5D82A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y16(cl-y)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
125
Chain Sequence
NLPTAQEVQGLMARIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Delta(5)-3-ketosteroid isomerase
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 31
structure length 125
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d82A00
1TUHA 3B4PA 2XR8B 2HMOB 4J9AA 3GWRA 2YFLB 3EF8A 5FW5A 3B8LA 3NV0B 5STDA 1OH0A 2OWPA 1E3VA 2STDA 2RGQA 3FLJA 1JKGA 3MG3A 2XSHB 3GZXB 4HM2B 4U13A 2GEYA 1O7NB 3F9SA 3H3HA 1GY7A 4J8TA 2GBXB 4STDA 3FF2A 2BMOB 3HK4A 4MJDA 4CDLA 3NXJA 1U5OA 8CHOA 1OF5A 1W01A 4HM4B 1JB2A 3KSPA 5IENA 3RGRA 4X2HA 3FGYA 3CNMA 2B1XB 1O7WB 4K1VA 4LEHA 1GS3A 1JN5A 5AIFA 3NUVA 2GXFA 1ZX2A 1OHSA 1STDA 1O7HB 2F98A 5KP4A 3OV4A 4HZBB 5EVHA 2PZVA 5AEUB 3ECFA 3D9RA 4KVHA 2YFIB 3VSYA 5AIGA 2JQ5A 3OWSA 3FZWA 5D81A 2QGUA 3MHEA 3G8ZA 1JKGB 1AR0A 3G0KA 3BLZA 3STDA 3EBTA 3IPTA 3NM2A 5IG0A 2HMKB 1NU3A 5CF2A 2INXA 5AEWB 5BVBA 1Q42A 1OF5B 1E3RA 3KE7A 3S5CA 3DMCA 1QJGA 1ZO2A 1ASKA 5DREA 4K1UA 1JN5B 2GEXA 3I0YA 4OVMA 2IMJA 2XRXB 3BB9A 2BNGA 4HJLB 5IG4A 1OHPA 4WYKA 4LMIA 4XM4A 6STDA 1Q40A 1EA2A 1WQLB 1OHOA 2QIYA 3T8UA 4XDVA 5CK6A 4R9KA 2F99A 4WWUC 1BUQA 1IDPA 4L8OA 3EC9A 5AIHA 3MSOA 1OGXA 3F8HA 5IERA 1W02A 1O7GB 3HX8A 3K7CA 1QMAA 3DXOA 3K0ZA 1EG9B 4XBYA 5IEPA 4FCMA 5AIIA 3GZBA 3LZAA 1SJWA 2CKFB 4GB5A 1UUWB 1W6YA 5TGNA 4XBTA 3EHCA 2Z7AA 4HM7B 7STDA 3GRDA 3HZPA 3JUPA 4PEJA 5JPUA 3EX9A 1O7MB 1C7HA 5KP3A 2RFRA 4WYKB 4IIAA 1Q40B 3NHXA 3F7SA 4R9LA 3SOAA 3M8CA 5G2GA 4H3UA 1ULJB 3F14A 3MG2A 1K41A 5D83A 5BXQA 3CPOA 4LGQA 1UUVB 3UJMA 2Z77A 1OCVA 5CF1A 3MYTA 2XSOB 2F86B 3F7XA 5AI1A 5D82A 3Q90A 3VGNA 4HM8B 3B7CA 3F8XA 3WMDA 2CHCA 2K54A 3GZYB 1NWWA 5CLKA 3SEDA 3JUMA 1ISKA 4HM0B 4ORLA 3ER7A 4HM6B 3MG1A 3CNXA 4HM3B 1Z1SA 1JB5A 3FKAA 3OWYA 4HM1B 3T8NA 3UNLA 3FSDA 4I4KA 2HMNB 3SOYA 3OXAA 1OGZA 1VZZA 5KP1A 3G16A 4HKVB 5IG3A 3OWUA 2HMLB 1HKXA 1GY6A 1OPYA 3NBRA 3DZLA 3EBYA 5IG5A 4WP5A 1OUNA 3JUOA 2I9WA 1GY5A 2GBWB 3OX9A 3ROBA 1CQSA 1TP6A 5IEOA 2UX0A 4N3VA 4OUQA 2HMMB 4HM5B 1JB4A 1DMMA 1ULIB 5DRVA 1O7PB 5IF6A 1A2KA 2A15A 1S5AA 4XB5A 1GYBA 2BMRB 2YFJB 5HGRA 3EQQB 3NV0A 4FCJA 3DUKA 4X2OA 4XDWA 3FH1A 3GZRA 2B24B 1NDOB 3FF0A 2BMQB 4HVNA 3CU3A 4R1KA 3MKIA 3E99A 3JUNA 4Q53A 3RGAA 1W00A 4RZMA 4XBXA 3H51A 1DMNA 2HMJB 1DMQA 2R4IA 2RCDA 3JUQA 3F40A 4L8PA 3B4OA 3A76A 3EN1B 3LYGA 3EN8A 5JPPA 2W2CA 3DM8A 4HZ9B 3EJVA 3KKGA 4L7KA 5CXOA 3KZTA 2Z76A 1E97A
chains in the Genus database with same CATH superfamily
2FGTA 1IVXA 1I0XA 1X1YA 2IUKA 4AKYA 1AY7A 3CME3 2CK3H 1NJI4 1TUHA 2KF5A 1SQWA 2WGOA 3B4PA 2XR8B 2HMOB 3HI7A 3S29A 4FR9A 3X42A 1YGWA 9RNTA 1UUGB 3EB8A 4J9AA 1KQS2 3GWRA 1HYFA 1V74A 1PFPA 1EKMA 1RDSA 2IYJA 2YFLB 2ZDJA 3KCHA 3LTAA 3EF8A 5FW5A 3B8LA 3NV0B 5STDA 3PYJA 1OH0A 1WMOA 2OWPA 1E3VA 3CCU3 3DGNA 2STDA 3CMA3 1YIT3 2RGQA 3FLJA 4GL6A 1RLSA 1JKGA 1LVNA 2BHMA 1STFI 4MMYB 3WDGB 3WA3A 3MG3A 1WNHA 4NHFA 3NQYA 2XSHB 1FUTA 4HAAA 3GZXB 1JZDA 2CFGA 1GD3A 4HM2B 4U13A 2GEYA 2CW9A 4WFOA 2F5WA 1O7NB 4XDWA 1UDII 2GSPA 3F9SA 3H3HA 1GY7A 1RRHA 1L5GB 2Q07A 1BRJA 3PCSA 3URPA 4J8TA 1CYUA 2GBXB 4R80A 1DVDA 1TRPA 4STDA 1LRAA 3BNEA 2W0QA 2BMOB 3FF2A 3HK4A 4MJDA 4LZIA 4N6UA 3ZFZA 4BL2A 3NXJA 1U5OA 4CDLA 4EBGA 1KC84 1FGRA 2P0MA 8CHOA 1OF5A 1W01A 1FGTA 4HM4B 3V92A 3QK9A 1YI23 1JB2A 2XFTA 2GU1A 3AHWA 1RN4A 3GAXA 3KSPA 5IENA 1B27A 1IVUA 2W03A 3BNBA 3FGYA 3CNMA 4X2HA 3RGRA 1GOUA 2B1XB 1O7WB 1X1UA 3NX0A 1BNFA 4K1VA 3PXMA 4LEHA 6RNTA 1MGWA 3LTCA 1GS3A 1JN5A 1UCJA 3NUVA 5AIFA 3D4AA 2GXFA 1ZX2A 5M1AA 1OHSA 1JZOA 1STDA 1O7HB 2UUGC 2PNCA 2F98A 4H61A 5KP4A 1RN1A 1RN7A 3OV4A 4HZBB 5EVHA 1I70A 1QVF2 3AGNA 2PZVA 1M904 5AEUB 1MWTA 1WMPA 3ECFA 3PS8A 4KFEA 4RNTA 5EQLA 3D9RA 4KVHA 2YFIB 1TJDA 3VSYA 1FZUA 4KT3B 3RDEA 1GD4A 1Q7Y4 5AIGA 2P38A 4N6LA 1R4YA 2L4VA 2JQ5A 3SYUA 4RNYA 3PZWA 3OWSA 3FZWA 3O8YA 2OCTA 2H0GA 2KF6A 5D81A 1VQ63 1YGEA 2P0XA 2QGUA 3MHEA 3SXXA 2CFLA 1VQM3 3G8ZA 1BRKA 1QAKA 1N9EA 2KF4A 1JKGB 4N6MA 1AR0A 1MGRA 3BLZA 3G0KA 3UL6A 3ZG0A 4BL3A 1G0TA 3STDA 3RNTA 3EBTA 3IPTA 4RBNA 3NM2A 1FGOA 1BSAA 2GU3A 4HBRA 1N8QA 2HMKB 2F4YA 2ZL8A 3Q2PA 5IG0A 1NU3A 1BNGA 4BTXA 3NM7A 2E2UA 2Y73A 2SBLA 2XFSA 1K28A 5CF2A 2INXA 3KSED 4CPKA 3FCSB 5AEWB 2H0IA 4ILFA 5BVBA 3JVCA 1YJW3 1JBRA 1CEWI 2LQVA 4N6TA 1VQO3 1GOYA 3X3ZA 1K8A4 1Q42A 1OF5B 1B2UA 3WODG 1E3RA 3KE7A 3S5CA 3AMOA 2C11A 3DMCA 1QJGA 1Q864 1ZO2A 1YVBI 1BNRA 1HU9A 1ASKA 2CX1A 5DREA 3AHSA 3LH4A 4JF8A 4K1UA 3Q3FA 1JN5B 2FNQA 4O8SA 2K3DA 2GEXA 1VQN3 3AGOA 3I0YA 2E2TA 4OVMA 1FA3A 3X3YA 3LTBA 2IMJA 1CH0A 2XRXB 2XGNA 1MWRA 4EXRA 1RGEA 1YJ93 1GMPA 3G4S3 3BB9A 3G713 1IV9A 2BNGA 1BIRA 4MMZB 1JBTA 2W6JH 2HOHA 2RNTA 4EV2A 5M19A 4HJLB 5IG4A 1TFKA 1VQ93 1R4CA 1OHPA 2CFDA 4WYKA 1TU5A 4LMIA 4XM4A 6STDA 1D6UA 1Q40A 1EA2A 2WOHA 4ZM8A 1JBSA 1BUJA 1LNHA 1WQLB 1WMNA 3J7Yd 4O2HA 1OHOA 2QIYA 3T8UA 1KWIA 4XDVA 3SVAA 2YX9A 1YVSA 1US1A 1MNLA 5CK6A 1TRQA 4R9KA 2F99A 1AVLA 1MWSA 1UCIA 3MWZA 1J2BA 1C54A 4LYLB 4WWUC 1BUQA 3BIRA 3NQZA 3A5EA 1GOVA 1IDPA 3WA2X 3U97A 1AVKA 5G1LA 1JNQA 4O3VA 4L8OA 3EC9A 1BRGA 5AIHA 2OTJ3 3MSOA 1OGXA 1V58A 4QWTA 2CWVA 1RNTA 1UCLA 3F8HA 5IERA 5BU4A 1W02A 3MPHA 1O7GB 1B2ZA 3HX8A 4HOHA 3ALAA 5RNTA 1M9GA 1G02A 1GMQA 1PU4A 3K7CA 3CC73 1QMAA 3DXOA 2F56A 1RGCA 3K0ZA 3CCE3 1EG9B 3AMOB 4EC6A 1FUSA 4XBYA 3WR2A 5IEPA 1IQXA 3DGOA 4FCMA 2OQEA 3EE1A 5AIIA 1W5ZA 3GZBA 3CC43 2W9PA 3SX1A 2RSXA 3LZAA 1SJWA 1BNIA 2CKFB 1M1XB 1LOYA 4GB5A 4R4KA 4CCVA 1UUWB 1W6YA 5TGNA 4XBTA 3EHCA 1VQ43 1VQQA 1IT7A 2Z7AA 4HM7B 5GSPA 2IUJA 1X1XA 1ROAA 1RMSA 7STDA 1QVG2 3GRDA 1QALA 3HZPA 3JUPA 4LSOA 2CIUA 3NBJA 4PEJA 1TIJA 5JPUA 1BNEA 3EX9A 3HIIA 1A67A 1SIHA 1I2EA 2JDIH 1O7MB 1C7HA 5KP3A 1JJ22 2RFRA 2J8XB 4WYKB 1A2VA 2QEX3 4GSPA 4IIAA 1Q40B 3NHXA 1ROVA 3F7SA 4R9LA 1UGIA 1ZGXA 3X40A 8RNTA 3SOAA 1JV2B 2KAAA 1IT8A 2ZA4A 2MC8A 3TDGA 1BGSA 4BTYA 4DKIA 3D5IA 1MWUA 1I0VA 3M8CA 5G2GA 1A2PA 1YNVX 2D42A 1NO3A 2IA7A 4H3UA 1ULJB 1IU7A 1Y4KA 1BSEA 1JRQA 3F14A 3D79A 1B2MA 2KCDA 1RSNA 1I2FA 5EEOA 4AKZA 2C4BA 5A0OB 3MG2A 1K41A 5D83A 5BXQA 3CPOA 4LGQA 1UUVB 3UJMA 1DE3A 4X2OA 2Z77A 2V1LA 1LOWA 2OTL3 1RGAA 1OCVA 1GSPA 1RKYA 5CF1A 3MYTA 2XSOB 2F86B 2W04A 1Q824 4EV5A 3F7XA 1LQMB 4N6NB 3GSPA 5AI1A 1LNIA 5D82A 3G6E3 3Q90A 5LC6A 3VGNA 4GHOA 4HM8B 4FMBA 3B7CA 1Q814 2KF3A 1FGQA 3PGBA 1SARA 5ELJA 3BNCA 3F8XA 1RNBA 2D1WA 1W2B2 6GSPA 4NREA 4J5GA 3CC23 1UI8A 1UW1A 2OOVA 3WMDA 2CHCA 2K54A 3CCL3 7GSPA 1Q7HA 3CCJ3 3GZYB 3NBBA 4KFDA 3DY5A 2MF7A 1SPUA 1NWWA 5CLKA 1YHQ3 4WHAA 3JUMA 3SEDA 1ISKA 5FGOA 4HM0B 4ORLA 3FG4A 1V57A 2K0MA 3DGYA 3ER7A 1KSIA 3KN4A 4HM6B 3MG1A 3CNXA 2M7OA 4HM3B 5G1KA 1Z1SA 4KFFA 1JB5A 2XF3A 2CC3A 2CWTA 3FKAA 3OWYA 1AV4A 1BSCA 4HM1B 2IY2A 2CG1A 3T8NA 2F5MA 1YJN3 2C10A 3UNLA 1UI7A 3FSDA 1B2SA 1LOVA 3LOYA 4I4KA 2HMNB 3OW22 1BRSA 3SOYA 3OXAA 1OGZA 1VZZA 4BU4A 1RTUA 4IPBA 4K90B 1UCKA 2WO0A 1RCKA 5ELUA 5KP1A 2BIRA 3G16A 4OK0A 3U1WA 3WHOA 1K9M4 1EQKA 1T2HA 1W6CA 2AADA 1UGHI 1W7CA 2CFKA 1FGMA 2CWUA 2W9QA 4HKVB 3KFQC 3ZG5A 1RRLA 3OWUA 2SARA 5BIRA 5IG3A 3WOFB 2CX0A 3HOHA 4FMDA 5LC7A 3WOEB 1F8NA 2HMLB 1D6YA 2RBIA 1HKXA 2O9UX 3LTDA 1YIJ3 1GY6A 1OPYA 3L0RA 3NBRA 3DZLA 3EBYA 1IVVA 5IG5A 3CCS3 1KD14 4WP5A 1U8CB 1HZ1A 4MMXB 3V99A 1OUNA 3X41A 3K63A 3I563 4KZ1A 3DGMA 3FG3A 1DVCA 3JUOA 2I9WA 1GY5A 5AYRB 2GBWB 2OQEC 2XGLA 1BSBA 3OX9A 4FCZA 4FMCA 4IT7A 1DYUA 5IW9A 5HOHA 1BSDA 3ROBA 2WGQA 2XEPA 1VQL3 3V98A 1N5HA 4BIRA 1CQSA 2H0HA 1TP6A 3LT9A 5IEOA 2UX0A 4G1MB 2FXTA 1FYSA 4N3VA 1N5PA 4AEQA 1A90A 1RGFA 1I2GA 4OUQA 3D3LA 2HMMB 4HM5B 1JB4A 2W56A 3SLUA 3K9MC 3UB1A 1IK3A 3CPW2 1DMMA 3BU4A 1ULIB 3LT8A 4CJNA 5DRVA 2CH9A 1O7PB 1DETA 4EYCA 5IF6A 1PY3A 3PCRA 1RGHA 4HYZA 1M1K4 1A2KA 3BNDA 1MOLA 2A15A 4K61A 5M18A 1S5AA 7RNTA 1W2ZA 2Y74A 4I5QA 2KXGA 1LQGC 1B3SA 1I8VA 3LMLA 1IVWA 4XB5A 4BTWA 3DGLA 1GYBA 1BVIA 2BMRB 4J5KA 3I553 2YFJB 1T5YA 4FMAA 4JRFA 1BANA 1RHLA 1T3BA 5HGRA 3S67A 4EW5A 3CCM3 2R41A 3CXC2 3DH2A 3EQQB 1IV7A 1Q9EA 3NV0A 1B21A 4FCJA 1W6GA 1LXEA 3DUKA 3FG1A 3IMAB 3N8BA 2BO9B 1D6ZA 2ML6A 1BNJA 1CYVA 3FH1A 3GZRA 3Q1CA 2B24B 1W4NA 1S723 1NDOB 1SIIA 3FF0A 1RJOA 1B2XA 2BMQB 3IJEB 4HVNA 1B20A 1IQ8A 3T0UA 2BT3A 4NPBA 3CD63 1RGLA 1I3FA 1RGGA 2KRTA 3CU3A 1BOXA 4R1KA 2ZHXB 3D5GA 3MKIA 2L1SA 1TTOA 2O3OA 4RNZA 1FW7A 3E99A 3JUNA 4Q53A 3RGAA 2LYXA 1GMRA 1W00A 1G96A 3VF1A 4RZMA 1VQP3 1VQ73 1VQ53 3S27A 4XBXA 1RGKA 2OOVC 5I97A 5AYSC 3CCV3 1LOXA 3K5TA 4TX4A 2BU4A 3H51A 1NB3I 2CFWA 1N8R4 3QRDA 1DMNA 1QAFA 1NNVA 2HMJB 2ML5A 2XH9A 3HIGA 3X3XA 4MEIA 1DMQA 1BRIA 3N54B 2R4IA 1T2IA 4O02B 1VQK3 1WTHA 2RCDA 1IYYA 1BAOA 4N6OB 2UGIA 3F40A 3JUQA 1ZS7A 1BNSA 1EUIC 4L8PA 3B4OA 3S28A 1BRNL 1PYLA 2AAEA 3N9HA 2W56B 3A76A 2P05A 2P09A 1RCLA 2WOFA 2Z6BA 2E2VA 1X1WA 3EN1B 3LYGA 5JBSA 1FUWA 3EN8A 5JPPA 2W2CA 3DM8A 3CCR3 3LXUX 2CG0A 1NB5I 1EEJA 3CCQ3 2QA43 4HZ9B 3EJVA 3KKGA 3KZTA 4L7KA 2Z76A 5CXOA 1BRHA 1N9JA 1VQ83 1IQYA 1I3IA 4N6V0 1K734 1TFOA 3UL5A 1BU4A 1AQZA 1E97A 3KIIA 1OACA
chains in the Genus database with same CATH topology
2FGTA 1IVXA 2IUKA 4AKYA 3CME3 1NJI4 2CK3H 1TUHA 1SQWA 2WGOA 3B4PA 2XR8B 2HMOB 3HI7A 3S29A 4FR9A 3X42A 3EB8A 4J9AA 1KQS2 3GWRA 1V74A 1PFPA 1EKMA 2YFLB 2ZDJA 3LTAA 3EF8A 5FW5A 3B8LA 3NV0B 5STDA 3PYJA 1OH0A 1WMOA 2OWPA 1E3VA 3CCU3 3DGNA 2STDA 3CMA3 1YIT3 2RGQA 3FLJA 4GL6A 1JKGA 1LVNA 2BHMA 1STFI 4MMYB 3WDGB 3WA3A 3MG3A 1WNHA 4NHFA 3NQYA 2XSHB 3GZXB 2CFGA 1GD3A 4HM2B 4U13A 2GEYA 2CW9A 4WFOA 1O7NB 4XDWA 3F9SA 3H3HA 1GY7A 1RRHA 1L5GB 2Q07A 3PCSA 4J8TA 1CYUA 2GBXB 4R80A 1DVDA 4STDA 3FF2A 3BNEA 2W0QA 2BMOB 3HK4A 4MJDA 4CDLA 4LZIA 4N6UA 3NXJA 1U5OA 4EBGA 1KC84 1FGRA 2P0MA 8CHOA 1OF5A 1W01A 1FGTA 4HM4B 3V92A 3QK9A 1YI23 1JB2A 2XFTA 2GU1A 3GAXA 3KSPA 5IENA 1IVUA 2W03A 3BNBA 3FGYA 4X2HA 3CNMA 3RGRA 2B1XB 1O7WB 3NX0A 4K1VA 3PXMA 4LEHA 3LTCA 1GS3A 1JN5A 5AIFA 3NUVA 2GXFA 1ZX2A 1OHSA 1STDA 1O7HB 2PNCA 2F98A 4H61A 5KP4A 1RN7A 3OV4A 4HZBB 5EVHA 1QVF2 2PZVA 1M904 5AEUB 1WMPA 3ECFA 3PS8A 4KFEA 5EQLA 3D9RA 4KVHA 2YFIB 3VSYA 3RDEA 1GD4A 1Q7Y4 5AIGA 2P38A 4N6LA 2L4VA 2JQ5A 4RNYA 3PZWA 3OWSA 3FZWA 3O8YA 2OCTA 5D81A 1VQ63 1YGEA 2P0XA 2QGUA 3MHEA 3SXXA 2CFLA 1VQM3 3G8ZA 1QAKA 1N9EA 1JKGB 4N6MA 1AR0A 3G0KA 3BLZA 3UL6A 3STDA 3EBTA 3IPTA 4RBNA 3NM2A 1FGOA 2GU3A 4HBRA 1N8QA 2HMKB 5IG0A 2ZL8A 3Q2PA 1NU3A 4BTXA 3NM7A 2E2UA 2Y73A 2SBLA 2XFSA 1K28A 5CF2A 2INXA 3KSED 3FCSB 5AEWB 5BVBA 3JVCA 1YJW3 1CEWI 2LQVA 4N6TA 1VQO3 3X3ZA 1K8A4 1Q42A 1OF5B 3WODG 1E3RA 3KE7A 3S5CA 3AMOA 2C11A 3DMCA 1QJGA 1Q864 1ZO2A 1YVBI 1HU9A 1ASKA 5DREA 3LH4A 4JF8A 4K1UA 1JN5B 2FNQA 4O8SA 2GEXA 1VQN3 3I0YA 2E2TA 4OVMA 1FA3A 3X3YA 3LTBA 2IMJA 2XRXB 2XGNA 4EXRA 1YJ93 3G4S3 3BB9A 3G713 1IV9A 2BNGA 4MMZB 2W6JH 4EV2A 4HJLB 5IG4A 1TFKA 1VQ93 1R4CA 1OHPA 2CFDA 4WYKA 1TU5A 4LMIA 4XM4A 6STDA 1D6UA 1Q40A 1EA2A 2WOHA 4ZM8A 1LNHA 1WQLB 1WMNA 3J7Yd 4O2HA 1OHOA 2QIYA 3T8UA 1KWIA 4XDVA 3SVAA 2YX9A 1US1A 1MNLA 5CK6A 4R9KA 2F99A 1AVLA 3MWZA 1J2BA 4WWUC 1BUQA 3NQZA 1IDPA 3WA2X 3U97A 1AVKA 1JNQA 4O3VA 4L8OA 3EC9A 5AIHA 2OTJ3 3MSOA 1OGXA 4QWTA 2CWVA 3F8HA 5IERA 1W02A 3MPHA 1O7GB 3HX8A 3ALAA 1M9GA 1PU4A 3K7CA 3CC73 1QMAA 3DXOA 3K0ZA 3CCE3 1EG9B 3AMOB 4EC6A 4XBYA 5IEPA 1IQXA 3DGOA 4FCMA 2OQEA 3EE1A 5AIIA 1W5ZA 3GZBA 3CC43 2W9PA 3SX1A 2RSXA 3LZAA 1SJWA 2CKFB 1M1XB 4GB5A 4R4KA 4CCVA 1UUWB 1W6YA 5TGNA 4XBTA 3EHCA 1VQ43 1IT7A 2Z7AA 4HM7B 2IUJA 1ROAA 1QVG2 7STDA 3GRDA 1QALA 3HZPA 3JUPA 4LSOA 2CIUA 3NBJA 4PEJA 1TIJA 5JPUA 3EX9A 3HIIA 1A67A 1SIHA 2JDIH 1O7MB 1C7HA 5KP3A 1JJ22 2RFRA 4WYKB 1A2VA 2QEX3 4IIAA 1Q40B 3NHXA 1ROVA 3F7SA 4R9LA 3X40A 3SOAA 1JV2B 1IT8A 2MC8A 3TDGA 4BTYA 3M8CA 5G2GA 2D42A 2IA7A 4H3UA 1NO3A 1ULJB 1IU7A 1Y4KA 3F14A 1JRQA 2KCDA 5EEOA 4AKZA 5A0OB 3MG2A 1K41A 5D83A 5BXQA 3CPOA 4LGQA 1UUVB 3UJMA 2Z77A 2V1LA 2OTL3 1OCVA 1RKYA 5CF1A 3MYTA 2XSOB 2F86B 2W04A 1Q824 4EV5A 3F7XA 4N6NB 5AI1A 5D82A 3G6E3 3Q90A 5LC6A 3VGNA 4HM8B 4FMBA 3B7CA 1Q814 1FGQA 3PGBA 5ELJA 3BNCA 3F8XA 2D1WA 1W2B2 4NREA 3CC23 1UI8A 1UW1A 2OOVA 3WMDA 2CHCA 2K54A 3CCL3 3CCJ3 3GZYB 3NBBA 4KFDA 3DY5A 2MF7A 1SPUA 1NWWA 5CLKA 1YHQ3 4WHAA 3JUMA 3SEDA 1ISKA 5FGOA 4HM0B 4ORLA 3FG4A 2K0MA 3ER7A 1KSIA 3KN4A 4HM6B 3MG1A 3CNXA 2M7OA 4HM3B 1Z1SA 4KFFA 1JB5A 2XF3A 2CC3A 2CWTA 3FKAA 3OWYA 1AV4A 4HM1B 3T8NA 2CG1A 1YJN3 2C10A 3UNLA 1UI7A 3FSDA 3LOYA 4I4KA 2HMNB 3OW22 3SOYA 3OXAA 1OGZA 1VZZA 4IPBA 4K90B 2WO0A 5ELUA 5KP1A 3G16A 4OK0A 3U1WA 1K9M4 1EQKA 1W6CA 4HKVB 1W7CA 2CFKA 1FGMA 2CWUA 2W9QA 5IG3A 3KFQC 1RRLA 3OWUA 3WOFB 4FMDA 5LC7A 3WOEB 1F8NA 2HMLB 1D6YA 1HKXA 2O9UX 3LTDA 1YIJ3 1GY6A 1OPYA 3L0RA 3NBRA 3DZLA 3EBYA 1IVVA 5IG5A 3CCS3 1KD14 4WP5A 1U8CB 4MMXB 3V99A 1OUNA 3X41A 3K63A 3I563 4KZ1A 3DGMA 3FG3A 1DVCA 3JUOA 2I9WA 1GY5A 5AYRB 2GBWB 2OQEC 2XGLA 4IT7A 3OX9A 4FCZA 4FMCA 1DYUA 5IW9A 3ROBA 2WGQA 2XEPA 1VQL3 3V98A 1N5HA 1CQSA 1TP6A 3LT9A 5IEOA 2UX0A 4G1MB 2FXTA 4N3VA 1N5PA 4AEQA 1A90A 4OUQA 3D3LA 2HMMB 4HM5B 1JB4A 2W56A 3SLUA 3K9MC 3UB1A 1IK3A 3CPW2 1DMMA 3LT8A 1ULIB 5DRVA 2CH9A 1O7PB 4EYCA 5IF6A 3PCRA 4HYZA 1M1K4 1A2KA 3BNDA 1MOLA 2A15A 4K61A 1S5AA 1W2ZA 2Y74A 2KXGA 3LMLA 1IVWA 4XB5A 4BTWA 3DGLA 1GYBA 2BMRB 3I553 2YFJB 1T5YA 4FMAA 4JRFA 5HGRA 3S67A 3CCM3 3CXC2 3EQQB 1IV7A 3NV0A 4FCJA 1W6GA 1LXEA 3DUKA 3FG1A 3IMAB 3N8BA 2ML6A 1D6ZA 2BO9B 3FH1A 1CYVA 3GZRA 3Q1CA 4X2OA 2B24B 1W4NA 1S723 1NDOB 1SIIA 3FF0A 1RJOA 2BMQB 3IJEB 4HVNA 1IQ8A 3T0UA 2BT3A 3CD63 3CU3A 2KRTA 4R1KA 3MKIA 4RNZA 2O3OA 3E99A 3JUNA 4Q53A 3RGAA 2LYXA 1W00A 3VF1A 1G96A 1VQP3 4RZMA 1VQ53 1VQ73 3S27A 4XBXA 5I97A 2OOVC 5AYSC 3CCV3 1LOXA 3K5TA 4TX4A 3H51A 1NB3I 2CFWA 1N8R4 3QRDA 1DMNA 1QAFA 2HMJB 2ML5A 2XH9A 3HIGA 3X3XA 4MEIA 1DMQA 3N54B 2R4IA 4O02B 1VQK3 1WTHA 2RCDA 4N6OB 3JUQA 3F40A 4L8PA 3S28A 3B4OA 3N9HA 2W56B 3A76A 2P05A 2P09A 2WOFA 2Z6BA 3EN1B 2E2VA 3LYGA 1FUWA 5JBSA 3EN8A 5JPPA 2W2CA 3DM8A 3CCR3 3LXUX 2CG0A 1NB5I 3CCQ3 2QA43 4HZ9B 3EJVA 3KKGA 3KZTA 4L7KA 2Z76A 5CXOA 1N9JA 1VQ83 1IQYA 4N6V0 1K734 1TFOA 3UL5A 1E97A 3KIIA 1OACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUH A;  3B4P A;  2XR8 B;  2HMO B;  4J9A A;  3GWR A;  2YFL B;  3EF8 A;  5FW5 A;  3B8L A;  3NV0 B;  5STD A;  1OH0 A;  2OWP A;  1E3V A;  2STD A;  2RGQ A;  3FLJ A;  1JKG A;  3MG3 A;  2XSH B;  3GZX B;  4HM2 B;  4U13 A;  2GEY A;  1O7N B;  3F9S A;  3H3H A;  1GY7 A;  4J8T A;  2GBX B;  4STD A;  3FF2 A;  2BMO B;  3HK4 A;  4MJD A;  4CDL A;  3NXJ A;  1U5O A;  8CHO A;  1OF5 A;  1W01 A;  4HM4 B;  1JB2 A;  3KSP A;  5IEN A;  3RGR A;  4X2H A;  3FGY A;  3CNM A;  2B1X B;  1O7W B;  4K1V A;  4LEH A;  1GS3 A;  1JN5 A;  5AIF A;  3NUV A;  2GXF A;  1ZX2 A;  1OHS A;  1STD A;  1O7H B;  2F98 A;  5KP4 A;  3OV4 A;  4HZB B;  5EVH A;  2PZV A;  5AEU B;  3ECF A;  3D9R A;  4KVH A;  2YFI B;  3VSY A;  5AIG A;  2JQ5 A;  3OWS A;  3FZW A;  5D81 A;  2QGU A;  3MHE A;  3G8Z A;  1JKG B;  1AR0 A;  3G0K A;  3BLZ A;  3STD A;  3EBT A;  3IPT A;  3NM2 A;  5IG0 A;  2HMK B;  1NU3 A;  5CF2 A;  2INX A;  5AEW B;  5BVB A;  1Q42 A;  1OF5 B;  1E3R A;  3KE7 A;  3S5C A;  3DMC A;  1QJG A;  1ZO2 A;  1ASK A;  5DRE A;  4K1U A;  1JN5 B;  2GEX A;  3I0Y A;  4OVM A;  2IMJ A;  2XRX B;  3BB9 A;  2BNG A;  4HJL B;  5IG4 A;  1OHP A;  4WYK A;  4LMI A;  4XM4 A;  6STD A;  1Q40 A;  1EA2 A;  1WQL B;  1OHO A;  2QIY A;  3T8U A;  4XDV A;  5CK6 A;  4R9K A;  2F99 A;  4WWU C;  1BUQ A;  1IDP A;  4L8O A;  3EC9 A;  5AIH A;  3MSO A;  1OGX A;  3F8H A;  5IER A;  1W02 A;  1O7G B;  3HX8 A;  3K7C A;  1QMA A;  3DXO A;  3K0Z A;  1EG9 B;  4XBY A;  5IEP A;  4FCM A;  5AII A;  3GZB A;  3LZA A;  1SJW A;  2CKF B;  4GB5 A;  1UUW B;  1W6Y A;  5TGN A;  4XBT A;  3EHC A;  2Z7A A;  4HM7 B;  7STD A;  3GRD A;  3HZP A;  3JUP A;  4PEJ A;  5JPU A;  3EX9 A;  1O7M B;  1C7H A;  5KP3 A;  2RFR A;  4WYK B;  4IIA A;  1Q40 B;  3NHX A;  3F7S A;  4R9L A;  3SOA A;  3M8C A;  5G2G A;  4H3U A;  1ULJ B;  3F14 A;  3MG2 A;  1K41 A;  5D83 A;  5BXQ A;  3CPO A;  4LGQ A;  1UUV B;  3UJM A;  2Z77 A;  1OCV A;  5CF1 A;  3MYT A;  2XSO B;  2F86 B;  3F7X A;  5AI1 A;  5D82 A;  3Q90 A;  3VGN A;  4HM8 B;  3B7C A;  3F8X A;  3WMD A;  2CHC A;  2K54 A;  3GZY B;  1NWW A;  5CLK A;  3SED A;  3JUM A;  1ISK A;  4HM0 B;  4ORL A;  3ER7 A;  4HM6 B;  3MG1 A;  3CNX A;  4HM3 B;  1Z1S A;  1JB5 A;  3FKA A;  3OWY A;  4HM1 B;  3T8N A;  3UNL A;  3FSD A;  4I4K A;  2HMN B;  3SOY A;  3OXA A;  1OGZ A;  1VZZ A;  5KP1 A;  3G16 A;  4HKV B;  5IG3 A;  3OWU A;  2HML B;  1HKX A;  1GY6 A;  1OPY A;  3NBR A;  3DZL A;  3EBY A;  5IG5 A;  4WP5 A;  1OUN A;  3JUO A;  2I9W A;  1GY5 A;  2GBW B;  3OX9 A;  3ROB A;  1CQS A;  1TP6 A;  5IEO A;  2UX0 A;  4N3V A;  4OUQ A;  2HMM B;  4HM5 B;  1JB4 A;  1DMM A;  1ULI B;  5DRV A;  1O7P B;  5IF6 A;  1A2K A;  2A15 A;  1S5A A;  4XB5 A;  1GYB A;  2BMR B;  2YFJ B;  5HGR A;  3EQQ B;  3NV0 A;  4FCJ A;  3DUK A;  4X2O A;  4XDW A;  3FH1 A;  3GZR A;  2B24 B;  1NDO B;  3FF0 A;  2BMQ B;  4HVN A;  3CU3 A;  4R1K A;  3MKI A;  3E99 A;  3JUN A;  4Q53 A;  3RGA A;  1W00 A;  4RZM A;  4XBX A;  3H51 A;  1DMN A;  2HMJ B;  1DMQ A;  2R4I A;  2RCD A;  3JUQ A;  3F40 A;  4L8P A;  3B4O A;  3A76 A;  3EN1 B;  3LYG A;  3EN8 A;  5JPP A;  2W2C A;  3DM8 A;  4HZ9 B;  3EJV A;  3KKG A;  4L7K A;  5CXO A;  3KZT A;  2Z76 A;  1E97 A; 
#chains in the Genus database with same CATH topology
 2FGT A;  1IVX A;  1I0X A;  1X1Y A;  2IUK A;  4AKY A;  1AY7 A;  3CME 3;  2CK3 H;  1NJI 4;  1TUH A;  2KF5 A;  1SQW A;  2WGO A;  3B4P A;  2XR8 B;  2HMO B;  3HI7 A;  3S29 A;  4FR9 A;  3X42 A;  1YGW A;  9RNT A;  1UUG B;  3EB8 A;  4J9A A;  1KQS 2;  3GWR A;  1HYF A;  1V74 A;  1PFP A;  1EKM A;  1RDS A;  2IYJ A;  2YFL B;  2ZDJ A;  3KCH A;  3LTA A;  3EF8 A;  5FW5 A;  3B8L A;  3NV0 B;  5STD A;  3PYJ A;  1OH0 A;  1WMO A;  2OWP A;  1E3V A;  3CCU 3;  3DGN A;  2STD A;  3CMA 3;  1YIT 3;  2RGQ A;  3FLJ A;  4GL6 A;  1RLS A;  1JKG A;  1LVN A;  2BHM A;  1STF I;  4MMY B;  3WDG B;  3WA3 A;  3MG3 A;  1WNH A;  4NHF A;  3NQY A;  2XSH B;  1FUT A;  4HAA A;  3GZX B;  1JZD A;  2CFG A;  1GD3 A;  4HM2 B;  4U13 A;  2GEY A;  2CW9 A;  4WFO A;  2F5W A;  1O7N B;  4XDW A;  1UDI I;  2GSP A;  3F9S A;  3H3H A;  1GY7 A;  1RRH A;  1L5G B;  2Q07 A;  1BRJ A;  3PCS A;  3URP A;  4J8T A;  1CYU A;  2GBX B;  4R80 A;  1DVD A;  1TRP A;  4STD A;  1LRA A;  3BNE A;  2W0Q A;  2BMO B;  3FF2 A;  3HK4 A;  4MJD A;  4LZI A;  4N6U A;  3ZFZ A;  4BL2 A;  3NXJ A;  1U5O A;  4CDL A;  4EBG A;  1KC8 4;  1FGR A;  2P0M A;  8CHO A;  1OF5 A;  1W01 A;  1FGT A;  4HM4 B;  3V92 A;  3QK9 A;  1YI2 3;  1JB2 A;  2XFT A;  2GU1 A;  3AHW A;  1RN4 A;  3GAX A;  3KSP A;  5IEN A;  1B27 A;  1IVU A;  2W03 A;  3BNB A;  3FGY A;  3CNM A;  4X2H A;  3RGR A;  1GOU A;  2B1X B;  1O7W B;  1X1U A;  3NX0 A;  1BNF A;  4K1V A;  3PXM A;  4LEH A;  6RNT A;  1MGW A;  3LTC A;  1GS3 A;  1JN5 A;  1UCJ A;  3NUV A;  5AIF A;  3D4A A;  2GXF A;  1ZX2 A;  5M1A A;  1OHS A;  1JZO A;  1STD A;  1O7H B;  2UUG C;  2PNC A;  2F98 A;  4H61 A;  5KP4 A;  1RN1 A;  1RN7 A;  3OV4 A;  4HZB B;  5EVH A;  1I70 A;  1QVF 2;  3AGN A;  2PZV A;  1M90 4;  5AEU B;  1MWT A;  1WMP A;  3ECF A;  3PS8 A;  4KFE A;  4RNT A;  5EQL A;  3D9R A;  4KVH A;  2YFI B;  1TJD A;  3VSY A;  1FZU A;  4KT3 B;  3RDE A;  1GD4 A;  1Q7Y 4;  5AIG A;  2P38 A;  4N6L A;  1R4Y A;  2L4V A;  2JQ5 A;  3SYU A;  4RNY A;  3PZW A;  3OWS A;  3FZW A;  3O8Y A;  2OCT A;  2H0G A;  2KF6 A;  5D81 A;  1VQ6 3;  1YGE A;  2P0X A;  2QGU A;  3MHE A;  3SXX A;  2CFL A;  1VQM 3;  3G8Z A;  1BRK A;  1QAK A;  1N9E A;  2KF4 A;  1JKG B;  4N6M A;  1AR0 A;  1MGR A;  3BLZ A;  3G0K A;  3UL6 A;  3ZG0 A;  4BL3 A;  1G0T A;  3STD A;  3RNT A;  3EBT A;  3IPT A;  4RBN A;  3NM2 A;  1FGO A;  1BSA A;  2GU3 A;  4HBR A;  1N8Q A;  2HMK B;  2F4Y A;  2ZL8 A;  3Q2P A;  5IG0 A;  1NU3 A;  1BNG A;  4BTX A;  3NM7 A;  2E2U A;  2Y73 A;  2SBL A;  2XFS A;  1K28 A;  5CF2 A;  2INX A;  3KSE D;  4CPK A;  3FCS B;  5AEW B;  2H0I A;  4ILF A;  5BVB A;  3JVC A;  1YJW 3;  1JBR A;  1CEW I;  2LQV A;  4N6T A;  1VQO 3;  1GOY A;  3X3Z A;  1K8A 4;  1Q42 A;  1OF5 B;  1B2U A;  3WOD G;  1E3R A;  3KE7 A;  3S5C A;  3AMO A;  2C11 A;  3DMC A;  1QJG A;  1Q86 4;  1ZO2 A;  1YVB I;  1BNR A;  1HU9 A;  1ASK A;  2CX1 A;  5DRE A;  3AHS A;  3LH4 A;  4JF8 A;  4K1U A;  3Q3F A;  1JN5 B;  2FNQ A;  4O8S A;  2K3D A;  2GEX A;  1VQN 3;  3AGO A;  3I0Y A;  2E2T A;  4OVM A;  1FA3 A;  3X3Y A;  3LTB A;  2IMJ A;  1CH0 A;  2XRX B;  2XGN A;  1MWR A;  4EXR A;  1RGE A;  1YJ9 3;  1GMP A;  3G4S 3;  3BB9 A;  3G71 3;  1IV9 A;  2BNG A;  1BIR A;  4MMZ B;  1JBT A;  2W6J H;  2HOH A;  2RNT A;  4EV2 A;  5M19 A;  4HJL B;  5IG4 A;  1TFK A;  1VQ9 3;  1R4C A;  1OHP A;  2CFD A;  4WYK A;  1TU5 A;  4LMI A;  4XM4 A;  6STD A;  1D6U A;  1Q40 A;  1EA2 A;  2WOH A;  4ZM8 A;  1JBS A;  1BUJ A;  1LNH A;  1WQL B;  1WMN A;  3J7Y d;  4O2H A;  1OHO A;  2QIY A;  3T8U A;  1KWI A;  4XDV A;  3SVA A;  2YX9 A;  1YVS A;  1US1 A;  1MNL A;  5CK6 A;  1TRQ A;  4R9K A;  2F99 A;  1AVL A;  1MWS A;  1UCI A;  3MWZ A;  1J2B A;  1C54 A;  4LYL B;  4WWU C;  1BUQ A;  3BIR A;  3NQZ A;  3A5E A;  1GOV A;  1IDP A;  3WA2 X;  3U97 A;  1AVK A;  5G1L A;  1JNQ A;  4O3V A;  4L8O A;  3EC9 A;  1BRG A;  5AIH A;  2OTJ 3;  3MSO A;  1OGX A;  1V58 A;  4QWT A;  2CWV A;  1RNT A;  1UCL A;  3F8H A;  5IER A;  5BU4 A;  1W02 A;  3MPH A;  1O7G B;  1B2Z A;  3HX8 A;  4HOH A;  3ALA A;  5RNT A;  1M9G A;  1G02 A;  1GMQ A;  1PU4 A;  3K7C A;  3CC7 3;  1QMA A;  3DXO A;  2F56 A;  1RGC A;  3K0Z A;  3CCE 3;  1EG9 B;  3AMO B;  4EC6 A;  1FUS A;  4XBY A;  3WR2 A;  5IEP A;  1IQX A;  3DGO A;  4FCM A;  2OQE A;  3EE1 A;  5AII A;  1W5Z A;  3GZB A;  3CC4 3;  2W9P A;  3SX1 A;  2RSX A;  3LZA A;  1SJW A;  1BNI A;  2CKF B;  1M1X B;  1LOY A;  4GB5 A;  4R4K A;  4CCV A;  1UUW B;  1W6Y A;  5TGN A;  4XBT A;  3EHC A;  1VQ4 3;  1VQQ A;  1IT7 A;  2Z7A A;  4HM7 B;  5GSP A;  2IUJ A;  1X1X A;  1ROA A;  1RMS A;  7STD A;  1QVG 2;  3GRD A;  1QAL A;  3HZP A;  3JUP A;  4LSO A;  2CIU A;  3NBJ A;  4PEJ A;  1TIJ A;  5JPU A;  1BNE A;  3EX9 A;  3HII A;  1A67 A;  1SIH A;  1I2E A;  2JDI H;  1O7M B;  1C7H A;  5KP3 A;  1JJ2 2;  2RFR A;  2J8X B;  4WYK B;  1A2V A;  2QEX 3;  4GSP A;  4IIA A;  1Q40 B;  3NHX A;  1ROV A;  3F7S A;  4R9L A;  1UGI A;  1ZGX A;  3X40 A;  8RNT A;  3SOA A;  1JV2 B;  2KAA A;  1IT8 A;  2ZA4 A;  2MC8 A;  3TDG A;  1BGS A;  4BTY A;  4DKI A;  3D5I A;  1MWU A;  1I0V A;  3M8C A;  5G2G A;  1A2P A;  1YNV X;  2D42 A;  1NO3 A;  2IA7 A;  4H3U A;  1ULJ B;  1IU7 A;  1Y4K A;  1BSE A;  1JRQ A;  3F14 A;  3D79 A;  1B2M A;  2KCD A;  1RSN A;  1I2F A;  5EEO A;  4AKZ A;  2C4B A;  5A0O B;  3MG2 A;  1K41 A;  5D83 A;  5BXQ A;  3CPO A;  4LGQ A;  1UUV B;  3UJM A;  1DE3 A;  4X2O A;  2Z77 A;  2V1L A;  1LOW A;  2OTL 3;  1RGA A;  1OCV A;  1GSP A;  1RKY A;  5CF1 A;  3MYT A;  2XSO B;  2F86 B;  2W04 A;  1Q82 4;  4EV5 A;  3F7X A;  1LQM B;  4N6N B;  3GSP A;  5AI1 A;  1LNI A;  5D82 A;  3G6E 3;  3Q90 A;  5LC6 A;  3VGN A;  4GHO A;  4HM8 B;  4FMB A;  3B7C A;  1Q81 4;  2KF3 A;  1FGQ A;  3PGB A;  1SAR A;  5ELJ A;  3BNC A;  3F8X A;  1RNB A;  2D1W A;  1W2B 2;  6GSP A;  4NRE A;  4J5G A;  3CC2 3;  1UI8 A;  1UW1 A;  2OOV A;  3WMD A;  2CHC A;  2K54 A;  3CCL 3;  7GSP A;  1Q7H A;  3CCJ 3;  3GZY B;  3NBB A;  4KFD A;  3DY5 A;  2MF7 A;  1SPU A;  1NWW A;  5CLK A;  1YHQ 3;  4WHA A;  3JUM A;  3SED A;  1ISK A;  5FGO A;  4HM0 B;  4ORL A;  3FG4 A;  1V57 A;  2K0M A;  3DGY A;  3ER7 A;  1KSI A;  3KN4 A;  4HM6 B;  3MG1 A;  3CNX A;  2M7O A;  4HM3 B;  5G1K A;  1Z1S A;  4KFF A;  1JB5 A;  2XF3 A;  2CC3 A;  2CWT A;  3FKA A;  3OWY A;  1AV4 A;  1BSC A;  4HM1 B;  2IY2 A;  2CG1 A;  3T8N A;  2F5M A;  1YJN 3;  2C10 A;  3UNL A;  1UI7 A;  3FSD A;  1B2S A;  1LOV A;  3LOY A;  4I4K A;  2HMN B;  3OW2 2;  1BRS A;  3SOY A;  3OXA A;  1OGZ A;  1VZZ A;  4BU4 A;  1RTU A;  4IPB A;  4K90 B;  1UCK A;  2WO0 A;  1RCK A;  5ELU A;  5KP1 A;  2BIR A;  3G16 A;  4OK0 A;  3U1W A;  3WHO A;  1K9M 4;  1EQK A;  1T2H A;  1W6C A;  2AAD A;  1UGH I;  1W7C A;  2CFK A;  1FGM A;  2CWU A;  2W9Q A;  4HKV B;  3KFQ C;  3ZG5 A;  1RRL A;  3OWU A;  2SAR A;  5BIR A;  5IG3 A;  3WOF B;  2CX0 A;  3HOH A;  4FMD A;  5LC7 A;  3WOE B;  1F8N A;  2HML B;  1D6Y A;  2RBI A;  1HKX A;  2O9U X;  3LTD A;  1YIJ 3;  1GY6 A;  1OPY A;  3L0R A;  3NBR A;  3DZL A;  3EBY A;  1IVV A;  5IG5 A;  3CCS 3;  1KD1 4;  4WP5 A;  1U8C B;  1HZ1 A;  4MMX B;  3V99 A;  1OUN A;  3X41 A;  3K63 A;  3I56 3;  4KZ1 A;  3DGM A;  3FG3 A;  1DVC A;  3JUO A;  2I9W A;  1GY5 A;  5AYR B;  2GBW B;  2OQE C;  2XGL A;  1BSB A;  3OX9 A;  4FCZ A;  4FMC A;  4IT7 A;  1DYU A;  5IW9 A;  5HOH A;  1BSD A;  3ROB A;  2WGQ A;  2XEP A;  1VQL 3;  3V98 A;  1N5H A;  4BIR A;  1CQS A;  2H0H A;  1TP6 A;  3LT9 A;  5IEO A;  2UX0 A;  4G1M B;  2FXT A;  1FYS A;  4N3V A;  1N5P A;  4AEQ A;  1A90 A;  1RGF A;  1I2G A;  4OUQ A;  3D3L A;  2HMM B;  4HM5 B;  1JB4 A;  2W56 A;  3SLU A;  3K9M C;  3UB1 A;  1IK3 A;  3CPW 2;  1DMM A;  3BU4 A;  1ULI B;  3LT8 A;  4CJN A;  5DRV A;  2CH9 A;  1O7P B;  1DET A;  4EYC A;  5IF6 A;  1PY3 A;  3PCR A;  1RGH A;  4HYZ A;  1M1K 4;  1A2K A;  3BND A;  1MOL A;  2A15 A;  4K61 A;  5M18 A;  1S5A A;  7RNT A;  1W2Z A;  2Y74 A;  4I5Q A;  2KXG A;  1LQG C;  1B3S A;  1I8V A;  3LML A;  1IVW A;  4XB5 A;  4BTW A;  3DGL A;  1GYB A;  1BVI A;  2BMR B;  4J5K A;  3I55 3;  2YFJ B;  1T5Y A;  4FMA A;  4JRF A;  1BAN A;  1RHL A;  1T3B A;  5HGR A;  3S67 A;  4EW5 A;  3CCM 3;  2R41 A;  3CXC 2;  3DH2 A;  3EQQ B;  1IV7 A;  1Q9E A;  3NV0 A;  1B21 A;  4FCJ A;  1W6G A;  1LXE A;  3DUK A;  3FG1 A;  3IMA B;  3N8B A;  2BO9 B;  1D6Z A;  2ML6 A;  1BNJ A;  1CYV A;  3FH1 A;  3GZR A;  3Q1C A;  2B24 B;  1W4N A;  1S72 3;  1NDO B;  1SII A;  3FF0 A;  1RJO A;  1B2X A;  2BMQ B;  3IJE B;  4HVN A;  1B20 A;  1IQ8 A;  3T0U A;  2BT3 A;  4NPB A;  3CD6 3;  1RGL A;  1I3F A;  1RGG A;  2KRT A;  3CU3 A;  1BOX A;  4R1K A;  2ZHX B;  3D5G A;  3MKI A;  2L1S A;  1TTO A;  2O3O A;  4RNZ A;  1FW7 A;  3E99 A;  3JUN A;  4Q53 A;  3RGA A;  2LYX A;  1GMR A;  1W00 A;  1G96 A;  3VF1 A;  4RZM A;  1VQP 3;  1VQ7 3;  1VQ5 3;  3S27 A;  4XBX A;  1RGK A;  2OOV C;  5I97 A;  5AYS C;  3CCV 3;  1LOX A;  3K5T A;  4TX4 A;  2BU4 A;  3H51 A;  1NB3 I;  2CFW A;  1N8R 4;  3QRD A;  1DMN A;  1QAF A;  1NNV A;  2HMJ B;  2ML5 A;  2XH9 A;  3HIG A;  3X3X A;  4MEI A;  1DMQ A;  1BRI A;  3N54 B;  2R4I A;  1T2I A;  4O02 B;  1VQK 3;  1WTH A;  2RCD A;  1IYY A;  1BAO A;  4N6O B;  2UGI A;  3F40 A;  3JUQ A;  1ZS7 A;  1BNS A;  1EUI C;  4L8P A;  3B4O A;  3S28 A;  1BRN L;  1PYL A;  2AAE A;  3N9H A;  2W56 B;  3A76 A;  2P05 A;  2P09 A;  1RCL A;  2WOF A;  2Z6B A;  2E2V A;  1X1W A;  3EN1 B;  3LYG A;  5JBS A;  1FUW A;  3EN8 A;  5JPP A;  2W2C A;  3DM8 A;  3CCR 3;  3LXU X;  2CG0 A;  1NB5 I;  1EEJ A;  3CCQ 3;  2QA4 3;  4HZ9 B;  3EJV A;  3KKG A;  3KZT A;  4L7K A;  2Z76 A;  5CXO A;  1BRH A;  1N9J A;  1VQ8 3;  1IQY A;  1I3I A;  4N6V 0;  1K73 4;  1TFO A;  3UL5 A;  1BU4 A;  1AQZ A;  1E97 A;  3KII A;  1OAC A; 
#chains in the Genus database with same CATH homology
 2FGT A;  1IVX A;  2IUK A;  4AKY A;  3CME 3;  1NJI 4;  2CK3 H;  1TUH A;  1SQW A;  2WGO A;  3B4P A;  2XR8 B;  2HMO B;  3HI7 A;  3S29 A;  4FR9 A;  3X42 A;  3EB8 A;  4J9A A;  1KQS 2;  3GWR A;  1V74 A;  1PFP A;  1EKM A;  2YFL B;  2ZDJ A;  3LTA A;  3EF8 A;  5FW5 A;  3B8L A;  3NV0 B;  5STD A;  3PYJ A;  1OH0 A;  1WMO A;  2OWP A;  1E3V A;  3CCU 3;  3DGN A;  2STD A;  3CMA 3;  1YIT 3;  2RGQ A;  3FLJ A;  4GL6 A;  1JKG A;  1LVN A;  2BHM A;  1STF I;  4MMY B;  3WDG B;  3WA3 A;  3MG3 A;  1WNH A;  4NHF A;  3NQY A;  2XSH B;  3GZX B;  2CFG A;  1GD3 A;  4HM2 B;  4U13 A;  2GEY A;  2CW9 A;  4WFO A;  1O7N B;  4XDW A;  3F9S A;  3H3H A;  1GY7 A;  1RRH A;  1L5G B;  2Q07 A;  3PCS A;  4J8T A;  1CYU A;  2GBX B;  4R80 A;  1DVD A;  4STD A;  3FF2 A;  3BNE A;  2W0Q A;  2BMO B;  3HK4 A;  4MJD A;  4CDL A;  4LZI A;  4N6U A;  3NXJ A;  1U5O A;  4EBG A;  1KC8 4;  1FGR A;  2P0M A;  8CHO A;  1OF5 A;  1W01 A;  1FGT A;  4HM4 B;  3V92 A;  3QK9 A;  1YI2 3;  1JB2 A;  2XFT A;  2GU1 A;  3GAX A;  3KSP A;  5IEN A;  1IVU A;  2W03 A;  3BNB A;  3FGY A;  4X2H A;  3CNM A;  3RGR A;  2B1X B;  1O7W B;  3NX0 A;  4K1V A;  3PXM A;  4LEH A;  3LTC A;  1GS3 A;  1JN5 A;  5AIF A;  3NUV A;  2GXF A;  1ZX2 A;  1OHS A;  1STD A;  1O7H B;  2PNC A;  2F98 A;  4H61 A;  5KP4 A;  1RN7 A;  3OV4 A;  4HZB B;  5EVH A;  1QVF 2;  2PZV A;  1M90 4;  5AEU B;  1WMP A;  3ECF A;  3PS8 A;  4KFE A;  5EQL A;  3D9R A;  4KVH A;  2YFI B;  3VSY A;  3RDE A;  1GD4 A;  1Q7Y 4;  5AIG A;  2P38 A;  4N6L A;  2L4V A;  2JQ5 A;  4RNY A;  3PZW A;  3OWS A;  3FZW A;  3O8Y A;  2OCT A;  5D81 A;  1VQ6 3;  1YGE A;  2P0X A;  2QGU A;  3MHE A;  3SXX A;  2CFL A;  1VQM 3;  3G8Z A;  1QAK A;  1N9E A;  1JKG B;  4N6M A;  1AR0 A;  3G0K A;  3BLZ A;  3UL6 A;  3STD A;  3EBT A;  3IPT A;  4RBN A;  3NM2 A;  1FGO A;  2GU3 A;  4HBR A;  1N8Q A;  2HMK B;  5IG0 A;  2ZL8 A;  3Q2P A;  1NU3 A;  4BTX A;  3NM7 A;  2E2U A;  2Y73 A;  2SBL A;  2XFS A;  1K28 A;  5CF2 A;  2INX A;  3KSE D;  3FCS B;  5AEW B;  5BVB A;  3JVC A;  1YJW 3;  1CEW I;  2LQV A;  4N6T A;  1VQO 3;  3X3Z A;  1K8A 4;  1Q42 A;  1OF5 B;  3WOD G;  1E3R A;  3KE7 A;  3S5C A;  3AMO A;  2C11 A;  3DMC A;  1QJG A;  1Q86 4;  1ZO2 A;  1YVB I;  1HU9 A;  1ASK A;  5DRE A;  3LH4 A;  4JF8 A;  4K1U A;  1JN5 B;  2FNQ A;  4O8S A;  2GEX A;  1VQN 3;  3I0Y A;  2E2T A;  4OVM A;  1FA3 A;  3X3Y A;  3LTB A;  2IMJ A;  2XRX B;  2XGN A;  4EXR A;  1YJ9 3;  3G4S 3;  3BB9 A;  3G71 3;  1IV9 A;  2BNG A;  4MMZ B;  2W6J H;  4EV2 A;  4HJL B;  5IG4 A;  1TFK A;  1VQ9 3;  1R4C A;  1OHP A;  2CFD A;  4WYK A;  1TU5 A;  4LMI A;  4XM4 A;  6STD A;  1D6U A;  1Q40 A;  1EA2 A;  2WOH A;  4ZM8 A;  1LNH A;  1WQL B;  1WMN A;  3J7Y d;  4O2H A;  1OHO A;  2QIY A;  3T8U A;  1KWI A;  4XDV A;  3SVA A;  2YX9 A;  1US1 A;  1MNL A;  5CK6 A;  4R9K A;  2F99 A;  1AVL A;  3MWZ A;  1J2B A;  4WWU C;  1BUQ A;  3NQZ A;  1IDP A;  3WA2 X;  3U97 A;  1AVK A;  1JNQ A;  4O3V A;  4L8O A;  3EC9 A;  5AIH A;  2OTJ 3;  3MSO A;  1OGX A;  4QWT A;  2CWV A;  3F8H A;  5IER A;  1W02 A;  3MPH A;  1O7G B;  3HX8 A;  3ALA A;  1M9G A;  1PU4 A;  3K7C A;  3CC7 3;  1QMA A;  3DXO A;  3K0Z A;  3CCE 3;  1EG9 B;  3AMO B;  4EC6 A;  4XBY A;  5IEP A;  1IQX A;  3DGO A;  4FCM A;  2OQE A;  3EE1 A;  5AII A;  1W5Z A;  3GZB A;  3CC4 3;  2W9P A;  3SX1 A;  2RSX A;  3LZA A;  1SJW A;  2CKF B;  1M1X B;  4GB5 A;  4R4K A;  4CCV A;  1UUW B;  1W6Y A;  5TGN A;  4XBT A;  3EHC A;  1VQ4 3;  1IT7 A;  2Z7A A;  4HM7 B;  2IUJ A;  1ROA A;  1QVG 2;  7STD A;  3GRD A;  1QAL A;  3HZP A;  3JUP A;  4LSO A;  2CIU A;  3NBJ A;  4PEJ A;  1TIJ A;  5JPU A;  3EX9 A;  3HII A;  1A67 A;  1SIH A;  2JDI H;  1O7M B;  1C7H A;  5KP3 A;  1JJ2 2;  2RFR A;  4WYK B;  1A2V A;  2QEX 3;  4IIA A;  1Q40 B;  3NHX A;  1ROV A;  3F7S A;  4R9L A;  3X40 A;  3SOA A;  1JV2 B;  1IT8 A;  2MC8 A;  3TDG A;  4BTY A;  3M8C A;  5G2G A;  2D42 A;  2IA7 A;  4H3U A;  1NO3 A;  1ULJ B;  1IU7 A;  1Y4K A;  3F14 A;  1JRQ A;  2KCD A;  5EEO A;  4AKZ A;  5A0O B;  3MG2 A;  1K41 A;  5D83 A;  5BXQ A;  3CPO A;  4LGQ A;  1UUV B;  3UJM A;  2Z77 A;  2V1L A;  2OTL 3;  1OCV A;  1RKY A;  5CF1 A;  3MYT A;  2XSO B;  2F86 B;  2W04 A;  1Q82 4;  4EV5 A;  3F7X A;  4N6N B;  5AI1 A;  5D82 A;  3G6E 3;  3Q90 A;  5LC6 A;  3VGN A;  4HM8 B;  4FMB A;  3B7C A;  1Q81 4;  1FGQ A;  3PGB A;  5ELJ A;  3BNC A;  3F8X A;  2D1W A;  1W2B 2;  4NRE A;  3CC2 3;  1UI8 A;  1UW1 A;  2OOV A;  3WMD A;  2CHC A;  2K54 A;  3CCL 3;  3CCJ 3;  3GZY B;  3NBB A;  4KFD A;  3DY5 A;  2MF7 A;  1SPU A;  1NWW A;  5CLK A;  1YHQ 3;  4WHA A;  3JUM A;  3SED A;  1ISK A;  5FGO A;  4HM0 B;  4ORL A;  3FG4 A;  2K0M A;  3ER7 A;  1KSI A;  3KN4 A;  4HM6 B;  3MG1 A;  3CNX A;  2M7O A;  4HM3 B;  1Z1S A;  4KFF A;  1JB5 A;  2XF3 A;  2CC3 A;  2CWT A;  3FKA A;  3OWY A;  1AV4 A;  4HM1 B;  3T8N A;  2CG1 A;  1YJN 3;  2C10 A;  3UNL A;  1UI7 A;  3FSD A;  3LOY A;  4I4K A;  2HMN B;  3OW2 2;  3SOY A;  3OXA A;  1OGZ A;  1VZZ A;  4IPB A;  4K90 B;  2WO0 A;  5ELU A;  5KP1 A;  3G16 A;  4OK0 A;  3U1W A;  1K9M 4;  1EQK A;  1W6C A;  4HKV B;  1W7C A;  2CFK A;  1FGM A;  2CWU A;  2W9Q A;  5IG3 A;  3KFQ C;  1RRL A;  3OWU A;  3WOF B;  4FMD A;  5LC7 A;  3WOE B;  1F8N A;  2HML B;  1D6Y A;  1HKX A;  2O9U X;  3LTD A;  1YIJ 3;  1GY6 A;  1OPY A;  3L0R A;  3NBR A;  3DZL A;  3EBY A;  1IVV A;  5IG5 A;  3CCS 3;  1KD1 4;  4WP5 A;  1U8C B;  4MMX B;  3V99 A;  1OUN A;  3X41 A;  3K63 A;  3I56 3;  4KZ1 A;  3DGM A;  3FG3 A;  1DVC A;  3JUO A;  2I9W A;  1GY5 A;  5AYR B;  2GBW B;  2OQE C;  2XGL A;  4IT7 A;  3OX9 A;  4FCZ A;  4FMC A;  1DYU A;  5IW9 A;  3ROB A;  2WGQ A;  2XEP A;  1VQL 3;  3V98 A;  1N5H A;  1CQS A;  1TP6 A;  3LT9 A;  5IEO A;  2UX0 A;  4G1M B;  2FXT A;  4N3V A;  1N5P A;  4AEQ A;  1A90 A;  4OUQ A;  3D3L A;  2HMM B;  4HM5 B;  1JB4 A;  2W56 A;  3SLU A;  3K9M C;  3UB1 A;  1IK3 A;  3CPW 2;  1DMM A;  3LT8 A;  1ULI B;  5DRV A;  2CH9 A;  1O7P B;  4EYC A;  5IF6 A;  3PCR A;  4HYZ A;  1M1K 4;  1A2K A;  3BND A;  1MOL A;  2A15 A;  4K61 A;  1S5A A;  1W2Z A;  2Y74 A;  2KXG A;  3LML A;  1IVW A;  4XB5 A;  4BTW A;  3DGL A;  1GYB A;  2BMR B;  3I55 3;  2YFJ B;  1T5Y A;  4FMA A;  4JRF A;  5HGR A;  3S67 A;  3CCM 3;  3CXC 2;  3EQQ B;  1IV7 A;  3NV0 A;  4FCJ A;  1W6G A;  1LXE A;  3DUK A;  3FG1 A;  3IMA B;  3N8B A;  2ML6 A;  1D6Z A;  2BO9 B;  3FH1 A;  1CYV A;  3GZR A;  3Q1C A;  4X2O A;  2B24 B;  1W4N A;  1S72 3;  1NDO B;  1SII A;  3FF0 A;  1RJO A;  2BMQ B;  3IJE B;  4HVN A;  1IQ8 A;  3T0U A;  2BT3 A;  3CD6 3;  3CU3 A;  2KRT A;  4R1K A;  3MKI A;  4RNZ A;  2O3O A;  3E99 A;  3JUN A;  4Q53 A;  3RGA A;  2LYX A;  1W00 A;  3VF1 A;  1G96 A;  1VQP 3;  4RZM A;  1VQ5 3;  1VQ7 3;  3S27 A;  4XBX A;  5I97 A;  2OOV C;  5AYS C;  3CCV 3;  1LOX A;  3K5T A;  4TX4 A;  3H51 A;  1NB3 I;  2CFW A;  1N8R 4;  3QRD A;  1DMN A;  1QAF A;  2HMJ B;  2ML5 A;  2XH9 A;  3HIG A;  3X3X A;  4MEI A;  1DMQ A;  3N54 B;  2R4I A;  4O02 B;  1VQK 3;  1WTH A;  2RCD A;  4N6O B;  3JUQ A;  3F40 A;  4L8P A;  3S28 A;  3B4O A;  3N9H A;  2W56 B;  3A76 A;  2P05 A;  2P09 A;  2WOF A;  2Z6B A;  3EN1 B;  2E2V A;  3LYG A;  1FUW A;  5JBS A;  3EN8 A;  5JPP A;  2W2C A;  3DM8 A;  3CCR 3;  3LXU X;  2CG0 A;  1NB5 I;  3CCQ 3;  2QA4 3;  4HZ9 B;  3EJV A;  3KKG A;  3KZT A;  4L7K A;  2Z76 A;  5CXO A;  1N9J A;  1VQ8 3;  1IQY A;  4N6V 0;  1K73 4;  1TFO A;  3UL5 A;  1E97 A;  3KII A;  1OAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...