5D82A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y16(cl-y)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
125
Chain Sequence
NLPTAQEVQGLMARIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Delta(5)-3-ketosteroid isomerase
total genus 31
structure length 125
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d82A00
3OWUA 5CF2A 4HM0B 1W6YA 1QJGA 3EQQB 3LZAA 4N3VA 1TP6A 3RGAA 3FZWA 3CPOA 3H51A 4FCMA 3IPTA 5IG3A 1GS3A 1ULJB 2HMOB 1OHPA 5FW5A 5CLKA 1UUWB 1NDOB 2YFJB 3I0YA 1GY5A 1Q40A 1C7HA 1GY6A 4HM1B 1OUNA 3MKIA 4HM7B 4OUQA 4HM5B 3S5CA 4K1UA 3EHCA 4X2OA 1BUQA 3KZTA 1Q42A 3EN1B 2BNGA 1CQSA 3F14A 3KE7A 4HM3B 5AIHA 5IG5A 4L7KA 3GWRA 1STDA 3EJVA 5IENA 3FF2A 1OPYA 1GYBA 3GZYB 2F98A 3JUOA 2I9WA 2F99A 3JUNA 2BMQB 1ISKA 4IIAA 3CNMA 3MG2A 2CKFB 3DUKA 4XDVA 5G2GA 5CXOA 1O7GB 3UNLA 5AEWB 4XBYA 4J8TA 3MG1A 3A76A 3F8XA 2GEXA 4H3UA 4HM4B 2UX0A 1E3RA 1ZX2A 4LGQA 1DMMA 3ER7A 4ORLA 3ROBA 5JPUA 3NHXA 4L8PA 1NWWA 2B1XB 1OF5A 3F8HA 3EN8A 1O7MB 1TUHA 1OF5B 3DM8A 3GZRA 3JUQA 2PZVA 3OWSA 3OXAA 2A15A 2K54A 1OCVA 4LEHA 2GBXB 2RCDA 3B4PA 4XM4A 1Q40B 4HM6B 3EBYA 3OWYA 3FSDA 3BLZA 4LMIA 1OHOA 4HVNA 3HK4A 3F9SA 3K7CA 2XSOB 3DZLA 3B8LA 4HJLB 3HZPA 4HM2B 4K1VA 5IG0A 5IF6A 2HMKB 3FLJA 4CDLA 3DMCA 3EX9A 1JKGB 6STDA 5JPPA 2HMJB 2STDA 1JKGA 1UUVB 4STDA 3EBTA 5CK6A 2R4IA 3EF8A 3UJMA 4HM8B 4WWUC 3G0KA 3VGNA 3DXOA 4KVHA 5IG4A 3G8ZA 4WYKA 3FKAA 1JN5B 1S5AA 2W2CA 3NV0B 4X2HA 5AEUB 5CF1A 3BB9A 5KP4A 1Z1SA 4FCJA 2Z76A 1OGZA 1IDPA 2XSHB 3KKGA 5IEOA 2YFIB 3F7SA 3JUMA 3CNXA 5IERA 3NUVA 3NM2A 5TGNA 3GZBA 1EA2A 1O7NB 3JUPA 5BXQA 5AIIA 2HMLB 4L8OA 4J9AA 1EG9B 3T8UA 3F40A 4HKVB 3F7XA 4HZ9B 1DMNA 1ZO2A 2GXFA 3GZXB 3B4OA 1W00A 2Z7AA 3ECFA 4Q53A 1W01A 1JB5A 4MJDA 5IEPA 5D82A 4WP5A 1O7WB 1NU3A 3SEDA 2GBWB 5AI1A 3G16A 4XBTA 4XDWA 1GY7A 1AR0A 3FH1A 5AIFA 2CHCA 2IMJA 1A2KA 1JB2A 1JN5A 1ULIB 1O7PB 3LYGA 4R9KA 2HMNB 2XRXB 3EC9A 3K0ZA 1U5OA 3T8NA 4PEJA 2BMOB 1E3VA 3E99A 3HX8A 1OH0A 2XR8B 3MG3A 4HZBB 1E97A 1OHSA 1ASKA 3MSOA 2YFLB 4GB5A 5D83A 1W02A 1K41A 4XB5A 8CHOA 3M8CA 4XBXA 2RGQA 3D9RA 3H3HA 5AIGA 5BVBA 3OV4A 3GRDA 1QMAA 4R9LA 2BMRB 3B7CA 5EVHA 3RGRA 5STDA 2OWPA 1OGXA 3CU3A 3NXJA 1DMQA 3Q90A 2F86B 1HKXA 2HMMB 1WQLB 2JQ5A 2QIYA 3SOAA 7STDA 5KP3A 2RFRA 1VZZA 3OX9A 4RZMA 3KSPA 5D81A 5DRVA 3STDA 4I4KA 2Z77A 2QGUA 3FF0A 3NBRA 4U13A 3NV0A 1SJWA 3FGYA 3WMDA 2INXA 4R1KA 2GEYA 1JB4A 3MHEA 3MYTA 4OVMA 3SOYA 1O7HB 2B24B 5HGRA 5KP1A 4WYKB 5DREA 3VSYA
chains in the Genus database with same CATH superfamily
3O8YA 3D3LA 1TP6A 1QALA 1BRIA 1GS3A 1ULJB 2BHMA 1NDOB 1Q824 1C7HA 3DGMA 1RNBA 2LYXA 1RGGA 2IA7A 2W56A 3KFQC 1IT7A 3NBJA 4J5GA 1FGTA 1CQSA 1RN7A 1I8VA 1W6GA 1BRKA 3AHSA 3KE7A 3GWRA 3EJVA 4N6TA 3JUOA 2CIUA 1MOLA 2F98A 1W5ZA 2I9WA 2BMQB 1D6ZA 1ISKA 3MG2A 4RNTA 2CKFB 1BSCA 3DUKA 2C4BA 1GD4A 3UNLA 4CCVA 1YJW3 5G1LA 3LMLA 2CG1A 4EW5A 1AVLA 1M9GA 3A76A 2GEXA 4LGQA 1ZX2A 4MMZB 1BUJA 1LQGC 2KXGA 3CME3 4L8PA 3GZRA 1OF5A 2B1XB 1WMNA 2BIRA 1R4CA 2GU1A 1BRHA 3DH2A 1UGIA 3OW22 1W7CA 6GSPA 1T2HA 4KZ1A 1GMPA 3U97A 2RCDA 3RDEA 1Q40B 4EC6A 1IVWA 2AAEA 4FMBA 1OHOA 2CX1A 4GSPA 3DGYA 3K7CA 4HM2B 2XSOB 4XDWA 3B8LA 5IG0A 2CFDA 1QVF2 2HMKB 3BNDA 2IY2A 5AYRB 2QEX3 1SPUA 1SQWA 1JBSA 3X41A 2D42A 3K63A 1I3FA 4KFDA 2C11A 3T0UA 3EBTA 5EQLA 3URPA 4N6OB 2W6JH 4WWUC 5IG4A 1MGWA 1IT8A 1JBRA 4AEQA 2W2CA 2CWTA 1BRGA 5AEUB 1B2SA 1Z1SA 3CCE3 1GSPA 2XSHB 3KKGA 5IERA 2BO9B 1B21A 3NUVA 1FUTA 2M7OA 4AKZA 3F40A 1RTUA 1B2MA 2FGTA 1VQP3 1EQKA 1X1UA 2W03A 4EBGA 1ROVA 3FG1A 4MEIA 5D82A 3WA2X 1KSIA 1YJ93 1MWUA 1RGEA 1FUWA 1KWIA 4LYLB 3SEDA 3LTDA 5RNTA 1AQZA 1G96A 4HBRA 1SIHA 3CCS3 2OQEA 1US1A 1JN5A 1M1K4 1YGEA 1O7PB 1F8NA 4CPKA 3ZG5A 3K5TA 3NX0A 2RNTA 3T8NA 1LNIA 1BNSA 3QRDA 1RGKA 2WO0A 2XGLA 2ZDJA 3AMOB 2RBIA 1OH0A 3E99A 2CFKA 1NJI4 2YFLB 1FGQA 4XB5A 1T2IA 2H0HA 5AIGA 5BVBA 5M19A 1RCLA 3OV4A 1QMAA 1AVKA 3MWZA 2BMRB 5EVHA 3IMAB 2OWPA 2MF7A 2OQEC 3LT8A 2F86B 1A2PA 2W04A 4FMAA 2OOVC 1HKXA 1WQLB 2FNQA 4JF8A 4RZMA 1VZZA 2P0XA 2Z77A 1RRLA 1BSBA 1Q7HA 3NBRA 3PS8A 4O2HA 3FGYA 2QA43 5IW9A 1YGWA 1O7HB 2B24B 1S723 1I3IA 2Z6BA 1UCKA 3G6E3 1T3BA 3Q3FA 3OWUA 3RGAA 1ZS7A 3EQQB 1K28A 3LOYA 3LZAA 3VGNA 4N6V0 3CC43 3CPOA 3H51A 3IPTA 1UUWB 2YFJB 3I0YA 1BANA 1GD3A 1GY5A 4OUQA 1VQ73 1C54A 1B2XA 1W2B2 4K1UA 4BL2A 1X1XA 3EHCA 3KZTA 4MMYB 3F14A 2P38A 3X3XA 4MMXB 1PU4A 1BSDA 1GMRA 5IENA 3FF2A 1BNJA 1GYBA 1MWRA 1OPYA 3D5GA 2WGOA 3FG4A 3GZYB 4WHAA 1UGHI 1N8R4 1OACA 1RMSA 1TRPA 2KF5A 1UUGB 3CNMA 1RRHA 3ZG0A 2P09A 4I5QA 1TIJA 2R41A 1HZ1A 4J8TA 4N6LA 1JV2B 4XBYA 7RNTA 4HM4B 4ORLA 1EUIC 1VQK3 3ER7A 1KQS2 1NWWA 3DM8A 3PYJA 1OF5B 4J5KA 3OXAA 1RCKA 3TDGA 1MGRA 4LEHA 4DKIA 4FMCA 4TX4A 3LTAA 4XM4A 4HM6B 5HOHA 1BSAA 3FSDA 4LMIA 2W9PA 1LNHA 2H0IA 3F9SA 1BUQA 1A67A 3DZLA 3KCHA 4LSOA 3HZPA 3NQYA 4H61A 3PXMA 1DVCA 4NREA 5JPPA 6STDA 1RSNA 2STDA 5ELJA 1SARA 1B2UA 1VQO3 1YJN3 1LOXA 4HM8B 3SX1A 3DGLA 4BTXA 1QAFA 2OTJ3 1I2FA 3FKAA 4X2HA 4FCZA 3BB9A 4NHFA 1UCIA 1GOUA 2IUJA 3JUMA 1N8QA 3MPHA 5TGNA 1BNGA 2ZL8A 3GZBA 2KF3A 1O7NB 1JBTA 1A90A 3UB1A 2HMLB 4J9AA 3CD63 1DE3A 3CCQ3 4HKVB 3F7XA 4HZ9B 1DMNA 1ZO2A 2GXFA 2KRTA 3GZXB 3B4OA 1W00A 3ECFA 1DYUA 1N5PA 3J7Yd 2H0GA 4MJDA 5IEPA 1KC84 1FW7A 2LQVA 1BAOA 1RLSA 1I0XA 4ZM8A 3FH1A 2UUGC 2CHCA 3NM7A 1RGAA 5GSPA 3D4AA 1U5OA 4PEJA 1CEWI 2KAAA 3HX8A 3PCRA 2XR8B 5AYSC 4HZBB 1ASKA 1DETA 4BTWA 2CC3A 3LXUX 4GB5A 4N6MA 1G0TA 3V92A 4AKYA 2F5WA 1GOVA 2WGQA 1I0VA 1V58A 4R9LA 3RGRA 2FXTA 5STDA 3CU3A 1OGXA 4K90B 4JRFA 1BNEA 2CWVA 3ALAA 5BIRA 2ML6A 1YIT3 4GHOA 2QIYA 1VQM3 4QWTA 7STDA 3FG3A 3KSPA 1LOVA 3FCSB 4I4KA 1V74A 1B20A 4R4KA 1BNIA 3FF0A 4BIRA 3N54B 3NV0A 4O02B 2HOHA 4U13A 2OOVA 3CPW2 2GU3A 3GSPA 3WOFB 2GEYA 3BIRA 3MHEA 3MYTA 3Q2PA 3S27A 3SOYA 4IT7A 1I2EA 5FGOA 4N6NB 3KSED 3VSYA 1W6YA 1QJGA 1RGLA 4R80A 5JPUA 3FZWA 3V99A 1TFKA 3PZWA 5JBSA 2HMOB 3PCSA 2KF4A 2RSXA 2CH9A 4BU4A 1Q40A 1V57A 1GY6A 5LC7A 3MKIA 3S5CA 4HM7B 1IK3A 1UI8A 3A5EA 2F4YA 1RHLA 5AIHA 1Q42A 3EN1B 4HM3B 1Q7Y4 3CMA3 1NO3A 3HOHA 4L7KA 3LH4A 1JZOA 1UDII 1STDA 2JDIH 1FYSA 1YI23 4HAAA 3G713 1MNLA 4RNZA 1W6CA 2XFTA 3KIIA 2MC8A 1WTHA 1X1WA 5CXOA 1O7GB 4K61A 5G2GA 1VQ63 1BVIA 2YX9A 1BU4A 2F56A 4H3UA 1MWSA 1AY7A 1WMPA 2UX0A 5M1AA 2UGIA 3OWSA 3EN8A 1O7MB 1TUHA 3JUQA 2PZVA 2A15A 1BIRA 2K54A 2K0MA 1LOYA 1WNHA 2GBXB 4BTYA 2KCDA 2P0MA 3EBYA 3OWYA 3BLZA 3D79A 2XFSA 2V1LA 2W56B 3HK4A 1B2ZA 2XEPA 2ZA4A 3X3YA 3FLJA 4CDLA 4KFEA 1RGHA 1QVG2 1TU5A 1CH0A 3BNEA 3DMCA 1JKGB 2F5MA 1K9M4 1RN1A 4STDA 5CK6A 1JRQA 3EF8A 1G02A 3UJMA 3WDGB 2GSPA 3G0KA 2E2TA 4KVHA 1LQMB 1B3SA 3D5IA 3G8ZA 4WYKA 2K3DA 1JN5B 1QAKA 1S5AA 3NV0B 5KP4A 2ZHXB 4FCJA 2Z76A 5IEOA 1K8A4 1N9JA 3CCU3 1PYLA 4GL6A 3I563 1IU7A 1SIIA 3NM2A 4N6UA 3WOEB 1EA2A 1Q9EA 3IJEB 2L1SA 3JUPA 5AIIA 2WOHA 3WA3A 3T8UA 1HYFA 2SARA 1KD14 2CK3H 1YVSA 2Z7AA 1YHQ3 1YVBI 4Q53A 1IQ8A 1JB5A 1FGOA 3BNBA 1LVNA 1LOWA 1BGSA 4EV5A 1NU3A 3U1WA 1IV9A 1FGRA 1BRJA 2GBWB 2Q07A 3G16A 5AI1A 1GY7A 2W9QA 1AR0A 3HIGA 5AIFA 2IMJA 2D1WA 1RKYA 1A2KA 1IVVA 1JB2A 1FZUA 1U8CB 1NNVA 1ULIB 2ML5A 2HMNB 3AGNA 3CCM3 3EC9A 3K0ZA 4NPBA 1VQL3 1E3VA 1EEJA 3X3ZA 1TFOA 1BNRA 2Y73A 3JVCA 3MSOA 1K734 2CG0A 5D83A 3BU4A 1W2ZA 2E2UA 3M8CA 4WFOA 4RBNA 3D9RA 1IYYA 2CFLA 3GRDA 3WHOA 1D6YA 3B7CA 3WODG 3NXJA 1L5GB 1DMQA 4HYZA 1ZGXA 2C10A 1W4NA 1BNFA 1RDSA 3EB8A 3SOAA 3NBBA 1IVUA 3EE1A 5DRVA 1GMQA 3STDA 4FMDA 3S67A 2BU4A 3DGNA 1ROAA 3WMDA 3I553 1JB4A 1VQQA 3CC23 1LXEA 1NB3I 1I70A 1M1XB 1R4YA 1UI7A 1WMOA 3LT9A 5HGRA 4G1MB 4WYKB 5KP1A 5CF2A 4HM0B 1PFPA 3HI7A 4N3VA 4FCMA 1GOYA 5IG3A 4HOHA 5FW5A 1OHPA 4CJNA 1YNVX 5CLKA 4EV2A 5A0OB 2P05A 6RNTA 9RNTA 4HM1B 3CCL3 1OUNA 3DY5A 4HM5B 1BOXA 1AV4A 3CCJ3 4X2OA 1T5YA 3S29A 2BNGA 5IG5A 1JZDA 2IUKA 1STFI 2KF6A 3JUNA 1I2GA 2F99A 1FUSA 4IIAA 1TTOA 2XF3A 4XDVA 3Q1CA 5AEWB 1FA3A 3N9HA 3MG1A 2CW9A 3F8XA 2L4VA 1E3RA 1N9EA 1DMMA 2AADA 1BRNL 3NQZA 3UL5A 3ROBA 3NHXA 1RN4A 4L8OA 3F8HA 1EKMA 3SVAA 1NB5I 3CCV3 1OCVA 1Q864 2WOFA 4FR9A 1J2BA 3B4PA 2E2VA 3SXXA 2XGNA 1N5HA 3LTCA 3SLUA 3RNTA 4HVNA 1BRSA 4K1VA 4HJLB 5IF6A 1M904 7GSPA 2PNCA 3CC73 3N8BA 4LZIA 8RNTA 1X1YA 4IPBA 3EX9A 5EEOA 2HMJB 1JKGA 1LRAA 1UUVB 1UW1A 3L0RA 1BSEA 1VQ93 2R4IA 1CYVA 1PY3A 5I97A 3X40A 3DXOA 3DGOA 1RGCA 4O8SA 3QK9A 2Y74A 1MWTA 3UL6A 4ILFA 5CF1A 3GAXA 1IDPA 1OGZA 3BNCA 5M18A 1DVDA 2YFIB 3F7SA 2CFGA 3AGOA 3CNXA 5G1KA 3WR2A 1UCJA 1YIJ3 3PGBA 3X42A 2SBLA 3ZFZA 1RJOA 1VQ83 5BXQA 3CXC2 3CCR3 1HU9A 1EG9B 1IQYA 2O3OA 3HIIA 4OK0A 1UCLA 1RGFA 3SYUA 2CWUA 1FGMA 3VF1A 1RNTA 1W01A 3K9MC 4KFFA 1VQ53 4WP5A 1O7WB 1VQ43 3G4S3 2J8XB 4XBTA 2O9UX 4EXRA 3AHWA 1JJ22 2CFWA 5LC6A 3LYGA 4R9KA 5ELUA 2XRXB 3AMOA 2BMOB 3MG3A 1E97A 1OHSA 1W02A 1K41A 2CX0A 1Y4KA 4KT3B 8CHOA 4XBXA 2RGQA 3H3HA 1TJDA 3LTBA 1JNQA 2W0QA 3Q90A 1IVXA 1A2VA 2OTL3 3V98A 1D6UA 2HMMB 1TRQA 4O3VA 2JQ5A 3KN4A 4RNYA 3S28A 5KP3A 2BT3A 2IYJA 1IV7A 2RFRA 3OX9A 5D81A 1B27A 2OCTA 2XH9A 1Q814 5BU4A 1CYUA 1IQXA 2QGUA 1SJWA 1VQN3 2INXA 4R1KA 4OVMA 4EYCA 4BL3A 5DREA
chains in the Genus database with same CATH topology
3O8YA 3D3LA 1TP6A 1QALA 1GS3A 1ULJB 2BHMA 1NDOB 1Q824 1C7HA 3DGMA 2LYXA 2IA7A 2W56A 3KFQC 1IT7A 3NBJA 1FGTA 1CQSA 1RN7A 1W6GA 3KE7A 3GWRA 3EJVA 4N6TA 3JUOA 2CIUA 1MOLA 2F98A 1W5ZA 2I9WA 2BMQB 1D6ZA 1ISKA 3MG2A 2CKFB 3DUKA 1GD4A 3UNLA 4CCVA 1YJW3 3LMLA 2CG1A 1M9GA 1AVLA 3A76A 2GEXA 4LGQA 1ZX2A 4MMZB 2KXGA 3CME3 4L8PA 3GZRA 1OF5A 2B1XB 1WMNA 2GU1A 1R4CA 3OW22 1W7CA 4KZ1A 3U97A 2RCDA 3RDEA 1Q40B 4EC6A 1IVWA 4FMBA 1OHOA 4XDWA 3K7CA 4HM2B 2XSOB 3B8LA 5IG0A 2CFDA 1QVF2 2HMKB 3BNDA 5AYRB 2QEX3 1SPUA 1SQWA 3X41A 2D42A 3K63A 4KFDA 2C11A 3T0UA 3EBTA 5EQLA 4N6OB 2W6JH 4WWUC 5IG4A 1IT8A 4AEQA 2W2CA 2CWTA 5AEUB 1Z1SA 3CCE3 2XSHB 3KKGA 5IERA 2BO9B 3NUVA 2M7OA 4AKZA 3F40A 2FGTA 1VQP3 1EQKA 2W03A 4EBGA 1ROVA 3FG1A 4MEIA 5D82A 3WA2X 1KSIA 1YJ93 1FUWA 1KWIA 3SEDA 3LTDA 1G96A 4HBRA 1SIHA 3CCS3 2OQEA 1US1A 1JN5A 1M1K4 1YGEA 1O7PB 1F8NA 3K5TA 3NX0A 3T8NA 3QRDA 2WO0A 2XGLA 3AMOB 2ZDJA 3E99A 1OH0A 2CFKA 1NJI4 2YFLB 1FGQA 4XB5A 5AIGA 5BVBA 3OV4A 1QMAA 1AVKA 3MWZA 2BMRB 5EVHA 3IMAB 2OWPA 2MF7A 2OQEC 3LT8A 2F86B 2W04A 4FMAA 2OOVC 1HKXA 1WQLB 2FNQA 4JF8A 4RZMA 1VZZA 2P0XA 2Z77A 1RRLA 3NBRA 3PS8A 4O2HA 3FGYA 2QA43 5IW9A 1O7HB 2B24B 1S723 2Z6BA 3G6E3 3OWUA 3RGAA 3LZAA 3EQQB 1K28A 3LOYA 3VGNA 3CC43 4N6V0 3CPOA 3H51A 3IPTA 1UUWB 2YFJB 3I0YA 1GD3A 1GY5A 4OUQA 1VQ73 1W2B2 4K1UA 3EHCA 3KZTA 4MMYB 3F14A 2P38A 3X3XA 4MMXB 1PU4A 5IENA 3FF2A 1OPYA 1GYBA 3GZYB 1N8R4 3FG4A 2WGOA 4WHAA 1OACA 3CNMA 1RRHA 2P09A 1TIJA 4N6LA 4J8TA 4XBYA 1JV2B 4HM4B 4ORLA 1VQK3 3ER7A 1KQS2 1NWWA 3DM8A 3PYJA 1OF5B 3OXAA 3TDGA 4LEHA 4FMCA 4TX4A 3LTAA 4XM4A 4HM6B 3FSDA 4LMIA 2W9PA 1LNHA 3F9SA 1BUQA 1A67A 3DZLA 3HZPA 3NQYA 4H61A 3PXMA 1DVCA 4NREA 5JPPA 6STDA 2STDA 5ELJA 1VQO3 1YJN3 1LOXA 4HM8B 3SX1A 3DGLA 4BTXA 1QAFA 2OTJ3 3FKAA 4X2HA 4FCZA 3BB9A 4NHFA 2IUJA 3JUMA 1N8QA 3MPHA 5TGNA 2ZL8A 3GZBA 1O7NB 1A90A 3UB1A 2HMLB 4J9AA 3CD63 3CCQ3 4HKVB 3F7XA 4HZ9B 1DMNA 1ZO2A 2GXFA 2KRTA 3GZXB 3B4OA 1W00A 3ECFA 1DYUA 1N5PA 3J7Yd 4MJDA 5IEPA 1KC84 2LQVA 4ZM8A 3FH1A 2CHCA 3NM7A 1U5OA 4PEJA 1CEWI 3HX8A 3PCRA 2XR8B 5AYSC 4HZBB 1ASKA 4BTWA 2CC3A 3LXUX 4GB5A 4N6MA 3V92A 4AKYA 2WGQA 4R9LA 3RGRA 2FXTA 5STDA 3CU3A 1OGXA 4K90B 4JRFA 2CWVA 3ALAA 2ML6A 1YIT3 2QIYA 1VQM3 4QWTA 7STDA 3FG3A 3KSPA 3FCSB 4I4KA 1V74A 4R4KA 3FF0A 3N54B 3NV0A 4O02B 4U13A 2OOVA 3CPW2 2GU3A 3WOFB 2GEYA 3MHEA 3MYTA 3Q2PA 3S27A 3SOYA 4IT7A 5FGOA 4N6NB 3KSED 3VSYA 1W6YA 1QJGA 4R80A 5JPUA 3FZWA 3V99A 1TFKA 3PZWA 5JBSA 2HMOB 3PCSA 2RSXA 2CH9A 1Q40A 3S5CA 1GY6A 5LC7A 3MKIA 1IK3A 4HM7B 1UI8A 5AIHA 1Q42A 3EN1B 4HM3B 1Q7Y4 3CMA3 1NO3A 4L7KA 3LH4A 2JDIH 1YI23 1STDA 3G713 1MNLA 4RNZA 1W6CA 2XFTA 3KIIA 2MC8A 1WTHA 5G2GA 5CXOA 1O7GB 4K61A 1VQ63 2YX9A 4H3UA 2UX0A 1WMPA 3OWSA 3EN8A 1O7MB 1TUHA 3JUQA 2PZVA 2A15A 2K54A 2K0MA 2GBXB 1WNHA 4BTYA 2KCDA 2P0MA 3EBYA 3OWYA 3BLZA 2XFSA 2V1LA 2W56B 3HK4A 2XEPA 3X3YA 3FLJA 4CDLA 4KFEA 1QVG2 1TU5A 3BNEA 3DMCA 1JKGB 1K9M4 4STDA 5CK6A 1JRQA 3EF8A 3UJMA 3WDGB 3G0KA 2E2TA 4KVHA 3G8ZA 4WYKA 1JN5B 1QAKA 1S5AA 3NV0B 5KP4A 4FCJA 5IEOA 2Z76A 1K8A4 1N9JA 3CCU3 4GL6A 3I563 1IU7A 1SIIA 3NM2A 4N6UA 3WOEB 1EA2A 3IJEB 3JUPA 5AIIA 2WOHA 3WA3A 3T8UA 1KD14 2CK3H 1YHQ3 2Z7AA 1YVBI 4Q53A 1IQ8A 1JB5A 1FGOA 3BNBA 1LVNA 4EV5A 1NU3A 3U1WA 1IV9A 1FGRA 2GBWB 5AI1A 2Q07A 3G16A 1GY7A 2W9QA 1AR0A 3HIGA 5AIFA 2IMJA 2D1WA 1RKYA 1A2KA 1IVVA 1JB2A 1U8CB 1ULIB 4LSOA 3CCM3 2ML5A 2HMNB 3EC9A 3K0ZA 1VQL3 1E3VA 3X3ZA 1TFOA 2Y73A 3JVCA 3MSOA 1K734 2CG0A 5D83A 1W2ZA 2E2UA 3M8CA 4WFOA 4RBNA 3D9RA 2CFLA 3GRDA 1D6YA 3B7CA 3WODG 3NXJA 1L5GB 1DMQA 4HYZA 2C10A 1W4NA 3EB8A 3SOAA 3NBBA 1IVUA 3EE1A 5DRVA 3STDA 4FMDA 3S67A 3DGNA 1ROAA 3WMDA 3I553 1JB4A 3CC23 1LXEA 1NB3I 1M1XB 1UI7A 1WMOA 3LT9A 5HGRA 4G1MB 4WYKB 5KP1A 5CF2A 4HM0B 1PFPA 3HI7A 4N3VA 4FCMA 5IG3A 5FW5A 1OHPA 4EV2A 5CLKA 5A0OB 2P05A 4HM1B 3CCL3 1OUNA 3DY5A 4HM5B 3CCJ3 1AV4A 4X2OA 1T5YA 3S29A 2BNGA 5IG5A 2IUKA 1STFI 3JUNA 2F99A 4IIAA 2XF3A 4XDVA 3Q1CA 5AEWB 1FA3A 3N9HA 3MG1A 2CW9A 3F8XA 2L4VA 1E3RA 1N9EA 1DMMA 3NQZA 3UL5A 3ROBA 3NHXA 4L8OA 3F8HA 1EKMA 3SVAA 1NB5I 3CCV3 1OCVA 1Q864 2WOFA 4FR9A 1J2BA 3B4PA 2E2VA 3SXXA 2XGNA 1N5HA 3LTCA 3SLUA 4HVNA 4K1VA 4HJLB 5IF6A 1M904 2PNCA 3CC73 3N8BA 4LZIA 4IPBA 3EX9A 5EEOA 2HMJB 1JKGA 1UUVB 1UW1A 3L0RA 1VQ93 2R4IA 1CYVA 5I97A 3X40A 3DXOA 3DGOA 4O8SA 3QK9A 2Y74A 3UL6A 5CF1A 3GAXA 1IDPA 1OGZA 3BNCA 1DVDA 2YFIB 3F7SA 2CFGA 3CNXA 1YIJ3 3PGBA 3X42A 2SBLA 1RJOA 1VQ83 5BXQA 3CXC2 3CCR3 1HU9A 1EG9B 1IQYA 2O3OA 3HIIA 4OK0A 2CWUA 1FGMA 3VF1A 1W01A 3K9MC 4KFFA 1VQ53 4WP5A 1O7WB 1VQ43 3G4S3 4XBTA 2O9UX 4EXRA 1JJ22 2CFWA 5LC6A 3LYGA 4R9KA 5ELUA 2XRXB 3AMOA 2BMOB 3MG3A 1E97A 1OHSA 1W02A 1K41A 1Y4KA 8CHOA 4XBXA 2RGQA 3H3HA 3LTBA 1JNQA 2W0QA 3Q90A 1IVXA 1A2VA 2OTL3 3V98A 1D6UA 2HMMB 4O3VA 4RNYA 2JQ5A 3KN4A 3S28A 5KP3A 2BT3A 2RFRA 1IV7A 3OX9A 5D81A 2XH9A 2OCTA 1Q814 1CYUA 1IQXA 2QGUA 1SJWA 1VQN3 2INXA 4R1KA 4OVMA 4EYCA 5DREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWU A;  5CF2 A;  4HM0 B;  1W6Y A;  1QJG A;  3EQQ B;  3LZA A;  4N3V A;  1TP6 A;  3RGA A;  3FZW A;  3CPO A;  3H51 A;  4FCM A;  3IPT A;  5IG3 A;  1GS3 A;  1ULJ B;  2HMO B;  1OHP A;  5FW5 A;  5CLK A;  1UUW B;  1NDO B;  2YFJ B;  3I0Y A;  1GY5 A;  1Q40 A;  1C7H A;  1GY6 A;  4HM1 B;  1OUN A;  3MKI A;  4HM7 B;  4OUQ A;  4HM5 B;  3S5C A;  4K1U A;  3EHC A;  4X2O A;  1BUQ A;  3KZT A;  1Q42 A;  3EN1 B;  2BNG A;  1CQS A;  3F14 A;  3KE7 A;  4HM3 B;  5AIH A;  5IG5 A;  4L7K A;  3GWR A;  1STD A;  3EJV A;  5IEN A;  3FF2 A;  1OPY A;  1GYB A;  3GZY B;  2F98 A;  3JUO A;  2I9W A;  2F99 A;  3JUN A;  2BMQ B;  1ISK A;  4IIA A;  3CNM A;  3MG2 A;  2CKF B;  3DUK A;  4XDV A;  5G2G A;  5CXO A;  1O7G B;  3UNL A;  5AEW B;  4XBY A;  4J8T A;  3MG1 A;  3A76 A;  3F8X A;  2GEX A;  4H3U A;  4HM4 B;  2UX0 A;  1E3R A;  1ZX2 A;  4LGQ A;  1DMM A;  3ER7 A;  4ORL A;  3ROB A;  5JPU A;  3NHX A;  4L8P A;  1NWW A;  2B1X B;  1OF5 A;  3F8H A;  3EN8 A;  1O7M B;  1TUH A;  1OF5 B;  3DM8 A;  3GZR A;  3JUQ A;  2PZV A;  3OWS A;  3OXA A;  2A15 A;  2K54 A;  1OCV A;  4LEH A;  2GBX B;  2RCD A;  3B4P A;  4XM4 A;  1Q40 B;  4HM6 B;  3EBY A;  3OWY A;  3FSD A;  3BLZ A;  4LMI A;  1OHO A;  4HVN A;  3HK4 A;  3F9S A;  3K7C A;  2XSO B;  3DZL A;  3B8L A;  4HJL B;  3HZP A;  4HM2 B;  4K1V A;  5IG0 A;  5IF6 A;  2HMK B;  3FLJ A;  4CDL A;  3DMC A;  3EX9 A;  1JKG B;  6STD A;  5JPP A;  2HMJ B;  2STD A;  1JKG A;  1UUV B;  4STD A;  3EBT A;  5CK6 A;  2R4I A;  3EF8 A;  3UJM A;  4HM8 B;  4WWU C;  3G0K A;  3VGN A;  3DXO A;  4KVH A;  5IG4 A;  3G8Z A;  4WYK A;  3FKA A;  1JN5 B;  1S5A A;  2W2C A;  3NV0 B;  4X2H A;  5AEU B;  5CF1 A;  3BB9 A;  5KP4 A;  1Z1S A;  4FCJ A;  2Z76 A;  1OGZ A;  1IDP A;  2XSH B;  3KKG A;  5IEO A;  2YFI B;  3F7S A;  3JUM A;  3CNX A;  5IER A;  3NUV A;  3NM2 A;  5TGN A;  3GZB A;  1EA2 A;  1O7N B;  3JUP A;  5BXQ A;  5AII A;  2HML B;  4L8O A;  4J9A A;  1EG9 B;  3T8U A;  3F40 A;  4HKV B;  3F7X A;  4HZ9 B;  1DMN A;  1ZO2 A;  2GXF A;  3GZX B;  3B4O A;  1W00 A;  2Z7A A;  3ECF A;  4Q53 A;  1W01 A;  1JB5 A;  4MJD A;  5IEP A;  5D82 A;  4WP5 A;  1O7W B;  1NU3 A;  3SED A;  2GBW B;  5AI1 A;  3G16 A;  4XBT A;  4XDW A;  1GY7 A;  1AR0 A;  3FH1 A;  5AIF A;  2CHC A;  2IMJ A;  1A2K A;  1JB2 A;  1JN5 A;  1ULI B;  1O7P B;  3LYG A;  4R9K A;  2HMN B;  2XRX B;  3EC9 A;  3K0Z A;  1U5O A;  3T8N A;  4PEJ A;  2BMO B;  1E3V A;  3E99 A;  3HX8 A;  1OH0 A;  2XR8 B;  3MG3 A;  4HZB B;  1E97 A;  1OHS A;  1ASK A;  3MSO A;  2YFL B;  4GB5 A;  5D83 A;  1W02 A;  1K41 A;  4XB5 A;  8CHO A;  3M8C A;  4XBX A;  2RGQ A;  3D9R A;  3H3H A;  5AIG A;  5BVB A;  3OV4 A;  3GRD A;  1QMA A;  4R9L A;  2BMR B;  3B7C A;  5EVH A;  3RGR A;  5STD A;  2OWP A;  1OGX A;  3CU3 A;  3NXJ A;  1DMQ A;  3Q90 A;  2F86 B;  1HKX A;  2HMM B;  1WQL B;  2JQ5 A;  2QIY A;  3SOA A;  7STD A;  5KP3 A;  2RFR A;  1VZZ A;  3OX9 A;  4RZM A;  3KSP A;  5D81 A;  5DRV A;  3STD A;  4I4K A;  2Z77 A;  2QGU A;  3FF0 A;  3NBR A;  4U13 A;  3NV0 A;  1SJW A;  3FGY A;  3WMD A;  2INX A;  4R1K A;  2GEY A;  1JB4 A;  3MHE A;  3MYT A;  4OVM A;  3SOY A;  1O7H B;  2B24 B;  5HGR A;  5KP1 A;  4WYK B;  5DRE A;  3VSY A; 
#chains in the Genus database with same CATH topology
 3O8Y A;  3D3L A;  1TP6 A;  1QAL A;  1BRI A;  1GS3 A;  1ULJ B;  2BHM A;  1NDO B;  1Q82 4;  1C7H A;  3DGM A;  1RNB A;  2LYX A;  1RGG A;  2IA7 A;  2W56 A;  3KFQ C;  1IT7 A;  3NBJ A;  4J5G A;  1FGT A;  1CQS A;  1RN7 A;  1I8V A;  1W6G A;  1BRK A;  3AHS A;  3KE7 A;  3GWR A;  3EJV A;  4N6T A;  3JUO A;  2CIU A;  1MOL A;  2F98 A;  1W5Z A;  2I9W A;  2BMQ B;  1D6Z A;  1ISK A;  3MG2 A;  4RNT A;  2CKF B;  1BSC A;  3DUK A;  2C4B A;  1GD4 A;  3UNL A;  4CCV A;  1YJW 3;  5G1L A;  3LML A;  2CG1 A;  4EW5 A;  1AVL A;  1M9G A;  3A76 A;  2GEX A;  4LGQ A;  1ZX2 A;  4MMZ B;  1BUJ A;  1LQG C;  2KXG A;  3CME 3;  4L8P A;  3GZR A;  1OF5 A;  2B1X B;  1WMN A;  2BIR A;  1R4C A;  2GU1 A;  1BRH A;  3DH2 A;  1UGI A;  3OW2 2;  1W7C A;  6GSP A;  1T2H A;  4KZ1 A;  1GMP A;  3U97 A;  2RCD A;  3RDE A;  1Q40 B;  4EC6 A;  1IVW A;  2AAE A;  4FMB A;  1OHO A;  2CX1 A;  4GSP A;  3DGY A;  3K7C A;  4HM2 B;  2XSO B;  4XDW A;  3B8L A;  5IG0 A;  2CFD A;  1QVF 2;  2HMK B;  3BND A;  2IY2 A;  5AYR B;  2QEX 3;  1SPU A;  1SQW A;  1JBS A;  3X41 A;  2D42 A;  3K63 A;  1I3F A;  4KFD A;  2C11 A;  3T0U A;  3EBT A;  5EQL A;  3URP A;  4N6O B;  2W6J H;  4WWU C;  5IG4 A;  1MGW A;  1IT8 A;  1JBR A;  4AEQ A;  2W2C A;  2CWT A;  1BRG A;  5AEU B;  1B2S A;  1Z1S A;  3CCE 3;  1GSP A;  2XSH B;  3KKG A;  5IER A;  2BO9 B;  1B21 A;  3NUV A;  1FUT A;  2M7O A;  4AKZ A;  3F40 A;  1RTU A;  1B2M A;  2FGT A;  1VQP 3;  1EQK A;  1X1U A;  2W03 A;  4EBG A;  1ROV A;  3FG1 A;  4MEI A;  5D82 A;  3WA2 X;  1KSI A;  1YJ9 3;  1MWU A;  1RGE A;  1FUW A;  1KWI A;  4LYL B;  3SED A;  3LTD A;  5RNT A;  1AQZ A;  1G96 A;  4HBR A;  1SIH A;  3CCS 3;  2OQE A;  1US1 A;  1JN5 A;  1M1K 4;  1YGE A;  1O7P B;  1F8N A;  4CPK A;  3ZG5 A;  3K5T A;  3NX0 A;  2RNT A;  3T8N A;  1LNI A;  1BNS A;  3QRD A;  1RGK A;  2WO0 A;  2XGL A;  2ZDJ A;  3AMO B;  2RBI A;  1OH0 A;  3E99 A;  2CFK A;  1NJI 4;  2YFL B;  1FGQ A;  4XB5 A;  1T2I A;  2H0H A;  5AIG A;  5BVB A;  5M19 A;  1RCL A;  3OV4 A;  1QMA A;  1AVK A;  3MWZ A;  2BMR B;  5EVH A;  3IMA B;  2OWP A;  2MF7 A;  2OQE C;  3LT8 A;  2F86 B;  1A2P A;  2W04 A;  4FMA A;  2OOV C;  1HKX A;  1WQL B;  2FNQ A;  4JF8 A;  4RZM A;  1VZZ A;  2P0X A;  2Z77 A;  1RRL A;  1BSB A;  1Q7H A;  3NBR A;  3PS8 A;  4O2H A;  3FGY A;  2QA4 3;  5IW9 A;  1YGW A;  1O7H B;  2B24 B;  1S72 3;  1I3I A;  2Z6B A;  1UCK A;  3G6E 3;  1T3B A;  3Q3F A;  3OWU A;  3RGA A;  1ZS7 A;  3EQQ B;  1K28 A;  3LOY A;  3LZA A;  3VGN A;  4N6V 0;  3CC4 3;  3CPO A;  3H51 A;  3IPT A;  1UUW B;  2YFJ B;  3I0Y A;  1BAN A;  1GD3 A;  1GY5 A;  4OUQ A;  1VQ7 3;  1C54 A;  1B2X A;  1W2B 2;  4K1U A;  4BL2 A;  1X1X A;  3EHC A;  3KZT A;  4MMY B;  3F14 A;  2P38 A;  3X3X A;  4MMX B;  1PU4 A;  1BSD A;  1GMR A;  5IEN A;  3FF2 A;  1BNJ A;  1GYB A;  1MWR A;  1OPY A;  3D5G A;  2WGO A;  3FG4 A;  3GZY B;  4WHA A;  1UGH I;  1N8R 4;  1OAC A;  1RMS A;  1TRP A;  2KF5 A;  1UUG B;  3CNM A;  1RRH A;  3ZG0 A;  2P09 A;  4I5Q A;  1TIJ A;  2R41 A;  1HZ1 A;  4J8T A;  4N6L A;  1JV2 B;  4XBY A;  7RNT A;  4HM4 B;  4ORL A;  1EUI C;  1VQK 3;  3ER7 A;  1KQS 2;  1NWW A;  3DM8 A;  3PYJ A;  1OF5 B;  4J5K A;  3OXA A;  1RCK A;  3TDG A;  1MGR A;  4LEH A;  4DKI A;  4FMC A;  4TX4 A;  3LTA A;  4XM4 A;  4HM6 B;  5HOH A;  1BSA A;  3FSD A;  4LMI A;  2W9P A;  1LNH A;  2H0I A;  3F9S A;  1BUQ A;  1A67 A;  3DZL A;  3KCH A;  4LSO A;  3HZP A;  3NQY A;  4H61 A;  3PXM A;  1DVC A;  4NRE A;  5JPP A;  6STD A;  1RSN A;  2STD A;  5ELJ A;  1SAR A;  1B2U A;  1VQO 3;  1YJN 3;  1LOX A;  4HM8 B;  3SX1 A;  3DGL A;  4BTX A;  1QAF A;  2OTJ 3;  1I2F A;  3FKA A;  4X2H A;  4FCZ A;  3BB9 A;  4NHF A;  1UCI A;  1GOU A;  2IUJ A;  3JUM A;  1N8Q A;  3MPH A;  5TGN A;  1BNG A;  2ZL8 A;  3GZB A;  2KF3 A;  1O7N B;  1JBT A;  1A90 A;  3UB1 A;  2HML B;  4J9A A;  3CD6 3;  1DE3 A;  3CCQ 3;  4HKV B;  3F7X A;  4HZ9 B;  1DMN A;  1ZO2 A;  2GXF A;  2KRT A;  3GZX B;  3B4O A;  1W00 A;  3ECF A;  1DYU A;  1N5P A;  3J7Y d;  2H0G A;  4MJD A;  5IEP A;  1KC8 4;  1FW7 A;  2LQV A;  1BAO A;  1RLS A;  1I0X A;  4ZM8 A;  3FH1 A;  2UUG C;  2CHC A;  3NM7 A;  1RGA A;  5GSP A;  3D4A A;  1U5O A;  4PEJ A;  1CEW I;  2KAA A;  3HX8 A;  3PCR A;  2XR8 B;  5AYS C;  4HZB B;  1ASK A;  1DET A;  4BTW A;  2CC3 A;  3LXU X;  4GB5 A;  4N6M A;  1G0T A;  3V92 A;  4AKY A;  2F5W A;  1GOV A;  2WGQ A;  1I0V A;  1V58 A;  4R9L A;  3RGR A;  2FXT A;  5STD A;  3CU3 A;  1OGX A;  4K90 B;  4JRF A;  1BNE A;  2CWV A;  3ALA A;  5BIR A;  2ML6 A;  1YIT 3;  4GHO A;  2QIY A;  1VQM 3;  4QWT A;  7STD A;  3FG3 A;  3KSP A;  1LOV A;  3FCS B;  4I4K A;  1V74 A;  1B20 A;  4R4K A;  1BNI A;  3FF0 A;  4BIR A;  3N54 B;  3NV0 A;  4O02 B;  2HOH A;  4U13 A;  2OOV A;  3CPW 2;  2GU3 A;  3GSP A;  3WOF B;  2GEY A;  3BIR A;  3MHE A;  3MYT A;  3Q2P A;  3S27 A;  3SOY A;  4IT7 A;  1I2E A;  5FGO A;  4N6N B;  3KSE D;  3VSY A;  1W6Y A;  1QJG A;  1RGL A;  4R80 A;  5JPU A;  3FZW A;  3V99 A;  1TFK A;  3PZW A;  5JBS A;  2HMO B;  3PCS A;  2KF4 A;  2RSX A;  2CH9 A;  4BU4 A;  1Q40 A;  1V57 A;  1GY6 A;  5LC7 A;  3MKI A;  3S5C A;  4HM7 B;  1IK3 A;  1UI8 A;  3A5E A;  2F4Y A;  1RHL A;  5AIH A;  1Q42 A;  3EN1 B;  4HM3 B;  1Q7Y 4;  3CMA 3;  1NO3 A;  3HOH A;  4L7K A;  3LH4 A;  1JZO A;  1UDI I;  1STD A;  2JDI H;  1FYS A;  1YI2 3;  4HAA A;  3G71 3;  1MNL A;  4RNZ A;  1W6C A;  2XFT A;  3KII A;  2MC8 A;  1WTH A;  1X1W A;  5CXO A;  1O7G B;  4K61 A;  5G2G A;  1VQ6 3;  1BVI A;  2YX9 A;  1BU4 A;  2F56 A;  4H3U A;  1MWS A;  1AY7 A;  1WMP A;  2UX0 A;  5M1A A;  2UGI A;  3OWS A;  3EN8 A;  1O7M B;  1TUH A;  3JUQ A;  2PZV A;  2A15 A;  1BIR A;  2K54 A;  2K0M A;  1LOY A;  1WNH A;  2GBX B;  4BTY A;  2KCD A;  2P0M A;  3EBY A;  3OWY A;  3BLZ A;  3D79 A;  2XFS A;  2V1L A;  2W56 B;  3HK4 A;  1B2Z A;  2XEP A;  2ZA4 A;  3X3Y A;  3FLJ A;  4CDL A;  4KFE A;  1RGH A;  1QVG 2;  1TU5 A;  1CH0 A;  3BNE A;  3DMC A;  1JKG B;  2F5M A;  1K9M 4;  1RN1 A;  4STD A;  5CK6 A;  1JRQ A;  3EF8 A;  1G02 A;  3UJM A;  3WDG B;  2GSP A;  3G0K A;  2E2T A;  4KVH A;  1LQM B;  1B3S A;  3D5I A;  3G8Z A;  4WYK A;  2K3D A;  1JN5 B;  1QAK A;  1S5A A;  3NV0 B;  5KP4 A;  2ZHX B;  4FCJ A;  2Z76 A;  5IEO A;  1K8A 4;  1N9J A;  3CCU 3;  1PYL A;  4GL6 A;  3I56 3;  1IU7 A;  1SII A;  3NM2 A;  4N6U A;  3WOE B;  1EA2 A;  1Q9E A;  3IJE B;  2L1S A;  3JUP A;  5AII A;  2WOH A;  3WA3 A;  3T8U A;  1HYF A;  2SAR A;  1KD1 4;  2CK3 H;  1YVS A;  2Z7A A;  1YHQ 3;  1YVB I;  4Q53 A;  1IQ8 A;  1JB5 A;  1FGO A;  3BNB A;  1LVN A;  1LOW A;  1BGS A;  4EV5 A;  1NU3 A;  3U1W A;  1IV9 A;  1FGR A;  1BRJ A;  2GBW B;  2Q07 A;  3G16 A;  5AI1 A;  1GY7 A;  2W9Q A;  1AR0 A;  3HIG A;  5AIF A;  2IMJ A;  2D1W A;  1RKY A;  1A2K A;  1IVV A;  1JB2 A;  1FZU A;  1U8C B;  1NNV A;  1ULI B;  2ML5 A;  2HMN B;  3AGN A;  3CCM 3;  3EC9 A;  3K0Z A;  4NPB A;  1VQL 3;  1E3V A;  1EEJ A;  3X3Z A;  1TFO A;  1BNR A;  2Y73 A;  3JVC A;  3MSO A;  1K73 4;  2CG0 A;  5D83 A;  3BU4 A;  1W2Z A;  2E2U A;  3M8C A;  4WFO A;  4RBN A;  3D9R A;  1IYY A;  2CFL A;  3GRD A;  3WHO A;  1D6Y A;  3B7C A;  3WOD G;  3NXJ A;  1L5G B;  1DMQ A;  4HYZ A;  1ZGX A;  2C10 A;  1W4N A;  1BNF A;  1RDS A;  3EB8 A;  3SOA A;  3NBB A;  1IVU A;  3EE1 A;  5DRV A;  1GMQ A;  3STD A;  4FMD A;  3S67 A;  2BU4 A;  3DGN A;  1ROA A;  3WMD A;  3I55 3;  1JB4 A;  1VQQ A;  3CC2 3;  1LXE A;  1NB3 I;  1I70 A;  1M1X B;  1R4Y A;  1UI7 A;  1WMO A;  3LT9 A;  5HGR A;  4G1M B;  4WYK B;  5KP1 A;  5CF2 A;  4HM0 B;  1PFP A;  3HI7 A;  4N3V A;  4FCM A;  1GOY A;  5IG3 A;  4HOH A;  5FW5 A;  1OHP A;  4CJN A;  1YNV X;  5CLK A;  4EV2 A;  5A0O B;  2P05 A;  6RNT A;  9RNT A;  4HM1 B;  3CCL 3;  1OUN A;  3DY5 A;  4HM5 B;  1BOX A;  1AV4 A;  3CCJ 3;  4X2O A;  1T5Y A;  3S29 A;  2BNG A;  5IG5 A;  1JZD A;  2IUK A;  1STF I;  2KF6 A;  3JUN A;  1I2G A;  2F99 A;  1FUS A;  4IIA A;  1TTO A;  2XF3 A;  4XDV A;  3Q1C A;  5AEW B;  1FA3 A;  3N9H A;  3MG1 A;  2CW9 A;  3F8X A;  2L4V A;  1E3R A;  1N9E A;  1DMM A;  2AAD A;  1BRN L;  3NQZ A;  3UL5 A;  3ROB A;  3NHX A;  1RN4 A;  4L8O A;  3F8H A;  1EKM A;  3SVA A;  1NB5 I;  3CCV 3;  1OCV A;  1Q86 4;  2WOF A;  4FR9 A;  1J2B A;  3B4P A;  2E2V A;  3SXX A;  2XGN A;  1N5H A;  3LTC A;  3SLU A;  3RNT A;  4HVN A;  1BRS A;  4K1V A;  4HJL B;  5IF6 A;  1M90 4;  7GSP A;  2PNC A;  3CC7 3;  3N8B A;  4LZI A;  8RNT A;  1X1Y A;  4IPB A;  3EX9 A;  5EEO A;  2HMJ B;  1JKG A;  1LRA A;  1UUV B;  1UW1 A;  3L0R A;  1BSE A;  1VQ9 3;  2R4I A;  1CYV A;  1PY3 A;  5I97 A;  3X40 A;  3DXO A;  3DGO A;  1RGC A;  4O8S A;  3QK9 A;  2Y74 A;  1MWT A;  3UL6 A;  4ILF A;  5CF1 A;  3GAX A;  1IDP A;  1OGZ A;  3BNC A;  5M18 A;  1DVD A;  2YFI B;  3F7S A;  2CFG A;  3AGO A;  3CNX A;  5G1K A;  3WR2 A;  1UCJ A;  1YIJ 3;  3PGB A;  3X42 A;  2SBL A;  3ZFZ A;  1RJO A;  1VQ8 3;  5BXQ A;  3CXC 2;  3CCR 3;  1HU9 A;  1EG9 B;  1IQY A;  2O3O A;  3HII A;  4OK0 A;  1UCL A;  1RGF A;  3SYU A;  2CWU A;  1FGM A;  3VF1 A;  1RNT A;  1W01 A;  3K9M C;  4KFF A;  1VQ5 3;  4WP5 A;  1O7W B;  1VQ4 3;  3G4S 3;  2J8X B;  4XBT A;  2O9U X;  4EXR A;  3AHW A;  1JJ2 2;  2CFW A;  5LC6 A;  3LYG A;  4R9K A;  5ELU A;  2XRX B;  3AMO A;  2BMO B;  3MG3 A;  1E97 A;  1OHS A;  1W02 A;  1K41 A;  2CX0 A;  1Y4K A;  4KT3 B;  8CHO A;  4XBX A;  2RGQ A;  3H3H A;  1TJD A;  3LTB A;  1JNQ A;  2W0Q A;  3Q90 A;  1IVX A;  1A2V A;  2OTL 3;  3V98 A;  1D6U A;  2HMM B;  1TRQ A;  4O3V A;  2JQ5 A;  3KN4 A;  4RNY A;  3S28 A;  5KP3 A;  2BT3 A;  2IYJ A;  1IV7 A;  2RFR A;  3OX9 A;  5D81 A;  1B27 A;  2OCT A;  2XH9 A;  1Q81 4;  5BU4 A;  1CYU A;  1IQX A;  2QGU A;  1SJW A;  1VQN 3;  2INX A;  4R1K A;  4OVM A;  4EYC A;  4BL3 A;  5DRE A; 
#chains in the Genus database with same CATH homology
 3O8Y A;  3D3L A;  1TP6 A;  1QAL A;  1GS3 A;  1ULJ B;  2BHM A;  1NDO B;  1Q82 4;  1C7H A;  3DGM A;  2LYX A;  2IA7 A;  2W56 A;  3KFQ C;  1IT7 A;  3NBJ A;  1FGT A;  1CQS A;  1RN7 A;  1W6G A;  3KE7 A;  3GWR A;  3EJV A;  4N6T A;  3JUO A;  2CIU A;  1MOL A;  2F98 A;  1W5Z A;  2I9W A;  2BMQ B;  1D6Z A;  1ISK A;  3MG2 A;  2CKF B;  3DUK A;  1GD4 A;  3UNL A;  4CCV A;  1YJW 3;  3LML A;  2CG1 A;  1M9G A;  1AVL A;  3A76 A;  2GEX A;  4LGQ A;  1ZX2 A;  4MMZ B;  2KXG A;  3CME 3;  4L8P A;  3GZR A;  1OF5 A;  2B1X B;  1WMN A;  2GU1 A;  1R4C A;  3OW2 2;  1W7C A;  4KZ1 A;  3U97 A;  2RCD A;  3RDE A;  1Q40 B;  4EC6 A;  1IVW A;  4FMB A;  1OHO A;  4XDW A;  3K7C A;  4HM2 B;  2XSO B;  3B8L A;  5IG0 A;  2CFD A;  1QVF 2;  2HMK B;  3BND A;  5AYR B;  2QEX 3;  1SPU A;  1SQW A;  3X41 A;  2D42 A;  3K63 A;  4KFD A;  2C11 A;  3T0U A;  3EBT A;  5EQL A;  4N6O B;  2W6J H;  4WWU C;  5IG4 A;  1IT8 A;  4AEQ A;  2W2C A;  2CWT A;  5AEU B;  1Z1S A;  3CCE 3;  2XSH B;  3KKG A;  5IER A;  2BO9 B;  3NUV A;  2M7O A;  4AKZ A;  3F40 A;  2FGT A;  1VQP 3;  1EQK A;  2W03 A;  4EBG A;  1ROV A;  3FG1 A;  4MEI A;  5D82 A;  3WA2 X;  1KSI A;  1YJ9 3;  1FUW A;  1KWI A;  3SED A;  3LTD A;  1G96 A;  4HBR A;  1SIH A;  3CCS 3;  2OQE A;  1US1 A;  1JN5 A;  1M1K 4;  1YGE A;  1O7P B;  1F8N A;  3K5T A;  3NX0 A;  3T8N A;  3QRD A;  2WO0 A;  2XGL A;  3AMO B;  2ZDJ A;  3E99 A;  1OH0 A;  2CFK A;  1NJI 4;  2YFL B;  1FGQ A;  4XB5 A;  5AIG A;  5BVB A;  3OV4 A;  1QMA A;  1AVK A;  3MWZ A;  2BMR B;  5EVH A;  3IMA B;  2OWP A;  2MF7 A;  2OQE C;  3LT8 A;  2F86 B;  2W04 A;  4FMA A;  2OOV C;  1HKX A;  1WQL B;  2FNQ A;  4JF8 A;  4RZM A;  1VZZ A;  2P0X A;  2Z77 A;  1RRL A;  3NBR A;  3PS8 A;  4O2H A;  3FGY A;  2QA4 3;  5IW9 A;  1O7H B;  2B24 B;  1S72 3;  2Z6B A;  3G6E 3;  3OWU A;  3RGA A;  3LZA A;  3EQQ B;  1K28 A;  3LOY A;  3VGN A;  3CC4 3;  4N6V 0;  3CPO A;  3H51 A;  3IPT A;  1UUW B;  2YFJ B;  3I0Y A;  1GD3 A;  1GY5 A;  4OUQ A;  1VQ7 3;  1W2B 2;  4K1U A;  3EHC A;  3KZT A;  4MMY B;  3F14 A;  2P38 A;  3X3X A;  4MMX B;  1PU4 A;  5IEN A;  3FF2 A;  1OPY A;  1GYB A;  3GZY B;  1N8R 4;  3FG4 A;  2WGO A;  4WHA A;  1OAC A;  3CNM A;  1RRH A;  2P09 A;  1TIJ A;  4N6L A;  4J8T A;  4XBY A;  1JV2 B;  4HM4 B;  4ORL A;  1VQK 3;  3ER7 A;  1KQS 2;  1NWW A;  3DM8 A;  3PYJ A;  1OF5 B;  3OXA A;  3TDG A;  4LEH A;  4FMC A;  4TX4 A;  3LTA A;  4XM4 A;  4HM6 B;  3FSD A;  4LMI A;  2W9P A;  1LNH A;  3F9S A;  1BUQ A;  1A67 A;  3DZL A;  3HZP A;  3NQY A;  4H61 A;  3PXM A;  1DVC A;  4NRE A;  5JPP A;  6STD A;  2STD A;  5ELJ A;  1VQO 3;  1YJN 3;  1LOX A;  4HM8 B;  3SX1 A;  3DGL A;  4BTX A;  1QAF A;  2OTJ 3;  3FKA A;  4X2H A;  4FCZ A;  3BB9 A;  4NHF A;  2IUJ A;  3JUM A;  1N8Q A;  3MPH A;  5TGN A;  2ZL8 A;  3GZB A;  1O7N B;  1A90 A;  3UB1 A;  2HML B;  4J9A A;  3CD6 3;  3CCQ 3;  4HKV B;  3F7X A;  4HZ9 B;  1DMN A;  1ZO2 A;  2GXF A;  2KRT A;  3GZX B;  3B4O A;  1W00 A;  3ECF A;  1DYU A;  1N5P A;  3J7Y d;  4MJD A;  5IEP A;  1KC8 4;  2LQV A;  4ZM8 A;  3FH1 A;  2CHC A;  3NM7 A;  1U5O A;  4PEJ A;  1CEW I;  3HX8 A;  3PCR A;  2XR8 B;  5AYS C;  4HZB B;  1ASK A;  4BTW A;  2CC3 A;  3LXU X;  4GB5 A;  4N6M A;  3V92 A;  4AKY A;  2WGQ A;  4R9L A;  3RGR A;  2FXT A;  5STD A;  3CU3 A;  1OGX A;  4K90 B;  4JRF A;  2CWV A;  3ALA A;  2ML6 A;  1YIT 3;  2QIY A;  1VQM 3;  4QWT A;  7STD A;  3FG3 A;  3KSP A;  3FCS B;  4I4K A;  1V74 A;  4R4K A;  3FF0 A;  3N54 B;  3NV0 A;  4O02 B;  4U13 A;  2OOV A;  3CPW 2;  2GU3 A;  3WOF B;  2GEY A;  3MHE A;  3MYT A;  3Q2P A;  3S27 A;  3SOY A;  4IT7 A;  5FGO A;  4N6N B;  3KSE D;  3VSY A;  1W6Y A;  1QJG A;  4R80 A;  5JPU A;  3FZW A;  3V99 A;  1TFK A;  3PZW A;  5JBS A;  2HMO B;  3PCS A;  2RSX A;  2CH9 A;  1Q40 A;  3S5C A;  1GY6 A;  5LC7 A;  3MKI A;  1IK3 A;  4HM7 B;  1UI8 A;  5AIH A;  1Q42 A;  3EN1 B;  4HM3 B;  1Q7Y 4;  3CMA 3;  1NO3 A;  4L7K A;  3LH4 A;  2JDI H;  1YI2 3;  1STD A;  3G71 3;  1MNL A;  4RNZ A;  1W6C A;  2XFT A;  3KII A;  2MC8 A;  1WTH A;  5G2G A;  5CXO A;  1O7G B;  4K61 A;  1VQ6 3;  2YX9 A;  4H3U A;  2UX0 A;  1WMP A;  3OWS A;  3EN8 A;  1O7M B;  1TUH A;  3JUQ A;  2PZV A;  2A15 A;  2K54 A;  2K0M A;  2GBX B;  1WNH A;  4BTY A;  2KCD A;  2P0M A;  3EBY A;  3OWY A;  3BLZ A;  2XFS A;  2V1L A;  2W56 B;  3HK4 A;  2XEP A;  3X3Y A;  3FLJ A;  4CDL A;  4KFE A;  1QVG 2;  1TU5 A;  3BNE A;  3DMC A;  1JKG B;  1K9M 4;  4STD A;  5CK6 A;  1JRQ A;  3EF8 A;  3UJM A;  3WDG B;  3G0K A;  2E2T A;  4KVH A;  3G8Z A;  4WYK A;  1JN5 B;  1QAK A;  1S5A A;  3NV0 B;  5KP4 A;  4FCJ A;  5IEO A;  2Z76 A;  1K8A 4;  1N9J A;  3CCU 3;  4GL6 A;  3I56 3;  1IU7 A;  1SII A;  3NM2 A;  4N6U A;  3WOE B;  1EA2 A;  3IJE B;  3JUP A;  5AII A;  2WOH A;  3WA3 A;  3T8U A;  1KD1 4;  2CK3 H;  1YHQ 3;  2Z7A A;  1YVB I;  4Q53 A;  1IQ8 A;  1JB5 A;  1FGO A;  3BNB A;  1LVN A;  4EV5 A;  1NU3 A;  3U1W A;  1IV9 A;  1FGR A;  2GBW B;  5AI1 A;  2Q07 A;  3G16 A;  1GY7 A;  2W9Q A;  1AR0 A;  3HIG A;  5AIF A;  2IMJ A;  2D1W A;  1RKY A;  1A2K A;  1IVV A;  1JB2 A;  1U8C B;  1ULI B;  4LSO A;  3CCM 3;  2ML5 A;  2HMN B;  3EC9 A;  3K0Z A;  1VQL 3;  1E3V A;  3X3Z A;  1TFO A;  2Y73 A;  3JVC A;  3MSO A;  1K73 4;  2CG0 A;  5D83 A;  1W2Z A;  2E2U A;  3M8C A;  4WFO A;  4RBN A;  3D9R A;  2CFL A;  3GRD A;  1D6Y A;  3B7C A;  3WOD G;  3NXJ A;  1L5G B;  1DMQ A;  4HYZ A;  2C10 A;  1W4N A;  3EB8 A;  3SOA A;  3NBB A;  1IVU A;  3EE1 A;  5DRV A;  3STD A;  4FMD A;  3S67 A;  3DGN A;  1ROA A;  3WMD A;  3I55 3;  1JB4 A;  3CC2 3;  1LXE A;  1NB3 I;  1M1X B;  1UI7 A;  1WMO A;  3LT9 A;  5HGR A;  4G1M B;  4WYK B;  5KP1 A;  5CF2 A;  4HM0 B;  1PFP A;  3HI7 A;  4N3V A;  4FCM A;  5IG3 A;  5FW5 A;  1OHP A;  4EV2 A;  5CLK A;  5A0O B;  2P05 A;  4HM1 B;  3CCL 3;  1OUN A;  3DY5 A;  4HM5 B;  3CCJ 3;  1AV4 A;  4X2O A;  1T5Y A;  3S29 A;  2BNG A;  5IG5 A;  2IUK A;  1STF I;  3JUN A;  2F99 A;  4IIA A;  2XF3 A;  4XDV A;  3Q1C A;  5AEW B;  1FA3 A;  3N9H A;  3MG1 A;  2CW9 A;  3F8X A;  2L4V A;  1E3R A;  1N9E A;  1DMM A;  3NQZ A;  3UL5 A;  3ROB A;  3NHX A;  4L8O A;  3F8H A;  1EKM A;  3SVA A;  1NB5 I;  3CCV 3;  1OCV A;  1Q86 4;  2WOF A;  4FR9 A;  1J2B A;  3B4P A;  2E2V A;  3SXX A;  2XGN A;  1N5H A;  3LTC A;  3SLU A;  4HVN A;  4K1V A;  4HJL B;  5IF6 A;  1M90 4;  2PNC A;  3CC7 3;  3N8B A;  4LZI A;  4IPB A;  3EX9 A;  5EEO A;  2HMJ B;  1JKG A;  1UUV B;  1UW1 A;  3L0R A;  1VQ9 3;  2R4I A;  1CYV A;  5I97 A;  3X40 A;  3DXO A;  3DGO A;  4O8S A;  3QK9 A;  2Y74 A;  3UL6 A;  5CF1 A;  3GAX A;  1IDP A;  1OGZ A;  3BNC A;  1DVD A;  2YFI B;  3F7S A;  2CFG A;  3CNX A;  1YIJ 3;  3PGB A;  3X42 A;  2SBL A;  1RJO A;  1VQ8 3;  5BXQ A;  3CXC 2;  3CCR 3;  1HU9 A;  1EG9 B;  1IQY A;  2O3O A;  3HII A;  4OK0 A;  2CWU A;  1FGM A;  3VF1 A;  1W01 A;  3K9M C;  4KFF A;  1VQ5 3;  4WP5 A;  1O7W B;  1VQ4 3;  3G4S 3;  4XBT A;  2O9U X;  4EXR A;  1JJ2 2;  2CFW A;  5LC6 A;  3LYG A;  4R9K A;  5ELU A;  2XRX B;  3AMO A;  2BMO B;  3MG3 A;  1E97 A;  1OHS A;  1W02 A;  1K41 A;  1Y4K A;  8CHO A;  4XBX A;  2RGQ A;  3H3H A;  3LTB A;  1JNQ A;  2W0Q A;  3Q90 A;  1IVX A;  1A2V A;  2OTL 3;  3V98 A;  1D6U A;  2HMM B;  4O3V A;  4RNY A;  2JQ5 A;  3KN4 A;  3S28 A;  5KP3 A;  2BT3 A;  2RFR A;  1IV7 A;  3OX9 A;  5D81 A;  2XH9 A;  2OCT A;  1Q81 4;  1CYU A;  1IQX A;  2QGU A;  1SJW A;  1VQN 3;  2INX A;  4R1K A;  4OVM A;  4EYC A;  5DRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...