LTA A;  1JN5 B;  1JB2 A;  4RNZ A;  3DY5 A;  1IU7 A;  1RGE A;  2BMR B;  3RNT A;  2KF4 A;  6GSP A;  5HOH A;  1UI8 A;  1VQN 3;  1BIR A;  3KN4 A;  3B4P A;  3KSE D;  2QIY A;  3LOY A;  3VGN A;  1I2F A;  3KFQ C;  5BIR A;  1IVV A;  1TRQ A;  2OWP A;  4HYZ A;  3RGA A;  5AIG A;  2F5M A;  3N9H A;  4IT7 A;  3RDE A;  3D9R A;  1NB5 I;  1BUQ A;  5KP1 A;  1VQ5 3;  4K90 B;  4FMD A;  3MPH A;  1A67 A;  1IVU A;  3PXM A;  2H0I A;  1PU4 A;  1QJG A;  3S28 A;  2YX9 A;  3BIR A;  1LQM B;  4MMZ B;  1IQX A;  2KXG A;  3FG3 A;  3CCJ 3;  3NM7 A;  1HU9 A;  4FMA A;  4XBX A;  1ZO2 A;  4FMB A;  4WYK B;  1A2P A;  2SBL A;  1FGM A;  2C10 A;  3GZR A;  3NBB A;  3WOF B;  1BRJ A;  5A0O B;  1A2K A;  1BRK A;  4EW5 A;  1AVL A;  1UUG B;  2IYJ A;  2LQV A;  3JVC A;  3NV0 A;  4HM6 B;  1RTU A;  5G2G A;  3WHO A;  3NQY A;  3G8Z A;  3HIG A;  1B2Z A;  1BVI A;  3FSD A;  1GY7 A;  1OHS A;  4R9L A;  3LTC A;  4TX4 A;  4AKY A;  3DGO A;  1I0X A;  5CF2 A;  1MWU A;  3DH2 A;  3MG2 A;  2CG0 A;  3HX8 A;  3RGR A;  1LOW A;  1YGW A;  4XDV A;  5EVH A;  1EUI C;  3ALA A;  1BSC A;  1E3V A;  4R4K A;  1EQK A;  2QA4 3;  3CCQ 3;  2RFR A;  3F40 A;  2L4V A;  2E2T A;  4X2H A;  1A2V A;  2HMN B;  2IY2 A;  1HYF A;  1IVW A;  2O9U X;  4R1K A;  1ROV A;  2FNQ A;  4R80 A;  1OCV A;  2CG1 A;  1VQL 3;  1X1X A;  1T5Y A;  3CCM 3;  1JRQ A;  4KZ1 A;  3FGY A;  1LOV A;  4CJN A;  1HKX A;  3SX1 A;  3OW2 2;  5D81 A;  1L5G B;  4MMX B;  2KF6 A;  4LGQ A;  3I0Y A;  3CNX A;  1BAN A;  1Q40 A;  2ML6 A;  1BNR A;  3GZB A;  4AEQ A;  2BO9 B;  3MG3 A;  1FYS A;  3HK4 A;  3ZFZ A;  1F8N A;  2WO0 A;  2F99 A;  5DRE A;  1W2B 2;  2H0H A;  2ZA4 A;  4HM1 B;  2FXT A;  1ZGX A;  1WMP A;  3D5G A;  5AIF A;  2R41 A;  4BL3 A;  1DVD A;  1BRS A;  1B2S A;  4KFD A;  1VQ9 3;  1VQ6 3;  1RCK A;  3K7C A;  1K9M 4;  1RMS A;  1IK3 A;  1M9G A;  1NNV A;  4CPK A;  4XM4 A;  3UL6 A;  3BNE A;  1TUH A;  3DXO A;  3IJE B;  3U97 A;  1JJ2 2;  1UCK A;  3EC9 A;  1Q7H A;  1ROA A;  3MWZ A;  1GMR A;  4J5K A;  3CMA 3;  1Q42 A;  3KSP A;  3UL5 A;  1R4C A;  4RNT A;  3ER7 A;  1SJW A;  1X1U A;  2CFK A;  3S27 A;  1IQY A;  4OK0 A;  1BUJ A;  5G1L A;  4MJD A;  1JKG B;  3X42 A;  1RGH A;  4BIR A;  1O7G B;  1U8C B;  5IG5 A;  1N8Q A;  2XRX B;  3FLJ A;  1SIH A;  2Z7A A;  1ULI B;  1CYV A;  2HML B;  4N6T A;  3F8X A;  1IYY A;  3NQZ A;  4KFF A;  4L7K A;  2BU4 A;  3PYJ A;  2XR8 B;  4EBG A;  3G6E 3;  1FUS A;  3F9S A;  2CK3 H;  2M7O A;  3AHW A;  1BNE A;  2WOF A;  3UB1 A;  3WA2 X;  1CYU A;  1JV2 B;  2OOV C;  1TTO A;  1STF I;  1RSN A;  2KRT A;  1BRH A;  3OX9 A;  3PCR A;  3H51 A;  3V92 A;  1UCI A;  2BMO B;  3D79 A;  5M1A A;  1KQS 2;  2OQE C;  1AV4 A;  3MSO A;  4OUQ A;  3VF1 A;  3LYG A;  5KP3 A;  1O7M B;  1O7P B;  1NWW A;  1UW1 A;  2J8X B;  3SOY A;  2CC3 A;  3SYU A;  5JBS A;  4WP5 A;  1UDI I;  2CFL A;  4HJL B;  1GD3 A;  3WMD A;  2HMJ B;  1MNL A;  1QAF A;  3I55 3;  4L8O A;  2GEY A;  2MC8 A;  5G1K A;  3B7C A;  2IUJ A;  1M1K 4;  1IV9 A;  3JUM A;  4AKZ A;  5RNT A;  1Q86 4;  1K8A 4;  1W5Z A;  1RN4 A;  3X3Z A;  4LEH A;  3V99 A;  1M90 4;  3S5C A;  1DMN A;  1EEJ A;  1BRG A;  1YNV X;  2A15 A;  3OV4 A;  1VQQ A;  1VQO 3;  8RNT A;  4BTY A;  1FUW A;  1GY5 A;  2E2U A;  4BTX A;  1YIT 3;  3U1W A;  4LYL B;  1BNI A;  1TP6 A;  1UUW B;  1WQL B;  3LXU X;  5M19 A;  1PFP A;  1C54 A;  3Q1C A;  2XFT A;  2RCD A;  2KF3 A;  5LC7 A;  3G71 3;  4N6U A;  3T0U A;  1IVX A;  1JZO A;  2W6J H;  3OWY A;  3K63 A;  3URP A;  4BTW A;  1YJ9 3;  1Q9E A;  1LXE A;  3CCS 3;  1GS3 A;  3KKG A;  1AR0 A;  2CH9 A;  5D83 A;  2CX1 A;  1BNS A;  3AMO B;  5M18 A;  1I2G A;  3MG1 A;  1RKY A;  3CCU 3;  1KD1 4;  3UJM A;  1LNI A;  4RBN A;  1RCL A;  4ILF A;  4L8P A;  2QGU A;  5AI1 A;  2P05 A;  3CC7 3;  2CX0 A;  3SED A;  1O7N B;  3EBT A;  2XSH B;  3BLZ A;  1BNF A;  1ULJ B;  4K1U A;  1SII A;  4ZM8 A;  1LOY A;  3A76 A;  1SPU A;  2XEP A;  1LRA A;  1N5P A;  2IMJ A;  3FKA A;  5IER A;  4HZB B;  3L0R A;  4WFO A;  4FCZ A;  2W04 A;  4HVN A;  1HZ1 A;  2XF3 A;  3JUO A;  2F4Y A;  1I70 A;  2HMM B;  4RZM A;  1BRI A;  3EB8 A;  3HOH A;  3KE7 A;  1QAK A;  2GSP A;  1TFO A;  1WMN A;  1T3B A;  1JZD A;  1QAL A;  1CH0 A;  1TIJ A;  3CNM A;  1RGG A;  4EXR A;  2XFS A;  4HM4 B;  1GOY A;  1B21 A;  3EE1 A;  4O02 B;  1UCJ A;  1RGL A;  1JN5 A;  2Z6B A;  3WDG B;  4J8T A;  4QWT A;  3CCR 3;  1DET A;  1N9E A;  2LYX A;  1V74 A;  1BRN L;  3NXJ A;  1X1Y A;  1T2H A;  1W7C A;  2D42 A;  1RRL A;  3NX0 A;  3HII A;  3EJV A;  3EQQ B;  1N8R 4;  4HBR A;  4NRE A;  4NHF A;  3CCE 3;  3DGN A;  3F7X A;  2CWV A;  1W00 A;  1G02 A;  1UUV B;  5BU4 A;  4OVM A;  1G0T A;  3S29 A;  4FCJ A;  1YVS A;  2Y74 A;  3QRD A;  4RNY A;  1VQ7 3;  3S67 A;  1JNQ A;  1BSB A;  4N6L A;  1C7H A;  1OHP A;  2ML5 A;  2F86 B;  5BXQ A;  1NU3 A;  1B2U A;  2W56 B;  3LT9 A;  4ORL A;  1ZS7 A;  3KII A;  1LQG C;  3CCL 3;  3GAX A;  1MOL A;  1BNG A;  3FG4 A;  4BU4 A;  1B2X A;  1LNH A;  1YGE A;  1RLS A;  2K3D A;  1K28 A;  3CD6 3;  4WYK A;  2AAE A;  3K0Z A;  1MGW A;  3F8H A;  4EYC A;  1VQK 3;  1YI2 3;  1MGR A;  1Q82 4; 
#chains in the Genus database with same CATH homology
 4STD A;  1OHO A;  4IPB A;  7STD A;  2XH9 A;  4LZI A;  3B4O A;  3ECF A;  2Z77 A;  1W6Y A;  2STD A;  5IEO A;  5BVB A;  4G1M B;  1QMA A;  3WA3 A;  2O3O A;  1K73 4;  4K61 A;  3DMC A;  1YJN 3;  3WOE B;  3E99 A;  5FGO A;  5I97 A;  4R9K A;  1O7H B;  2Y73 A;  3G16 A;  4PEJ A;  3T8N A;  3PGB A;  3G4S 3;  3BNB A;  2D1W A;  2XGN A;  2HMK B;  1TU5 A;  2HMO B;  3NBR A;  4HZ9 B;  2ZDJ A;  3EBY A;  3F7S A;  4O8S A;  1IV7 A;  1U5O A;  4Q53 A;  2MF7 A;  4KFE A;  3FH1 A;  5LC6 A;  1IQ8 A;  1N9J A;  2OOV A;  3NM2 A;  1KWI A;  2IUK A;  3FF0 A;  5CXO A;  1IDP A;  1YVB I;  2W0Q A;  3EX9 A;  2OTL 3;  3PS8 A;  2P38 A;  5AEW B;  1OAC A;  1D6Y A;  1UI7 A;  2FGT A;  3TDG A;  1STD A;  2JDI H;  4J9A A;  3X40 A;  5IG3 A;  1NDO B;  3QK9 A;  1RRH A;  2P0X A;  3D3L A;  5DRV A;  5EEO A;  3FF2 A;  1WTH A;  2K54 A;  4H3U A;  4MEI A;  4XDW A;  4HM8 B;  1Z1S A;  2CIU A;  3F14 A;  3BNC A;  1VZZ A;  3NV0 B;  2E2V A;  2YFJ B;  3GZX B;  3Q2P A;  2INX A;  3DGM A;  4GB5 A;  2PZV A;  2Q07 A;  1G96 A;  1JKG A;  1WMO A;  5AEU B;  4FMC A;  3X41 A;  3LH4 A;  3NHX A;  2CFG A;  2CHC A;  2YFI B;  1CQS A;  3N54 B;  3EN1 B;  3T8U A;  1SQW A;  3I56 3;  1W02 A;  2RSX A;  8CHO A;  1OF5 B;  1GD4 A;  1OUN A;  2XGL A;  1AVK A;  4JRF A;  1LOX A;  3K5T A;  3OWU A;  2C11 A;  1D6U A;  1EKM A;  2CKF B;  1KC8 4;  3GZY B;  4FR9 A;  5TGN A;  3LT8 A;  4O2H A;  5IF6 A;  1VQM 3;  1OGX A;  4XB5 A;  1N5H A;  2YFL B;  5IEN A;  1FGT A;  3CPW 2;  1YIJ 3;  4XBY A;  1E97 A;  1OH0 A;  3BND A;  1NJI 4;  3CPO A;  1Y4K A;  1Q7Y 4;  1IT8 A;  1VQ8 3;  3SXX A;  1K41 A;  4KVH A;  3LML A;  3IPT A;  1Q40 B;  3DUK A;  3NBJ A;  5IEP A;  1VQP 3;  1D6Z A;  1ISK A;  2WGO A;  3CXC 2;  2QEX 3;  2CW9 A;  3EHC A;  3M8C A;  1OPY A;  1QVG 2;  2P09 A;  1RJO A;  1DVC A;  4HM3 B;  2BT3 A;  1KSI A;  2UX0 A;  3SLU A;  3LZA A;  3HZP A;  5AYR B;  1A90 A;  2W9P A;  3JUQ A;  3JUN A;  4LSO A;  3OXA A;  5JPP A;  1DMQ A;  1ASK A;  1W4N A;  4HKV B;  4N6M A;  5IW9 A;  4K1V A;  3K9M C;  1FGO A;  4I4K A;  3SVA A;  1ZX2 A;  2KCD A;  3UNL A;  3O8Y A;  5CF1 A;  1S5A A;  4U13 A;  2WGQ A;  2V1L A;  3DGL A;  4HM7 B;  1IT7 A;  3AMO A;  4FCM A;  1OF5 A;  3FZW A;  2B24 B;  5STD A;  3CC4 3;  4IIA A;  3J7Y d;  1NO3 A;  2GEX A;  2CWT A;  1YJW 3;  3GRD A;  4GL6 A;  1GY6 A;  1DMM A;  4CDL A;  3X3Y A;  1TFK A;  2GBW B;  3LTB A;  4N6N B;  2XSO B;  5IG4 A;  3Q90 A;  5KP4 A;  3B8L A;  5EQL A;  1WNH A;  1JB4 A;  1EA2 A;  5FW5 A;  1RN7 A;  2W2C A;  4N6O B;  3STD A;  5CLK A;  1FA3 A;  3FCS B;  1EG9 B;  3CME 3;  3GWR A;  4X2O A;  4LMI A;  2I9W A;  5IG0 A;  2BMQ B;  3PZW A;  3G0K A;  3H3H A;  1YHQ 3;  2GU1 A;  3DZL A;  4HM5 B;  1W6G A;  3CU3 A;  3SOA A;  4JF8 A;  4EV2 A;  3N8B A;  3HI7 A;  2F98 A;  2R4I A;  1NB3 I;  4XBT A;  1E3R A;  2ZL8 A;  2W9Q A;  2IA7 A;  2JQ5 A;  3IMA B;  3MHE A;  1Q81 4;  1W01 A;  5AII A;  2Z76 A;  4HM0 B;  2W03 A;  4O3V A;  1FGQ A;  2GBX B;  1US1 A;  5AYS C;  3ROB A;  2OTJ 3;  2K0M A;  2CFD A;  3MYT A;  3LTD A;  3MKI A;  2RGQ A;  4MMY B;  5CK6 A;  3VSY A;  3CC2 3;  2BNG A;  3WOD G;  2GU3 A;  2W56 A;  1LVN A;  3X3X A;  4CCV A;  2WOH A;  2CWU A;  2OQE A;  3EN8 A;  3EF8 A;  1W6C A;  4EC6 A;  3CCV 3;  5HGR A;  4WHA A;  1FGR A;  1W2Z A;  1O7W B;  1OGZ A;  4N6V 0;  1JB5 A;  3PCS A;  3V98 A;  3JUP A;  4H61 A;  4WWU C;  6STD A;  5D82 A;  3OWS A;  1CEW I;  1VQ4 3;  4N3V A;  2OCT A;  1GYB A;  3BB9 A;  2CFW A;  3NUV A;  2P0M A;  5AIH A;  2B1X B;  5JPU A;  2GXF A;  1J2B A;  1DYU A;  1QVF 2;  3KZT A;  4HM2 B;  3FG1 A;  1S72 3;  1M1X B;  2BHM A;  3DM8 A;  5ELU A;  5ELJ A;  4EV5 A;  2PNC A;  3LTA A;  1JN5 B;  1JB2 A;  4RNZ A;  3DY5 A;  1IU7 A;  2BMR B;  1UI8 A;  1VQN 3;  3KN4 A;  3B4P A;  3KSE D;  2QIY A;  3LOY A;  3VGN A;  3KFQ C;  1IVV A;  2OWP A;  4HYZ A;  3RGA A;  5AIG A;  3N9H A;  4IT7 A;  3RDE A;  1NB5 I;  3D9R A;  1BUQ A;  5KP1 A;  1VQ5 3;  4K90 B;  4FMD A;  3MPH A;  1A67 A;  1IVU A;  3PXM A;  1PU4 A;  1QJG A;  3S28 A;  2YX9 A;  4MMZ B;  1IQX A;  2KXG A;  3FG3 A;  3CCJ 3;  3NM7 A;  1HU9 A;  4FMA A;  4XBX A;  1ZO2 A;  4FMB A;  4WYK B;  2SBL A;  3NBB A;  1FGM A;  2C10 A;  3GZR A;  3WOF B;  5A0O B;  1A2K A;  1AVL A;  3JVC A;  4HM6 B;  2LQV A;  3NV0 A;  5G2G A;  3NQY A;  3G8Z A;  3HIG A;  3FSD A;  4R9L A;  4TX4 A;  1GY7 A;  1OHS A;  4AKY A;  3LTC A;  3DGO A;  5CF2 A;  3MG2 A;  2CG0 A;  3HX8 A;  3RGR A;  4XDV A;  5EVH A;  3ALA A;  1E3V A;  4R4K A;  1EQK A;  2QA4 3;  3CCQ 3;  2RFR A;  3F40 A;  2L4V A;  2E2T A;  4X2H A;  1A2V A;  2HMN B;  1IVW A;  2O9U X;  4R1K A;  1ROV A;  2FNQ A;  4R80 A;  1OCV A;  2CG1 A;  1VQL 3;  1T5Y A;  3CCM 3;  1JRQ A;  4KZ1 A;  3FGY A;  1HKX A;  3SX1 A;  3OW2 2;  5D81 A;  1L5G B;  4MMX B;  4LGQ A;  3I0Y A;  3CNX A;  1Q40 A;  2ML6 A;  3GZB A;  4AEQ A;  2BO9 B;  3MG3 A;  3HK4 A;  1F8N A;  2WO0 A;  2F99 A;  5DRE A;  1W2B 2;  4HM1 B;  2FXT A;  1WMP A;  5AIF A;  1DVD A;  4KFD A;  1VQ9 3;  1VQ6 3;  3K7C A;  1K9M 4;  1IK3 A;  1M9G A;  4XM4 A;  3UL6 A;  3BNE A;  1TUH A;  3DXO A;  3IJE B;  3U97 A;  1JJ2 2;  3MWZ A;  3EC9 A;  1ROA A;  3CMA 3;  1Q42 A;  3KSP A;  3UL5 A;  1R4C A;  3ER7 A;  1SJW A;  2CFK A;  3S27 A;  1IQY A;  4OK0 A;  4MJD A;  1JKG B;  3X42 A;  1O7G B;  1U8C B;  5IG5 A;  1N8Q A;  2XRX B;  3FLJ A;  1SIH A;  2Z7A A;  1ULI B;  1CYV A;  2HML B;  4N6T A;  3F8X A;  3NQZ A;  4KFF A;  4L7K A;  3PYJ A;  2XR8 B;  4EBG A;  3G6E 3;  3F9S A;  2CK3 H;  2M7O A;  2WOF A;  3UB1 A;  3WA2 X;  1CYU A;  2OOV C;  1JV2 B;  1STF I;  2KRT A;  3OX9 A;  3PCR A;  3H51 A;  3V92 A;  2BMO B;  1KQS 2;  2OQE C;  1AV4 A;  3MSO A;  4OUQ A;  3VF1 A;  3LYG A;  5KP3 A;  1O7M B;  1O7P B;  1NWW A;  1UW1 A;  3SOY A;  2CC3 A;  5JBS A;  4WP5 A;  2CFL A;  4HJL B;  1GD3 A;  3WMD A;  2HMJ B;  1MNL A;  1QAF A;  3I55 3;  4L8O A;  2GEY A;  2MC8 A;  1M1K 4;  3B7C A;  2IUJ A;  1IV9 A;  3JUM A;  4AKZ A;  1Q86 4;  1K8A 4;  1W5Z A;  3X3Z A;  4LEH A;  3V99 A;  1M90 4;  3S5C A;  1DMN A;  2A15 A;  3OV4 A;  1VQO 3;  4BTY A;  1FUW A;  1GY5 A;  2E2U A;  4BTX A;  1YIT 3;  3U1W A;  1TP6 A;  1UUW B;  1WQL B;  3LXU X;  1PFP A;  3Q1C A;  2XFT A;  2RCD A;  5LC7 A;  3G71 3;  4N6U A;  3T0U A;  1IVX A;  2W6J H;  3OWY A;  3K63 A;  4BTW A;  1YJ9 3;  1LXE A;  3CCS 3;  1GS3 A;  3KKG A;  1AR0 A;  2CH9 A;  5D83 A;  3AMO B;  1RKY A;  3CCU 3;  3MG1 A;  1KD1 4;  3UJM A;  4RBN A;  4L8P A;  2QGU A;  5AI1 A;  2P05 A;  3CC7 3;  3SED A;  1O7N B;  3EBT A;  2XSH B;  3BLZ A;  1ULJ B;  4K1U A;  1SII A;  4ZM8 A;  3A76 A;  1SPU A;  2XEP A;  5IER A;  1N5P A;  2IMJ A;  3FKA A;  4HZB B;  3L0R A;  4WFO A;  4FCZ A;  2W04 A;  4HVN A;  2XF3 A;  3JUO A;  2HMM B;  4RZM A;  3EB8 A;  3KE7 A;  1QAK A;  1TFO A;  1WMN A;  1QAL A;  1TIJ A;  3CNM A;  4EXR A;  2XFS A;  4HM4 B;  4O02 B;  3EE1 A;  2Z6B A;  1JN5 A;  3WDG B;  4J8T A;  4QWT A;  3CCR 3;  1N9E A;  2LYX A;  1V74 A;  3NXJ A;  1W7C A;  2D42 A;  1RRL A;  3NX0 A;  3HII A;  3EJV A;  3EQQ B;  1N8R 4;  4HBR A;  4NRE A;  4NHF A;  3CCE 3;  3DGN A;  3F7X A;  2CWV A;  1W00 A;  1UUV B;  4OVM A;  3S29 A;  4FCJ A;  2Y74 A;  3QRD A;  4RNY A;  1VQ7 3;  3S67 A;  1JNQ A;  4N6L A;  1C7H A;  1OHP A;  2ML5 A;  2F86 B;  5BXQ A;  1NU3 A;  2W56 B;  3LT9 A;  4ORL A;  3KII A;  3CCL 3;  3GAX A;  1MOL A;  3FG4 A;  1YGE A;  1LNH A;  1K28 A;  3CD6 3;  4WYK A;  3K0Z A;  4EYC A;  3F8H A;  1VQK 3;  1YI2 3;  1Q82 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...