1DMMA

Crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 30
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmmA00
5D83A 1JB2A 5CF1A 5IENA 3KSPA 1VZZA 3OXAA 3LZAA 2HMMB 1Q40B 3DM8A 2CKFB 2GEXA 5CK6A 4K1UA 4R1KA 2IMJA 3I0YA 4HM4B 3CNMA 3KE7A 3F14A 1DMQA 5HGRA 5BXQA 1OF5A 5AIGA 5IEOA 4HM7B 3EBTA 2XR8B 4HM2B 1TUHA 5IERA 3G0KA 5IF6A 3EBYA 1S5AA 4XBYA 1O7WB 2GXFA 3DXOA 2OWPA 3GZBA 3IPTA 4HVNA 3FSDA 3JUPA 1OPYA 3CPOA 1W6YA 1OGXA 4GB5A 3SEDA 4HM5B 3B4OA 5IG5A 5FW5A 3F8XA 4J8TA 4LGQA 3NUVA 4WP5A 3EQQB 2HMKB 3GRDA 3MYTA 4J9AA 1OH0A 4HM8B 3EF8A 5AIHA 4XBXA 5D82A 2Z7AA 1JN5B 3K0ZA 4L8OA 1EG9B 3FKAA 3OV4A 3M8CA 3FH1A 3FZWA 4Q53A 1STDA 3CNXA 4HM3B 1OHPA 2Z76A 3ER7A 3DMCA 5EVHA 1O7MB 1O7GB 4XM4A 3ROBA 2GBWB 3EC9A 3MG3A 1ZO2A 1WQLB 4CDLA 4IIAA 3NV0B 1OF5B 3F40A 3BLZA 4RZMA 4U13A 5IG4A 5D81A 4HZBB 1NU3A 1K41A 1TP6A 3RGRA 3VGNA 3DZLA 2A15A 5DREA 3T8UA 1JB5A 3A76A 5IEPA 1OHOA 1JB4A 4KVHA 3UJMA 4FCMA 4HM6B 3DUKA 4L8PA 1A2KA 1ULJB 5G2GA 1ULIB 1W02A 5JPUA 2RCDA 4LMIA 4K1VA 3EJVA 6STDA 2CHCA 2XRXB 3MG2A 5CXOA 1OUNA 1NWWA 4R9LA 5KP3A 4N3VA 1W01A 3H3HA 4PEJA 3MSOA 5STDA 2PZVA 1SJWA 1DMMA 4WYKB 2GEYA 3HX8A 2BMQB 3GZXB 3EHCA 3Q90A 4STDA 5AIIA 4OUQA 1GY7A 5CLKA 3WMDA 1DMNA 3NHXA 1OCVA 3BB9A 3OWSA 3HK4A 3MKIA 8CHOA 1GY6A 1GYBA 3GZRA 4XDWA 1E3VA 3D9RA 4HM0B 5JPPA 3FF0A 4HJLB 7STDA 1GS3A 5IG3A 1BUQA 3OWUA 2W2CA 3B8LA 4R9KA 4X2OA 1AR0A 4ORLA 4LEHA 3RGAA 3S5CA 1QMAA 2F86B 1GY5A 2JQ5A 3SOAA 5AEUB 1IDPA 1ASKA 3NM2A 2HMNB 2B24B 3JUQA 3T8NA 3E99A 3G8ZA 2BMOB 4L7KA 4XDVA 1E3RA 5IG0A 4WWUC 1O7HB 2HMLB 2INXA 1NDOB 4X2HA 5BVBA 4HZ9B 3MHEA 3G16A 5KP1A 3GZYB 1O7PB 5TGNA 1UUVB 3EN1B 1ISKA 2QGUA 2R4IA 3F8HA 3H51A 1CQSA 2B1XB 2YFIB 5CF2A 3CU3A 3EX9A 1JKGA 3MG1A 4MJDA 1U5OA 1OHSA 4HKVB 3JUOA 2BNGA 3NV0A 3LYGA 2RFRA 1Q42A 2F99A 3UNLA 5AIFA 2XSOB 1UUWB 3F9SA 3OWYA 2K54A 3KKGA 3FF2A 1OGZA 4OVMA 3F7XA 2HMOB 1Q40A 3K7CA 3FGYA 2YFLB 3F7SA 4XB5A 3OX9A 1ZX2A 3NXJA 3NBRA 3JUNA 5AEWB 2RGQA 2XSHB 1W00A 2UX0A 5DRVA 1HKXA 4HM1B 2BMRB 5KP4A 3JUMA 4I4KA 3HZPA 2Z77A 3SOYA 1O7NB 4WYKA 4FCJA 3B4PA 3EN8A 2I9WA 3FLJA 2STDA 1JKGB 3KZTA 2F98A 5AI1A 1E97A 2HMJB 2YFJB 3VSYA 1C7HA 3STDA 1QJGA 1JN5A 2QIYA 1Z1SA 3GWRA 3ECFA 4H3UA 2GBXB 1EA2A 3B7CA 4XBTA
chains in the Genus database with same CATH superfamily
5D83A 1JB2A 1RLSA 1RCLA 1T5YA 3KSPA 1VZZA 4KFEA 5CF1A 4O02B 5IENA 2ML6A 3OXAA 3LZAA 1BNGA 2KF3A 2ZDJA 2HMMB 3AHWA 1Q40B 3ZFZA 1DYUA 3DM8A 3Q3FA 4N6MA 2CKFB 4KT3B 4GSPA 1B3SA 2GEXA 5CK6A 1Q824 1TJDA 1BRGA 3FCSB 4K1UA 3CCL3 4EBGA 1UW1A 1RCKA 4R1KA 2IMJA 3I0YA 1RNBA 2F5WA 1RN4A 4HM4B 4QWTA 1MGWA 1RGHA 3CNMA 1C54A 2LYXA 2XEPA 3KE7A 3F14A 1DMQA 5HGRA 2E2VA 1G96A 1OF5A 5BXQA 5AIGA 5IEOA 4HM7B 3S29A 3EBTA 2XR8B 1F8NA 3LMLA 4HM2B 1GMQA 1TUHA 3ALAA 5IERA 5M1AA 2P38A 3G0KA 1BGSA 5IF6A 3CC73 1UI7A 2D1WA 3EBYA 3SVAA 1S5AA 4XBYA 1O7WB 3CD63 2GXFA 3DXOA 4XBTA 2OWPA 3EB8A 3OW22 1YJW3 1DE3A 3GZBA 1LRAA 3IPTA 4HVNA 1BRNL 3LXUX 3FSDA 1VQ43 2E2UA 2KF4A 2C10A 1N9EA 1NB3I 3FG1A 3JUPA 3HI7A 1YJ93 1VQM3 4R80A 1B2ZA 1OPYA 3CPOA 9RNTA 1W6YA 1OGXA 3BNCA 3G6E3 3NM7A 1V74A 4GB5A 2H0HA 1UDII 3SEDA 3O8YA 4HM5B 4J5KA 3B4OA 2P0XA 1K734 4WHAA 5IG5A 1RNTA 2CFKA 2XFTA 4H61A 4MEIA 5FW5A 1KQS2 2WGOA 1IU7A 2F4YA 3F8XA 4J8TA 3Q2PA 4LGQA 3WOFB 5BU4A 3NUVA 1JJ22 1RDSA 1X1WA 4WP5A 3EQQB 1RGKA 2KF6A 2SBLA 2HMKB 3GRDA 3MYTA 4J9AA 1OH0A 4HM8B 1LOXA 3EF8A 5AIHA 1BNSA 2XF3A 4AEQA 3J7Yd 2CFGA 1I0XA 2IA7A 4XBXA 5D82A 2XH9A 2CG1A 2Z7AA 3WHOA 1JN5B 4N6UA 1X1YA 1T3BA 1RSNA 3K0ZA 1LQGC 4L8OA 1RN1A 1KWIA 1EG9B 1UI8A 3FKAA 3OV4A 3M8CA 3K5TA 2QA43 2FXTA 3BNBA 3BNDA 3FH1A 3FZWA 4Q53A 1A90A 2IUKA 1EQKA 1STDA 3UB1A 3CNXA 4HM3B 1SIHA 1I8VA 1OHPA 1LNHA 2Z76A 3A5EA 3ER7A 1IQ8A 2Y73A 3DMCA 4N6NB 5EVHA 1O7MB 1HZ1A 1IK3A 1O7GB 1RRLA 4JRFA 2C11A 1NNVA 1BVIA 2OQEA 2AADA 1WTHA 1JV2B 5EEOA 4XM4A 1TIJA 3ROBA 2GBWB 1BSAA 1GOVA 1VQ53 3EC9A 1IQYA 2BT3A 2IYJA 4K61A 3KIIA 2W56A 2YX9A 3MG3A 1BNIA 1ZO2A 1WQLB 3KFQC 3BIRA 1YJN3 2Q07A 1CYVA 1CH0A 1W2ZA 1YVBI 3HIGA 4IIAA 1AQZA 4CDLA 3URPA 4RNTA 2QEX3 2HOHA 4LYLB 3CCS3 1AY7A 8RNTA 5M18A 1J2BA 3NV0B 1JBRA 1OF5B 1T2IA 3AHSA 4R4KA 1FW7A 1M1K4 1WMOA 3HOHA 2GU3A 3F40A 3RDEA 3BLZA 4RZMA 2OQEC 2W9PA 4U13A 5IG4A 1TU5A 1YIT3 1TFOA 2Y74A 3D5IA 4CJNA 1SARA 1HU9A 5RNTA 5D81A 1SQWA 5G1LA 4HZBB 4AKZA 1IVVA 1K41A 1NU3A 1US1A 3I553 1VQ93 1TP6A 3N8BA 5LC7A 3RGRA 4GHOA 4FMBA 1BRJA 1X1UA 1ROVA 1R4CA 1EKMA 1QAKA 3DGLA 3LTBA 3VGNA 3DZLA 2A15A 1OACA 3X40A 1DVCA 5DREA 3T8UA 1JB5A 3A76A 5IEPA 5ELJA 1JZDA 1CEWI 1OHOA 3TDGA 1M904 1GMRA 5FGOA 1JB4A 1YHQ3 1QVF2 2WOHA 2F56A 2W04A 1W2B2 3X3XA 1TFKA 1IV7A 4KVHA 1IT8A 1RN7A 1W4NA 2SARA 1W5ZA 4EW5A 3UJMA 1N5HA 2M7OA 4FCMA 1JRQA 3PXMA 4HM6B 3DUKA 3SXXA 4L8PA 4RBNA 4EYCA 1A2KA 1ULJB 3CCM3 5G2GA 1ULIB 1W02A 1RGEA 2RCDA 4LMIA 5JPUA 4K1VA 1W7CA 2CFLA 3DGMA 3EJVA 6STDA 2CHCA 2XRXB 5IW9A 3MG2A 1IQXA 1OUNA 2CFWA 1N8QA 5CXOA 1LNIA 1NWWA 1R4YA 3SLUA 5AYSC 4R9LA 5KP3A 1JZOA 2CX1A 4N3VA 2KAAA 1W01A 1Q864 3H3HA 1FGOA 4PEJA 1PU4A 3MSOA 1L5GB 1GOYA 5STDA 1V58A 2PZVA 1IVWA 1SJWA 2OCTA 3LTCA 2PNCA 1DMMA 3PYJA 4BIRA 1GSPA 2CWVA 2WGQA 4WYKB 3KN4A 1FGMA 3N9HA 1UCKA 2ZA4A 4KFFA 1BU4A 1STFI 5G1KA 7RNTA 1S723 2GEYA 1FA3A 1NB5I 1CYUA 3HX8A 5LC6A 1MNLA 5GSPA 3DY5A 3WOEB 2XGNA 1RGAA 2CIUA 3D5GA 4K90B 3S27A 2BMQB 3K9MC 3GZXB 1GOUA 2MC8A 3EHCA 4STDA 5AIIA 1LOYA 1SIIA 1YGWA 1UUGB 4OUQA 1GY7A 2W56B 5CLKA 1K9M4 1I2GA 4HBRA 4NREA 3NQYA 3UL5A 1DMNA 3NHXA 3WMDA 1OCVA 3BB9A 1MWTA 3CCR3 3IJEB 3OWSA 3DGOA 1EUIC 1FUWA 5ELUA 4KFDA 4JF8A 3U97A 3HK4A 2FGTA 3MKIA 3U1WA 8CHOA 2XFSA 3CC23 1Q7HA 2OTJ3 1B2MA 3CMA3 1GY6A 4NPBA 3WA3A 1GYBA 3GZRA 4XDWA 3V92A 1E3VA 3D9RA 4HM0B 5JPPA 2J8XB 4IT7A 4MMYB 3FF0A 1BSDA 2BO9B 2W9QA 4HJLB 1B27A 3DH2A 2OTL3 1JBTA 2MF7A 7STDA 1GS3A 2P09A 2FNQA 5IG3A 3CCJ3 3OWUA 1BUQA 2W2CA 1BSEA 3B8LA 4R9KA 5AYRB 1IV9A 4EV2A 1YIJ3 4X2OA 1AR0A 1ZS7A 2CX0A 4LZIA 1WMNA 1JBSA 1UCLA 5M19A 3HIIA 4FR9A 1KC84 4DKIA 3MWZA 4ORLA 1Q9EA 3CXC2 2KXGA 3CCQ3 4LEHA 3DGNA 3PCRA 3FG4A 3RGAA 4O2HA 3S5CA 1QMAA 3KSED 2F86B 3X3ZA 1GY5A 2JQ5A 3SOAA 1A67A 4O3VA 2KCDA 3LOYA 4FMCA 3D3LA 5AEUB 1IDPA 3ZG0A 1ASKA 2ZHXB 3NM2A 2CWTA 1RHLA 2AAEA 2HMNB 3D79A 4FMDA 3WR2A 3X42A 1HYFA 1RKYA 2B24B 2BIRA 1EEJA 1G0TA 1KSIA 1UCIA 3E99A 3JUQA 2O9UX 1LOVA 3BNEA 3T8NA 1N9JA 1PYLA 2JDIH 1IVXA 2BMOB 1U8CB 1WNHA 3G8ZA 3G4S3 3FG3A 4L7KA 1BSBA 4XDVA 1E3RA 3VF1A 3N54B 5IG0A 4WWUC 3RNTA 3G713 1O7HB 4IPBA 3X41A 1DETA 2HMLB 2Z6BA 6RNTA 1BOXA 3AMOA 1T2HA 2KRTA 2INXA 2CC3A 1NDOB 2BU4A 3PGBA 4X2HA 5BVBA 1I0VA 4O8SA 4HAAA 2D42A 4HZ9B 4I5QA 1BIRA 3MHEA 3LT9A 3PCSA 3AGOA 4HYZA 3G16A 5KP1A 1BRKA 3GZYB 1VQ83 1A2PA 1O7PB 3BU4A 1A2VA 1Y4KA 4N6TA 5TGNA 5A0OB 1IT7A 1UUVB 4BTXA 1QVG2 1MWUA 1X1XA 3EN1B 3PZWA 1TRPA 4FMAA 1ISKA 1UGIA 2QGUA 3Q1CA 1BUJA 2R4IA 3GSPA 1D6YA 2L1SA 3F8HA 3H51A 1CQSA 2V1LA 4ILFA 2B1XB 1GMPA 2YFIB 5CF2A 1SPUA 4FCZA 1BAOA 1I3IA 3T0UA 3S67A 3I563 2ZL8A 3CU3A 3EX9A 1JKGA 2BHMA 1LXEA 3MG1A 3NBBA 3LH4A 4J5GA 4MJDA 4EC6A 1VQL3 1U5OA 2WO0A 3CME3 4N6V0 1N8R4 1OHSA 1FZUA 1V57A 1M9GA 4HKVB 2CG0A 1LOWA 1ROAA 3JUOA 1RTUA 1I70A 6GSPA 3JVCA 3LTDA 2BNGA 1NJI4 3QK9A 3NV0A 3WODG 1I2EA 2CH9A 1PFPA 1MWRA 1AVKA 2CK3H 3LTAA 1BNJA 2GU1A 2L4VA 3PS8A 4HOHA 1B2UA 2UGIA 1B20A 3LYGA 2O3OA 3EE1A 5JBSA 1JNQA 2RFRA 1N5PA 3S28A 1RGFA 1Q42A 4RNYA 1TTOA 1VQ63 1FGTA 1B2XA 2F5MA 2F99A 3UNLA 1GD3A 1TRQA 5AIFA 2RNTA 2XSOB 1UUWB 3F9SA 3L0RA 3OWYA 4RNZA 2K54A 3KKGA 1BSCA 3FF2A 4MMZB 1OGZA 4OVMA 3F7XA 3DGYA 4GL6A 2HMOB 1Q40A 1QAFA 2CW9A 1UGHI 1W6CA 4EXRA 1UCJA 2CFDA 3SX1A 3K7CA 1M1XB 2R41A 3FGYA 1K28A 1PY3A 2YFLB 3F7SA 1Q7Y4 2OOVA 4G1MB 3CCV3 4XB5A 2GSPA 1FGQA 3OX9A 3CC43 1GD4A 1ZX2A 1LVNA 1MWSA 1RGCA 1ZGXA 2RBIA 3UL6A 5I97A 3CPW2 3WA2X 3X3YA 3MPHA 3NBRA 3NXJA 4LSOA 1FGRA 3JUNA 2W0QA 5AEWB 4BL3A 1RGGA 2RGQA 2E2TA 2XSHB 4ZM8A 3CCE3 1W00A 3AMOB 1I3FA 1G02A 1YGEA 3K63A 1BRSA 2C4BA 1AVLA 2UX0A 1AV4A 1VQK3 1QALA 1KD14 1IVUA 5DRVA 2H0GA 1BNFA 1HKXA 4HM1B 1MGRA 5BIRA 2BMRB 1D6UA 3NQZA 2UUGC 4N6LA 5KP4A 2WOFA 1VQO3 1BRHA 1NO3A 2OOVC 3JUMA 1LQMB 4I4KA 3HZPA 4BL2A 2Z77A 3SOYA 1O7NB 1BNRA 1YNVX 1D6ZA 3NBJA 4FCJA 4WYKA 3QRDA 4KZ1A 3SYUA 3NX0A 3B4PA 1VQP3 3EN8A 2I9WA 3FLJA 4MMXB 2STDA 4WFOA 4EV5A 1FYSA 3AGNA 1RMSA 3V98A 4CCVA 1JKGB 2ML5A 1BANA 1B21A 4BTYA 2CWUA 1DVDA 1YVSA 2IUJA 3KZTA 2F98A 2XGLA 2P05A 2W03A 5AI1A 4NHFA 3CCU3 3LT8A 4N6OB 4OK0A 3V99A 1E97A 2HMJB 5HOHA 1FUSA 4CPKA 1K8A4 3WDGB 2LQVA 2YFJB 1YI23 3D4AA 3VSYA 2P0MA 3GAXA 1C7HA 5EQLA 3STDA 1QJGA 4BTWA 1VQQA 4BU4A 1JN5A 7GSPA 1FUTA 1VQN3 2KF5A 1BRIA 2QIYA 1Z1SA 2RSXA 2K0MA 1B2SA 3GWRA 1RGLA 3ECFA 1MOLA 1RJOA 1RRHA 2IY2A 1BNEA 4AKYA 1VQ73 3KCHA 1Q814 4H3UA 2K3DA 2GBXB 2W6JH 1EA2A 1IYYA 2H0IA 3B7CA 1W6GA 1WMPA 3IMAB 4TX4A 3ZG5A 3Q90A 1I2FA
chains in the Genus database with same CATH topology
5D83A 1JB2A 5CF1A 1T5YA 3KSPA 4KFEA 1VZZA 5IENA 4O02B 2ML6A 3OXAA 3LZAA 2ZDJA 2HMMB 1Q40B 1DYUA 3DM8A 4N6MA 2CKFB 2GEXA 5CK6A 1Q824 3FCSB 4K1UA 3CCL3 4EBGA 1UW1A 4R1KA 2IMJA 3I0YA 4HM4B 4QWTA 3CNMA 2LYXA 2XEPA 3KE7A 3F14A 1DMQA 5HGRA 2E2VA 1G96A 1OF5A 5BXQA 5AIGA 5IEOA 4HM7B 3S29A 3EBTA 2XR8B 1F8NA 3LMLA 4HM2B 1TUHA 3ALAA 5IERA 2P38A 3G0KA 5IF6A 3CC73 1UI7A 2D1WA 3EBYA 3SVAA 1S5AA 4XBYA 1O7WB 3CD63 2GXFA 3DXOA 4XBTA 2OWPA 3EB8A 3OW22 1YJW3 3GZBA 3IPTA 4HVNA 3LXUX 3FSDA 1VQ43 2E2UA 2C10A 1N9EA 1NB3I 3FG1A 3JUPA 3HI7A 1YJ93 1VQM3 4R80A 1OPYA 3CPOA 1W6YA 1OGXA 3BNCA 3G6E3 3NM7A 1V74A 4GB5A 3SEDA 3O8YA 4HM5B 3B4OA 2P0XA 1K734 4WHAA 5IG5A 2CFKA 2XFTA 4H61A 4MEIA 5FW5A 1KQS2 2WGOA 1IU7A 3F8XA 4J8TA 3Q2PA 4LGQA 3WOFB 3NUVA 1JJ22 4WP5A 3EQQB 2SBLA 2HMKB 3GRDA 3MYTA 4J9AA 1OH0A 4HM8B 1LOXA 3EF8A 5AIHA 2XF3A 4AEQA 3J7Yd 2CFGA 2IA7A 4XBXA 5D82A 2XH9A 2CG1A 2Z7AA 1JN5B 4N6UA 3K0ZA 4L8OA 1KWIA 1EG9B 1UI8A 3FKAA 3OV4A 3M8CA 3K5TA 2QA43 2FXTA 3BNBA 3BNDA 3FH1A 3FZWA 4Q53A 1A90A 2IUKA 1EQKA 1STDA 3UB1A 3CNXA 4HM3B 1SIHA 1OHPA 1LNHA 2Z76A 3ER7A 1IQ8A 2Y73A 3DMCA 4N6NB 5EVHA 1O7MB 1IK3A 1O7GB 1RRLA 4JRFA 2C11A 2OQEA 1WTHA 1JV2B 5EEOA 4XM4A 1TIJA 3ROBA 2GBWB 1VQ53 3EC9A 1IQYA 2BT3A 4K61A 3KIIA 2W56A 2YX9A 3MG3A 1ZO2A 1WQLB 3KFQC 1YJN3 2Q07A 1CYVA 1W2ZA 1YVBI 3HIGA 4IIAA 4CDLA 2QEX3 1J2BA 3NV0B 1OF5B 4R4KA 1M1K4 1WMOA 2GU3A 3F40A 3RDEA 3BLZA 4RZMA 2OQEC 2W9PA 4U13A 5IG4A 1TU5A 1YIT3 1TFOA 2Y74A 1HU9A 5D81A 1SQWA 3I553 4HZBB 4AKZA 1IVVA 1K41A 1NU3A 1US1A 1VQ93 1TP6A 3N8BA 5LC7A 3RGRA 4FMBA 1ROVA 1R4CA 1EKMA 1QAKA 3DGLA 3LTBA 3VGNA 3DZLA 2A15A 1OACA 3X40A 1DVCA 5DREA 3T8UA 1JB5A 3A76A 5IEPA 5ELJA 1CEWI 1OHOA 3TDGA 1M904 5FGOA 1JB4A 1YHQ3 1QVF2 2WOHA 2W04A 1W2B2 3X3XA 1TFKA 1IV7A 4KVHA 1IT8A 1RN7A 1W4NA 1W5ZA 3UJMA 1N5HA 2M7OA 4FCMA 1JRQA 3PXMA 4HM6B 3DUKA 3SXXA 4L8PA 4RBNA 4EYCA 1A2KA 1ULJB 3CCM3 5G2GA 1ULIB 1W02A 5JPUA 2RCDA 4LMIA 4K1VA 1W7CA 2CFLA 3DGMA 3EJVA 6STDA 2CHCA 2XRXB 5IW9A 3MG2A 1IQXA 1OUNA 2CFWA 1N8QA 5CXOA 1NWWA 3SLUA 5AYSC 4R9LA 5KP3A 4N3VA 1W01A 1Q864 3H3HA 1FGOA 4PEJA 1PU4A 3MSOA 1L5GB 5STDA 2PZVA 1IVWA 1SJWA 2OCTA 3LTCA 2PNCA 1DMMA 3PYJA 2CWVA 2WGQA 4WYKB 3KN4A 1FGMA 3N9HA 4KFFA 1STFI 1S723 2GEYA 1FA3A 1NB5I 1CYUA 3HX8A 5LC6A 1MNLA 3DY5A 3WOEB 2XGNA 3S27A 2CIUA 4K90B 2BMQB 3K9MC 3GZXB 2MC8A 3EHCA 4STDA 5AIIA 1SIIA 4OUQA 1GY7A 2W56B 5CLKA 1K9M4 4HBRA 4NREA 3NQYA 3UL5A 1DMNA 3NHXA 3WMDA 1OCVA 3BB9A 3CCR3 3IJEB 3OWSA 3DGOA 1FUWA 5ELUA 4KFDA 4JF8A 3U97A 3HK4A 2FGTA 3MKIA 3U1WA 8CHOA 2XFSA 3CC23 2OTJ3 3CMA3 1GY6A 3WA3A 1GYBA 3GZRA 4XDWA 3V92A 1E3VA 3D9RA 4HM0B 5JPPA 4IT7A 4MMYB 3FF0A 4HJLB 2BO9B 2W9QA 2OTL3 2MF7A 7STDA 1GS3A 2P09A 2FNQA 5IG3A 3CCJ3 3OWUA 1BUQA 2W2CA 3B8LA 4R9KA 5AYRB 1IV9A 4EV2A 1YIJ3 4X2OA 1AR0A 4LZIA 1WMNA 3HIIA 4FR9A 1KC84 3MWZA 4ORLA 3CCQ3 3CXC2 2KXGA 4LEHA 3DGNA 3PCRA 3FG4A 3RGAA 4O2HA 3S5CA 1QMAA 3KSED 2F86B 3X3ZA 1GY5A 2JQ5A 3SOAA 1A67A 4O3VA 2KCDA 3LOYA 4FMCA 3D3LA 5AEUB 1IDPA 1ASKA 3NM2A 2CWTA 2HMNB 4FMDA 3X42A 1RKYA 2B24B 1KSIA 3JUQA 3E99A 3T8NA 3CCS3 2O9UX 3BNEA 1N9JA 2JDIH 1IVXA 2BMOB 1U8CB 1WNHA 3G8ZA 3G4S3 3FG3A 4L7KA 4XDVA 1E3RA 3VF1A 3N54B 5IG0A 4WWUC 3G713 1O7HB 4IPBA 3X41A 2HMLB 2Z6BA 3AMOA 2KRTA 2INXA 2CC3A 1NDOB 3PGBA 4X2HA 5BVBA 4O8SA 2D42A 4HZ9B 3MHEA 3LT9A 3PCSA 4HYZA 3G16A 5KP1A 3GZYB 1VQ83 1O7PB 1A2VA 1Y4KA 4N6TA 5TGNA 5A0OB 1IT7A 1UUVB 4BTXA 1QVG2 3EN1B 3PZWA 4FMAA 1ISKA 2QGUA 3Q1CA 2R4IA 1D6YA 3F8HA 3H51A 1CQSA 2V1LA 2B1XB 2YFIB 5CF2A 1SPUA 4FCZA 3T0UA 3I563 3S67A 2ZL8A 3CU3A 3EX9A 1JKGA 2BHMA 1LXEA 3MG1A 3NBBA 3LH4A 4MJDA 4EC6A 1VQL3 1U5OA 2WO0A 3CME3 4N6V0 1N8R4 1OHSA 1M9GA 4HKVB 2CG0A 1ROAA 3JUOA 3JVCA 3LTDA 2BNGA 1NJI4 3QK9A 3NV0A 3WODG 2CH9A 1PFPA 3LTAA 1AVKA 2CK3H 2GU1A 2L4VA 3PS8A 3LYGA 2O3OA 3EE1A 5JBSA 1JNQA 2RFRA 1N5PA 3S28A 1Q42A 4RNYA 1VQ63 1FGTA 2F99A 3UNLA 1GD3A 5AIFA 2XSOB 1UUWB 3F9SA 3L0RA 3OWYA 4RNZA 2K54A 3KKGA 3FF2A 4MMZB 1OGZA 4OVMA 3F7XA 4GL6A 2HMOB 1Q40A 1QAFA 2CW9A 1W6CA 4EXRA 2CFDA 3SX1A 3K7CA 1M1XB 3FGYA 1K28A 2YFLB 3F7SA 1Q7Y4 2OOVA 4G1MB 3CCV3 4XB5A 3OX9A 1FGQA 3CC43 1GD4A 1ZX2A 1LVNA 5I97A 3UL6A 3CPW2 3WA2X 3X3YA 3MPHA 3NBRA 3NXJA 4LSOA 1FGRA 3JUNA 2W0QA 5AEWB 2RGQA 2E2TA 2XSHB 4ZM8A 3CCE3 1W00A 3AMOB 1YGEA 3K63A 2UX0A 1AVLA 1AV4A 1VQK3 1QALA 1KD14 1IVUA 5DRVA 1HKXA 4HM1B 2BMRB 1D6UA 3NQZA 4N6LA 5KP4A 2WOFA 1VQO3 1NO3A 2OOVC 3JUMA 4I4KA 3HZPA 2Z77A 3SOYA 1O7NB 1D6ZA 3NBJA 4FCJA 4WYKA 3QRDA 4KZ1A 3NX0A 3B4PA 1VQP3 3EN8A 2I9WA 3FLJA 4MMXB 2STDA 4WFOA 4EV5A 3V98A 4CCVA 1JKGB 2ML5A 4BTYA 2CWUA 1DVDA 2IUJA 3KZTA 2F98A 2XGLA 2P05A 2W03A 5AI1A 4NHFA 3CCU3 3LT8A 4N6OB 4OK0A 3V99A 1E97A 2HMJB 1K8A4 3WDGB 2LQVA 2YFJB 1YI23 3VSYA 2P0MA 3GAXA 1C7HA 5EQLA 3STDA 1QJGA 4BTWA 1JN5A 1VQN3 2QIYA 1Z1SA 2RSXA 2K0MA 3GWRA 3ECFA 1MOLA 1RJOA 1RRHA 4AKYA 1VQ73 1Q814 4H3UA 2GBXB 2W6JH 1EA2A 3B7CA 1W6GA 1WMPA 3IMAB 4TX4A 3Q90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D83 A;  1JB2 A;  5CF1 A;  5IEN A;  3KSP A;  1VZZ A;  3OXA A;  3LZA A;  2HMM B;  1Q40 B;  3DM8 A;  2CKF B;  2GEX A;  5CK6 A;  4K1U A;  4R1K A;  2IMJ A;  3I0Y A;  4HM4 B;  3CNM A;  3KE7 A;  3F14 A;  1DMQ A;  5HGR A;  5BXQ A;  1OF5 A;  5AIG A;  5IEO A;  4HM7 B;  3EBT A;  2XR8 B;  4HM2 B;  1TUH A;  5IER A;  3G0K A;  5IF6 A;  3EBY A;  1S5A A;  4XBY A;  1O7W B;  2GXF A;  3DXO A;  2OWP A;  3GZB A;  3IPT A;  4HVN A;  3FSD A;  3JUP A;  1OPY A;  3CPO A;  1W6Y A;  1OGX A;  4GB5 A;  3SED A;  4HM5 B;  3B4O A;  5IG5 A;  5FW5 A;  3F8X A;  4J8T A;  4LGQ A;  3NUV A;  4WP5 A;  3EQQ B;  2HMK B;  3GRD A;  3MYT A;  4J9A A;  1OH0 A;  4HM8 B;  3EF8 A;  5AIH A;  4XBX A;  5D82 A;  2Z7A A;  1JN5 B;  3K0Z A;  4L8O A;  1EG9 B;  3FKA A;  3OV4 A;  3M8C A;  3FH1 A;  3FZW A;  4Q53 A;  1STD A;  3CNX A;  4HM3 B;  1OHP A;  2Z76 A;  3ER7 A;  3DMC A;  5EVH A;  1O7M B;  1O7G B;  4XM4 A;  3ROB A;  2GBW B;  3EC9 A;  3MG3 A;  1ZO2 A;  1WQL B;  4CDL A;  4IIA A;  3NV0 B;  1OF5 B;  3F40 A;  3BLZ A;  4RZM A;  4U13 A;  5IG4 A;  5D81 A;  4HZB B;  1NU3 A;  1K41 A;  1TP6 A;  3RGR A;  3VGN A;  3DZL A;  2A15 A;  5DRE A;  3T8U A;  1JB5 A;  3A76 A;  5IEP A;  1OHO A;  1JB4 A;  4KVH A;  3UJM A;  4FCM A;  4HM6 B;  3DUK A;  4L8P A;  1A2K A;  1ULJ B;  5G2G A;  1ULI B;  1W02 A;  5JPU A;  2RCD A;  4LMI A;  4K1V A;  3EJV A;  6STD A;  2CHC A;  2XRX B;  3MG2 A;  5CXO A;  1OUN A;  1NWW A;  4R9L A;  5KP3 A;  4N3V A;  1W01 A;  3H3H A;  4PEJ A;  3MSO A;  5STD A;  2PZV A;  1SJW A;  1DMM A;  4WYK B;  2GEY A;  3HX8 A;  2BMQ B;  3GZX B;  3EHC A;  3Q90 A;  4STD A;  5AII A;  4OUQ A;  1GY7 A;  5CLK A;  3WMD A;  1DMN A;  3NHX A;  1OCV A;  3BB9 A;  3OWS A;  3HK4 A;  3MKI A;  8CHO A;  1GY6 A;  1GYB A;  3GZR A;  4XDW A;  1E3V A;  3D9R A;  4HM0 B;  5JPP A;  3FF0 A;  4HJL B;  7STD A;  1GS3 A;  5IG3 A;  1BUQ A;  3OWU A;  2W2C A;  3B8L A;  4R9K A;  4X2O A;  1AR0 A;  4ORL A;  4LEH A;  3RGA A;  3S5C A;  1QMA A;  2F86 B;  1GY5 A;  2JQ5 A;  3SOA A;  5AEU B;  1IDP A;  1ASK A;  3NM2 A;  2HMN B;  2B24 B;  3JUQ A;  3T8N A;  3E99 A;  3G8Z A;  2BMO B;  4L7K A;  4XDV A;  1E3R A;  5IG0 A;  4WWU C;  1O7H B;  2HML B;  2INX A;  1NDO B;  4X2H A;  5BVB A;  4HZ9 B;  3MHE A;  3G16 A;  5KP1 A;  3GZY B;  1O7P B;  5TGN A;  1UUV B;  3EN1 B;  1ISK A;  2QGU A;  2R4I A;  3F8H A;  3H51 A;  1CQS A;  2B1X B;  2YFI B;  5CF2 A;  3CU3 A;  3EX9 A;  1JKG A;  3MG1 A;  4MJD A;  1U5O A;  1OHS A;  4HKV B;  3JUO A;  2BNG A;  3NV0 A;  3LYG A;  2RFR A;  1Q42 A;  2F99 A;  3UNL A;  5AIF A;  2XSO B;  1UUW B;  3F9S A;  3OWY A;  2K54 A;  3KKG A;  3FF2 A;  1OGZ A;  4OVM A;  3F7X A;  2HMO B;  1Q40 A;  3K7C A;  3FGY A;  2YFL B;  3F7S A;  4XB5 A;  3OX9 A;  1ZX2 A;  3NXJ A;  3NBR A;  3JUN A;  5AEW B;  2RGQ A;  2XSH B;  1W00 A;  2UX0 A;  5DRV A;  1HKX A;  4HM1 B;  2BMR B;  5KP4 A;  3JUM A;  4I4K A;  3HZP A;  2Z77 A;  3SOY A;  1O7N B;  4WYK A;  4FCJ A;  3B4P A;  3EN8 A;  2I9W A;  3FLJ A;  2STD A;  1JKG B;  3KZT A;  2F98 A;  5AI1 A;  1E97 A;  2HMJ B;  2YFJ B;  3VSY A;  1C7H A;  3STD A;  1QJG A;  1JN5 A;  2QIY A;  1Z1S A;  3GWR A;  3ECF A;  4H3U A;  2GBX B;  1EA2 A;  3B7C A;  4XBT A; 
#chains in the Genus database with same CATH topology
 5D83 A;  1JB2 A;  1RLS A;  1RCL A;  1T5Y A;  3KSP A;  1VZZ A;  4KFE A;  5CF1 A;  4O02 B;  5IEN A;  2ML6 A;  3OXA A;  3LZA A;  1BNG A;  2KF3 A;  2ZDJ A;  2HMM B;  3AHW A;  1Q40 B;  3ZFZ A;  1DYU A;  3DM8 A;  3Q3F A;  4N6M A;  2CKF B;  4KT3 B;  4GSP A;  1B3S A;  2GEX A;  5CK6 A;  1Q82 4;  1TJD A;  1BRG A;  3FCS B;  4K1U A;  3CCL 3;  4EBG A;  1UW1 A;  1RCK A;  4R1K A;  2IMJ A;  3I0Y A;  1RNB A;  2F5W A;  1RN4 A;  4HM4 B;  4QWT A;  1MGW A;  1RGH A;  3CNM A;  1C54 A;  2LYX A;  2XEP A;  3KE7 A;  3F14 A;  1DMQ A;  5HGR A;  2E2V A;  1G96 A;  1OF5 A;  5BXQ A;  5AIG A;  5IEO A;  4HM7 B;  3S29 A;  3EBT A;  2XR8 B;  1F8N A;  3LML A;  4HM2 B;  1GMQ A;  1TUH A;  3ALA A;  5IER A;  5M1A A;  2P38 A;  3G0K A;  1BGS A;  5IF6 A;  3CC7 3;  1UI7 A;  2D1W A;  3EBY A;  3SVA A;  1S5A A;  4XBY A;  1O7W B;  3CD6 3;  2GXF A;  3DXO A;  4XBT A;  2OWP A;  3EB8 A;  3OW2 2;  1YJW 3;  1DE3 A;  3GZB A;  1LRA A;  3IPT A;  4HVN A;  1BRN L;  3LXU X;  3FSD A;  1VQ4 3;  2E2U A;  2KF4 A;  2C10 A;  1N9E A;  1NB3 I;  3FG1 A;  3JUP A;  3HI7 A;  1YJ9 3;  1VQM 3;  4R80 A;  1B2Z A;  1OPY A;  3CPO A;  9RNT A;  1W6Y A;  1OGX A;  3BNC A;  3G6E 3;  3NM7 A;  1V74 A;  4GB5 A;  2H0H A;  1UDI I;  3SED A;  3O8Y A;  4HM5 B;  4J5K A;  3B4O A;  2P0X A;  1K73 4;  4WHA A;  5IG5 A;  1RNT A;  2CFK A;  2XFT A;  4H61 A;  4MEI A;  5FW5 A;  1KQS 2;  2WGO A;  1IU7 A;  2F4Y A;  3F8X A;  4J8T A;  3Q2P A;  4LGQ A;  3WOF B;  5BU4 A;  3NUV A;  1JJ2 2;  1RDS A;  1X1W A;  4WP5 A;  3EQQ B;  1RGK A;  2KF6 A;  2SBL A;  2HMK B;  3GRD A;  3MYT A;  4J9A A;  1OH0 A;  4HM8 B;  1LOX A;  3EF8 A;  5AIH A;  1BNS A;  2XF3 A;  4AEQ A;  3J7Y d;  2CFG A;  1I0X A;  2IA7 A;  4XBX A;  5D82 A;  2XH9 A;  2CG1 A;  2Z7A A;  3WHO A;  1JN5 B;  4N6U A;  1X1Y A;  1T3B A;  1RSN A;  3K0Z A;  1LQG C;  4L8O A;  1RN1 A;  1KWI A;  1EG9 B;  1UI8 A;  3FKA A;  3OV4 A;  3M8C A;  3K5T A;  2QA4 3;  2FXT A;  3BNB A;  3BND A;  3FH1 A;  3FZW A;  4Q53 A;  1A90 A;  2IUK A;  1EQK A;  1STD A;  3UB1 A;  3CNX A;  4HM3 B;  1SIH A;  1I8V A;  1OHP A;  1LNH A;  2Z76 A;  3A5E A;  3ER7 A;  1IQ8 A;  2Y73 A;  3DMC A;  4N6N B;  5EVH A;  1O7M B;  1HZ1 A;  1IK3 A;  1O7G B;  1RRL A;  4JRF A;  2C11 A;  1NNV A;  1BVI A;  2OQE A;  2AAD A;  1WTH A;  1JV2 B;  5EEO A;  4XM4 A;  1TIJ A;  3ROB A;  2GBW B;  1BSA A;  1GOV A;  1VQ5 3;  3EC9 A;  1IQY A;  2BT3 A;  2IYJ A;  4K61 A;  3KII A;  2W56 A;  2YX9 A;  3MG3 A;  1BNI A;  1ZO2 A;  1WQL B;  3KFQ C;  3BIR A;  1YJN 3;  2Q07 A;  1CYV A;  1CH0 A;  1W2Z A;  1YVB I;  3HIG A;  4IIA A;  1AQZ A;  4CDL A;  3URP A;  4RNT A;  2QEX 3;  2HOH A;  4LYL B;  3CCS 3;  1AY7 A;  8RNT A;  5M18 A;  1J2B A;  3NV0 B;  1JBR A;  1OF5 B;  1T2I A;  3AHS A;  4R4K A;  1FW7 A;  1M1K 4;  1WMO A;  3HOH A;  2GU3 A;  3F40 A;  3RDE A;  3BLZ A;  4RZM A;  2OQE C;  2W9P A;  4U13 A;  5IG4 A;  1TU5 A;  1YIT 3;  1TFO A;  2Y74 A;  3D5I A;  4CJN A;  1SAR A;  1HU9 A;  5RNT A;  5D81 A;  1SQW A;  5G1L A;  4HZB B;  4AKZ A;  1IVV A;  1K41 A;  1NU3 A;  1US1 A;  3I55 3;  1VQ9 3;  1TP6 A;  3N8B A;  5LC7 A;  3RGR A;  4GHO A;  4FMB A;  1BRJ A;  1X1U A;  1ROV A;  1R4C A;  1EKM A;  1QAK A;  3DGL A;  3LTB A;  3VGN A;  3DZL A;  2A15 A;  1OAC A;  3X40 A;  1DVC A;  5DRE A;  3T8U A;  1JB5 A;  3A76 A;  5IEP A;  5ELJ A;  1JZD A;  1CEW I;  1OHO A;  3TDG A;  1M90 4;  1GMR A;  5FGO A;  1JB4 A;  1YHQ 3;  1QVF 2;  2WOH A;  2F56 A;  2W04 A;  1W2B 2;  3X3X A;  1TFK A;  1IV7 A;  4KVH A;  1IT8 A;  1RN7 A;  1W4N A;  2SAR A;  1W5Z A;  4EW5 A;  3UJM A;  1N5H A;  2M7O A;  4FCM A;  1JRQ A;  3PXM A;  4HM6 B;  3DUK A;  3SXX A;  4L8P A;  4RBN A;  4EYC A;  1A2K A;  1ULJ B;  3CCM 3;  5G2G A;  1ULI B;  1W02 A;  1RGE A;  2RCD A;  4LMI A;  5JPU A;  4K1V A;  1W7C A;  2CFL A;  3DGM A;  3EJV A;  6STD A;  2CHC A;  2XRX B;  5IW9 A;  3MG2 A;  1IQX A;  1OUN A;  2CFW A;  1N8Q A;  5CXO A;  1LNI A;  1NWW A;  1R4Y A;  3SLU A;  5AYS C;  4R9L A;  5KP3 A;  1JZO A;  2CX1 A;  4N3V A;  2KAA A;  1W01 A;  1Q86 4;  3H3H A;  1FGO A;  4PEJ A;  1PU4 A;  3MSO A;  1L5G B;  1GOY A;  5STD A;  1V58 A;  2PZV A;  1IVW A;  1SJW A;  2OCT A;  3LTC A;  2PNC A;  1DMM A;  3PYJ A;  4BIR A;  1GSP A;  2CWV A;  2WGQ A;  4WYK B;  3KN4 A;  1FGM A;  3N9H A;  1UCK A;  2ZA4 A;  4KFF A;  1BU4 A;  1STF I;  5G1K A;  7RNT A;  1S72 3;  2GEY A;  1FA3 A;  1NB5 I;  1CYU A;  3HX8 A;  5LC6 A;  1MNL A;  5GSP A;  3DY5 A;  3WOE B;  2XGN A;  1RGA A;  2CIU A;  3D5G A;  4K90 B;  3S27 A;  2BMQ B;  3K9M C;  3GZX B;  1GOU A;  2MC8 A;  3EHC A;  4STD A;  5AII A;  1LOY A;  1SII A;  1YGW A;  1UUG B;  4OUQ A;  1GY7 A;  2W56 B;  5CLK A;  1K9M 4;  1I2G A;  4HBR A;  4NRE A;  3NQY A;  3UL5 A;  1DMN A;  3NHX A;  3WMD A;  1OCV A;  3BB9 A;  1MWT A;  3CCR 3;  3IJE B;  3OWS A;  3DGO A;  1EUI C;  1FUW A;  5ELU A;  4KFD A;  4JF8 A;  3U97 A;  3HK4 A;  2FGT A;  3MKI A;  3U1W A;  8CHO A;  2XFS A;  3CC2 3;  1Q7H A;  2OTJ 3;  1B2M A;  3CMA 3;  1GY6 A;  4NPB A;  3WA3 A;  1GYB A;  3GZR A;  4XDW A;  3V92 A;  1E3V A;  3D9R A;  4HM0 B;  5JPP A;  2J8X B;  4IT7 A;  4MMY B;  3FF0 A;  1BSD A;  2BO9 B;  2W9Q A;  4HJL B;  1B27 A;  3DH2 A;  2OTL 3;  1JBT A;  2MF7 A;  7STD A;  1GS3 A;  2P09 A;  2FNQ A;  5IG3 A;  3CCJ 3;  3OWU A;  1BUQ A;  2W2C A;  1BSE A;  3B8L A;  4R9K A;  5AYR B;  1IV9 A;  4EV2 A;  1YIJ 3;  4X2O A;  1AR0 A;  1ZS7 A;  2CX0 A;  4LZI A;  1WMN A;  1JBS A;  1UCL A;  5M19 A;  3HII A;  4FR9 A;  1KC8 4;  4DKI A;  3MWZ A;  4ORL A;  1Q9E A;  3CXC 2;  2KXG A;  3CCQ 3;  4LEH A;  3DGN A;  3PCR A;  3FG4 A;  3RGA A;  4O2H A;  3S5C A;  1QMA A;  3KSE D;  2F86 B;  3X3Z A;  1GY5 A;  2JQ5 A;  3SOA A;  1A67 A;  4O3V A;  2KCD A;  3LOY A;  4FMC A;  3D3L A;  5AEU B;  1IDP A;  3ZG0 A;  1ASK A;  2ZHX B;  3NM2 A;  2CWT A;  1RHL A;  2AAE A;  2HMN B;  3D79 A;  4FMD A;  3WR2 A;  3X42 A;  1HYF A;  1RKY A;  2B24 B;  2BIR A;  1EEJ A;  1G0T A;  1KSI A;  1UCI A;  3E99 A;  3JUQ A;  2O9U X;  1LOV A;  3BNE A;  3T8N A;  1N9J A;  1PYL A;  2JDI H;  1IVX A;  2BMO B;  1U8C B;  1WNH A;  3G8Z A;  3G4S 3;  3FG3 A;  4L7K A;  1BSB A;  4XDV A;  1E3R A;  3VF1 A;  3N54 B;  5IG0 A;  4WWU C;  3RNT A;  3G71 3;  1O7H B;  4IPB A;  3X41 A;  1DET A;  2HML B;  2Z6B A;  6RNT A;  1BOX A;  3AMO A;  1T2H A;  2KRT A;  2INX A;  2CC3 A;  1NDO B;  2BU4 A;  3PGB A;  4X2H A;  5BVB A;  1I0V A;  4O8S A;  4HAA A;  2D42 A;  4HZ9 B;  4I5Q A;  1BIR A;  3MHE A;  3LT9 A;  3PCS A;  3AGO A;  4HYZ A;  3G16 A;  5KP1 A;  1BRK A;  3GZY B;  1VQ8 3;  1A2P A;  1O7P B;  3BU4 A;  1A2V A;  1Y4K A;  4N6T A;  5TGN A;  5A0O B;  1IT7 A;  1UUV B;  4BTX A;  1QVG 2;  1MWU A;  1X1X A;  3EN1 B;  3PZW A;  1TRP A;  4FMA A;  1ISK A;  1UGI A;  2QGU A;  3Q1C A;  1BUJ A;  2R4I A;  3GSP A;  1D6Y A;  2L1S A;  3F8H A;  3H51 A;  1CQS A;  2V1L A;  4ILF A;  2B1X B;  1GMP A;  2YFI B;  5CF2 A;  1SPU A;  4FCZ A;  1BAO A;  1I3I A;  3T0U A;  3S67 A;  3I56 3;  2ZL8 A;  3CU3 A;  3EX9 A;  1JKG A;  2BHM A;  1LXE A;  3MG1 A;  3NBB A;  3LH4 A;  4J5G A;  4MJD A;  4EC6 A;  1VQL 3;  1U5O A;  2WO0 A;  3CME 3;  4N6V 0;  1N8R 4;  1OHS A;  1FZU A;  1V57 A;  1M9G A;  4HKV B;  2CG0 A;  1LOW A;  1ROA A;  3JUO A;  1RTU A;  1I70 A;  6GSP A;  3JVC A;  3LTD A;  2BNG A;  1NJI 4;  3QK9 A;  3NV0 A;  3WOD G;  1I2E A;  2CH9 A;  1PFP A;  1MWR A;  1AVK A;  2CK3 H;  3LTA A;  1BNJ A;  2GU1 A;  2L4V A;  3PS8 A;  4HOH A;  1B2U A;  2UGI A;  1B20 A;  3LYG A;  2O3O A;  3EE1 A;  5JBS A;  1JNQ A;  2RFR A;  1N5P A;  3S28 A;  1RGF A;  1Q42 A;  4RNY A;  1TTO A;  1VQ6 3;  1FGT A;  1B2X A;  2F5M A;  2F99 A;  3UNL A;  1GD3 A;  1TRQ A;  5AIF A;  2RNT A;  2XSO B;  1UUW B;  3F9S A;  3L0R A;  3OWY A;  4RNZ A;  2K54 A;  3KKG A;  1BSC A;  3FF2 A;  4MMZ B;  1OGZ A;  4OVM A;  3F7X A;  3DGY A;  4GL6 A;  2HMO B;  1Q40 A;  1QAF A;  2CW9 A;  1UGH I;  1W6C A;  4EXR A;  1UCJ A;  2CFD A;  3SX1 A;  3K7C A;  1M1X B;  2R41 A;  3FGY A;  1K28 A;  1PY3 A;  2YFL B;  3F7S A;  1Q7Y 4;  2OOV A;  4G1M B;  3CCV 3;  4XB5 A;  2GSP A;  1FGQ A;  3OX9 A;  3CC4 3;  1GD4 A;  1ZX2 A;  1LVN A;  1MWS A;  1RGC A;  1ZGX A;  2RBI A;  3UL6 A;  5I97 A;  3CPW 2;  3WA2 X;  3X3Y A;  3MPH A;  3NBR A;  3NXJ A;  4LSO A;  1FGR A;  3JUN A;  2W0Q A;  5AEW B;  4BL3 A;  1RGG A;  2RGQ A;  2E2T A;  2XSH B;  4ZM8 A;  3CCE 3;  1W00 A;  3AMO B;  1I3F A;  1G02 A;  1YGE A;  3K63 A;  1BRS A;  2C4B A;  1AVL A;  2UX0 A;  1AV4 A;  1VQK 3;  1QAL A;  1KD1 4;  1IVU A;  5DRV A;  2H0G A;  1BNF A;  1HKX A;  4HM1 B;  1MGR A;  5BIR A;  2BMR B;  1D6U A;  3NQZ A;  2UUG C;  4N6L A;  5KP4 A;  2WOF A;  1VQO 3;  1BRH A;  1NO3 A;  2OOV C;  3JUM A;  1LQM B;  4I4K A;  3HZP A;  4BL2 A;  2Z77 A;  3SOY A;  1O7N B;  1BNR A;  1YNV X;  1D6Z A;  3NBJ A;  4FCJ A;  4WYK A;  3QRD A;  4KZ1 A;  3SYU A;  3NX0 A;  3B4P A;  1VQP 3;  3EN8 A;  2I9W A;  3FLJ A;  4MMX B;  2STD A;  4WFO A;  4EV5 A;  1FYS A;  3AGN A;  1RMS A;  3V98 A;  4CCV A;  1JKG B;  2ML5 A;  1BAN A;  1B21 A;  4BTY A;  2CWU A;  1DVD A;  1YVS A;  2IUJ A;  3KZT A;  2F98 A;  2XGL A;  2P05 A;  2W03 A;  5AI1 A;  4NHF A;  3CCU 3;  3LT8 A;  4N6O B;  4OK0 A;  3V99 A;  1E97 A;  2HMJ B;  5HOH A;  1FUS A;  4CPK A;  1K8A 4;  3WDG B;  2LQV A;  2YFJ B;  1YI2 3;  3D4A A;  3VSY A;  2P0M A;  3GAX A;  1C7H A;  5EQL A;  3STD A;  1QJG A;  4BTW A;  1VQQ A;  4BU4 A;  1JN5 A;  7GSP A;  1FUT A;  1VQN 3;  2KF5 A;  1BRI A;  2QIY A;  1Z1S A;  2RSX A;  2K0M A;  1B2S A;  3GWR A;  1RGL A;  3ECF A;  1MOL A;  1RJO A;  1RRH A;  2IY2 A;  1BNE A;  4AKY A;  1VQ7 3;  3KCH A;  1Q81 4;  4H3U A;  2K3D A;  2GBX B;  2W6J H;  1EA2 A;  1IYY A;  2H0I A;  3B7C A;  1W6G A;  1WMP A;  3IMA B;  4TX4 A;  3ZG5 A;  3Q90 A;  1I2F A; 
#chains in the Genus database with same CATH homology
 5D83 A;  1JB2 A;  5CF1 A;  1T5Y A;  3KSP A;  4KFE A;  1VZZ A;  5IEN A;  4O02 B;  2ML6 A;  3OXA A;  3LZA A;  2ZDJ A;  2HMM B;  1Q40 B;  1DYU A;  3DM8 A;  4N6M A;  2CKF B;  2GEX A;  5CK6 A;  1Q82 4;  3FCS B;  4K1U A;  3CCL 3;  4EBG A;  1UW1 A;  4R1K A;  2IMJ A;  3I0Y A;  4HM4 B;  4QWT A;  3CNM A;  2LYX A;  2XEP A;  3KE7 A;  3F14 A;  1DMQ A;  5HGR A;  2E2V A;  1G96 A;  1OF5 A;  5BXQ A;  5AIG A;  5IEO A;  4HM7 B;  3S29 A;  3EBT A;  2XR8 B;  1F8N A;  3LML A;  4HM2 B;  1TUH A;  3ALA A;  5IER A;  2P38 A;  3G0K A;  5IF6 A;  3CC7 3;  1UI7 A;  2D1W A;  3EBY A;  3SVA A;  1S5A A;  4XBY A;  1O7W B;  3CD6 3;  2GXF A;  3DXO A;  4XBT A;  2OWP A;  3EB8 A;  3OW2 2;  1YJW 3;  3GZB A;  3IPT A;  4HVN A;  3LXU X;  3FSD A;  1VQ4 3;  2E2U A;  2C10 A;  1N9E A;  1NB3 I;  3FG1 A;  3JUP A;  3HI7 A;  1YJ9 3;  1VQM 3;  4R80 A;  1OPY A;  3CPO A;  1W6Y A;  1OGX A;  3BNC A;  3G6E 3;  3NM7 A;  1V74 A;  4GB5 A;  3SED A;  3O8Y A;  4HM5 B;  3B4O A;  2P0X A;  1K73 4;  4WHA A;  5IG5 A;  2CFK A;  2XFT A;  4H61 A;  4MEI A;  5FW5 A;  1KQS 2;  2WGO A;  1IU7 A;  3F8X A;  4J8T A;  3Q2P A;  4LGQ A;  3WOF B;  3NUV A;  1JJ2 2;  4WP5 A;  3EQQ B;  2SBL A;  2HMK B;  3GRD A;  3MYT A;  4J9A A;  1OH0 A;  4HM8 B;  1LOX A;  3EF8 A;  5AIH A;  2XF3 A;  4AEQ A;  3J7Y d;  2CFG A;  2IA7 A;  4XBX A;  5D82 A;  2XH9 A;  2CG1 A;  2Z7A A;  1JN5 B;  4N6U A;  3K0Z A;  4L8O A;  1KWI A;  1EG9 B;  1UI8 A;  3FKA A;  3OV4 A;  3M8C A;  3K5T A;  2QA4 3;  2FXT A;  3BNB A;  3BND A;  3FH1 A;  3FZW A;  4Q53 A;  1A90 A;  2IUK A;  1EQK A;  1STD A;  3UB1 A;  3CNX A;  4HM3 B;  1SIH A;  1OHP A;  1LNH A;  2Z76 A;  3ER7 A;  1IQ8 A;  2Y73 A;  3DMC A;  4N6N B;  5EVH A;  1O7M B;  1IK3 A;  1O7G B;  1RRL A;  4JRF A;  2C11 A;  2OQE A;  1WTH A;  1JV2 B;  5EEO A;  4XM4 A;  1TIJ A;  3ROB A;  2GBW B;  1VQ5 3;  3EC9 A;  1IQY A;  2BT3 A;  4K61 A;  3KII A;  2W56 A;  2YX9 A;  3MG3 A;  1ZO2 A;  1WQL B;  3KFQ C;  1YJN 3;  2Q07 A;  1CYV A;  1W2Z A;  1YVB I;  3HIG A;  4IIA A;  4CDL A;  2QEX 3;  1J2B A;  3NV0 B;  1OF5 B;  4R4K A;  1M1K 4;  1WMO A;  2GU3 A;  3F40 A;  3RDE A;  3BLZ A;  4RZM A;  2OQE C;  2W9P A;  4U13 A;  5IG4 A;  1TU5 A;  1YIT 3;  1TFO A;  2Y74 A;  1HU9 A;  5D81 A;  1SQW A;  3I55 3;  4HZB B;  4AKZ A;  1IVV A;  1K41 A;  1NU3 A;  1US1 A;  1VQ9 3;  1TP6 A;  3N8B A;  5LC7 A;  3RGR A;  4FMB A;  1ROV A;  1R4C A;  1EKM A;  1QAK A;  3DGL A;  3LTB A;  3VGN A;  3DZL A;  2A15 A;  1OAC A;  3X40 A;  1DVC A;  5DRE A;  3T8U A;  1JB5 A;  3A76 A;  5IEP A;  5ELJ A;  1CEW I;  1OHO A;  3TDG A;  1M90 4;  5FGO A;  1JB4 A;  1YHQ 3;  1QVF 2;  2WOH A;  2W04 A;  1W2B 2;  3X3X A;  1TFK A;  1IV7 A;  4KVH A;  1IT8 A;  1RN7 A;  1W4N A;  1W5Z A;  3UJM A;  1N5H A;  2M7O A;  4FCM A;  1JRQ A;  3PXM A;  4HM6 B;  3DUK A;  3SXX A;  4L8P A;  4RBN A;  4EYC A;  1A2K A;  1ULJ B;  3CCM 3;  5G2G A;  1ULI B;  1W02 A;  5JPU A;  2RCD A;  4LMI A;  4K1V A;  1W7C A;  2CFL A;  3DGM A;  3EJV A;  6STD A;  2CHC A;  2XRX B;  5IW9 A;  3MG2 A;  1IQX A;  1OUN A;  2CFW A;  1N8Q A;  5CXO A;  1NWW A;  3SLU A;  5AYS C;  4R9L A;  5KP3 A;  4N3V A;  1W01 A;  1Q86 4;  3H3H A;  1FGO A;  4PEJ A;  1PU4 A;  3MSO A;  1L5G B;  5STD A;  2PZV A;  1IVW A;  1SJW A;  2OCT A;  3LTC A;  2PNC A;  1DMM A;  3PYJ A;  2CWV A;  2WGQ A;  4WYK B;  3KN4 A;  1FGM A;  3N9H A;  4KFF A;  1STF I;  1S72 3;  2GEY A;  1FA3 A;  1NB5 I;  1CYU A;  3HX8 A;  5LC6 A;  1MNL A;  3DY5 A;  3WOE B;  2XGN A;  3S27 A;  2CIU A;  4K90 B;  2BMQ B;  3K9M C;  3GZX B;  2MC8 A;  3EHC A;  4STD A;  5AII A;  1SII A;  4OUQ A;  1GY7 A;  2W56 B;  5CLK A;  1K9M 4;  4HBR A;  4NRE A;  3NQY A;  3UL5 A;  1DMN A;  3NHX A;  3WMD A;  1OCV A;  3BB9 A;  3CCR 3;  3IJE B;  3OWS A;  3DGO A;  1FUW A;  5ELU A;  4KFD A;  4JF8 A;  3U97 A;  3HK4 A;  2FGT A;  3MKI A;  3U1W A;  8CHO A;  2XFS A;  3CC2 3;  2OTJ 3;  3CMA 3;  1GY6 A;  3WA3 A;  1GYB A;  3GZR A;  4XDW A;  3V92 A;  1E3V A;  3D9R A;  4HM0 B;  5JPP A;  4IT7 A;  4MMY B;  3FF0 A;  4HJL B;  2BO9 B;  2W9Q A;  2OTL 3;  2MF7 A;  7STD A;  1GS3 A;  2P09 A;  2FNQ A;  5IG3 A;  3CCJ 3;  3OWU A;  1BUQ A;  2W2C A;  3B8L A;  4R9K A;  5AYR B;  1IV9 A;  4EV2 A;  1YIJ 3;  4X2O A;  1AR0 A;  4LZI A;  1WMN A;  3HII A;  4FR9 A;  1KC8 4;  3MWZ A;  4ORL A;  3CCQ 3;  3CXC 2;  2KXG A;  4LEH A;  3DGN A;  3PCR A;  3FG4 A;  3RGA A;  4O2H A;  3S5C A;  1QMA A;  3KSE D;  2F86 B;  3X3Z A;  1GY5 A;  2JQ5 A;  3SOA A;  1A67 A;  4O3V A;  2KCD A;  3LOY A;  4FMC A;  3D3L A;  5AEU B;  1IDP A;  1ASK A;  3NM2 A;  2CWT A;  2HMN B;  4FMD A;  3X42 A;  1RKY A;  2B24 B;  1KSI A;  3JUQ A;  3E99 A;  3T8N A;  3CCS 3;  2O9U X;  3BNE A;  1N9J A;  2JDI H;  1IVX A;  2BMO B;  1U8C B;  1WNH A;  3G8Z A;  3G4S 3;  3FG3 A;  4L7K A;  4XDV A;  1E3R A;  3VF1 A;  3N54 B;  5IG0 A;  4WWU C;  3G71 3;  1O7H B;  4IPB A;  3X41 A;  2HML B;  2Z6B A;  3AMO A;  2KRT A;  2INX A;  2CC3 A;  1NDO B;  3PGB A;  4X2H A;  5BVB A;  4O8S A;  2D42 A;  4HZ9 B;  3MHE A;  3LT9 A;  3PCS A;  4HYZ A;  3G16 A;  5KP1 A;  3GZY B;  1VQ8 3;  1O7P B;  1A2V A;  1Y4K A;  4N6T A;  5TGN A;  5A0O B;  1IT7 A;  1UUV B;  4BTX A;  1QVG 2;  3EN1 B;  3PZW A;  4FMA A;  1ISK A;  2QGU A;  3Q1C A;  2R4I A;  1D6Y A;  3F8H A;  3H51 A;  1CQS A;  2V1L A;  2B1X B;  2YFI B;  5CF2 A;  1SPU A;  4FCZ A;  3T0U A;  3I56 3;  3S67 A;  2ZL8 A;  3CU3 A;  3EX9 A;  1JKG A;  2BHM A;  1LXE A;  3MG1 A;  3NBB A;  3LH4 A;  4MJD A;  4EC6 A;  1VQL 3;  1U5O A;  2WO0 A;  3CME 3;  4N6V 0;  1N8R 4;  1OHS A;  1M9G A;  4HKV B;  2CG0 A;  1ROA A;  3JUO A;  3JVC A;  3LTD A;  2BNG A;  1NJI 4;  3QK9 A;  3NV0 A;  3WOD G;  2CH9 A;  1PFP A;  3LTA A;  1AVK A;  2CK3 H;  2GU1 A;  2L4V A;  3PS8 A;  3LYG A;  2O3O A;  3EE1 A;  5JBS A;  1JNQ A;  2RFR A;  1N5P A;  3S28 A;  1Q42 A;  4RNY A;  1VQ6 3;  1FGT A;  2F99 A;  3UNL A;  1GD3 A;  5AIF A;  2XSO B;  1UUW B;  3F9S A;  3L0R A;  3OWY A;  4RNZ A;  2K54 A;  3KKG A;  3FF2 A;  4MMZ B;  1OGZ A;  4OVM A;  3F7X A;  4GL6 A;  2HMO B;  1Q40 A;  1QAF A;  2CW9 A;  1W6C A;  4EXR A;  2CFD A;  3SX1 A;  3K7C A;  1M1X B;  3FGY A;  1K28 A;  2YFL B;  3F7S A;  1Q7Y 4;  2OOV A;  4G1M B;  3CCV 3;  4XB5 A;  3OX9 A;  1FGQ A;  3CC4 3;  1GD4 A;  1ZX2 A;  1LVN A;  5I97 A;  3UL6 A;  3CPW 2;  3WA2 X;  3X3Y A;  3MPH A;  3NBR A;  3NXJ A;  4LSO A;  1FGR A;  3JUN A;  2W0Q A;  5AEW B;  2RGQ A;  2E2T A;  2XSH B;  4ZM8 A;  3CCE 3;  1W00 A;  3AMO B;  1YGE A;  3K63 A;  2UX0 A;  1AVL A;  1AV4 A;  1VQK 3;  1QAL A;  1KD1 4;  1IVU A;  5DRV A;  1HKX A;  4HM1 B;  2BMR B;  1D6U A;  3NQZ A;  4N6L A;  5KP4 A;  2WOF A;  1VQO 3;  1NO3 A;  2OOV C;  3JUM A;  4I4K A;  3HZP A;  2Z77 A;  3SOY A;  1O7N B;  1D6Z A;  3NBJ A;  4FCJ A;  4WYK A;  3QRD A;  4KZ1 A;  3NX0 A;  3B4P A;  1VQP 3;  3EN8 A;  2I9W A;  3FLJ A;  4MMX B;  2STD A;  4WFO A;  4EV5 A;  3V98 A;  4CCV A;  1JKG B;  2ML5 A;  4BTY A;  2CWU A;  1DVD A;  2IUJ A;  3KZT A;  2F98 A;  2XGL A;  2P05 A;  2W03 A;  5AI1 A;  4NHF A;  3CCU 3;  3LT8 A;  4N6O B;  4OK0 A;  3V99 A;  1E97 A;  2HMJ B;  1K8A 4;  3WDG B;  2LQV A;  2YFJ B;  1YI2 3;  3VSY A;  2P0M A;  3GAX A;  1C7H A;  5EQL A;  3STD A;  1QJG A;  4BTW A;  1JN5 A;  1VQN 3;  2QIY A;  1Z1S A;  2RSX A;  2K0M A;  3GWR A;  3ECF A;  1MOL A;  1RJO A;  1RRH A;  4AKY A;  1VQ7 3;  1Q81 4;  4H3U A;  2GBX B;  2W6J H;  1EA2 A;  3B7C A;  1W6G A;  1WMP A;  3IMA B;  4TX4 A;  3Q90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...