1DMMA

Crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmmA00
4R9LA 1U5OA 2RCDA 3B8LA 4XM4A 4OUQA 1IDPA 4HM1B 3UNLA 3JUQA 1GS3A 2YFLB 1S5AA 4K1UA 2QIYA 5CF2A 1CQSA 3MG3A 2CHCA 1Q42A 5IENA 4PEJA 5AI1A 4HM5B 3EN1B 3EQQB 1OHPA 5KP4A 1Q40A 4LEHA 3GZBA 1E97A 1OPYA 3OV4A 3NUVA 4L8PA 3WMDA 1GY6A 4XBXA 1JB2A 1NU3A 1OUNA 1O7MB 2K54A 1E3VA 5AEWB 1NDOB 3DXOA 1DMQA 3G0KA 4CDLA 3EF8A 3T8NA 1OCVA 4Q53A 3GZXB 3NXJA 2BMOB 5DRVA 4HZBB 3DUKA 3HK4A 3ECFA 5CK6A 3JUOA 1WQLB 3D9RA 4X2HA 4FCMA 3ER7A 5EVHA 4HM0B 3HX8A 3B7CA 3FZWA 2Z76A 4XBYA 1JKGA 1TP6A 1OH0A 4XBTA 2XSHB 3GRDA 5G2GA 1AR0A 1JN5A 4HKVB 7STDA 1EG9B 3GZRA 3LZAA 4LMIA 1O7GB 4FCJA 1ULJB 3E99A 1W6YA 5AIFA 1UUVB 4IIAA 2XSOB 2Z77A 1GY5A 4L7KA 1E3RA 3FGYA 4ORLA 3B4PA 2GBWB 2UX0A 3F8HA 3GWRA 2OWPA 1BUQA 5D81A 1DMNA 3B4OA 5D83A 3EX9A 4U13A 1DMMA 4XDVA 5IERA 3MKIA 3KE7A 2GEXA 2RFRA 4LGQA 3T8UA 3UJMA 2HMJB 3K7CA 5DREA 2Z7AA 3NHXA 5HGRA 2HMNB 3KSPA 2IMJA 5CLKA 2BMRB 3NM2A 3F40A 3VSYA 2HMLB 3DMCA 3JUPA 1OF5A 3HZPA 4KVHA 1Z1SA 2B1XB 3GZYB 1O7PB 4HVNA 1UUWB 5IG4A 4K1VA 1O7WB 5D82A 5STDA 1JKGB 3NV0B 3KZTA 1O7NB 3OWSA 8CHOA 3MSOA 4XB5A 3EN8A 3OXAA 1W01A 2A15A 3F7XA 1HKXA 2QGUA 5AIIA 3K0ZA 3ROBA 1VZZA 6STDA 1EA2A 4X2OA 3NBRA 3MYTA 3MHEA 5JPPA 1ASKA 4HM7B 4RZMA 4J9AA 3FSDA 3MG2A 3I0YA 3G16A 4HM6B 3OWUA 2GBXB 4H3UA 2STDA 1JB4A 4HM2B 3FKAA 3Q90A 1Q40B 4WWUC 1K41A 4STDA 5IEOA 2XR8B 3MG1A 5IEPA 3EBTA 3F8XA 1C7HA 2INXA 4WYKA 2BNGA 5CF1A 4OVMA 4I4KA 1ZO2A 3OWYA 1GYBA 3EHCA 2YFIB 4HM8B 4XDWA 2R4IA 3LYGA 1QJGA 3FLJA 1STDA 5FW5A 4GB5A 1A2KA 4HM3B 3CNXA 3RGAA 4J8TA 1W00A 3G8ZA 5JPUA 3F9SA 2BMQB 2PZVA 2F99A 1JB5A 4L8OA 2HMMB 2JQ5A 2HMKB 4HJLB 3FH1A 3A76A 3BB9A 3KKGA 4R1KA 1ZX2A 3IPTA 1JN5B 2B24B 2F86B 1OHOA 3DZLA 2F98A 2RGQA 1OGXA 5AIHA 5IF6A 2XRXB 4R9KA 5BVBA 3JUNA 4WP5A 1SJWA 2YFJB 3EJVA 3EC9A 5AEUB 3CPOA 3STDA 3SEDA 2I9WA 3BLZA 2GXFA 5KP1A 3FF2A 4HM4B 2GEYA 3OX9A 4WYKB 4N3VA 3S5CA 1NWWA 3H3HA 1W02A 3EBYA 3FF0A 3DM8A 5IG0A 1OGZA 3CU3A 3VGNA 3NV0A 1OHSA 3H51A 5IG3A 3CNMA 4HZ9B 5TGNA 1GY7A 3RGRA 3SOAA 1ULIB 5CXOA 4MJDA 3F14A 3SOYA 5IG5A 1QMAA 5BXQA 1OF5B 3F7SA 1ISKA 5AIGA 3JUMA 5KP3A 1TUHA 2W2CA 3M8CA 2CKFB 1O7HB 2HMOB
chains in the Genus database with same CATH superfamily
4R9LA 2CWVA 2R41A 2E2TA 1U5OA 2RCDA 3FCSB 2CFWA 3B8LA 4XM4A 4OUQA 3RNTA 1IDPA 4HM1B 3UNLA 3CCM3 1GMRA 3JUQA 1Q9EA 3KCHA 4KFDA 1GS3A 4AKYA 2YFLB 3DGNA 2OTJ3 1BRHA 1S5AA 1RGEA 4MMXB 4K1UA 2CH9A 2SARA 2P38A 4EBGA 1V58A 1NO3A 5AYRB 1Q814 1VQL3 2QIYA 2CX1A 4FMBA 1IQ8A 3BNEA 5CF2A 4ZM8A 1CQSA 1UDII 3MG3A 2CHCA 1Q42A 5IENA 3LH4A 3LTBA 3PZWA 4PEJA 6GSPA 2CIUA 5AI1A 1NB5I 3UB1A 3DH2A 4HM5B 3EN1B 3EQQB 3WHOA 1OHPA 1YJ93 5KP4A 1Q40A 2XFSA 4LEHA 3GZBA 4O3VA 1E97A 3JVCA 1DE3A 1OPYA 5M19A 3AGNA 1TRQA 2KF6A 1W2B2 2H0IA 1LNIA 3OV4A 1ZS7A 3LXUX 3NUVA 2C10A 1IU7A 3A5EA 2QEX3 1RGGA 4L8PA 3WR2A 2XGNA 3WMDA 1GY6A 2KF5A 1UCJA 4XBXA 1MNLA 2CG0A 1RNTA 4CPKA 1JB2A 1NU3A 3NQYA 1DVCA 1O7MB 1OUNA 2WGOA 2MC8A 1JBRA 1BIRA 2BIRA 1RGHA 1PYLA 2K54A 1E3VA 2KF3A 2KF4A 5AEWB 3HIGA 1NDOB 3DXOA 1DMQA 2OQEC 1I2FA 3UL6A 1YIJ3 2LQVA 3G0KA 4CDLA 3NM7A 1Q7Y4 3EF8A 1QVG2 1IV9A 3T8NA 1RTUA 1B3SA 3CCV3 1OCVA 2OTL3 3WA3A 1SPUA 2WO0A 4Q53A 3GZXB 4I5QA 3NXJA 1QAKA 4HAAA 1BNIA 2BMOB 5DRVA 4IT7A 4K90B 3BIRA 4HZBB 4LSOA 3DUKA 3HK4A 7RNTA 2O9UX 3ECFA 1EQKA 3FG4A 5CK6A 1FUWA 1T2HA 1GD3A 2H0GA 3JUOA 4KT3B 2KXGA 5EQLA 2E2UA 1WQLB 2KAAA 4CJNA 3AHWA 1K8A4 3D9RA 1VQK3 2BO9B 2LYXA 4ILFA 4X2HA 4FCMA 1M904 3BU4A 3ER7A 1RGKA 2XF3A 5EVHA 1BNRA 2ZDJA 3X3XA 1W6CA 1KQS2 4HM0B 3HX8A 3B7CA 3FZWA 4BU4A 3CCQ3 4G1MB 1BRNL 2Z76A 2O3OA 4XBYA 1BRSA 1JKGA 1TP6A 5IW9A 1OH0A 3ALAA 4XBTA 3KSED 2XSHB 3LT9A 1YVBI 3V98A 3GRDA 5G2GA 1AR0A 1YNVX 1JN5A 1BRJA 1RGLA 2IYJA 4HKVB 3CCU3 5LC6A 1FW7A 4FMAA 1SQWA 7STDA 3VF1A 1TJDA 1EG9B 2YX9A 4OK0A 2RSXA 3GZRA 3PGBA 1AV4A 5LC7A 1I0VA 1W7CA 3RDEA 1JRQA 3LZAA 3CCR3 1NNVA 4LMIA 3NBBA 1DVDA 1J2BA 4N6OB 3J7Yd 1BU4A 1KC84 1O7GB 1PY3A 1JNQA 1BVIA 4FCJA 1ULJB 5I97A 4TX4A 3E99A 1W6YA 1B27A 1FGQA 5AIFA 1RKYA 1UUVB 1VQ43 1N9JA 4IIAA 3KFQC 2Y74A 1US1A 4RBNA 4EXRA 2AADA 1UCLA 2XSOB 4O8SA 2Z77A 4EW5A 1GY5A 4L7KA 3V92A 2OOVC 1E3RA 3FGYA 4ORLA 3Q1CA 2CC3A 3QRDA 3CD63 3CPW2 3B4PA 2GBWB 2UX0A 3G6E3 3F8HA 3GWRA 3DY5A 1BANA 5G1KA 2OWPA 1BUQA 4NHFA 5D81A 1DMNA 1RN1A 4N6NB 1RLSA 3B4OA 3K63A 3HIIA 5D83A 1L5GB 3EX9A 3LOYA 4U13A 2F5WA 1DMMA 1A2VA 1CEWI 1VQQA 1X1YA 1A67A 1JZOA 4XDVA 5IERA 3MKIA 3KE7A 1QAFA 8RNTA 2GEXA 1RDSA 1GOUA 1T2IA 2XEPA 3WOFB 1TFKA 2RFRA 3GSPA 4LGQA 3T8UA 2HMJB 3UJMA 1B2XA 3K7CA 1LQGC 2W04A 1RJOA 5DREA 2Z7AA 1B2SA 1LOVA 3NHXA 1VQM3 5HGRA 2HMNB 1BOXA 1KWIA 3KIIA 1PFPA 1K28A 3KSPA 1EUIC 1K9M4 2IMJA 2FGTA 3V99A 1K734 1UGHI 4BTYA 1ZGXA 2P05A 5CLKA 2BMRB 4FMDA 4O2HA 3LTAA 2XH9A 3NM2A 5BU4A 3F40A 5HOHA 3VSYA 4CCVA 3D3LA 2HMLB 3DMCA 4BTWA 1GOVA 3JUPA 3IJEB 2OQEA 1RMSA 1YIT3 4H61A 1OF5A 1ROAA 1YVSA 3HZPA 3I553 1R4CA 4KVHA 1IT8A 3WOEB 3S27A 1Z1SA 9RNTA 2B1XB 1T5YA 4MMYB 3CME3 3D79A 3GZYB 3TDGA 2W56A 1D6YA 3N9HA 1O7PB 1LQMB 1RHLA 3Q3FA 4HVNA 1UUWB 5IG4A 4K1VA 1GMPA 4NPBA 1YI23 1IQXA 1O7WB 2HOHA 5D82A 2OCTA 5STDA 3G4S3 1FUTA 2QA43 1OACA 1UUGB 4KFEA 3NQZA 3SXXA 1BNJA 1JKGB 2BT3A 2ZHXB 1M1K4 2W6JH 2F4YA 3NV0B 4WHAA 1GOYA 3KZTA 1IK3A 2AAEA 1LNHA 1O7NB 3URPA 4KFFA 3OWSA 1N9EA 8CHOA 1GMQA 1W4NA 3MSOA 1CH0A 1X1UA 3EN8A 1DYUA 4XB5A 2Y73A 1VQO3 4R4KA 3OXAA 1YGEA 1VQN3 2Z6BA 1UCIA 1W01A 1MGRA 2A15A 3NX0A 3GAXA 1KSIA 4R80A 1YJN3 3F7XA 2J8XB 2RBIA 1HKXA 6RNTA 1G96A 3EB8A 2QGUA 2V1LA 3DGOA 5AIIA 3CC23 3FG1A 3K0ZA 5ELUA 1D6UA 3NBJA 2WOHA 3ROBA 4BL2A 1VZZA 2C4BA 3S28A 2JDIH 1MGWA 3AGOA 6STDA 4N6V0 3LTDA 1EA2A 2RNTA 4X2OA 1STFI 3NBRA 3CCL3 1RGCA 2CFDA 3FG3A 3MYTA 3MHEA 2L4VA 3CCJ3 3D5IA 3BNBA 2CK3H 5JPPA 1ASKA 3LT8A 4HM7B 4RZMA 3WA2X 3DGYA 4J9AA 2F5MA 4WFOA 1IQYA 1RN7A 2CWTA 1QVF2 3FSDA 5M1AA 3X3ZA 1N5HA 3SLUA 1B2UA 1LRAA 3MG2A 2MF7A 3SVAA 1B2MA 3I0YA 1BRIA 3G16A 4HM6B 1GD4A 3X3YA 1JJ22 3OWUA 3ZG5A 1BGSA 2GBXB 2GU1A 1LOWA 1MWSA 4BIRA 1VQ53 2BHMA 3HOHA 4H3UA 1R4YA 2STDA 3AMOA 1JB4A 1Y4KA 1FGRA 1FGMA 2WGQA 3WODG 4HM2B 2KRTA 1BSDA 1W5ZA 1A2PA 1NB3I 2FXTA 2K3DA 3FKAA 3O8YA 4N6MA 1IVUA 1M9GA 5M18A 2W0QA 3Q90A 1UI8A 1BSAA 3N54B 4MEIA 1Q40B 4WWUC 4DKIA 1BSBA 1K41A 2CX0A 1GSPA 4STDA 5IEOA 1RGAA 2XR8B 3MG1A 3ZFZA 1IVXA 1AVKA 1N8R4 2XGLA 2IUKA 4FMCA 3EBTA 2P09A 1I2EA 5G1LA 1W2ZA 5IEPA 2W9PA 3F8XA 1C7HA 2INXA 4WYKA 1MWRA 2BNGA 3K9MC 5GSPA 5EEOA 1QALA 5CF1A 3CXC2 3KN4A 1Q864 3LTCA 1UI7A 2CFGA 4I4KA 4OVMA 4RNZA 3L0RA 3CMA3 3AHSA 3SX1A 1A90A 1AQZA 2Q07A 2FNQA 1JBTA 2IUJA 1ZO2A 3OWYA 1MOLA 4FR9A 1BNGA 1GYBA 1SIHA 1RRHA 2BU4A 2C11A 1RRLA 3EHCA 1RCKA 1YJW3 2YFIB 4HM8B 3CCS3 4XDWA 1BSEA 1I3FA 2R4IA 3LYGA 1IVWA 1QJGA 3FLJA 1STDA 1AVLA 2F56A 5FW5A 1WNHA 2UGIA 3PCSA 4GB5A 2SBLA 1TFOA 1A2KA 4EYCA 2XFTA 4IPBA 4HM3B 4HOHA 4QWTA 3CNXA 1UCKA 1HZ1A 3DGLA 1I8VA 2ML6A 1S723 3RGAA 3S29A 2CFKA 1IT7A 1BNSA 1Q824 4FCZA 4J8TA 1BUJA 2D42A 1WMOA 1W00A 3N8BA 1VQ93 3G8ZA 5JPUA 1VQP3 4EC6A 5A0OB 3D5GA 3F9SA 3OW22 3SYUA 4RNYA 4JRFA 1IV7A 1LOXA 3G713 1V57A 3PCRA 2BMQB 2W9QA 1I3IA 2PZVA 2F99A 5FGOA 5ELJA 1BNEA 1JB5A 1WMNA 4L8OA 3BNDA 2HMMB 2JQ5A 2HMKB 1U8CB 4HJLB 3FH1A 1WMPA 3EE1A 5BIRA 3A76A 3BB9A 3KKGA 4R1KA 1ZX2A 4O02B 1TIJA 3IPTA 1EKMA 1DETA 2M7OA 1JN5B 4HBRA 1T3BA 3DGMA 1G0TA 1BNFA 1MWUA 1FYSA 1I70A 2B24B 2F86B 1OHOA 1M1XB 1CYUA 3DZLA 4JF8A 1FZUA 4MMZB 1B2ZA 2IY2A 1VQ73 1EEJA 1B20A 2F98A 2RGQA 1OGXA 4K61A 4GHOA 5AIHA 3ZG0A 5IF6A 1VQ83 1FGTA 2XRXB 4AEQA 1RGFA 1I2GA 3CC73 2W03A 4NREA 4R9KA 3WDGB 4BL3A 1D6ZA 3AMOB 5BVBA 2D1WA 3X41A 3JUNA 4WP5A 7GSPA 1BSCA 4GL6A 2ZA4A 4N6LA 1B21A 1SJWA 5AYSC 1AY7A 2YFJB 2ML5A 3EC9A 3EJVA 3S67A 5AEUB 3CPOA 3PXMA 3STDA 3SEDA 2I9WA 3BLZA 1X1XA 1JV2B 2GXFA 4AKZA 5KP1A 1FA3A 2GSPA 1N8QA 3FF2A 4J5GA 3U1WA 4HM4B 2GEYA 3OX9A 4GSPA 2OOVA 1TU5A 1YHQ3 4WYKB 4N3VA 3S5CA 1LXEA 3T0UA 1NWWA 2K0MA 3CC43 2H0HA 5RNTA 1IVVA 1YGWA 1N5PA 3H3HA 1I0XA 1W02A 3EBYA 3FF0A 3MWZA 3DM8A 4LZIA 1HYFA 1JZDA 5IG0A 1G02A 3HI7A 2P0MA 4HYZA 1IYYA 1CYVA 1BRGA 2ZL8A 1HU9A 1OGZA 2P0XA 3CU3A 3VGNA 1FGOA 3CCE3 3NV0A 1OHSA 1LOYA 4EV2A 5JBSA 3X40A 3Q2PA 3H51A 5IG3A 1NJI4 3CNMA 1FUSA 1TRPA 4HZ9B 1RNBA 1RCLA 4BTXA 1BAOA 3BNCA 1GY7A 3PS8A 1UW1A 3QK9A 5TGNA 1W6GA 3PYJA 3RGRA 1LVNA 1SIIA 2CWUA 2L1SA 2E2VA 2PNCA 4EV5A 1V74A 1ULIB 4N6TA 3SOAA 5CXOA 1VQ63 3D4AA 1WTHA 4MJDA 1PU4A 1TTOA 3F14A 1BRKA 1KD14 3LMLA 3SOYA 5IG5A 1QMAA 3IMAB 5BXQA 1OF5B 3I563 2IA7A 3F7SA 4KZ1A 1SARA 3K5TA 3U97A 3MPHA 1F8NA 1C54A 2W56B 2CFLA 1MWTA 1ROVA 4J5KA 4LYLB 3X42A 4RNTA 1ISKA 3UL5A 5AIGA 2UUGC 1UGIA 3JUMA 5KP3A 1TUHA 4N6UA 2W2CA 3M8CA 2CKFB 1O7HB 1RSNA 2KCDA 1JBSA 1X1WA 2GU3A 1Q7HA 2WOFA 2HMOB 2CG1A 2CW9A 1RN4A
chains in the Genus database with same CATH topology
4R9LA 2CWVA 2E2TA 1U5OA 2RCDA 3FCSB 2CFWA 3B8LA 4XM4A 4OUQA 3CCM3 1IDPA 4HM1B 3UNLA 3JUQA 4KFDA 1GS3A 4AKYA 2YFLB 3DGNA 2OTJ3 1S5AA 4MMXB 4K1UA 2CH9A 4EBGA 2P38A 1NO3A 5AYRB 1Q814 1VQL3 2QIYA 4FMBA 1IQ8A 3BNEA 5CF2A 4ZM8A 1CQSA 3MG3A 2CHCA 1Q42A 5IENA 3LH4A 3LTBA 3PZWA 4PEJA 2CIUA 5AI1A 1NB5I 3UB1A 4HM5B 3EN1B 3EQQB 1OHPA 1YJ93 5KP4A 1Q40A 2XFSA 4LEHA 3GZBA 4O3VA 1E97A 3JVCA 1OPYA 1W2B2 3OV4A 3LXUX 3NUVA 2C10A 1IU7A 2QEX3 4L8PA 2XGNA 3WMDA 1GY6A 4XBXA 1MNLA 2CG0A 1JB2A 1NU3A 3NQYA 1DVCA 1O7MB 1OUNA 2WGOA 2MC8A 2K54A 1E3VA 5AEWB 3HIGA 1NDOB 3DXOA 1DMQA 2OQEC 3UL6A 1YIJ3 2LQVA 3G0KA 4CDLA 3NM7A 1Q7Y4 3EF8A 1QVG2 1IV9A 3T8NA 3CCV3 1OCVA 2OTL3 3WA3A 1SPUA 2WO0A 4Q53A 3GZXB 3NXJA 1QAKA 2BMOB 5DRVA 4IT7A 4K90B 4HZBB 4LSOA 3DUKA 3HK4A 2O9UX 3ECFA 1EQKA 3FG4A 5CK6A 1FUWA 3JUOA 1GD3A 2KXGA 5EQLA 2E2UA 1WQLB 1K8A4 3D9RA 1VQK3 2BO9B 2LYXA 4X2HA 4FCMA 1M904 3ER7A 2XF3A 5EVHA 2ZDJA 3X3XA 1W6CA 1KQS2 4HM0B 3HX8A 3B7CA 3FZWA 3CCQ3 4G1MB 2Z76A 2O3OA 4XBYA 1JKGA 1TP6A 5IW9A 1OH0A 3ALAA 4XBTA 3KSED 2XSHB 3LT9A 1YVBI 3V98A 3GRDA 5G2GA 1AR0A 1JN5A 3CCU3 4HKVB 5LC6A 4FMAA 1SQWA 7STDA 3VF1A 4OK0A 1EG9B 2YX9A 2RSXA 3GZRA 3PGBA 1AV4A 5LC7A 1W7CA 3RDEA 1JRQA 3LZAA 3CCR3 1DVDA 4LMIA 3NBBA 1J2BA 4N6OB 3J7Yd 1KC84 1O7GB 1JNQA 4FCJA 1ULJB 5I97A 4TX4A 3E99A 1W6YA 1FGQA 5AIFA 1RKYA 1VQ43 1UUVB 1N9JA 4IIAA 3KFQC 2Y74A 1US1A 4RBNA 4EXRA 2XSOB 4O8SA 2Z77A 1GY5A 4L7KA 3V92A 2OOVC 1E3RA 3FGYA 4ORLA 3Q1CA 2CC3A 3QRDA 3CD63 3CPW2 3B4PA 2GBWB 2UX0A 3G6E3 3F8HA 3GWRA 3DY5A 2OWPA 1BUQA 4NHFA 5D81A 1DMNA 4N6NB 3B4OA 3K63A 3HIIA 5D83A 1L5GB 3EX9A 3LOYA 4U13A 1DMMA 1A2VA 1CEWI 1A67A 4XDVA 5IERA 3MKIA 3KE7A 1QAFA 2GEXA 2XEPA 3WOFB 1TFKA 2RFRA 4LGQA 3T8UA 3UJMA 2HMJB 3K7CA 2W04A 1RJOA 5DREA 2Z7AA 3NHXA 1VQM3 5HGRA 2HMNB 1KWIA 3KIIA 1PFPA 1K28A 3KSPA 1K9M4 2IMJA 2FGTA 3V99A 1K734 4BTYA 2P05A 5CLKA 2BMRB 4FMDA 4O2HA 3LTAA 2XH9A 3NM2A 3F40A 3VSYA 4CCVA 3D3LA 2HMLB 3DMCA 4BTWA 3JUPA 3IJEB 2OQEA 1YIT3 4H61A 1OF5A 1ROAA 3I553 3HZPA 1R4CA 4KVHA 1IT8A 3WOEB 3S27A 1Z1SA 2B1XB 1T5YA 4MMYB 3CME3 3GZYB 3TDGA 2W56A 1D6YA 3N9HA 1O7PB 4HVNA 1UUWB 5IG4A 4K1VA 1YI23 1IQXA 1O7WB 5D82A 2OCTA 5STDA 3G4S3 2QA43 1OACA 4KFEA 3NQZA 3SXXA 2BT3A 1JKGB 1M1K4 2W6JH 3NV0B 4WHAA 3KZTA 1IK3A 1LNHA 1O7NB 4KFFA 3OWSA 1N9EA 8CHOA 1W4NA 3MSOA 4XB5A 3EN8A 1DYUA 2Y73A 1VQO3 4R4KA 3OXAA 1YGEA 1VQN3 2Z6BA 1W01A 2A15A 3NX0A 3GAXA 1KSIA 4R80A 1YJN3 3F7XA 1HKXA 1G96A 3EB8A 2QGUA 2V1LA 3DGOA 5AIIA 3CC23 3FG1A 3K0ZA 5ELUA 1D6UA 3NBJA 2WOHA 3ROBA 1VZZA 3S28A 2JDIH 6STDA 4N6V0 3LTDA 1EA2A 4X2OA 1STFI 3NBRA 3CCL3 2CFDA 3FG3A 3MYTA 3MHEA 2L4VA 3CCJ3 3BNBA 2CK3H 5JPPA 1ASKA 3LT8A 4HM7B 4RZMA 3WA2X 4J9AA 4WFOA 1IQYA 1RN7A 2CWTA 1QVF2 3FSDA 3X3ZA 1N5HA 3SLUA 3MG2A 2MF7A 3SVAA 3I0YA 3G16A 4HM6B 1GD4A 3X3YA 1JJ22 3OWUA 2GBXB 2GU1A 1VQ53 2BHMA 4H3UA 2STDA 3AMOA 1JB4A 1Y4KA 1FGRA 1FGMA 2WGQA 3WODG 4HM2B 2KRTA 1W5ZA 2FXTA 1NB3I 4N6MA 3FKAA 3O8YA 1IVUA 1M9GA 2W0QA 3Q90A 1UI8A 3N54B 4MEIA 1Q40B 4WWUC 1K41A 4STDA 5IEOA 2XR8B 3MG1A 1IVXA 1AVKA 1N8R4 2XGLA 2IUKA 4FMCA 3EBTA 2P09A 5IEPA 1W2ZA 2W9PA 3F8XA 1C7HA 2INXA 4WYKA 2BNGA 3K9MC 5EEOA 1QALA 5CF1A 3CXC2 3KN4A 1Q864 3LTCA 1UI7A 2CFGA 4I4KA 4OVMA 4RNZA 3L0RA 3CMA3 3SX1A 1A90A 2Q07A 2FNQA 2IUJA 1ZO2A 3OWYA 1MOLA 4FR9A 1GYBA 1SIHA 1RRHA 3EHCA 2C11A 1RRLA 1YJW3 2YFIB 4HM8B 3CCS3 4XDWA 2R4IA 3LYGA 1IVWA 1QJGA 3FLJA 1STDA 1AVLA 5FW5A 1WNHA 3PCSA 4GB5A 2SBLA 1TFOA 1A2KA 4EYCA 2XFTA 4IPBA 4HM3B 4QWTA 3CNXA 3DGLA 2ML6A 1S723 3RGAA 3S29A 2CFKA 1IT7A 1Q824 4FCZA 4J8TA 2D42A 1WMOA 1W00A 3N8BA 1VQ93 3G8ZA 5JPUA 1VQP3 4EC6A 5A0OB 3F9SA 3OW22 4RNYA 4JRFA 1LOXA 1IV7A 3G713 3PCRA 2BMQB 2W9QA 2PZVA 2F99A 5FGOA 5ELJA 1JB5A 1WMNA 4L8OA 3BNDA 2HMMB 2JQ5A 2HMKB 1U8CB 4HJLB 3FH1A 1WMPA 3EE1A 3A76A 3BB9A 3KKGA 4R1KA 1ZX2A 4O02B 1TIJA 3IPTA 1EKMA 2M7OA 1JN5B 4HBRA 3DGMA 2B24B 1CYUA 2F86B 1OHOA 1M1XB 3DZLA 4JF8A 4MMZB 1VQ73 2F98A 2RGQA 1OGXA 4K61A 5AIHA 5IF6A 1VQ83 1FGTA 2XRXB 4AEQA 3CC73 2W03A 4NREA 4R9KA 3WDGB 1D6ZA 3AMOB 5BVBA 2D1WA 3X41A 3JUNA 4WP5A 4GL6A 4N6LA 1SJWA 5AYSC 2YFJB 3EJVA 2ML5A 3EC9A 3S67A 5AEUB 3CPOA 3PXMA 3STDA 3SEDA 2I9WA 3BLZA 1JV2B 2GXFA 4AKZA 5KP1A 1FA3A 1N8QA 3FF2A 3U1WA 4HM4B 2GEYA 3OX9A 2OOVA 1TU5A 1YHQ3 4WYKB 4N3VA 3S5CA 1LXEA 3T0UA 1NWWA 2K0MA 3CC43 1IVVA 1N5PA 3H3HA 1W02A 3MWZA 3EBYA 3FF0A 4LZIA 3DM8A 5IG0A 3HI7A 2P0MA 4HYZA 1CYVA 2ZL8A 1HU9A 1OGZA 2P0XA 3CU3A 3VGNA 1FGOA 3CCE3 3NV0A 1OHSA 4EV2A 5JBSA 3X40A 3Q2PA 3H51A 5IG3A 1NJI4 3CNMA 4HZ9B 4BTXA 3BNCA 3QK9A 1GY7A 3PS8A 1UW1A 5TGNA 1W6GA 3PYJA 3RGRA 1LVNA 1SIIA 2CWUA 2E2VA 2PNCA 4EV5A 1V74A 1ULIB 4N6TA 3SOAA 5CXOA 1VQ63 1WTHA 4MJDA 1PU4A 3F14A 1KD14 3LMLA 3SOYA 5IG5A 1QMAA 3IMAB 5BXQA 1OF5B 3I563 2IA7A 3F7SA 4KZ1A 3K5TA 3U97A 3MPHA 1F8NA 2W56B 2CFLA 1ROVA 3X42A 1ISKA 3UL5A 5AIGA 3JUMA 5KP3A 1TUHA 4N6UA 2W2CA 3M8CA 2CKFB 1O7HB 2KCDA 2GU3A 2WOFA 2HMOB 2CG1A 2CW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9L A;  1U5O A;  2RCD A;  3B8L A;  4XM4 A;  4OUQ A;  1IDP A;  4HM1 B;  3UNL A;  3JUQ A;  1GS3 A;  2YFL B;  1S5A A;  4K1U A;  2QIY A;  5CF2 A;  1CQS A;  3MG3 A;  2CHC A;  1Q42 A;  5IEN A;  4PEJ A;  5AI1 A;  4HM5 B;  3EN1 B;  3EQQ B;  1OHP A;  5KP4 A;  1Q40 A;  4LEH A;  3GZB A;  1E97 A;  1OPY A;  3OV4 A;  3NUV A;  4L8P A;  3WMD A;  1GY6 A;  4XBX A;  1JB2 A;  1NU3 A;  1OUN A;  1O7M B;  2K54 A;  1E3V A;  5AEW B;  1NDO B;  3DXO A;  1DMQ A;  3G0K A;  4CDL A;  3EF8 A;  3T8N A;  1OCV A;  4Q53 A;  3GZX B;  3NXJ A;  2BMO B;  5DRV A;  4HZB B;  3DUK A;  3HK4 A;  3ECF A;  5CK6 A;  3JUO A;  1WQL B;  3D9R A;  4X2H A;  4FCM A;  3ER7 A;  5EVH A;  4HM0 B;  3HX8 A;  3B7C A;  3FZW A;  2Z76 A;  4XBY A;  1JKG A;  1TP6 A;  1OH0 A;  4XBT A;  2XSH B;  3GRD A;  5G2G A;  1AR0 A;  1JN5 A;  4HKV B;  7STD A;  1EG9 B;  3GZR A;  3LZA A;  4LMI A;  1O7G B;  4FCJ A;  1ULJ B;  3E99 A;  1W6Y A;  5AIF A;  1UUV B;  4IIA A;  2XSO B;  2Z77 A;  1GY5 A;  4L7K A;  1E3R A;  3FGY A;  4ORL A;  3B4P A;  2GBW B;  2UX0 A;  3F8H A;  3GWR A;  2OWP A;  1BUQ A;  5D81 A;  1DMN A;  3B4O A;  5D83 A;  3EX9 A;  4U13 A;  1DMM A;  4XDV A;  5IER A;  3MKI A;  3KE7 A;  2GEX A;  2RFR A;  4LGQ A;  3T8U A;  3UJM A;  2HMJ B;  3K7C A;  5DRE A;  2Z7A A;  3NHX A;  5HGR A;  2HMN B;  3KSP A;  2IMJ A;  5CLK A;  2BMR B;  3NM2 A;  3F40 A;  3VSY A;  2HML B;  3DMC A;  3JUP A;  1OF5 A;  3HZP A;  4KVH A;  1Z1S A;  2B1X B;  3GZY B;  1O7P B;  4HVN A;  1UUW B;  5IG4 A;  4K1V A;  1O7W B;  5D82 A;  5STD A;  1JKG B;  3NV0 B;  3KZT A;  1O7N B;  3OWS A;  8CHO A;  3MSO A;  4XB5 A;  3EN8 A;  3OXA A;  1W01 A;  2A15 A;  3F7X A;  1HKX A;  2QGU A;  5AII A;  3K0Z A;  3ROB A;  1VZZ A;  6STD A;  1EA2 A;  4X2O A;  3NBR A;  3MYT A;  3MHE A;  5JPP A;  1ASK A;  4HM7 B;  4RZM A;  4J9A A;  3FSD A;  3MG2 A;  3I0Y A;  3G16 A;  4HM6 B;  3OWU A;  2GBX B;  4H3U A;  2STD A;  1JB4 A;  4HM2 B;  3FKA A;  3Q90 A;  1Q40 B;  4WWU C;  1K41 A;  4STD A;  5IEO A;  2XR8 B;  3MG1 A;  5IEP A;  3EBT A;  3F8X A;  1C7H A;  2INX A;  4WYK A;  2BNG A;  5CF1 A;  4OVM A;  4I4K A;  1ZO2 A;  3OWY A;  1GYB A;  3EHC A;  2YFI B;  4HM8 B;  4XDW A;  2R4I A;  3LYG A;  1QJG A;  3FLJ A;  1STD A;  5FW5 A;  4GB5 A;  1A2K A;  4HM3 B;  3CNX A;  3RGA A;  4J8T A;  1W00 A;  3G8Z A;  5JPU A;  3F9S A;  2BMQ B;  2PZV A;  2F99 A;  1JB5 A;  4L8O A;  2HMM B;  2JQ5 A;  2HMK B;  4HJL B;  3FH1 A;  3A76 A;  3BB9 A;  3KKG A;  4R1K A;  1ZX2 A;  3IPT A;  1JN5 B;  2B24 B;  2F86 B;  1OHO A;  3DZL A;  2F98 A;  2RGQ A;  1OGX A;  5AIH A;  5IF6 A;  2XRX B;  4R9K A;  5BVB A;  3JUN A;  4WP5 A;  1SJW A;  2YFJ B;  3EJV A;  3EC9 A;  5AEU B;  3CPO A;  3STD A;  3SED A;  2I9W A;  3BLZ A;  2GXF A;  5KP1 A;  3FF2 A;  4HM4 B;  2GEY A;  3OX9 A;  4WYK B;  4N3V A;  3S5C A;  1NWW A;  3H3H A;  1W02 A;  3EBY A;  3FF0 A;  3DM8 A;  5IG0 A;  1OGZ A;  3CU3 A;  3VGN A;  3NV0 A;  1OHS A;  3H51 A;  5IG3 A;  3CNM A;  4HZ9 B;  5TGN A;  1GY7 A;  3RGR A;  3SOA A;  1ULI B;  5CXO A;  4MJD A;  3F14 A;  3SOY A;  5IG5 A;  1QMA A;  5BXQ A;  1OF5 B;  3F7S A;  1ISK A;  5AIG A;  3JUM A;  5KP3 A;  1TUH A;  2W2C A;  3M8C A;  2CKF B;  1O7H B;  2HMO B; 
#chains in the Genus database with same CATH topology
 4R9L A;  2CWV A;  2R41 A;  2E2T A;  1U5O A;  2RCD A;  3FCS B;  2CFW A;  3B8L A;  4XM4 A;  4OUQ A;  3RNT A;  1IDP A;  4HM1 B;  3UNL A;  3CCM 3;  1GMR A;  3JUQ A;  1Q9E A;  3KCH A;  4KFD A;  1GS3 A;  4AKY A;  2YFL B;  3DGN A;  2OTJ 3;  1BRH A;  1S5A A;  1RGE A;  4MMX B;  4K1U A;  2CH9 A;  2SAR A;  2P38 A;  4EBG A;  1V58 A;  1NO3 A;  5AYR B;  1Q81 4;  1VQL 3;  2QIY A;  2CX1 A;  4FMB A;  1IQ8 A;  3BNE A;  5CF2 A;  4ZM8 A;  1CQS A;  1UDI I;  3MG3 A;  2CHC A;  1Q42 A;  5IEN A;  3LH4 A;  3LTB A;  3PZW A;  4PEJ A;  6GSP A;  2CIU A;  5AI1 A;  1NB5 I;  3UB1 A;  3DH2 A;  4HM5 B;  3EN1 B;  3EQQ B;  3WHO A;  1OHP A;  1YJ9 3;  5KP4 A;  1Q40 A;  2XFS A;  4LEH A;  3GZB A;  4O3V A;  1E97 A;  3JVC A;  1DE3 A;  1OPY A;  5M19 A;  3AGN A;  1TRQ A;  2KF6 A;  1W2B 2;  2H0I A;  1LNI A;  3OV4 A;  1ZS7 A;  3LXU X;  3NUV A;  2C10 A;  1IU7 A;  3A5E A;  2QEX 3;  1RGG A;  4L8P A;  3WR2 A;  2XGN A;  3WMD A;  1GY6 A;  2KF5 A;  1UCJ A;  4XBX A;  1MNL A;  2CG0 A;  1RNT A;  4CPK A;  1JB2 A;  1NU3 A;  3NQY A;  1DVC A;  1O7M B;  1OUN A;  2WGO A;  2MC8 A;  1JBR A;  1BIR A;  2BIR A;  1RGH A;  1PYL A;  2K54 A;  1E3V A;  2KF3 A;  2KF4 A;  5AEW B;  3HIG A;  1NDO B;  3DXO A;  1DMQ A;  2OQE C;  1I2F A;  3UL6 A;  1YIJ 3;  2LQV A;  3G0K A;  4CDL A;  3NM7 A;  1Q7Y 4;  3EF8 A;  1QVG 2;  1IV9 A;  3T8N A;  1RTU A;  1B3S A;  3CCV 3;  1OCV A;  2OTL 3;  3WA3 A;  1SPU A;  2WO0 A;  4Q53 A;  3GZX B;  4I5Q A;  3NXJ A;  1QAK A;  4HAA A;  1BNI A;  2BMO B;  5DRV A;  4IT7 A;  4K90 B;  3BIR A;  4HZB B;  4LSO A;  3DUK A;  3HK4 A;  7RNT A;  2O9U X;  3ECF A;  1EQK A;  3FG4 A;  5CK6 A;  1FUW A;  1T2H A;  1GD3 A;  2H0G A;  3JUO A;  4KT3 B;  2KXG A;  5EQL A;  2E2U A;  1WQL B;  2KAA A;  4CJN A;  3AHW A;  1K8A 4;  3D9R A;  1VQK 3;  2BO9 B;  2LYX A;  4ILF A;  4X2H A;  4FCM A;  1M90 4;  3BU4 A;  3ER7 A;  1RGK A;  2XF3 A;  5EVH A;  1BNR A;  2ZDJ A;  3X3X A;  1W6C A;  1KQS 2;  4HM0 B;  3HX8 A;  3B7C A;  3FZW A;  4BU4 A;  3CCQ 3;  4G1M B;  1BRN L;  2Z76 A;  2O3O A;  4XBY A;  1BRS A;  1JKG A;  1TP6 A;  5IW9 A;  1OH0 A;  3ALA A;  4XBT A;  3KSE D;  2XSH B;  3LT9 A;  1YVB I;  3V98 A;  3GRD A;  5G2G A;  1AR0 A;  1YNV X;  1JN5 A;  1BRJ A;  1RGL A;  2IYJ A;  4HKV B;  3CCU 3;  5LC6 A;  1FW7 A;  4FMA A;  1SQW A;  7STD A;  3VF1 A;  1TJD A;  1EG9 B;  2YX9 A;  4OK0 A;  2RSX A;  3GZR A;  3PGB A;  1AV4 A;  5LC7 A;  1I0V A;  1W7C A;  3RDE A;  1JRQ A;  3LZA A;  3CCR 3;  1NNV A;  4LMI A;  3NBB A;  1DVD A;  1J2B A;  4N6O B;  3J7Y d;  1BU4 A;  1KC8 4;  1O7G B;  1PY3 A;  1JNQ A;  1BVI A;  4FCJ A;  1ULJ B;  5I97 A;  4TX4 A;  3E99 A;  1W6Y A;  1B27 A;  1FGQ A;  5AIF A;  1RKY A;  1UUV B;  1VQ4 3;  1N9J A;  4IIA A;  3KFQ C;  2Y74 A;  1US1 A;  4RBN A;  4EXR A;  2AAD A;  1UCL A;  2XSO B;  4O8S A;  2Z77 A;  4EW5 A;  1GY5 A;  4L7K A;  3V92 A;  2OOV C;  1E3R A;  3FGY A;  4ORL A;  3Q1C A;  2CC3 A;  3QRD A;  3CD6 3;  3CPW 2;  3B4P A;  2GBW B;  2UX0 A;  3G6E 3;  3F8H A;  3GWR A;  3DY5 A;  1BAN A;  5G1K A;  2OWP A;  1BUQ A;  4NHF A;  5D81 A;  1DMN A;  1RN1 A;  4N6N B;  1RLS A;  3B4O A;  3K63 A;  3HII A;  5D83 A;  1L5G B;  3EX9 A;  3LOY A;  4U13 A;  2F5W A;  1DMM A;  1A2V A;  1CEW I;  1VQQ A;  1X1Y A;  1A67 A;  1JZO A;  4XDV A;  5IER A;  3MKI A;  3KE7 A;  1QAF A;  8RNT A;  2GEX A;  1RDS A;  1GOU A;  1T2I A;  2XEP A;  3WOF B;  1TFK A;  2RFR A;  3GSP A;  4LGQ A;  3T8U A;  2HMJ B;  3UJM A;  1B2X A;  3K7C A;  1LQG C;  2W04 A;  1RJO A;  5DRE A;  2Z7A A;  1B2S A;  1LOV A;  3NHX A;  1VQM 3;  5HGR A;  2HMN B;  1BOX A;  1KWI A;  3KII A;  1PFP A;  1K28 A;  3KSP A;  1EUI C;  1K9M 4;  2IMJ A;  2FGT A;  3V99 A;  1K73 4;  1UGH I;  4BTY A;  1ZGX A;  2P05 A;  5CLK A;  2BMR B;  4FMD A;  4O2H A;  3LTA A;  2XH9 A;  3NM2 A;  5BU4 A;  3F40 A;  5HOH A;  3VSY A;  4CCV A;  3D3L A;  2HML B;  3DMC A;  4BTW A;  1GOV A;  3JUP A;  3IJE B;  2OQE A;  1RMS A;  1YIT 3;  4H61 A;  1OF5 A;  1ROA A;  1YVS A;  3HZP A;  3I55 3;  1R4C A;  4KVH A;  1IT8 A;  3WOE B;  3S27 A;  1Z1S A;  9RNT A;  2B1X B;  1T5Y A;  4MMY B;  3CME 3;  3D79 A;  3GZY B;  3TDG A;  2W56 A;  1D6Y A;  3N9H A;  1O7P B;  1LQM B;  1RHL A;  3Q3F A;  4HVN A;  1UUW B;  5IG4 A;  4K1V A;  1GMP A;  4NPB A;  1YI2 3;  1IQX A;  1O7W B;  2HOH A;  5D82 A;  2OCT A;  5STD A;  3G4S 3;  1FUT A;  2QA4 3;  1OAC A;  1UUG B;  4KFE A;  3NQZ A;  3SXX A;  1BNJ A;  1JKG B;  2BT3 A;  2ZHX B;  1M1K 4;  2W6J H;  2F4Y A;  3NV0 B;  4WHA A;  1GOY A;  3KZT A;  1IK3 A;  2AAE A;  1LNH A;  1O7N B;  3URP A;  4KFF A;  3OWS A;  1N9E A;  8CHO A;  1GMQ A;  1W4N A;  3MSO A;  1CH0 A;  1X1U A;  3EN8 A;  1DYU A;  4XB5 A;  2Y73 A;  1VQO 3;  4R4K A;  3OXA A;  1YGE A;  1VQN 3;  2Z6B A;  1UCI A;  1W01 A;  1MGR A;  2A15 A;  3NX0 A;  3GAX A;  1KSI A;  4R80 A;  1YJN 3;  3F7X A;  2J8X B;  2RBI A;  1HKX A;  6RNT A;  1G96 A;  3EB8 A;  2QGU A;  2V1L A;  3DGO A;  5AII A;  3CC2 3;  3FG1 A;  3K0Z A;  5ELU A;  1D6U A;  3NBJ A;  2WOH A;  3ROB A;  4BL2 A;  1VZZ A;  2C4B A;  3S28 A;  2JDI H;  1MGW A;  3AGO A;  6STD A;  4N6V 0;  3LTD A;  1EA2 A;  2RNT A;  4X2O A;  1STF I;  3NBR A;  3CCL 3;  1RGC A;  2CFD A;  3FG3 A;  3MYT A;  3MHE A;  2L4V A;  3CCJ 3;  3D5I A;  3BNB A;  2CK3 H;  5JPP A;  1ASK A;  3LT8 A;  4HM7 B;  4RZM A;  3WA2 X;  3DGY A;  4J9A A;  2F5M A;  4WFO A;  1IQY A;  1RN7 A;  2CWT A;  1QVF 2;  3FSD A;  5M1A A;  3X3Z A;  1N5H A;  3SLU A;  1B2U A;  1LRA A;  3MG2 A;  2MF7 A;  3SVA A;  1B2M A;  3I0Y A;  1BRI A;  3G16 A;  4HM6 B;  1GD4 A;  3X3Y A;  1JJ2 2;  3OWU A;  3ZG5 A;  1BGS A;  2GBX B;  2GU1 A;  1LOW A;  1MWS A;  4BIR A;  1VQ5 3;  2BHM A;  3HOH A;  4H3U A;  1R4Y A;  2STD A;  3AMO A;  1JB4 A;  1Y4K A;  1FGR A;  1FGM A;  2WGQ A;  3WOD G;  4HM2 B;  2KRT A;  1BSD A;  1W5Z A;  1A2P A;  1NB3 I;  2FXT A;  2K3D A;  3FKA A;  3O8Y A;  4N6M A;  1IVU A;  1M9G A;  5M18 A;  2W0Q A;  3Q90 A;  1UI8 A;  1BSA A;  3N54 B;  4MEI A;  1Q40 B;  4WWU C;  4DKI A;  1BSB A;  1K41 A;  2CX0 A;  1GSP A;  4STD A;  5IEO A;  1RGA A;  2XR8 B;  3MG1 A;  3ZFZ A;  1IVX A;  1AVK A;  1N8R 4;  2XGL A;  2IUK A;  4FMC A;  3EBT A;  2P09 A;  1I2E A;  5G1L A;  1W2Z A;  5IEP A;  2W9P A;  3F8X A;  1C7H A;  2INX A;  4WYK A;  1MWR A;  2BNG A;  3K9M C;  5GSP A;  5EEO A;  1QAL A;  5CF1 A;  3CXC 2;  3KN4 A;  1Q86 4;  3LTC A;  1UI7 A;  2CFG A;  4I4K A;  4OVM A;  4RNZ A;  3L0R A;  3CMA 3;  3AHS A;  3SX1 A;  1A90 A;  1AQZ A;  2Q07 A;  2FNQ A;  1JBT A;  2IUJ A;  1ZO2 A;  3OWY A;  1MOL A;  4FR9 A;  1BNG A;  1GYB A;  1SIH A;  1RRH A;  2BU4 A;  2C11 A;  1RRL A;  3EHC A;  1RCK A;  1YJW 3;  2YFI B;  4HM8 B;  3CCS 3;  4XDW A;  1BSE A;  1I3F A;  2R4I A;  3LYG A;  1IVW A;  1QJG A;  3FLJ A;  1STD A;  1AVL A;  2F56 A;  5FW5 A;  1WNH A;  2UGI A;  3PCS A;  4GB5 A;  2SBL A;  1TFO A;  1A2K A;  4EYC A;  2XFT A;  4IPB A;  4HM3 B;  4HOH A;  4QWT A;  3CNX A;  1UCK A;  1HZ1 A;  3DGL A;  1I8V A;  2ML6 A;  1S72 3;  3RGA A;  3S29 A;  2CFK A;  1IT7 A;  1BNS A;  1Q82 4;  4FCZ A;  4J8T A;  1BUJ A;  2D42 A;  1WMO A;  1W00 A;  3N8B A;  1VQ9 3;  3G8Z A;  5JPU A;  1VQP 3;  4EC6 A;  5A0O B;  3D5G A;  3F9S A;  3OW2 2;  3SYU A;  4RNY A;  4JRF A;  1IV7 A;  1LOX A;  3G71 3;  1V57 A;  3PCR A;  2BMQ B;  2W9Q A;  1I3I A;  2PZV A;  2F99 A;  5FGO A;  5ELJ A;  1BNE A;  1JB5 A;  1WMN A;  4L8O A;  3BND A;  2HMM B;  2JQ5 A;  2HMK B;  1U8C B;  4HJL B;  3FH1 A;  1WMP A;  3EE1 A;  5BIR A;  3A76 A;  3BB9 A;  3KKG A;  4R1K A;  1ZX2 A;  4O02 B;  1TIJ A;  3IPT A;  1EKM A;  1DET A;  2M7O A;  1JN5 B;  4HBR A;  1T3B A;  3DGM A;  1G0T A;  1BNF A;  1MWU A;  1FYS A;  1I70 A;  2B24 B;  2F86 B;  1OHO A;  1M1X B;  1CYU A;  3DZL A;  4JF8 A;  1FZU A;  4MMZ B;  1B2Z A;  2IY2 A;  1VQ7 3;  1EEJ A;  1B20 A;  2F98 A;  2RGQ A;  1OGX A;  4K61 A;  4GHO A;  5AIH A;  3ZG0 A;  5IF6 A;  1VQ8 3;  1FGT A;  2XRX B;  4AEQ A;  1RGF A;  1I2G A;  3CC7 3;  2W03 A;  4NRE A;  4R9K A;  3WDG B;  4BL3 A;  1D6Z A;  3AMO B;  5BVB A;  2D1W A;  3X41 A;  3JUN A;  4WP5 A;  7GSP A;  1BSC A;  4GL6 A;  2ZA4 A;  4N6L A;  1B21 A;  1SJW A;  5AYS C;  1AY7 A;  2YFJ B;  2ML5 A;  3EC9 A;  3EJV A;  3S67 A;  5AEU B;  3CPO A;  3PXM A;  3STD A;  3SED A;  2I9W A;  3BLZ A;  1X1X A;  1JV2 B;  2GXF A;  4AKZ A;  5KP1 A;  1FA3 A;  2GSP A;  1N8Q A;  3FF2 A;  4J5G A;  3U1W A;  4HM4 B;  2GEY A;  3OX9 A;  4GSP A;  2OOV A;  1TU5 A;  1YHQ 3;  4WYK B;  4N3V A;  3S5C A;  1LXE A;  3T0U A;  1NWW A;  2K0M A;  3CC4 3;  2H0H A;  5RNT A;  1IVV A;  1YGW A;  1N5P A;  3H3H A;  1I0X A;  1W02 A;  3EBY A;  3FF0 A;  3MWZ A;  3DM8 A;  4LZI A;  1HYF A;  1JZD A;  5IG0 A;  1G02 A;  3HI7 A;  2P0M A;  4HYZ A;  1IYY A;  1CYV A;  1BRG A;  2ZL8 A;  1HU9 A;  1OGZ A;  2P0X A;  3CU3 A;  3VGN A;  1FGO A;  3CCE 3;  3NV0 A;  1OHS A;  1LOY A;  4EV2 A;  5JBS A;  3X40 A;  3Q2P A;  3H51 A;  5IG3 A;  1NJI 4;  3CNM A;  1FUS A;  1TRP A;  4HZ9 B;  1RNB A;  1RCL A;  4BTX A;  1BAO A;  3BNC A;  1GY7 A;  3PS8 A;  1UW1 A;  3QK9 A;  5TGN A;  1W6G A;  3PYJ A;  3RGR A;  1LVN A;  1SII A;  2CWU A;  2L1S A;  2E2V A;  2PNC A;  4EV5 A;  1V74 A;  1ULI B;  4N6T A;  3SOA A;  5CXO A;  1VQ6 3;  3D4A A;  1WTH A;  4MJD A;  1PU4 A;  1TTO A;  3F14 A;  1BRK A;  1KD1 4;  3LML A;  3SOY A;  5IG5 A;  1QMA A;  3IMA B;  5BXQ A;  1OF5 B;  3I56 3;  2IA7 A;  3F7S A;  4KZ1 A;  1SAR A;  3K5T A;  3U97 A;  3MPH A;  1F8N A;  1C54 A;  2W56 B;  2CFL A;  1MWT A;  1ROV A;  4J5K A;  4LYL B;  3X42 A;  4RNT A;  1ISK A;  3UL5 A;  5AIG A;  2UUG C;  1UGI A;  3JUM A;  5KP3 A;  1TUH A;  4N6U A;  2W2C A;  3M8C A;  2CKF B;  1O7H B;  1RSN A;  2KCD A;  1JBS A;  1X1W A;  2GU3 A;  1Q7H A;  2WOF A;  2HMO B;  2CG1 A;  2CW9 A;  1RN4 A; 
#chains in the Genus database with same CATH homology
 4R9L A;  2CWV A;  2E2T A;  1U5O A;  2RCD A;  3FCS B;  2CFW A;  3B8L A;  4XM4 A;  4OUQ A;  3CCM 3;  1IDP A;  4HM1 B;  3UNL A;  3JUQ A;  4KFD A;  1GS3 A;  4AKY A;  2YFL B;  3DGN A;  2OTJ 3;  1S5A A;  4MMX B;  4K1U A;  2CH9 A;  4EBG A;  2P38 A;  1NO3 A;  5AYR B;  1Q81 4;  1VQL 3;  2QIY A;  4FMB A;  1IQ8 A;  3BNE A;  5CF2 A;  4ZM8 A;  1CQS A;  3MG3 A;  2CHC A;  1Q42 A;  5IEN A;  3LH4 A;  3LTB A;  3PZW A;  4PEJ A;  2CIU A;  5AI1 A;  1NB5 I;  3UB1 A;  4HM5 B;  3EN1 B;  3EQQ B;  1OHP A;  1YJ9 3;  5KP4 A;  1Q40 A;  2XFS A;  4LEH A;  3GZB A;  4O3V A;  1E97 A;  3JVC A;  1OPY A;  1W2B 2;  3OV4 A;  3LXU X;  3NUV A;  2C10 A;  1IU7 A;  2QEX 3;  4L8P A;  2XGN A;  3WMD A;  1GY6 A;  4XBX A;  1MNL A;  2CG0 A;  1JB2 A;  1NU3 A;  3NQY A;  1DVC A;  1O7M B;  1OUN A;  2WGO A;  2MC8 A;  2K54 A;  1E3V A;  5AEW B;  3HIG A;  1NDO B;  3DXO A;  1DMQ A;  2OQE C;  3UL6 A;  1YIJ 3;  2LQV A;  3G0K A;  4CDL A;  3NM7 A;  1Q7Y 4;  3EF8 A;  1QVG 2;  1IV9 A;  3T8N A;  3CCV 3;  1OCV A;  2OTL 3;  3WA3 A;  1SPU A;  2WO0 A;  4Q53 A;  3GZX B;  3NXJ A;  1QAK A;  2BMO B;  5DRV A;  4IT7 A;  4K90 B;  4HZB B;  4LSO A;  3DUK A;  3HK4 A;  2O9U X;  3ECF A;  1EQK A;  3FG4 A;  5CK6 A;  1FUW A;  3JUO A;  1GD3 A;  2KXG A;  5EQL A;  2E2U A;  1WQL B;  1K8A 4;  3D9R A;  1VQK 3;  2BO9 B;  2LYX A;  4X2H A;  4FCM A;  1M90 4;  3ER7 A;  2XF3 A;  5EVH A;  2ZDJ A;  3X3X A;  1W6C A;  1KQS 2;  4HM0 B;  3HX8 A;  3B7C A;  3FZW A;  3CCQ 3;  4G1M B;  2Z76 A;  2O3O A;  4XBY A;  1JKG A;  1TP6 A;  5IW9 A;  1OH0 A;  3ALA A;  4XBT A;  3KSE D;  2XSH B;  3LT9 A;  1YVB I;  3V98 A;  3GRD A;  5G2G A;  1AR0 A;  1JN5 A;  3CCU 3;  4HKV B;  5LC6 A;  4FMA A;  1SQW A;  7STD A;  3VF1 A;  4OK0 A;  1EG9 B;  2YX9 A;  2RSX A;  3GZR A;  3PGB A;  1AV4 A;  5LC7 A;  1W7C A;  3RDE A;  1JRQ A;  3LZA A;  3CCR 3;  1DVD A;  4LMI A;  3NBB A;  1J2B A;  4N6O B;  3J7Y d;  1KC8 4;  1O7G B;  1JNQ A;  4FCJ A;  1ULJ B;  5I97 A;  4TX4 A;  3E99 A;  1W6Y A;  1FGQ A;  5AIF A;  1RKY A;  1VQ4 3;  1UUV B;  1N9J A;  4IIA A;  3KFQ C;  2Y74 A;  1US1 A;  4RBN A;  4EXR A;  2XSO B;  4O8S A;  2Z77 A;  1GY5 A;  4L7K A;  3V92 A;  2OOV C;  1E3R A;  3FGY A;  4ORL A;  3Q1C A;  2CC3 A;  3QRD A;  3CD6 3;  3CPW 2;  3B4P A;  2GBW B;  2UX0 A;  3G6E 3;  3F8H A;  3GWR A;  3DY5 A;  2OWP A;  1BUQ A;  4NHF A;  5D81 A;  1DMN A;  4N6N B;  3B4O A;  3K63 A;  3HII A;  5D83 A;  1L5G B;  3EX9 A;  3LOY A;  4U13 A;  1DMM A;  1A2V A;  1CEW I;  1A67 A;  4XDV A;  5IER A;  3MKI A;  3KE7 A;  1QAF A;  2GEX A;  2XEP A;  3WOF B;  1TFK A;  2RFR A;  4LGQ A;  3T8U A;  3UJM A;  2HMJ B;  3K7C A;  2W04 A;  1RJO A;  5DRE A;  2Z7A A;  3NHX A;  1VQM 3;  5HGR A;  2HMN B;  1KWI A;  3KII A;  1PFP A;  1K28 A;  3KSP A;  1K9M 4;  2IMJ A;  2FGT A;  3V99 A;  1K73 4;  4BTY A;  2P05 A;  5CLK A;  2BMR B;  4FMD A;  4O2H A;  3LTA A;  2XH9 A;  3NM2 A;  3F40 A;  3VSY A;  4CCV A;  3D3L A;  2HML B;  3DMC A;  4BTW A;  3JUP A;  3IJE B;  2OQE A;  1YIT 3;  4H61 A;  1OF5 A;  1ROA A;  3I55 3;  3HZP A;  1R4C A;  4KVH A;  1IT8 A;  3WOE B;  3S27 A;  1Z1S A;  2B1X B;  1T5Y A;  4MMY B;  3CME 3;  3GZY B;  3TDG A;  2W56 A;  1D6Y A;  3N9H A;  1O7P B;  4HVN A;  1UUW B;  5IG4 A;  4K1V A;  1YI2 3;  1IQX A;  1O7W B;  5D82 A;  2OCT A;  5STD A;  3G4S 3;  2QA4 3;  1OAC A;  4KFE A;  3NQZ A;  3SXX A;  2BT3 A;  1JKG B;  1M1K 4;  2W6J H;  3NV0 B;  4WHA A;  3KZT A;  1IK3 A;  1LNH A;  1O7N B;  4KFF A;  3OWS A;  1N9E A;  8CHO A;  1W4N A;  3MSO A;  4XB5 A;  3EN8 A;  1DYU A;  2Y73 A;  1VQO 3;  4R4K A;  3OXA A;  1YGE A;  1VQN 3;  2Z6B A;  1W01 A;  2A15 A;  3NX0 A;  3GAX A;  1KSI A;  4R80 A;  1YJN 3;  3F7X A;  1HKX A;  1G96 A;  3EB8 A;  2QGU A;  2V1L A;  3DGO A;  5AII A;  3CC2 3;  3FG1 A;  3K0Z A;  5ELU A;  1D6U A;  3NBJ A;  2WOH A;  3ROB A;  1VZZ A;  3S28 A;  2JDI H;  6STD A;  4N6V 0;  3LTD A;  1EA2 A;  4X2O A;  1STF I;  3NBR A;  3CCL 3;  2CFD A;  3FG3 A;  3MYT A;  3MHE A;  2L4V A;  3CCJ 3;  3BNB A;  2CK3 H;  5JPP A;  1ASK A;  3LT8 A;  4HM7 B;  4RZM A;  3WA2 X;  4J9A A;  4WFO A;  1IQY A;  1RN7 A;  2CWT A;  1QVF 2;  3FSD A;  3X3Z A;  1N5H A;  3SLU A;  3MG2 A;  2MF7 A;  3SVA A;  3I0Y A;  3G16 A;  4HM6 B;  1GD4 A;  3X3Y A;  1JJ2 2;  3OWU A;  2GBX B;  2GU1 A;  1VQ5 3;  2BHM A;  4H3U A;  2STD A;  3AMO A;  1JB4 A;  1Y4K A;  1FGR A;  1FGM A;  2WGQ A;  3WOD G;  4HM2 B;  2KRT A;  1W5Z A;  2FXT A;  1NB3 I;  4N6M A;  3FKA A;  3O8Y A;  1IVU A;  1M9G A;  2W0Q A;  3Q90 A;  1UI8 A;  3N54 B;  4MEI A;  1Q40 B;  4WWU C;  1K41 A;  4STD A;  5IEO A;  2XR8 B;  3MG1 A;  1IVX A;  1AVK A;  1N8R 4;  2XGL A;  2IUK A;  4FMC A;  3EBT A;  2P09 A;  5IEP A;  1W2Z A;  2W9P A;  3F8X A;  1C7H A;  2INX A;  4WYK A;  2BNG A;  3K9M C;  5EEO A;  1QAL A;  5CF1 A;  3CXC 2;  3KN4 A;  1Q86 4;  3LTC A;  1UI7 A;  2CFG A;  4I4K A;  4OVM A;  4RNZ A;  3L0R A;  3CMA 3;  3SX1 A;  1A90 A;  2Q07 A;  2FNQ A;  2IUJ A;  1ZO2 A;  3OWY A;  1MOL A;  4FR9 A;  1GYB A;  1SIH A;  1RRH A;  3EHC A;  2C11 A;  1RRL A;  1YJW 3;  2YFI B;  4HM8 B;  3CCS 3;  4XDW A;  2R4I A;  3LYG A;  1IVW A;  1QJG A;  3FLJ A;  1STD A;  1AVL A;  5FW5 A;  1WNH A;  3PCS A;  4GB5 A;  2SBL A;  1TFO A;  1A2K A;  4EYC A;  2XFT A;  4IPB A;  4HM3 B;  4QWT A;  3CNX A;  3DGL A;  2ML6 A;  1S72 3;  3RGA A;  3S29 A;  2CFK A;  1IT7 A;  1Q82 4;  4FCZ A;  4J8T A;  2D42 A;  1WMO A;  1W00 A;  3N8B A;  1VQ9 3;  3G8Z A;  5JPU A;  1VQP 3;  4EC6 A;  5A0O B;  3F9S A;  3OW2 2;  4RNY A;  4JRF A;  1LOX A;  1IV7 A;  3G71 3;  3PCR A;  2BMQ B;  2W9Q A;  2PZV A;  2F99 A;  5FGO A;  5ELJ A;  1JB5 A;  1WMN A;  4L8O A;  3BND A;  2HMM B;  2JQ5 A;  2HMK B;  1U8C B;  4HJL B;  3FH1 A;  1WMP A;  3EE1 A;  3A76 A;  3BB9 A;  3KKG A;  4R1K A;  1ZX2 A;  4O02 B;  1TIJ A;  3IPT A;  1EKM A;  2M7O A;  1JN5 B;  4HBR A;  3DGM A;  2B24 B;  1CYU A;  2F86 B;  1OHO A;  1M1X B;  3DZL A;  4JF8 A;  4MMZ B;  1VQ7 3;  2F98 A;  2RGQ A;  1OGX A;  4K61 A;  5AIH A;  5IF6 A;  1VQ8 3;  1FGT A;  2XRX B;  4AEQ A;  3CC7 3;  2W03 A;  4NRE A;  4R9K A;  3WDG B;  1D6Z A;  3AMO B;  5BVB A;  2D1W A;  3X41 A;  3JUN A;  4WP5 A;  4GL6 A;  4N6L A;  1SJW A;  5AYS C;  2YFJ B;  3EJV A;  2ML5 A;  3EC9 A;  3S67 A;  5AEU B;  3CPO A;  3PXM A;  3STD A;  3SED A;  2I9W A;  3BLZ A;  1JV2 B;  2GXF A;  4AKZ A;  5KP1 A;  1FA3 A;  1N8Q A;  3FF2 A;  3U1W A;  4HM4 B;  2GEY A;  3OX9 A;  2OOV A;  1TU5 A;  1YHQ 3;  4WYK B;  4N3V A;  3S5C A;  1LXE A;  3T0U A;  1NWW A;  2K0M A;  3CC4 3;  1IVV A;  1N5P A;  3H3H A;  1W02 A;  3MWZ A;  3EBY A;  3FF0 A;  4LZI A;  3DM8 A;  5IG0 A;  3HI7 A;  2P0M A;  4HYZ A;  1CYV A;  2ZL8 A;  1HU9 A;  1OGZ A;  2P0X A;  3CU3 A;  3VGN A;  1FGO A;  3CCE 3;  3NV0 A;  1OHS A;  4EV2 A;  5JBS A;  3X40 A;  3Q2P A;  3H51 A;  5IG3 A;  1NJI 4;  3CNM A;  4HZ9 B;  4BTX A;  3BNC A;  3QK9 A;  1GY7 A;  3PS8 A;  1UW1 A;  5TGN A;  1W6G A;  3PYJ A;  3RGR A;  1LVN A;  1SII A;  2CWU A;  2E2V A;  2PNC A;  4EV5 A;  1V74 A;  1ULI B;  4N6T A;  3SOA A;  5CXO A;  1VQ6 3;  1WTH A;  4MJD A;  1PU4 A;  3F14 A;  1KD1 4;  3LML A;  3SOY A;  5IG5 A;  1QMA A;  3IMA B;  5BXQ A;  1OF5 B;  3I56 3;  2IA7 A;  3F7S A;  4KZ1 A;  3K5T A;  3U97 A;  3MPH A;  1F8N A;  2W56 B;  2CFL A;  1ROV A;  3X42 A;  1ISK A;  3UL5 A;  5AIG A;  3JUM A;  5KP3 A;  1TUH A;  4N6U A;  2W2C A;  3M8C A;  2CKF B;  1O7H B;  2KCD A;  2GU3 A;  2WOF A;  2HMO B;  2CG1 A;  2CW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...