1DMMA

Crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmmA00
5BVBA 1OUNA 4XDVA 3OX9A 3EHCA 4WWUC 4HM8B 3GZRA 4HM0B 1UUVB 3OWUA 3HK4A 4PEJA 3KSPA 3EJVA 1O7PB 5AI1A 3A76A 2HMNB 4LMIA 3SOAA 2JQ5A 2XRXB 5STDA 5CK6A 3B7CA 1QJGA 3BB9A 3DZLA 3NM2A 4HZBB 3NV0A 2K54A 5IF6A 5IG5A 1C7HA 4K1VA 1Q40B 1JKGA 1JN5A 1EA2A 1OCVA 1GY6A 3G16A 5KP4A 4MJDA 5KP3A 4LEHA 1UUWB 3KZTA 3FZWA 3SEDA 4L8PA 1OHOA 1OGXA 4KVHA 2I9WA 5IG3A 2YFJB 3EBTA 3F8XA 3GRDA 2W2CA 3EN8A 4FCJA 1JB4A 1O7MB 5G2GA 5IEOA 3ER7A 1TUHA 5CF2A 1ASKA 4XBYA 5FW5A 4HVNA 3DM8A 3ECFA 2Z77A 1O7NB 1GS3A 4GB5A 3T8NA 1ZX2A 3F7SA 2GBWB 3MSOA 2HMJB 1NU3A 3DUKA 1JB5A 1VZZA 4FCMA 5D81A 1WQLB 3B8LA 5DRVA 1TP6A 3F9SA 3RGRA 2BMRB 3UNLA 3GZYB 3I0YA 3M8CA 3K7CA 2YFLB 2F99A 5EVHA 3JUPA 3NV0B 3FH1A 4IIAA 1OH0A 4HM2B 3ROBA 3KKGA 4RZMA 3VSYA 1JKGB 2CHCA 3F8HA 4WYKB 3EX9A 1JN5B 3B4PA 3MKIA 4HM7B 2Z76A 3DMCA 1Q42A 3BLZA 3HZPA 3STDA 4HM1B 4U13A 1A2KA 3JUOA 5AIFA 1DMMA 3CU3A 1ULJB 6STDA 3SOYA 3F14A 4WYKA 3DXOA 2UX0A 3OV4A 3GZXB 2BMQB 1W01A 5HGRA 2GBXB 4HM3B 5KP1A 4HZ9B 4LGQA 4OVMA 3OXAA 1E97A 2XSOB 1SJWA 1JB2A 3EBYA 5AEWB 1IDPA 1EG9B 3G0KA 5IERA 2CKFB 5IEPA 4HKVB 1DMQA 3LYGA 2B1XB 5AIGA 1NDOB 2YFIB 4L8OA 1DMNA 1OHPA 2A15A 3JUNA 4R9LA 4XB5A 3VGNA 3GZBA 3KE7A 1GY5A 3B4OA 3IPTA 5D82A 3NBRA 2GEXA 1OHSA 1OGZA 3FF2A 4XM4A 3OWSA 4XDWA 1S5AA 1GY7A 3CPOA 8CHOA 3WMDA 4R9KA 1W00A 5IENA 2HMMB 5AIHA 3FSDA 1OF5A 3NXJA 3HX8A 2F86B 3MHEA 3NHXA 2B24B 1W6YA 3Q90A 2RGQA 4HM6B 3S5CA 2XR8B 3D9RA 3FLJA 5JPUA 2GXFA 4J8TA 3FKAA 2QGUA 4R1KA 4STDA 2R4IA 1O7HB 3F7XA 5TGNA 5DREA 3F40A 2OWPA 4OUQA 1NWWA 3FF0A 3FGYA 2HMOB 7STDA 2PZVA 2BMOB 1Z1SA 2RCDA 5D83A 4HM4B 5IG4A 3JUQA 1W02A 3G8ZA 3E99A 5AIIA 2IMJA 1BUQA 2INXA 4J9AA 4WP5A 4XBTA 3UJMA 3H51A 1O7GB 1CQSA 3CNMA 3MG2A 1GYBA 1O7WB 5CLKA 5CF1A 5IG0A 5JPPA 4HM5B 2RFRA 1ISKA 1U5OA 2BNGA 3K0ZA 1HKXA 3MG3A 3EQQB 4Q53A 3JUMA 1ZO2A 2XSHB 4K1UA 3EF8A 2HMKB 1OF5B 1ULIB 1Q40A 2GEYA 4CDLA 3NUVA 1E3RA 3H3HA 4XBXA 3CNXA 3LZAA 2Z7AA 2STDA 1OPYA 4H3UA 5AEUB 1STDA 4N3VA 1K41A 4L7KA 3RGAA 2QIYA 3GWRA 1QMAA 3MYTA 5CXOA 1AR0A 4HJLB 2HMLB 4I4KA 3OWYA 4ORLA 3EN1B 4X2OA 3MG1A 2F98A 5BXQA 1E3VA 4X2HA 3T8UA 3EC9A
chains in the Genus database with same CATH superfamily
1YJW3 5BVBA 3FG3A 1OUNA 3VF1A 3LMLA 1I70A 1K8A4 4FMBA 3G4S3 4XDVA 3OX9A 1UI8A 1X1WA 2CX0A 2W03A 1VQ63 1SPUA 2W56A 1DYUA 3CME3 3EHCA 4WWUC 1W2B2 4R4KA 4HM8B 1D6YA 1QAFA 3GZRA 3SXXA 1BRNL 4BIRA 4HM0B 1UUVB 3OWUA 5ELUA 1BOXA 1V74A 1VQP3 3HK4A 3HIIA 1KC84 4PEJA 2KXGA 1STFI 1D6UA 3KSPA 4I5QA 1RGLA 3EJVA 3CCV3 1WMPA 1NB5I 1QALA 1RGHA 1O7PB 5JBSA 2F56A 5AI1A 4WFOA 1DVDA 2CG1A 3A76A 3UL6A 2HMNB 1GOUA 4LMIA 3SOAA 1YJ93 1BSAA 2JQ5A 2CK3H 2XRXB 2W0QA 5CK6A 2R41A 5STDA 1LOWA 2L4VA 1GOYA 3B7CA 1YI23 4KZ1A 5G1KA 1QJGA 3BB9A 1A2PA 3DZLA 2AAEA 3NM2A 3S28A 4HZBB 4G1MB 3NV0A 3V99A 2FXTA 3HOHA 2K54A 3KN4A 1EUIC 2OOVA 5RNTA 3CCM3 2F5MA 2W6JH 6GSPA 5IF6A 5IG5A 1YGWA 1C7HA 3K9MC 1NO3A 2E2VA 4K1VA 1T3BA 2ZHXB 4O2HA 2RBIA 1Q40B 1JKGA 3KIIA 1JN5A 1N5HA 4EV2A 2Y74A 1EA2A 4FMCA 4MMXB 3RNTA 1OCVA 1GY6A 2E2UA 3LH4A 2ZA4A 4IPBA 1TTOA 1DVCA 3AHSA 3G16A 1FGRA 4GL6A 5KP4A 2QEX3 3AMOA 4MJDA 1FGOA 5KP3A 1RN1A 7GSPA 1LVNA 2WOFA 4LEHA 1YIT3 1UUWB 2P09A 3KZTA 3I563 4LZIA 1V58A 4FCZA 1ROAA 1RCKA 3FZWA 3SEDA 4K90B 4L8PA 1OHOA 1W6GA 4CJNA 1A67A 1K28A 4WHAA 3AHWA 5AYRB 3D79A 1BRJA 3DGYA 2XEPA 1OGXA 3N54B 1I2FA 4J5GA 4KVHA 2I9WA 2KF3A 1L5GB 5IG3A 2YFJB 3EBTA 3F8XA 4NREA 3CC43 1M904 3GRDA 1BSEA 1IVWA 3CCQ3 2W2CA 1FGTA 1IVUA 3G6E3 1MOLA 3EN8A 1GMPA 4FCJA 2O3OA 1IQXA 1JB4A 4FMDA 5BU4A 1O7MB 4QWTA 5G2GA 5IEOA 2IA7A 3ER7A 4HBRA 1TUHA 1TU5A 1A90A 2LYXA 3X3YA 1BRKA 5CF2A 1ASKA 4XBYA 5FW5A 3WOEB 1G02A 4HVNA 3DM8A 3ECFA 5GSPA 1N5PA 2Z77A 3FG1A 3UB1A 3BNEA 1O7NB 4EC6A 1GS3A 4GB5A 1S723 4HAAA 5LC6A 1UGHI 1RN7A 1SARA 3T8NA 3WA3A 1ZX2A 3F7SA 1VQK3 1PY3A 1YIJ3 1MWSA 2GBWB 1BNIA 1LNHA 1RLSA 3QK9A 3MSOA 2HMJB 1NU3A 2LQVA 2AADA 3DUKA 1JB5A 1KQS2 1VZZA 1I8VA 4FCMA 5D81A 3NBBA 1AQZA 1WQLB 3SVAA 3B8LA 3ZFZA 1J2BA 5DRVA 1TP6A 3KCHA 1UCLA 3F9SA 1N9EA 3SX1A 4HOHA 5FGOA 3RGRA 2BMRB 2CFLA 3GZYB 3I0YA 1MGWA 3UNLA 3M8CA 3K7CA 2YFLB 1BNGA 3L0RA 2SBLA 3WA2X 2F99A 2OOVC 1WTHA 1ZS7A 4KFDA 3CCS3 3LOYA 5EVHA 3NQYA 1VQ43 2CC3A 1R4CA 4EXRA 3JUPA 1RKYA 1JBRA 3NQZA 1A2VA 4BTWA 1BSCA 2OQEA 3HIGA 3NV0B 3FH1A 2D1WA 3NBJA 4O02B 1KD14 1MNLA 1FGMA 4IIAA 3EB8A 1GOVA 1OH0A 1RDSA 4HM2B 2KF5A 3ZG5A 1BNJA 3WODG 1I0VA 9RNTA 3ROBA 3KKGA 1YVSA 1VQQA 4RZMA 3S27A 1IT7A 1BRIA 4GHOA 3SLUA 3VSYA 1JKGB 2CHCA 3F8HA 4WYKB 2ML5A 3EX9A 4MMYB 3GAXA 1JN5B 3UL5A 3B4PA 3FCSB 1IV7A 1GD3A 1MGRA 1PU4A 3BU4A 1BNFA 2Z76A 3MKIA 4HM7B 3TDGA 1RGEA 3CXC2 3DGMA 3DMCA 1YVBI 4EYCA 1R4YA 1Q42A 3PXMA 2FGTA 3PGBA 2YX9A 3AMOB 3BLZA 4LYLB 2GU3A 3HZPA 3STDA 2UUGC 3Q1CA 3NX0A 4HM1B 4U13A 3QRDA 1QVG2 1A2KA 4N6TA 1V57A 3K5TA 1IQYA 3JUOA 1F8NA 1HU9A 3G713 2CFDA 1BGSA 1VQO3 1B20A 5AIFA 3A5EA 1DMMA 2CFGA 2BHMA 3CU3A 2Z6BA 2XGLA 1FGQA 1ULJB 3WHOA 2IYJA 4K61A 2W04A 6STDA 1I2GA 1D6ZA 2BIRA 3X3ZA 1FZUA 1B2ZA 2W9QA 1BSDA 1B2SA 3F14A 3PCRA 3SOYA 4MEIA 4GSPA 3CCR3 1LXEA 4KT3B 3D4AA 3S29A 4WYKA 1RTUA 3DXOA 2UX0A 2WO0A 3OV4A 1RNTA 3GZXB 4KFFA 5M1AA 2BMQB 3MWZA 1W01A 5HGRA 2GBXB 3D3LA 3N9HA 2C11A 1HZ1A 3CMA3 4HM3B 2MF7A 4RNYA 4J5KA 3WDGB 5KP1A 1US1A 2KF6A 3BNCA 1I3FA 1LOYA 1GD4A 4NHFA 2CWTA 2WOHA 1Q864 2P38A 4HZ9B 1UCIA 1RGGA 3X40A 1LOVA 4EW5A 1I2EA 2UGIA 1KSIA 1W7CA 4LGQA 5EQLA 4OVMA 4N6MA 2CX1A 3OXAA 4ZM8A 1E97A 2XSOB 1YJN3 1B21A 1BUJA 1SJWA 1JB2A 3EBYA 5AEWB 1TFOA 1IDPA 2K3DA 1EG9B 1MWRA 1JV2B 3G0KA 1C54A 4BL2A 5IERA 1UI7A 1T5YA 2CKFB 3DGOA 5IEPA 4HKVB 1DMQA 1TRQA 1EKMA 2XH9A 3LYGA 3Q3FA 4JRFA 1N9JA 1EEJA 1G0TA 2P05A 2OQEC 5EEOA 2FNQA 2B1XB 1B2UA 1AY7A 4BU4A 2L1SA 1OACA 4RNZA 5AIGA 2D42A 1VQ83 1NDOB 2YFIB 4L8OA 1TIJA 1DMNA 1OHPA 1CEWI 2A15A 3JUNA 4IT7A 5A0OB 3IMAB 2KAAA 4FMAA 1IK3A 4R9LA 2OCTA 2C4BA 1TRPA 4XB5A 1IQ8A 3VGNA 2HOHA 3GZBA 3KE7A 3FG4A 2OTJ3 1NNVA 5HOHA 1GY5A 3B4OA 3CC23 3IPTA 5D82A 4BTXA 2Y73A 2BO9B 3NBRA 4EV5A 2GEXA 2WGQA 1BRSA 1OHSA 2IY2A 3PS8A 1OGZA 1RSNA 4CCVA 1G96A 2GSPA 1TJDA 3FF2A 1QVF2 2V1LA 1JZOA 2Q07A 3LT9A 4XM4A 1FUSA 1WMOA 2J8XB 3OWSA 4XDWA 1UGIA 1S5AA 1BU4A 3KFQC 1BIRA 1GY7A 1BANA 1TFKA 3BIRA 3BNBA 1LOXA 1EQKA 2GU1A 8RNTA 1WNHA 1M9GA 3CPOA 2CWUA 1RGKA 3PCSA 8CHOA 1K734 1SQWA 1AV4A 3WMDA 1JBTA 3X41A 3DH2A 4R9KA 1W00A 5IENA 2HMMB 4BTYA 1B3SA 5AIHA 3D5IA 3FSDA 3GSPA 1OF5A 3NXJA 1LRAA 1RNBA 2F5WA 1RN4A 3CCJ3 1RGAA 3CCE3 3HX8A 3I553 2F86B 1M1XB 3CC73 4DKIA 3MHEA 3NHXA 2B24B 4CPKA 5I97A 1W6YA 5M19A 1N8R4 3Q90A 1Q9EA 3CD63 2CH9A 1LQMB 1JNQA 2RGQA 2E2TA 3D5GA 4HM6B 4EBGA 1Q814 3S5CA 1T2IA 2SARA 3DGNA 3HI7A 2XR8B 4LSOA 3D9RA 3FLJA 5JPUA 2GXFA 1SIIA 1RJOA 2QGUA 3FKAA 4J8TA 4RBNA 1JJ22 4O8SA 4R1KA 2WGOA 4STDA 2XFSA 1X1XA 2R4IA 1O7HB 4MMZB 3F7XA 4O3VA 5TGNA 3WOFB 1N8QA 5DREA 3F40A 4FR9A 3LTCA 2M7OA 1RGFA 1RGCA 2OWPA 1IU7A 3NM7A 4OUQA 1NWWA 3FF0A 1JRQA 1VQN3 3FGYA 1VQM3 1I3IA 1QAKA 4ILFA 2H0IA 1W2ZA 1MWUA 2P0MA 2HMOB 1NB3I 2C10A 3N8BA 7STDA 3LXUX 2PZVA 3V98A 3MPHA 2BMOB 1BNEA 4OK0A 1BVIA 1Z1SA 3CCL3 3WR2A 3KSED 2RCDA 3O8YA 5D83A 2MC8A 3T0UA 3X42A 4HM4B 2P0XA 5IG4A 1Q7Y4 3JUQA 2CG0A 4N6LA 1RCLA 1W02A 1LQGC 3DY5A 3G8ZA 3E99A 3ZG0A 1K9M4 3LTBA 1VQL3 1YGEA 3IJEB 3LTAA 5AIIA 2IMJA 1NJI4 3JVCA 2INXA 1VQ53 1BUQA 1RRLA 2F4YA 3AGNA 1Q7HA 1UDII 4J9AA 1PYLA 4WP5A 4XBTA 3UJMA 2CW9A 1FUWA 1ZGXA 3H51A 1HYFA 1O7GB 2XGNA 3CPW2 4BL3A 1CQSA 2IUJA 1AVLA 3CNMA 1BNRA 1IV9A 5LC7A 2RNTA 2BT3A 5AEUB 2ZL8A 4N6NB 5IW9A 1W6CA 1GYBA 3MG2A 1GMRA 3RDEA 1O7WB 3BNDA 5CLKA 2ZDJA 3J7Yd 3SYUA 5CF1A 3OW22 5IG0A 1FA3A 3Q2PA 1CH0A 2ML6A 2RFRA 4HM5B 5JPPA 1ISKA 1MWTA 4JF8A 1W4NA 2BU4A 2JDIH 1FW7A 3PYJA 1U5OA 7RNTA 2BNGA 3K0ZA 3U1WA 1YHQ3 1HKXA 3MG3A 3EQQB 1B2MA 4Q53A 1X1UA 2K0MA 3JUMA 1ZO2A 2OTL3 1RHLA 2XSHB 4K1UA 3EF8A 2CFWA 1BRGA 1BSBA 1FYSA 2RSXA 1WMNA 1UCKA 2HMKB 4AKZA 2H0HA 4N6V0 1OF5B 1GSPA 1ULIB 2W9PA 2QA43 1Q40A 2GEYA 2PNCA 3X3XA 3CCU3 3AGOA 1BNSA 1BRHA 1UW1A 3LT8A 4R80A 1Q824 4CDLA 2CWVA 3NUVA 1CYVA 1B2XA 4N6UA 4RNTA 1E3RA 3H3HA 4XBXA 6RNTA 3CNXA 1B27A 2KCDA 3LZAA 2Z7AA 1AVKA 3S67A 1LNIA 2STDA 1YNVX 1OPYA 1IVVA 1RRHA 1ROVA 4H3UA 1JZDA 1STDA 2CIUA 1W5ZA 2XF3A 1IVXA 4HYZA 2IUKA 4KFEA 3V92A 4AEQA 4N3VA 1VQ93 3ALAA 1K41A 4L7KA 1Y4KA 5G1LA 1DE3A 3RGAA 2W56B 2QIYA 1X1YA 4H61A 1IT8A 3PZWA 3U97A 5ELJA 5M18A 3URPA 5AYSC 3EE1A 1DETA 3GWRA 4NPBA 1T2HA 1QMAA 2KF4A 1M1K4 1UUGB 3MYTA 5CXOA 1BAOA 1I0XA 1GMQA 2CFKA 4AKYA 1AR0A 2H0GA 4HJLB 1IYYA 2HMLB 3DGLA 4I4KA 1PFPA 5BIRA 3OWYA 4ORLA 1FUTA 1U8CB 2KRTA 3EN1B 1RMSA 4X2OA 1JBSA 4TX4A 1CYUA 2O9UX 2XFTA 2F98A 3MG1A 1VQ73 5BXQA 1E3VA 4X2HA 3T8UA 3K63A 1KWIA 3EC9A 3LTDA 1SIHA 4N6OB 1UCJA
chains in the Genus database with same CATH topology
1YJW3 5BVBA 3FG3A 1OUNA 3VF1A 3LMLA 1K8A4 4FMBA 3G4S3 4XDVA 3OX9A 1UI8A 2W03A 1VQ63 1SPUA 2W56A 1DYUA 3CME3 3EHCA 4WWUC 1W2B2 4R4KA 4HM8B 1D6YA 1QAFA 3GZRA 3SXXA 4HM0B 1UUVB 3OWUA 5ELUA 1V74A 1VQP3 3HK4A 3HIIA 1KC84 4PEJA 2KXGA 1STFI 1D6UA 3KSPA 3EJVA 3CCV3 1WMPA 1NB5I 1QALA 1O7PB 5JBSA 5AI1A 4WFOA 1DVDA 2CG1A 3A76A 3UL6A 2HMNB 4LMIA 3SOAA 1YJ93 2JQ5A 2CK3H 2XRXB 2W0QA 5CK6A 5STDA 2L4VA 3B7CA 1YI23 4KZ1A 1QJGA 3BB9A 3DZLA 3NM2A 3S28A 4HZBB 4G1MB 3NV0A 3V99A 2FXTA 2K54A 3KN4A 2OOVA 3CCM3 2W6JH 5IF6A 5IG5A 1C7HA 3K9MC 1NO3A 2E2VA 4K1VA 4O2HA 1Q40B 1JKGA 3KIIA 1JN5A 1N5HA 4EV2A 2Y74A 1EA2A 4FMCA 4MMXB 1OCVA 1GY6A 2E2UA 3LH4A 4IPBA 1DVCA 3G16A 1FGRA 4GL6A 5KP4A 2QEX3 3AMOA 4MJDA 1FGOA 5KP3A 1LVNA 2WOFA 4LEHA 1YIT3 1UUWB 2P09A 3KZTA 3I563 4LZIA 4FCZA 1ROAA 3FZWA 3SEDA 4K90B 4L8PA 1OHOA 1W6GA 1A67A 1K28A 4WHAA 5AYRB 2XEPA 1OGXA 3N54B 4KVHA 2I9WA 1L5GB 5IG3A 2YFJB 3EBTA 3F8XA 4NREA 3CC43 1M904 3GRDA 1IVWA 3CCQ3 2W2CA 1FGTA 1IVUA 3G6E3 1MOLA 3EN8A 4FCJA 2O3OA 1IQXA 1JB4A 4FMDA 1O7MB 4QWTA 5G2GA 5IEOA 2IA7A 3ER7A 4HBRA 1TUHA 1TU5A 1A90A 2LYXA 3X3YA 5CF2A 1ASKA 4XBYA 5FW5A 3WOEB 4HVNA 3DM8A 3ECFA 3UB1A 1N5PA 2Z77A 3FG1A 4EC6A 3BNEA 1O7NB 1S723 1GS3A 4GB5A 5LC6A 1RN7A 3WA3A 3T8NA 1ZX2A 3F7SA 1VQK3 1YIJ3 2GBWB 1LNHA 3QK9A 3MSOA 2HMJB 1NU3A 2LQVA 3DUKA 1JB5A 1KQS2 1VZZA 4FCMA 5D81A 3NBBA 1WQLB 3SVAA 3B8LA 1J2BA 5DRVA 1TP6A 3F9SA 1N9EA 3SX1A 5FGOA 3RGRA 2BMRB 2CFLA 3GZYB 3I0YA 3UNLA 3M8CA 3K7CA 2YFLB 3L0RA 2SBLA 3WA2X 2F99A 2OOVC 1WTHA 4KFDA 3CCS3 3LOYA 5EVHA 3NQYA 1VQ43 2CC3A 1R4CA 4EXRA 3JUPA 1RKYA 3NQZA 1A2VA 4BTWA 2OQEA 3HIGA 3NV0B 3FH1A 2D1WA 3NBJA 4O02B 1KD14 1MNLA 1FGMA 4IIAA 3EB8A 1OH0A 4HM2B 3WODG 3ROBA 3KKGA 4RZMA 3S27A 1IT7A 3SLUA 3VSYA 1JKGB 2CHCA 3F8HA 4WYKB 2ML5A 3EX9A 4MMYB 3GAXA 1JN5B 3UL5A 3B4PA 3FCSB 1IV7A 1GD3A 1PU4A 3CXC2 3MKIA 4HM7B 2Z76A 3TDGA 3DGMA 3DMCA 1YVBI 4EYCA 3PXMA 1Q42A 2FGTA 3PGBA 2YX9A 3AMOB 3BLZA 2GU3A 3HZPA 3STDA 3Q1CA 3NX0A 4HM1B 4U13A 3QRDA 1QVG2 1A2KA 4N6TA 3K5TA 1IQYA 3JUOA 1F8NA 1HU9A 3G713 2CFDA 1VQO3 5AIFA 1DMMA 2CFGA 2BHMA 3CU3A 2Z6BA 2XGLA 1FGQA 1ULJB 4K61A 2W04A 6STDA 1D6ZA 3X3ZA 2W9QA 3SOYA 3F14A 3PCRA 4MEIA 3CCR3 1LXEA 3S29A 4WYKA 3DXOA 2UX0A 2WO0A 3OV4A 3GZXB 4KFFA 2BMQB 3MWZA 1W01A 5HGRA 2GBXB 3D3LA 3N9HA 2C11A 3CMA3 4HM3B 2MF7A 4RNYA 3WDGB 5KP1A 1US1A 3BNCA 1GD4A 4NHFA 2CWTA 2WOHA 1Q864 2P38A 4HZ9B 3X40A 1KSIA 1W7CA 4LGQA 5EQLA 4OVMA 4N6MA 3OXAA 4ZM8A 1E97A 2XSOB 1YJN3 1SJWA 1JB2A 3EBYA 5AEWB 1TFOA 1IDPA 1EG9B 3G0KA 1JV2B 5IERA 1UI7A 2CKFB 1T5YA 3DGOA 5IEPA 4HKVB 1DMQA 1EKMA 2XH9A 3LYGA 4JRFA 1N9JA 2P05A 2OQEC 5EEOA 2FNQA 2B1XB 1OACA 4RNZA 5AIGA 2D42A 1VQ83 1NDOB 2YFIB 4L8OA 1TIJA 1DMNA 1OHPA 1CEWI 2A15A 3JUNA 4IT7A 5A0OB 3IMAB 4FMAA 1IK3A 4R9LA 2OCTA 4XB5A 1IQ8A 3VGNA 3GZBA 3KE7A 3FG4A 2OTJ3 1GY5A 3B4OA 3CC23 3IPTA 5D82A 4BTXA 2Y73A 2BO9B 3NBRA 4EV5A 2GEXA 2WGQA 1OHSA 3PS8A 1OGZA 4CCVA 1G96A 3FF2A 1QVF2 2V1LA 2Q07A 3LT9A 4XM4A 1WMOA 3OWSA 4XDWA 1S5AA 3KFQC 1GY7A 1TFKA 3BNBA 1LOXA 1EQKA 2GU1A 1WNHA 1M9GA 3CPOA 2CWUA 3PCSA 8CHOA 1K734 1SQWA 1AV4A 3WMDA 3X41A 4R9KA 1W00A 5IENA 2HMMB 4BTYA 5AIHA 3FSDA 1OF5A 3NXJA 3CCJ3 3CCE3 3HX8A 3I553 2F86B 1M1XB 3CC73 3MHEA 3NHXA 2B24B 5I97A 1W6YA 1N8R4 3Q90A 3CD63 2CH9A 1JNQA 2RGQA 2E2TA 4HM6B 4EBGA 1Q814 3S5CA 3DGNA 3HI7A 4LSOA 2XR8B 3D9RA 3FLJA 5JPUA 2GXFA 1SIIA 1RJOA 2QGUA 3FKAA 4J8TA 4RBNA 1JJ22 4O8SA 4R1KA 2WGOA 4STDA 2XFSA 2R4IA 4MMZB 1O7HB 4O3VA 3F7XA 3WOFB 5TGNA 1N8QA 5DREA 3F40A 4FR9A 3LTCA 2M7OA 2OWPA 1IU7A 3NM7A 4OUQA 1NWWA 3FF0A 1JRQA 1VQN3 3FGYA 1VQM3 1QAKA 1W2ZA 2P0MA 2HMOB 1NB3I 2C10A 3N8BA 7STDA 3LXUX 2PZVA 3V98A 3MPHA 2BMOB 4OK0A 1Z1SA 3CCL3 3KSED 2RCDA 3O8YA 5D83A 2MC8A 3T0UA 3X42A 4HM4B 2P0XA 5IG4A 1Q7Y4 3JUQA 2CG0A 4N6LA 1W02A 3DY5A 3G8ZA 3E99A 1K9M4 3LTBA 1VQL3 1YGEA 3IJEB 3LTAA 5AIIA 2IMJA 1NJI4 3JVCA 2INXA 1VQ53 1BUQA 1RRLA 4J9AA 4WP5A 4XBTA 3UJMA 1FUWA 2CW9A 3H51A 1O7GB 2XGNA 3CPW2 1CQSA 2IUJA 1AVLA 3CNMA 1IV9A 5LC7A 2BT3A 5AEUB 2ZL8A 4N6NB 5IW9A 1W6CA 1GYBA 3MG2A 3RDEA 1O7WB 3BNDA 5CLKA 2ZDJA 3J7Yd 5CF1A 3OW22 5IG0A 1FA3A 3Q2PA 2ML6A 4HM5B 2RFRA 5JPPA 1ISKA 4JF8A 1W4NA 2JDIH 3PYJA 1U5OA 2BNGA 3K0ZA 3U1WA 1YHQ3 1HKXA 3MG3A 3EQQB 4Q53A 2K0MA 3JUMA 1ZO2A 2OTL3 2XSHB 4K1UA 3EF8A 2CFWA 2RSXA 1WMNA 2HMKB 4AKZA 4N6V0 1OF5B 1ULIB 2W9PA 2QA43 1Q40A 2GEYA 2PNCA 3X3XA 3CCU3 1UW1A 4R80A 3LT8A 1Q824 4CDLA 2CWVA 3NUVA 1CYVA 4N6UA 1E3RA 3H3HA 4XBXA 3CNXA 2KCDA 3LZAA 2Z7AA 1AVKA 3S67A 2STDA 1OPYA 1IVVA 1RRHA 1ROVA 4H3UA 2CIUA 1STDA 3V92A 1W5ZA 2XF3A 1IVXA 4HYZA 2IUKA 4KFEA 4AEQA 1VQ93 4N3VA 3ALAA 1K41A 4L7KA 1Y4KA 3RGAA 2W56B 2QIYA 4H61A 1IT8A 3PZWA 3U97A 5ELJA 5AYSC 3EE1A 3GWRA 1QMAA 1M1K4 3MYTA 5CXOA 2CFKA 4AKYA 1AR0A 4HJLB 2HMLB 3DGLA 4I4KA 1PFPA 3OWYA 4ORLA 1U8CB 2KRTA 3EN1B 4X2OA 1CYUA 4TX4A 2O9UX 2XFTA 2F98A 3MG1A 1VQ73 5BXQA 1E3VA 4X2HA 3T8UA 3K63A 1KWIA 3EC9A 3LTDA 1SIHA 4N6OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BVB A;  1OUN A;  4XDV A;  3OX9 A;  3EHC A;  4WWU C;  4HM8 B;  3GZR A;  4HM0 B;  1UUV B;  3OWU A;  3HK4 A;  4PEJ A;  3KSP A;  3EJV A;  1O7P B;  5AI1 A;  3A76 A;  2HMN B;  4LMI A;  3SOA A;  2JQ5 A;  2XRX B;  5STD A;  5CK6 A;  3B7C A;  1QJG A;  3BB9 A;  3DZL A;  3NM2 A;  4HZB B;  3NV0 A;  2K54 A;  5IF6 A;  5IG5 A;  1C7H A;  4K1V A;  1Q40 B;  1JKG A;  1JN5 A;  1EA2 A;  1OCV A;  1GY6 A;  3G16 A;  5KP4 A;  4MJD A;  5KP3 A;  4LEH A;  1UUW B;  3KZT A;  3FZW A;  3SED A;  4L8P A;  1OHO A;  1OGX A;  4KVH A;  2I9W A;  5IG3 A;  2YFJ B;  3EBT A;  3F8X A;  3GRD A;  2W2C A;  3EN8 A;  4FCJ A;  1JB4 A;  1O7M B;  5G2G A;  5IEO A;  3ER7 A;  1TUH A;  5CF2 A;  1ASK A;  4XBY A;  5FW5 A;  4HVN A;  3DM8 A;  3ECF A;  2Z77 A;  1O7N B;  1GS3 A;  4GB5 A;  3T8N A;  1ZX2 A;  3F7S A;  2GBW B;  3MSO A;  2HMJ B;  1NU3 A;  3DUK A;  1JB5 A;  1VZZ A;  4FCM A;  5D81 A;  1WQL B;  3B8L A;  5DRV A;  1TP6 A;  3F9S A;  3RGR A;  2BMR B;  3UNL A;  3GZY B;  3I0Y A;  3M8C A;  3K7C A;  2YFL B;  2F99 A;  5EVH A;  3JUP A;  3NV0 B;  3FH1 A;  4IIA A;  1OH0 A;  4HM2 B;  3ROB A;  3KKG A;  4RZM A;  3VSY A;  1JKG B;  2CHC A;  3F8H A;  4WYK B;  3EX9 A;  1JN5 B;  3B4P A;  3MKI A;  4HM7 B;  2Z76 A;  3DMC A;  1Q42 A;  3BLZ A;  3HZP A;  3STD A;  4HM1 B;  4U13 A;  1A2K A;  3JUO A;  5AIF A;  1DMM A;  3CU3 A;  1ULJ B;  6STD A;  3SOY A;  3F14 A;  4WYK A;  3DXO A;  2UX0 A;  3OV4 A;  3GZX B;  2BMQ B;  1W01 A;  5HGR A;  2GBX B;  4HM3 B;  5KP1 A;  4HZ9 B;  4LGQ A;  4OVM A;  3OXA A;  1E97 A;  2XSO B;  1SJW A;  1JB2 A;  3EBY A;  5AEW B;  1IDP A;  1EG9 B;  3G0K A;  5IER A;  2CKF B;  5IEP A;  4HKV B;  1DMQ A;  3LYG A;  2B1X B;  5AIG A;  1NDO B;  2YFI B;  4L8O A;  1DMN A;  1OHP A;  2A15 A;  3JUN A;  4R9L A;  4XB5 A;  3VGN A;  3GZB A;  3KE7 A;  1GY5 A;  3B4O A;  3IPT A;  5D82 A;  3NBR A;  2GEX A;  1OHS A;  1OGZ A;  3FF2 A;  4XM4 A;  3OWS A;  4XDW A;  1S5A A;  1GY7 A;  3CPO A;  8CHO A;  3WMD A;  4R9K A;  1W00 A;  5IEN A;  2HMM B;  5AIH A;  3FSD A;  1OF5 A;  3NXJ A;  3HX8 A;  2F86 B;  3MHE A;  3NHX A;  2B24 B;  1W6Y A;  3Q90 A;  2RGQ A;  4HM6 B;  3S5C A;  2XR8 B;  3D9R A;  3FLJ A;  5JPU A;  2GXF A;  4J8T A;  3FKA A;  2QGU A;  4R1K A;  4STD A;  2R4I A;  1O7H B;  3F7X A;  5TGN A;  5DRE A;  3F40 A;  2OWP A;  4OUQ A;  1NWW A;  3FF0 A;  3FGY A;  2HMO B;  7STD A;  2PZV A;  2BMO B;  1Z1S A;  2RCD A;  5D83 A;  4HM4 B;  5IG4 A;  3JUQ A;  1W02 A;  3G8Z A;  3E99 A;  5AII A;  2IMJ A;  1BUQ A;  2INX A;  4J9A A;  4WP5 A;  4XBT A;  3UJM A;  3H51 A;  1O7G B;  1CQS A;  3CNM A;  3MG2 A;  1GYB A;  1O7W B;  5CLK A;  5CF1 A;  5IG0 A;  5JPP A;  4HM5 B;  2RFR A;  1ISK A;  1U5O A;  2BNG A;  3K0Z A;  1HKX A;  3MG3 A;  3EQQ B;  4Q53 A;  3JUM A;  1ZO2 A;  2XSH B;  4K1U A;  3EF8 A;  2HMK B;  1OF5 B;  1ULI B;  1Q40 A;  2GEY A;  4CDL A;  3NUV A;  1E3R A;  3H3H A;  4XBX A;  3CNX A;  3LZA A;  2Z7A A;  2STD A;  1OPY A;  4H3U A;  5AEU B;  1STD A;  4N3V A;  1K41 A;  4L7K A;  3RGA A;  2QIY A;  3GWR A;  1QMA A;  3MYT A;  5CXO A;  1AR0 A;  4HJL B;  2HML B;  4I4K A;  3OWY A;  4ORL A;  3EN1 B;  4X2O A;  3MG1 A;  2F98 A;  5BXQ A;  1E3V A;  4X2H A;  3T8U A;  3EC9 A; 
#chains in the Genus database with same CATH topology
 1YJW 3;  5BVB A;  3FG3 A;  1OUN A;  3VF1 A;  3LML A;  1I70 A;  1K8A 4;  4FMB A;  3G4S 3;  4XDV A;  3OX9 A;  1UI8 A;  1X1W A;  2CX0 A;  2W03 A;  1VQ6 3;  1SPU A;  2W56 A;  1DYU A;  3CME 3;  3EHC A;  4WWU C;  1W2B 2;  4R4K A;  4HM8 B;  1D6Y A;  1QAF A;  3GZR A;  3SXX A;  1BRN L;  4BIR A;  4HM0 B;  1UUV B;  3OWU A;  5ELU A;  1BOX A;  1V74 A;  1VQP 3;  3HK4 A;  3HII A;  1KC8 4;  4PEJ A;  2KXG A;  1STF I;  1D6U A;  3KSP A;  4I5Q A;  1RGL A;  3EJV A;  3CCV 3;  1WMP A;  1NB5 I;  1QAL A;  1RGH A;  1O7P B;  5JBS A;  2F56 A;  5AI1 A;  4WFO A;  1DVD A;  2CG1 A;  3A76 A;  3UL6 A;  2HMN B;  1GOU A;  4LMI A;  3SOA A;  1YJ9 3;  1BSA A;  2JQ5 A;  2CK3 H;  2XRX B;  2W0Q A;  5CK6 A;  2R41 A;  5STD A;  1LOW A;  2L4V A;  1GOY A;  3B7C A;  1YI2 3;  4KZ1 A;  5G1K A;  1QJG A;  3BB9 A;  1A2P A;  3DZL A;  2AAE A;  3NM2 A;  3S28 A;  4HZB B;  4G1M B;  3NV0 A;  3V99 A;  2FXT A;  3HOH A;  2K54 A;  3KN4 A;  1EUI C;  2OOV A;  5RNT A;  3CCM 3;  2F5M A;  2W6J H;  6GSP A;  5IF6 A;  5IG5 A;  1YGW A;  1C7H A;  3K9M C;  1NO3 A;  2E2V A;  4K1V A;  1T3B A;  2ZHX B;  4O2H A;  2RBI A;  1Q40 B;  1JKG A;  3KII A;  1JN5 A;  1N5H A;  4EV2 A;  2Y74 A;  1EA2 A;  4FMC A;  4MMX B;  3RNT A;  1OCV A;  1GY6 A;  2E2U A;  3LH4 A;  2ZA4 A;  4IPB A;  1TTO A;  1DVC A;  3AHS A;  3G16 A;  1FGR A;  4GL6 A;  5KP4 A;  2QEX 3;  3AMO A;  4MJD A;  1FGO A;  5KP3 A;  1RN1 A;  7GSP A;  1LVN A;  2WOF A;  4LEH A;  1YIT 3;  1UUW B;  2P09 A;  3KZT A;  3I56 3;  4LZI A;  1V58 A;  4FCZ A;  1ROA A;  1RCK A;  3FZW A;  3SED A;  4K90 B;  4L8P A;  1OHO A;  1W6G A;  4CJN A;  1A67 A;  1K28 A;  4WHA A;  3AHW A;  5AYR B;  3D79 A;  1BRJ A;  3DGY A;  2XEP A;  1OGX A;  3N54 B;  1I2F A;  4J5G A;  4KVH A;  2I9W A;  2KF3 A;  1L5G B;  5IG3 A;  2YFJ B;  3EBT A;  3F8X A;  4NRE A;  3CC4 3;  1M90 4;  3GRD A;  1BSE A;  1IVW A;  3CCQ 3;  2W2C A;  1FGT A;  1IVU A;  3G6E 3;  1MOL A;  3EN8 A;  1GMP A;  4FCJ A;  2O3O A;  1IQX A;  1JB4 A;  4FMD A;  5BU4 A;  1O7M B;  4QWT A;  5G2G A;  5IEO A;  2IA7 A;  3ER7 A;  4HBR A;  1TUH A;  1TU5 A;  1A90 A;  2LYX A;  3X3Y A;  1BRK A;  5CF2 A;  1ASK A;  4XBY A;  5FW5 A;  3WOE B;  1G02 A;  4HVN A;  3DM8 A;  3ECF A;  5GSP A;  1N5P A;  2Z77 A;  3FG1 A;  3UB1 A;  3BNE A;  1O7N B;  4EC6 A;  1GS3 A;  4GB5 A;  1S72 3;  4HAA A;  5LC6 A;  1UGH I;  1RN7 A;  1SAR A;  3T8N A;  3WA3 A;  1ZX2 A;  3F7S A;  1VQK 3;  1PY3 A;  1YIJ 3;  1MWS A;  2GBW B;  1BNI A;  1LNH A;  1RLS A;  3QK9 A;  3MSO A;  2HMJ B;  1NU3 A;  2LQV A;  2AAD A;  3DUK A;  1JB5 A;  1KQS 2;  1VZZ A;  1I8V A;  4FCM A;  5D81 A;  3NBB A;  1AQZ A;  1WQL B;  3SVA A;  3B8L A;  3ZFZ A;  1J2B A;  5DRV A;  1TP6 A;  3KCH A;  1UCL A;  3F9S A;  1N9E A;  3SX1 A;  4HOH A;  5FGO A;  3RGR A;  2BMR B;  2CFL A;  3GZY B;  3I0Y A;  1MGW A;  3UNL A;  3M8C A;  3K7C A;  2YFL B;  1BNG A;  3L0R A;  2SBL A;  3WA2 X;  2F99 A;  2OOV C;  1WTH A;  1ZS7 A;  4KFD A;  3CCS 3;  3LOY A;  5EVH A;  3NQY A;  1VQ4 3;  2CC3 A;  1R4C A;  4EXR A;  3JUP A;  1RKY A;  1JBR A;  3NQZ A;  1A2V A;  4BTW A;  1BSC A;  2OQE A;  3HIG A;  3NV0 B;  3FH1 A;  2D1W A;  3NBJ A;  4O02 B;  1KD1 4;  1MNL A;  1FGM A;  4IIA A;  3EB8 A;  1GOV A;  1OH0 A;  1RDS A;  4HM2 B;  2KF5 A;  3ZG5 A;  1BNJ A;  3WOD G;  1I0V A;  9RNT A;  3ROB A;  3KKG A;  1YVS A;  1VQQ A;  4RZM A;  3S27 A;  1IT7 A;  1BRI A;  4GHO A;  3SLU A;  3VSY A;  1JKG B;  2CHC A;  3F8H A;  4WYK B;  2ML5 A;  3EX9 A;  4MMY B;  3GAX A;  1JN5 B;  3UL5 A;  3B4P A;  3FCS B;  1IV7 A;  1GD3 A;  1MGR A;  1PU4 A;  3BU4 A;  1BNF A;  2Z76 A;  3MKI A;  4HM7 B;  3TDG A;  1RGE A;  3CXC 2;  3DGM A;  3DMC A;  1YVB I;  4EYC A;  1R4Y A;  1Q42 A;  3PXM A;  2FGT A;  3PGB A;  2YX9 A;  3AMO B;  3BLZ A;  4LYL B;  2GU3 A;  3HZP A;  3STD A;  2UUG C;  3Q1C A;  3NX0 A;  4HM1 B;  4U13 A;  3QRD A;  1QVG 2;  1A2K A;  4N6T A;  1V57 A;  3K5T A;  1IQY A;  3JUO A;  1F8N A;  1HU9 A;  3G71 3;  2CFD A;  1BGS A;  1VQO 3;  1B20 A;  5AIF A;  3A5E A;  1DMM A;  2CFG A;  2BHM A;  3CU3 A;  2Z6B A;  2XGL A;  1FGQ A;  1ULJ B;  3WHO A;  2IYJ A;  4K61 A;  2W04 A;  6STD A;  1I2G A;  1D6Z A;  2BIR A;  3X3Z A;  1FZU A;  1B2Z A;  2W9Q A;  1BSD A;  1B2S A;  3F14 A;  3PCR A;  3SOY A;  4MEI A;  4GSP A;  3CCR 3;  1LXE A;  4KT3 B;  3D4A A;  3S29 A;  4WYK A;  1RTU A;  3DXO A;  2UX0 A;  2WO0 A;  3OV4 A;  1RNT A;  3GZX B;  4KFF A;  5M1A A;  2BMQ B;  3MWZ A;  1W01 A;  5HGR A;  2GBX B;  3D3L A;  3N9H A;  2C11 A;  1HZ1 A;  3CMA 3;  4HM3 B;  2MF7 A;  4RNY A;  4J5K A;  3WDG B;  5KP1 A;  1US1 A;  2KF6 A;  3BNC A;  1I3F A;  1LOY A;  1GD4 A;  4NHF A;  2CWT A;  2WOH A;  1Q86 4;  2P38 A;  4HZ9 B;  1UCI A;  1RGG A;  3X40 A;  1LOV A;  4EW5 A;  1I2E A;  2UGI A;  1KSI A;  1W7C A;  4LGQ A;  5EQL A;  4OVM A;  4N6M A;  2CX1 A;  3OXA A;  4ZM8 A;  1E97 A;  2XSO B;  1YJN 3;  1B21 A;  1BUJ A;  1SJW A;  1JB2 A;  3EBY A;  5AEW B;  1TFO A;  1IDP A;  2K3D A;  1EG9 B;  1MWR A;  1JV2 B;  3G0K A;  1C54 A;  4BL2 A;  5IER A;  1UI7 A;  1T5Y A;  2CKF B;  3DGO A;  5IEP A;  4HKV B;  1DMQ A;  1TRQ A;  1EKM A;  2XH9 A;  3LYG A;  3Q3F A;  4JRF A;  1N9J A;  1EEJ A;  1G0T A;  2P05 A;  2OQE C;  5EEO A;  2FNQ A;  2B1X B;  1B2U A;  1AY7 A;  4BU4 A;  2L1S A;  1OAC A;  4RNZ A;  5AIG A;  2D42 A;  1VQ8 3;  1NDO B;  2YFI B;  4L8O A;  1TIJ A;  1DMN A;  1OHP A;  1CEW I;  2A15 A;  3JUN A;  4IT7 A;  5A0O B;  3IMA B;  2KAA A;  4FMA A;  1IK3 A;  4R9L A;  2OCT A;  2C4B A;  1TRP A;  4XB5 A;  1IQ8 A;  3VGN A;  2HOH A;  3GZB A;  3KE7 A;  3FG4 A;  2OTJ 3;  1NNV A;  5HOH A;  1GY5 A;  3B4O A;  3CC2 3;  3IPT A;  5D82 A;  4BTX A;  2Y73 A;  2BO9 B;  3NBR A;  4EV5 A;  2GEX A;  2WGQ A;  1BRS A;  1OHS A;  2IY2 A;  3PS8 A;  1OGZ A;  1RSN A;  4CCV A;  1G96 A;  2GSP A;  1TJD A;  3FF2 A;  1QVF 2;  2V1L A;  1JZO A;  2Q07 A;  3LT9 A;  4XM4 A;  1FUS A;  1WMO A;  2J8X B;  3OWS A;  4XDW A;  1UGI A;  1S5A A;  1BU4 A;  3KFQ C;  1BIR A;  1GY7 A;  1BAN A;  1TFK A;  3BIR A;  3BNB A;  1LOX A;  1EQK A;  2GU1 A;  8RNT A;  1WNH A;  1M9G A;  3CPO A;  2CWU A;  1RGK A;  3PCS A;  8CHO A;  1K73 4;  1SQW A;  1AV4 A;  3WMD A;  1JBT A;  3X41 A;  3DH2 A;  4R9K A;  1W00 A;  5IEN A;  2HMM B;  4BTY A;  1B3S A;  5AIH A;  3D5I A;  3FSD A;  3GSP A;  1OF5 A;  3NXJ A;  1LRA A;  1RNB A;  2F5W A;  1RN4 A;  3CCJ 3;  1RGA A;  3CCE 3;  3HX8 A;  3I55 3;  2F86 B;  1M1X B;  3CC7 3;  4DKI A;  3MHE A;  3NHX A;  2B24 B;  4CPK A;  5I97 A;  1W6Y A;  5M19 A;  1N8R 4;  3Q90 A;  1Q9E A;  3CD6 3;  2CH9 A;  1LQM B;  1JNQ A;  2RGQ A;  2E2T A;  3D5G A;  4HM6 B;  4EBG A;  1Q81 4;  3S5C A;  1T2I A;  2SAR A;  3DGN A;  3HI7 A;  2XR8 B;  4LSO A;  3D9R A;  3FLJ A;  5JPU A;  2GXF A;  1SII A;  1RJO A;  2QGU A;  3FKA A;  4J8T A;  4RBN A;  1JJ2 2;  4O8S A;  4R1K A;  2WGO A;  4STD A;  2XFS A;  1X1X A;  2R4I A;  1O7H B;  4MMZ B;  3F7X A;  4O3V A;  5TGN A;  3WOF B;  1N8Q A;  5DRE A;  3F40 A;  4FR9 A;  3LTC A;  2M7O A;  1RGF A;  1RGC A;  2OWP A;  1IU7 A;  3NM7 A;  4OUQ A;  1NWW A;  3FF0 A;  1JRQ A;  1VQN 3;  3FGY A;  1VQM 3;  1I3I A;  1QAK A;  4ILF A;  2H0I A;  1W2Z A;  1MWU A;  2P0M A;  2HMO B;  1NB3 I;  2C10 A;  3N8B A;  7STD A;  3LXU X;  2PZV A;  3V98 A;  3MPH A;  2BMO B;  1BNE A;  4OK0 A;  1BVI A;  1Z1S A;  3CCL 3;  3WR2 A;  3KSE D;  2RCD A;  3O8Y A;  5D83 A;  2MC8 A;  3T0U A;  3X42 A;  4HM4 B;  2P0X A;  5IG4 A;  1Q7Y 4;  3JUQ A;  2CG0 A;  4N6L A;  1RCL A;  1W02 A;  1LQG C;  3DY5 A;  3G8Z A;  3E99 A;  3ZG0 A;  1K9M 4;  3LTB A;  1VQL 3;  1YGE A;  3IJE B;  3LTA A;  5AII A;  2IMJ A;  1NJI 4;  3JVC A;  2INX A;  1VQ5 3;  1BUQ A;  1RRL A;  2F4Y A;  3AGN A;  1Q7H A;  1UDI I;  4J9A A;  1PYL A;  4WP5 A;  4XBT A;  3UJM A;  2CW9 A;  1FUW A;  1ZGX A;  3H51 A;  1HYF A;  1O7G B;  2XGN A;  3CPW 2;  4BL3 A;  1CQS A;  2IUJ A;  1AVL A;  3CNM A;  1BNR A;  1IV9 A;  5LC7 A;  2RNT A;  2BT3 A;  5AEU B;  2ZL8 A;  4N6N B;  5IW9 A;  1W6C A;  1GYB A;  3MG2 A;  1GMR A;  3RDE A;  1O7W B;  3BND A;  5CLK A;  2ZDJ A;  3J7Y d;  3SYU A;  5CF1 A;  3OW2 2;  5IG0 A;  1FA3 A;  3Q2P A;  1CH0 A;  2ML6 A;  2RFR A;  4HM5 B;  5JPP A;  1ISK A;  1MWT A;  4JF8 A;  1W4N A;  2BU4 A;  2JDI H;  1FW7 A;  3PYJ A;  1U5O A;  7RNT A;  2BNG A;  3K0Z A;  3U1W A;  1YHQ 3;  1HKX A;  3MG3 A;  3EQQ B;  1B2M A;  4Q53 A;  1X1U A;  2K0M A;  3JUM A;  1ZO2 A;  2OTL 3;  1RHL A;  2XSH B;  4K1U A;  3EF8 A;  2CFW A;  1BRG A;  1BSB A;  1FYS A;  2RSX A;  1WMN A;  1UCK A;  2HMK B;  4AKZ A;  2H0H A;  4N6V 0;  1OF5 B;  1GSP A;  1ULI B;  2W9P A;  2QA4 3;  1Q40 A;  2GEY A;  2PNC A;  3X3X A;  3CCU 3;  3AGO A;  1BNS A;  1BRH A;  1UW1 A;  3LT8 A;  4R80 A;  1Q82 4;  4CDL A;  2CWV A;  3NUV A;  1CYV A;  1B2X A;  4N6U A;  4RNT A;  1E3R A;  3H3H A;  4XBX A;  6RNT A;  3CNX A;  1B27 A;  2KCD A;  3LZA A;  2Z7A A;  1AVK A;  3S67 A;  1LNI A;  2STD A;  1YNV X;  1OPY A;  1IVV A;  1RRH A;  1ROV A;  4H3U A;  1JZD A;  1STD A;  2CIU A;  1W5Z A;  2XF3 A;  1IVX A;  4HYZ A;  2IUK A;  4KFE A;  3V92 A;  4AEQ A;  4N3V A;  1VQ9 3;  3ALA A;  1K41 A;  4L7K A;  1Y4K A;  5G1L A;  1DE3 A;  3RGA A;  2W56 B;  2QIY A;  1X1Y A;  4H61 A;  1IT8 A;  3PZW A;  3U97 A;  5ELJ A;  5M18 A;  3URP A;  5AYS C;  3EE1 A;  1DET A;  3GWR A;  4NPB A;  1T2H A;  1QMA A;  2KF4 A;  1M1K 4;  1UUG B;  3MYT A;  5CXO A;  1BAO A;  1I0X A;  1GMQ A;  2CFK A;  4AKY A;  1AR0 A;  2H0G A;  4HJL B;  1IYY A;  2HML B;  3DGL A;  4I4K A;  1PFP A;  5BIR A;  3OWY A;  4ORL A;  1FUT A;  1U8C B;  2KRT A;  3EN1 B;  1RMS A;  4X2O A;  1JBS A;  4TX4 A;  1CYU A;  2O9U X;  2XFT A;  2F98 A;  3MG1 A;  1VQ7 3;  5BXQ A;  1E3V A;  4X2H A;  3T8U A;  3K63 A;  1KWI A;  3EC9 A;  3LTD A;  1SIH A;  4N6O B;  1UCJ A; 
#chains in the Genus database with same CATH homology
 1YJW 3;  5BVB A;  3FG3 A;  1OUN A;  3VF1 A;  3LML A;  1K8A 4;  4FMB A;  3G4S 3;  4XDV A;  3OX9 A;  1UI8 A;  2W03 A;  1VQ6 3;  1SPU A;  2W56 A;  1DYU A;  3CME 3;  3EHC A;  4WWU C;  1W2B 2;  4R4K A;  4HM8 B;  1D6Y A;  1QAF A;  3GZR A;  3SXX A;  4HM0 B;  1UUV B;  3OWU A;  5ELU A;  1V74 A;  1VQP 3;  3HK4 A;  3HII A;  1KC8 4;  4PEJ A;  2KXG A;  1STF I;  1D6U A;  3KSP A;  3EJV A;  3CCV 3;  1WMP A;  1NB5 I;  1QAL A;  1O7P B;  5JBS A;  5AI1 A;  4WFO A;  1DVD A;  2CG1 A;  3A76 A;  3UL6 A;  2HMN B;  4LMI A;  3SOA A;  1YJ9 3;  2JQ5 A;  2CK3 H;  2XRX B;  2W0Q A;  5CK6 A;  5STD A;  2L4V A;  3B7C A;  1YI2 3;  4KZ1 A;  1QJG A;  3BB9 A;  3DZL A;  3NM2 A;  3S28 A;  4HZB B;  4G1M B;  3NV0 A;  3V99 A;  2FXT A;  2K54 A;  3KN4 A;  2OOV A;  3CCM 3;  2W6J H;  5IF6 A;  5IG5 A;  1C7H A;  3K9M C;  1NO3 A;  2E2V A;  4K1V A;  4O2H A;  1Q40 B;  1JKG A;  3KII A;  1JN5 A;  1N5H A;  4EV2 A;  2Y74 A;  1EA2 A;  4FMC A;  4MMX B;  1OCV A;  1GY6 A;  2E2U A;  3LH4 A;  4IPB A;  1DVC A;  3G16 A;  1FGR A;  4GL6 A;  5KP4 A;  2QEX 3;  3AMO A;  4MJD A;  1FGO A;  5KP3 A;  1LVN A;  2WOF A;  4LEH A;  1YIT 3;  1UUW B;  2P09 A;  3KZT A;  3I56 3;  4LZI A;  4FCZ A;  1ROA A;  3FZW A;  3SED A;  4K90 B;  4L8P A;  1OHO A;  1W6G A;  1A67 A;  1K28 A;  4WHA A;  5AYR B;  2XEP A;  1OGX A;  3N54 B;  4KVH A;  2I9W A;  1L5G B;  5IG3 A;  2YFJ B;  3EBT A;  3F8X A;  4NRE A;  3CC4 3;  1M90 4;  3GRD A;  1IVW A;  3CCQ 3;  2W2C A;  1FGT A;  1IVU A;  3G6E 3;  1MOL A;  3EN8 A;  4FCJ A;  2O3O A;  1IQX A;  1JB4 A;  4FMD A;  1O7M B;  4QWT A;  5G2G A;  5IEO A;  2IA7 A;  3ER7 A;  4HBR A;  1TUH A;  1TU5 A;  1A90 A;  2LYX A;  3X3Y A;  5CF2 A;  1ASK A;  4XBY A;  5FW5 A;  3WOE B;  4HVN A;  3DM8 A;  3ECF A;  3UB1 A;  1N5P A;  2Z77 A;  3FG1 A;  4EC6 A;  3BNE A;  1O7N B;  1S72 3;  1GS3 A;  4GB5 A;  5LC6 A;  1RN7 A;  3WA3 A;  3T8N A;  1ZX2 A;  3F7S A;  1VQK 3;  1YIJ 3;  2GBW B;  1LNH A;  3QK9 A;  3MSO A;  2HMJ B;  1NU3 A;  2LQV A;  3DUK A;  1JB5 A;  1KQS 2;  1VZZ A;  4FCM A;  5D81 A;  3NBB A;  1WQL B;  3SVA A;  3B8L A;  1J2B A;  5DRV A;  1TP6 A;  3F9S A;  1N9E A;  3SX1 A;  5FGO A;  3RGR A;  2BMR B;  2CFL A;  3GZY B;  3I0Y A;  3UNL A;  3M8C A;  3K7C A;  2YFL B;  3L0R A;  2SBL A;  3WA2 X;  2F99 A;  2OOV C;  1WTH A;  4KFD A;  3CCS 3;  3LOY A;  5EVH A;  3NQY A;  1VQ4 3;  2CC3 A;  1R4C A;  4EXR A;  3JUP A;  1RKY A;  3NQZ A;  1A2V A;  4BTW A;  2OQE A;  3HIG A;  3NV0 B;  3FH1 A;  2D1W A;  3NBJ A;  4O02 B;  1KD1 4;  1MNL A;  1FGM A;  4IIA A;  3EB8 A;  1OH0 A;  4HM2 B;  3WOD G;  3ROB A;  3KKG A;  4RZM A;  3S27 A;  1IT7 A;  3SLU A;  3VSY A;  1JKG B;  2CHC A;  3F8H A;  4WYK B;  2ML5 A;  3EX9 A;  4MMY B;  3GAX A;  1JN5 B;  3UL5 A;  3B4P A;  3FCS B;  1IV7 A;  1GD3 A;  1PU4 A;  3CXC 2;  3MKI A;  4HM7 B;  2Z76 A;  3TDG A;  3DGM A;  3DMC A;  1YVB I;  4EYC A;  3PXM A;  1Q42 A;  2FGT A;  3PGB A;  2YX9 A;  3AMO B;  3BLZ A;  2GU3 A;  3HZP A;  3STD A;  3Q1C A;  3NX0 A;  4HM1 B;  4U13 A;  3QRD A;  1QVG 2;  1A2K A;  4N6T A;  3K5T A;  1IQY A;  3JUO A;  1F8N A;  1HU9 A;  3G71 3;  2CFD A;  1VQO 3;  5AIF A;  1DMM A;  2CFG A;  2BHM A;  3CU3 A;  2Z6B A;  2XGL A;  1FGQ A;  1ULJ B;  4K61 A;  2W04 A;  6STD A;  1D6Z A;  3X3Z A;  2W9Q A;  3SOY A;  3F14 A;  3PCR A;  4MEI A;  3CCR 3;  1LXE A;  3S29 A;  4WYK A;  3DXO A;  2UX0 A;  2WO0 A;  3OV4 A;  3GZX B;  4KFF A;  2BMQ B;  3MWZ A;  1W01 A;  5HGR A;  2GBX B;  3D3L A;  3N9H A;  2C11 A;  3CMA 3;  4HM3 B;  2MF7 A;  4RNY A;  3WDG B;  5KP1 A;  1US1 A;  3BNC A;  1GD4 A;  4NHF A;  2CWT A;  2WOH A;  1Q86 4;  2P38 A;  4HZ9 B;  3X40 A;  1KSI A;  1W7C A;  4LGQ A;  5EQL A;  4OVM A;  4N6M A;  3OXA A;  4ZM8 A;  1E97 A;  2XSO B;  1YJN 3;  1SJW A;  1JB2 A;  3EBY A;  5AEW B;  1TFO A;  1IDP A;  1EG9 B;  3G0K A;  1JV2 B;  5IER A;  1UI7 A;  2CKF B;  1T5Y A;  3DGO A;  5IEP A;  4HKV B;  1DMQ A;  1EKM A;  2XH9 A;  3LYG A;  4JRF A;  1N9J A;  2P05 A;  2OQE C;  5EEO A;  2FNQ A;  2B1X B;  1OAC A;  4RNZ A;  5AIG A;  2D42 A;  1VQ8 3;  1NDO B;  2YFI B;  4L8O A;  1TIJ A;  1DMN A;  1OHP A;  1CEW I;  2A15 A;  3JUN A;  4IT7 A;  5A0O B;  3IMA B;  4FMA A;  1IK3 A;  4R9L A;  2OCT A;  4XB5 A;  1IQ8 A;  3VGN A;  3GZB A;  3KE7 A;  3FG4 A;  2OTJ 3;  1GY5 A;  3B4O A;  3CC2 3;  3IPT A;  5D82 A;  4BTX A;  2Y73 A;  2BO9 B;  3NBR A;  4EV5 A;  2GEX A;  2WGQ A;  1OHS A;  3PS8 A;  1OGZ A;  4CCV A;  1G96 A;  3FF2 A;  1QVF 2;  2V1L A;  2Q07 A;  3LT9 A;  4XM4 A;  1WMO A;  3OWS A;  4XDW A;  1S5A A;  3KFQ C;  1GY7 A;  1TFK A;  3BNB A;  1LOX A;  1EQK A;  2GU1 A;  1WNH A;  1M9G A;  3CPO A;  2CWU A;  3PCS A;  8CHO A;  1K73 4;  1SQW A;  1AV4 A;  3WMD A;  3X41 A;  4R9K A;  1W00 A;  5IEN A;  2HMM B;  4BTY A;  5AIH A;  3FSD A;  1OF5 A;  3NXJ A;  3CCJ 3;  3CCE 3;  3HX8 A;  3I55 3;  2F86 B;  1M1X B;  3CC7 3;  3MHE A;  3NHX A;  2B24 B;  5I97 A;  1W6Y A;  1N8R 4;  3Q90 A;  3CD6 3;  2CH9 A;  1JNQ A;  2RGQ A;  2E2T A;  4HM6 B;  4EBG A;  1Q81 4;  3S5C A;  3DGN A;  3HI7 A;  4LSO A;  2XR8 B;  3D9R A;  3FLJ A;  5JPU A;  2GXF A;  1SII A;  1RJO A;  2QGU A;  3FKA A;  4J8T A;  4RBN A;  1JJ2 2;  4O8S A;  4R1K A;  2WGO A;  4STD A;  2XFS A;  2R4I A;  4MMZ B;  1O7H B;  4O3V A;  3F7X A;  3WOF B;  5TGN A;  1N8Q A;  5DRE A;  3F40 A;  4FR9 A;  3LTC A;  2M7O A;  2OWP A;  1IU7 A;  3NM7 A;  4OUQ A;  1NWW A;  3FF0 A;  1JRQ A;  1VQN 3;  3FGY A;  1VQM 3;  1QAK A;  1W2Z A;  2P0M A;  2HMO B;  1NB3 I;  2C10 A;  3N8B A;  7STD A;  3LXU X;  2PZV A;  3V98 A;  3MPH A;  2BMO B;  4OK0 A;  1Z1S A;  3CCL 3;  3KSE D;  2RCD A;  3O8Y A;  5D83 A;  2MC8 A;  3T0U A;  3X42 A;  4HM4 B;  2P0X A;  5IG4 A;  1Q7Y 4;  3JUQ A;  2CG0 A;  4N6L A;  1W02 A;  3DY5 A;  3G8Z A;  3E99 A;  1K9M 4;  3LTB A;  1VQL 3;  1YGE A;  3IJE B;  3LTA A;  5AII A;  2IMJ A;  1NJI 4;  3JVC A;  2INX A;  1VQ5 3;  1BUQ A;  1RRL A;  4J9A A;  4WP5 A;  4XBT A;  3UJM A;  1FUW A;  2CW9 A;  3H51 A;  1O7G B;  2XGN A;  3CPW 2;  1CQS A;  2IUJ A;  1AVL A;  3CNM A;  1IV9 A;  5LC7 A;  2BT3 A;  5AEU B;  2ZL8 A;  4N6N B;  5IW9 A;  1W6C A;  1GYB A;  3MG2 A;  3RDE A;  1O7W B;  3BND A;  5CLK A;  2ZDJ A;  3J7Y d;  5CF1 A;  3OW2 2;  5IG0 A;  1FA3 A;  3Q2P A;  2ML6 A;  4HM5 B;  2RFR A;  5JPP A;  1ISK A;  4JF8 A;  1W4N A;  2JDI H;  3PYJ A;  1U5O A;  2BNG A;  3K0Z A;  3U1W A;  1YHQ 3;  1HKX A;  3MG3 A;  3EQQ B;  4Q53 A;  2K0M A;  3JUM A;  1ZO2 A;  2OTL 3;  2XSH B;  4K1U A;  3EF8 A;  2CFW A;  2RSX A;  1WMN A;  2HMK B;  4AKZ A;  4N6V 0;  1OF5 B;  1ULI B;  2W9P A;  2QA4 3;  1Q40 A;  2GEY A;  2PNC A;  3X3X A;  3CCU 3;  1UW1 A;  4R80 A;  3LT8 A;  1Q82 4;  4CDL A;  2CWV A;  3NUV A;  1CYV A;  4N6U A;  1E3R A;  3H3H A;  4XBX A;  3CNX A;  2KCD A;  3LZA A;  2Z7A A;  1AVK A;  3S67 A;  2STD A;  1OPY A;  1IVV A;  1RRH A;  1ROV A;  4H3U A;  2CIU A;  1STD A;  3V92 A;  1W5Z A;  2XF3 A;  1IVX A;  4HYZ A;  2IUK A;  4KFE A;  4AEQ A;  1VQ9 3;  4N3V A;  3ALA A;  1K41 A;  4L7K A;  1Y4K A;  3RGA A;  2W56 B;  2QIY A;  4H61 A;  1IT8 A;  3PZW A;  3U97 A;  5ELJ A;  5AYS C;  3EE1 A;  3GWR A;  1QMA A;  1M1K 4;  3MYT A;  5CXO A;  2CFK A;  4AKY A;  1AR0 A;  4HJL B;  2HML B;  3DGL A;  4I4K A;  1PFP A;  3OWY A;  4ORL A;  1U8C B;  2KRT A;  3EN1 B;  4X2O A;  1CYU A;  4TX4 A;  2O9U X;  2XFT A;  2F98 A;  3MG1 A;  1VQ7 3;  5BXQ A;  1E3V A;  4X2H A;  3T8U A;  3K63 A;  1KWI A;  3EC9 A;  3LTD A;  1SIH A;  4N6O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...