5D82A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y16(cl-y)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
126
structure length
125
Chain Sequence
NLPTAQEVQGLMARIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta(5)-3-ketosteroid isomerase
publication title Dissecting Proton Delocalization in an Enzyme's Hydrogen Bond Network with Unnatural Amino Acids.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 125
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2015-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5d82A00
3MG3A 2Z7AA 5AEWB 4R9LA 3LZAA 4Q53A 1OGXA 5EVHA 1TUHA 3T8UA 2HMMB 2YFLB 1OHOA 1OF5B 1GS3A 5IG5A 3CNMA 3VGNA 4J9AA 2K54A 2STDA 2XR8B 3S5CA 3HX8A 4X2OA 1SJWA 3D9RA 5IEPA 4OVMA 4HM1B 1Q40A 5AIFA 4CDLA 3EX9A 1Q42A 3MHEA 5IEOA 4K1UA 1GY6A 2B24B 3MYTA 1UUWB 2GBXB 1W00A 2INXA 1Z1SA 2HMLB 1ZO2A 2JQ5A 3VSYA 2GBWB 1C7HA 3NUVA 8CHOA 2PZVA 3E99A 1JN5B 4ORLA 4XDWA 4HM2B 4OUQA 3DMCA 1QMAA 2XSHB 3MG2A 4GB5A 5DREA 3BLZA 4HM4B 3IPTA 1OGZA 1TP6A 3JUOA 3A76A 3K7CA 2RFRA 3MSOA 3FSDA 5KP4A 1OUNA 1GY5A 4WYKA 3F9SA 3GZRA 1O7HB 1U5OA 3KKGA 4HVNA 5D82A 4H3UA 1JB5A 2F99A 3UJMA 1JB2A 3FZWA 3DZLA 4HKVB 4XM4A 4FCMA 3EBTA 5KP3A 3MKIA 5STDA 3GZBA 1CQSA 1DMNA 3STDA 3SOAA 3T8NA 3OWUA 3EQQB 5IG3A 2YFJB 4N3VA 3ER7A 4XB5A 1JKGA 4L8PA 4HM6B 4XBXA 3B8LA 2UX0A 3M8CA 1A2KA 1VZZA 1W01A 5JPUA 2F86B 4HM5B 3EN1B 3KE7A 5JPPA 3H3HA 2Z76A 3NXJA 3JUPA 3WMDA 3EC9A 3B7CA 3EF8A 1E97A 4PEJA 5BVBA 5FW5A 2BMRB 5CF2A 3CNXA 4HJLB 5IG4A 6STDA 4MJDA 3B4PA 3FF2A 5CXOA 5TGNA 3OXAA 5IENA 3OX9A 4L7KA 3CPOA 3EBYA 4X2HA 3CU3A 2IMJA 1AR0A 3OWSA 2RGQA 3FKAA 5G2GA 1OF5A 2B1XB 3RGRA 2BMOB 3UNLA 3GZXB 1JB4A 1K41A 3JUNA 1S5AA 1OH0A 4J8TA 5AIGA 2XRXB 5AEUB 1BUQA 4WWUC 1W6YA 1ASKA 4XBTA 5IF6A 2I9WA 3DM8A 1O7MB 3NM2A 1ISKA 2W2CA 3FGYA 1IDPA 1O7GB 3F8XA 1JN5A 4U13A 2HMNB 2BMQB 3SEDA 5IG0A 1W02A 5D81A 3HK4A 4HM7B 1DMMA 3BB9A 1O7WB 3JUMA 5D83A 5AI1A 1GYBA 2OWPA 3NV0B 1NDOB 1Q40B 5DRVA 4IIAA 3LYGA 4XDVA 3ROBA 1QJGA 2BNGA 4XBYA 3Q90A 4LGQA 2A15A 3MG1A 1NWWA 2HMOB 4I4KA 4HM8B 3GZYB 4FCJA 3F7XA 1HKXA 1E3RA 3ECFA 3FF0A 3KSPA 4HZ9B 4RZMA 3B4OA 2Z77A 5KP1A 4HM3B 3SOYA 4STDA 4LMIA 5AIIA 3NV0A 2XSOB 5AIHA 2GEXA 1ZX2A 2CHCA 4LEHA 3G16A 3EN8A 1EG9B 3FLJA 3EHCA 3FH1A 4WYKB 1NU3A 5CF1A 1O7PB 3G0KA 3HZPA 1GY7A 2R4IA 3GRDA 3I0YA 3RGAA 4WP5A 3EJVA 5BXQA 2CKFB 5IERA 1ULJB 5CK6A 3JUQA 3NHXA 3DUKA 2HMKB 1E3VA 7STDA 3F7SA 1STDA 2GXFA 4R1KA 3GWRA 3K0ZA 1WQLB 1JKGB 1DMQA 3G8ZA 3KZTA 2YFIB 1OHSA 3OV4A 1OCVA 1UUVB 3NBRA 4HM0B 3OWYA 1OPYA 5HGRA 3DXOA 1ULIB 2HMJB 4L8OA 2QIYA 5CLKA 1EA2A 2RCDA 4K1VA 3F8HA 4KVHA 4HZBB 2QGUA 4R9KA 3F40A 3H51A 3F14A 1OHPA 2GEYA 1O7NB 2F98A
chains in the Genus database with same CATH superfamily
3MG3A 2KF4A 2P05A 1I2FA 2WOHA 4GHOA 2Z7AA 2IUJA 5AEWB 1RHLA 4RNTA 4R9LA 1X1WA 3LZAA 1U8CB 3PYJA 4Q53A 1OGXA 5EVHA 1EUIC 2OOVA 3KFQC 2CFLA 3OW22 4H61A 4JF8A 1TUHA 4N6LA 3T8UA 2HMMB 2YFLB 1B2SA 1OHOA 1RRLA 1RRHA 3X42A 3MPHA 3J7Yd 1RGLA 1WTHA 1OF5B 3PCSA 1GS3A 1A2PA 4BL3A 5IG5A 1B2MA 3CNMA 3VGNA 4J9AA 1PY3A 3URPA 4O8SA 2K54A 2BHMA 2STDA 2XR8B 2Y74A 3DH2A 2ZDJA 4O3VA 2KAAA 3IJEB 3S5CA 1M904 3HX8A 4X2OA 1SJWA 3D9RA 3X41A 1I3FA 5IEPA 5IW9A 4OVMA 1IV7A 1DYUA 4HM1B 4CJNA 3G713 1VQ83 1VQM3 2M7OA 4AEQA 1Q40A 2BO9B 2O3OA 5AIFA 1FA3A 4CDLA 1K734 3CCM3 2CWUA 2JDIH 2OTJ3 3EX9A 1RDSA 2P0XA 3SX1A 1Q42A 3MHEA 5IEOA 4K1UA 4MMZB 3MWZA 2GU1A 4TX4A 4O2HA 3CCR3 1RCKA 7RNTA 1GY6A 2B24B 3MYTA 1X1UA 4GL6A 2CFDA 1UUWB 2IUKA 2GBXB 1W00A 2INXA 4N6V0 2Y73A 2ZL8A 1Z1SA 4N6UA 1L5GB 3K63A 2HMLB 1KC84 3I553 1ZO2A 2JQ5A 3AMOB 3VSYA 2GBWB 1C7HA 2RBIA 3NUVA 8CHOA 3X3XA 1W6GA 3RDEA 2PZVA 3E99A 1BNSA 1VQ53 1VQQA 5LC6A 4RNZA 2RSXA 1FYSA 3DGMA 1JN5B 2KRTA 1VQP3 2GU3A 4IT7A 3LH4A 1BSDA 4ORLA 4EYCA 5G1LA 4XDWA 1RSNA 4HM2B 1PFPA 2UUGC 4NREA 1BOXA 1IT7A 1N9EA 1W2B2 3LTCA 4K61A 3LTBA 1HU9A 4OUQA 3DMCA 3V98A 1K8A4 1FW7A 1QMAA 1T2HA 2CWVA 2XSHB 3KN4A 3MG2A 1RMSA 4GB5A 3BLZA 1FGRA 1UGIA 5DREA 1Q864 4KFFA 4HM4B 1Q7Y4 3IPTA 1BGSA 1BNGA 1OGZA 3AGNA 2D1WA 1TP6A 1AV4A 3NQZA 3WDGB 3JUOA 1BU4A 1FGQA 1FGTA 3A76A 2GSPA 1S723 2AADA 2WGQA 2KXGA 3K7CA 1VQO3 2RFRA 3MSOA 1BRJA 3FSDA 4BU4A 5KP4A 1QVF2 1YGWA 1OUNA 3G6E3 1YIJ3 1GY5A 2FNQA 4LZIA 4WYKA 1JZDA 2QA43 3F9SA 3GZRA 1O7HB 1BRKA 1U5OA 1YHQ3 3KKGA 1BNIA 1BRGA 3FG4A 4HVNA 1DVDA 5D82A 4H3UA 1Q824 3SLUA 1JB5A 2OOVC 3UL5A 3WODG 4EW5A 1NB5I 2F99A 3UJMA 1TRPA 1JB2A 2D42A 3FZWA 3DGOA 4R80A 1RGKA 1UW1A 1N8QA 1BRHA 3DZLA 4HOHA 2AAEA 1BUJA 1JV2B 3BU4A 4HKVB 2OQEC 1I70A 3T0UA 1BIRA 1EKMA 4XM4A 1B2UA 4FCMA 2WO0A 5FGOA 3UB1A 1NB3I 3EBTA 3I563 4EV5A 4OK0A 5KP3A 3CD63 3MKIA 1RGCA 3NBBA 1LQMB 4N6OB 5LC7A 5STDA 2IY2A 4N6NB 3GZBA 1RGHA 1RGGA 1N8R4 1CQSA 2CWTA 8RNTA 4R4KA 1DMNA 3STDA 1ZGXA 1DVCA 3SOAA 2H0GA 3T8NA 3OWUA 1BNRA 3K9MC 2R41A 3CC23 1B20A 3EQQB 1NJI4 1Q9EA 2YFJB 3D3LA 2L4VA 5IG3A 4N3VA 7GSPA 3PXMA 3ER7A 3NBJA 3SXXA 1W5ZA 2E2VA 1ZS7A 3ZG5A 4XB5A 1W7CA 4BL2A 1JKGA 4L8PA 4HM6B 4BTYA 1RN7A 1N5HA 4XBXA 3B8LA 3CXC2 3U97A 1T2IA 1KD14 2CX0A 2CFGA 2CC3A 2OQEA 2UX0A 2CX1A 1BSAA 3M8CA 1SIHA 1GOUA 3LT8A 2OTL3 1YVSA 1YI23 2CFWA 5RNTA 1A2KA 2BT3A 1HYFA 1PYLA 1VZZA 3GAXA 1W01A 5JPUA 3CCV3 2Q07A 2F86B 4HM5B 3EN1B 5M1AA 3KE7A 4KFEA 5JPPA 1SARA 4HYZA 2IYJA 1JJ22 1EEJA 2SARA 3FG3A 1RJOA 1R4YA 3H3HA 2Z76A 3HOHA 4G1MB 5G1KA 1I2GA 3WOEB 1UGHI 1FZUA 1G0TA 1B3SA 3JUPA 2WGOA 3NXJA 4MMXB 3G4S3 3WMDA 1I2EA 1JBRA 2MC8A 2F5MA 3EC9A 2LQVA 1MWRA 3B7CA 3EF8A 1E97A 3PGBA 4AKYA 4PEJA 5JBSA 5M19A 2ZHXB 1CYUA 1IU7A 4J5KA 4FMBA 5BVBA 5FW5A 3CCS3 3BNCA 2BMRB 5CF2A 1UUGB 1WMPA 3CNXA 3A5EA 4HJLB 5IG4A 1CEWI 1QVG2 6STDA 4MJDA 3B4PA 1UI8A 3FF2A 5CXOA 1M1XB 1B2XA 3Q1CA 3OXAA 5TGNA 3V99A 1AVLA 3HIIA 2P09A 4JRFA 2CW9A 3NX0A 5IENA 3OX9A 4L7KA 2KCDA 3EE1A 1BSBA 3CPOA 1GD4A 1IQ8A 3EBYA 4X2HA 1T3BA 3CU3A 4HAAA 1VQL3 2IMJA 1AR0A 2PNCA 3OWSA 2RGQA 2KF3A 3D5IA 1JZOA 3FKAA 2CG0A 5G2GA 1OF5A 2B1XB 3Q3FA 2BMOB 4LSOA 3RGRA 3UNLA 2W6JH 3GZXB 4DKIA 5EEOA 1EQKA 3RNTA 2QEX3 1JB4A 2FXTA 1BANA 1G02A 1WMNA 4QWTA 1IVUA 4RNYA 5A0OB 3DGLA 4MMYB 4AKZA 4N6TA 3D5GA 1K41A 1I0XA 1S5AA 1OH0A 3JUNA 4J8TA 2W04A 3X3ZA 1GSPA 2C4BA 5AIGA 1N5PA 2XRXB 3BNEA 5AEUB 1BUQA 1FUTA 3WA2X 1LOWA 3X40A 1LOYA 1JRQA 4WWUC 3LXUX 2F4YA 1W6YA 4BTXA 2Z6BA 3AHWA 3KIIA 1ASKA 4XBTA 2XGLA 1WNHA 4KFDA 5HOHA 5IF6A 3QK9A 1Y4KA 1UCIA 1MOLA 4ILFA 1YJW3 2I9WA 2K0MA 1RGFA 2WOFA 3FCSB 4KZ1A 3DM8A 2SBLA 1IV9A 1K28A 1O7MB 1W6CA 3AHSA 3FG1A 3NM2A 1ISKA 1I0VA 3AMOA 2ML6A 1NNVA 1TRQA 2W2CA 3FGYA 5ELJA 1IT8A 1SIIA 1AY7A 3NQYA 3PZWA 1IDPA 1O7GB 1LVNA 1JN5A 3F8XA 4U13A 3PS8A 2HMNB 2F56A 1Q814 4CPKA 3WA3A 1LRAA 2BMQB 3S27A 3U1WA 3SEDA 3X3YA 1ROVA 5IG0A 1W02A 1J2BA 5D81A 3DGYA 3HK4A 4HM7B 1STFI 1CYVA 1M9GA 1SQWA 2P0MA 2LYXA 1YJN3 1DMMA 1BNEA 3BB9A 1YIT3 2J8XB 4RBNA 2RNTA 3HI7A 3KSED 3DY5A 2XEPA 3N8BA 1O7WB 5AYSC 2XF3A 2HOHA 1G96A 1VQK3 3CCE3 1YJ93 1W4NA 3ZG0A 1C54A 3JUMA 2YX9A 1LOVA 5AI1A 1GYBA 5D83A 2MF7A 2OWPA 3NV0B 5BIRA 1KQS2 1DE3A 3VF1A 1NDOB 3D4AA 4EBGA 3CME3 1VQ63 1VQN3 1Q40B 5DRVA 4IIAA 3LYGA 2CIUA 4XDVA 3K5TA 1A67A 1GMQA 3V92A 3ROBA 2CK3H 3DGNA 4BIRA 1QJGA 3LOYA 3O8YA 1RGAA 2V1LA 3LMLA 2BNGA 2KF6A 1JBTA 4XBYA 3Q90A 4LGQA 4FR9A 2A15A 1D6YA 2ZA4A 1TJDA 2CH9A 1VQ73 3MG1A 1TU5A 1NWWA 1B21A 2HMOB 4I4KA 4HM8B 3GZYB 1FGMA 4FCJA 1LNIA 1LXEA 3AGOA 3F7XA 2ML5A 1W2ZA 2W9PA 1X1YA 3HIGA 5BU4A 2W9QA 1HKXA 2H0IA 2XFSA 1RKYA 1E3RA 1IYYA 3ECFA 2UGIA 3QRDA 1D6UA 4BTWA 4LYLB 1IVXA 3FF0A 3KSPA 2W56B 1RN1A 5AYRB 3CPW2 1B27A 4HZ9B 4RZMA 1HZ1A 2W0QA 3B4OA 5EQLA 4J5GA 2Z77A 5KP1A 4HM3B 3D79A 3SOYA 3TDGA 1TTOA 4STDA 4LMIA 5GSPA 3CC43 3EB8A 3NV0A 2XSOB 5AIIA 5AIHA 2GEXA 1ZX2A 1BNFA 2CHCA 2O9UX 4LEHA 3BIRA 4EV2A 3G16A 4ZM8A 3EN8A 6GSPA 1EG9B 3KCHA 3UL6A 2L1SA 4CCVA 1PU4A 4WFOA 1RNBA 1MGRA 1UCJA 2BIRA 4HBRA 2E2TA 3FLJA 3EHCA 4I5QA 3FH1A 4WYKB 2F5WA 1NU3A 5CF1A 1BSEA 1BAOA 1TIJA 2BU4A 3CMA3 1O7PB 3G0KA 2W03A 1GMPA 3HZPA 3ZFZA 1V74A 1CH0A 1GY7A 4O02B 1BNJA 4KT3B 4NPBA 2R4IA 2IA7A 1NO3A 1T5YA 3GRDA 3I0YA 1FUWA 3CC73 4EXRA 3ALAA 4K90B 3SYUA 2XFTA 3RGAA 3S28A 3S29A 4WP5A 3EJVA 3IMAB 1KWIA 3GSPA 1LOXA 5BXQA 4FMAA 1Q7HA 1BSCA 3CCQ3 4FMDA 2CKFB 5IERA 1RCLA 1IQXA 4WHAA 1ULJB 1V57A 2W56A 1VQ43 1GD3A 1GOYA 1LQGC 3WOFB 1UI7A 1IVWA 2P38A 1F8NA 2XH9A 5CK6A 3JUQA 1FGOA 3NHXA 1BRNL 3DUKA 1RLSA 3SVAA 1IK3A 2XGNA 5ELUA 2HMKB 2K3DA 4FCZA 1E3VA 3CCJ3 7STDA 1IVVA 3LT9A 1MWTA 2CG1A 3L0RA 1BRSA 3N54B 1JNQA 3S67A 1JBSA 1D6ZA 1UCLA 3F7SA 1STDA 2GXFA 4R1KA 1I8VA 1I3IA 1X1XA 2KF5A 3N9HA 3WR2A 1MGWA 5M18A 1M1K4 1LNHA 1R4CA 2H0HA 3GWRA 3K0ZA 4N6MA 1AVKA 1WQLB 5I97A 1K9M4 1JKGB 1US1A 1TFKA 3PCRA 1KSIA 1RTUA 1MWUA 1DMQA 3G8ZA 1RGEA 1VQ93 3LTDA 3KZTA 2FGTA 1RN4A 4NHFA 2YFIB 1OHSA 3OV4A 1OCVA 1UUVB 3BNDA 4FMCA 3NBRA 4HM0B 3OWYA 1OPYA 1QAFA 1BRIA 1GOVA 1V58A 5HGRA 1BVIA 2CFKA 1AQZA 3DXOA 1IQYA 1ULIB 2C10A 2HMJB 6RNTA 3BNBA 1QALA 1YGEA 2OCTA 3CCL3 1FUSA 1QAKA 1RNTA 1MNLA 1YNVX 2C11A 1ROAA 2QIYA 4L8OA 1SPUA 5CLKA 1EA2A 4IPBA 1OACA 2E2UA 3JVCA 3WHOA 3CCU3 1B2ZA 1YVBI 2RCDA 1MWSA 1UDII 3LTAA 1TFOA 3Q2PA 1UCKA 1A2VA 4GSPA 4K1VA 1N9JA 3F8HA 9RNTA 4KVHA 4HZBB 1A90A 2QGUA 4MEIA 1GMRA 4R9KA 3F40A 3H51A 3NM7A 3F14A 4EC6A 1OHPA 1DETA 1WMOA 2GEYA 1O7NB 2F98A
chains in the Genus database with same CATH topology
3MG3A 2P05A 2WOHA 2Z7AA 2IUJA 5AEWB 4R9LA 3LZAA 1U8CB 3PYJA 4Q53A 1OGXA 5EVHA 2OOVA 3KFQC 2CFLA 3OW22 4H61A 4JF8A 1TUHA 4N6LA 3T8UA 2HMMB 2YFLB 1RRHA 1OHOA 1RRLA 3X42A 3MPHA 3J7Yd 1WTHA 1OF5B 3PCSA 1GS3A 5IG5A 3CNMA 3VGNA 4J9AA 4O8SA 2K54A 2BHMA 2STDA 2XR8B 2Y74A 4O3VA 2ZDJA 3S5CA 3IJEB 1M904 3HX8A 4X2OA 1SJWA 3D9RA 3X41A 5IEPA 5IW9A 4OVMA 1IV7A 1DYUA 4HM1B 3G713 1VQ83 1VQM3 2M7OA 4AEQA 1Q40A 2BO9B 2O3OA 5AIFA 1FA3A 4CDLA 1K734 3CCM3 2CWUA 2JDIH 2OTJ3 3EX9A 2P0XA 3SX1A 1Q42A 3MHEA 5IEOA 4K1UA 4MMZB 3MWZA 2GU1A 4TX4A 4O2HA 3CCR3 1GY6A 2B24B 3MYTA 4GL6A 2CFDA 1UUWB 2IUKA 2GBXB 1W00A 2INXA 4N6V0 2Y73A 2ZL8A 1Z1SA 4N6UA 1L5GB 3K63A 2HMLB 1KC84 3I553 1ZO2A 2JQ5A 3AMOB 3VSYA 2GBWB 1C7HA 3NUVA 8CHOA 3X3XA 1W6GA 3RDEA 2PZVA 3E99A 1VQ53 5LC6A 4RNZA 2RSXA 3DGMA 1JN5B 2KRTA 1VQP3 2GU3A 4IT7A 3LH4A 4ORLA 4EYCA 4XDWA 4HM2B 1PFPA 4NREA 1W2B2 1IT7A 1N9EA 3LTCA 4K61A 3LTBA 1HU9A 4OUQA 3DMCA 3V98A 1K8A4 1QMAA 2CWVA 2XSHB 3KN4A 3MG2A 4GB5A 5DREA 3BLZA 1FGRA 1Q864 4KFFA 4HM4B 1Q7Y4 3IPTA 1OGZA 2D1WA 1TP6A 1AV4A 3NQZA 3WDGB 3JUOA 1FGQA 3A76A 1FGTA 1S723 2WGQA 2KXGA 3K7CA 1VQO3 2RFRA 3MSOA 3FSDA 5KP4A 1QVF2 1OUNA 3G6E3 1YIJ3 1GY5A 2FNQA 4LZIA 4WYKA 2QA43 3F9SA 3GZRA 1O7HB 1YHQ3 1U5OA 3KKGA 1DVDA 3FG4A 4HVNA 5D82A 4H3UA 1Q824 3SLUA 1JB5A 2OOVC 3UL5A 3WODG 1NB5I 2F99A 3UJMA 1JB2A 2D42A 3FZWA 3DGOA 4R80A 1UW1A 1N8QA 3DZLA 1JV2B 4HKVB 2OQEC 3T0UA 1EKMA 4XM4A 4FCMA 2WO0A 5FGOA 3UB1A 1NB3I 3EBTA 3I563 4EV5A 4OK0A 5KP3A 3CD63 3MKIA 3NBBA 4N6OB 5LC7A 5STDA 4N6NB 3GZBA 1N8R4 1CQSA 2CWTA 4R4KA 1DMNA 3STDA 1DVCA 3SOAA 3T8NA 3OWUA 3K9MC 3CC23 1NJI4 3EQQB 3D3LA 2YFJB 5IG3A 2L4VA 4N3VA 3PXMA 3ER7A 3NBJA 3SXXA 1W5ZA 2E2VA 4XB5A 1W7CA 1JKGA 4L8PA 4HM6B 4BTYA 1RN7A 1N5HA 4XBXA 3B8LA 3CXC2 3U97A 1KD14 2CFGA 2CC3A 2OQEA 2UX0A 3M8CA 1SIHA 3LT8A 2OTL3 1YI23 2CFWA 1A2KA 2BT3A 1VZZA 3GAXA 1W01A 5JPUA 3CCV3 2Q07A 2F86B 4HM5B 3EN1B 3KE7A 4KFEA 5JPPA 4HYZA 1JJ22 3FG3A 1RJOA 3H3HA 2Z76A 4G1MB 3WOEB 3NXJA 3JUPA 2WGOA 4MMXB 3G4S3 3WMDA 2MC8A 3EC9A 2LQVA 3B7CA 3EF8A 1E97A 3PGBA 4AKYA 4PEJA 5JBSA 1CYUA 1IU7A 5BVBA 4FMBA 5FW5A 3CCS3 3BNCA 2BMRB 5CF2A 1WMPA 3CNXA 4HJLB 1QVG2 5IG4A 1CEWI 6STDA 4MJDA 3B4PA 1UI8A 3FF2A 5CXOA 1M1XB 3Q1CA 5TGNA 3OXAA 3V99A 1AVLA 3HIIA 2P09A 4JRFA 2CW9A 3NX0A 5IENA 3OX9A 4L7KA 2KCDA 3EE1A 3CPOA 1GD4A 1IQ8A 3EBYA 4X2HA 3CU3A 1VQL3 2IMJA 1AR0A 2PNCA 3OWSA 2RGQA 3FKAA 5G2GA 2CG0A 1OF5A 2B1XB 4LSOA 2BMOB 3RGRA 3UNLA 2W6JH 3GZXB 5EEOA 1EQKA 2QEX3 1JB4A 2FXTA 4QWTA 1WMNA 5A0OB 1IVUA 4RNYA 3DGLA 4MMYB 4AKZA 4N6TA 1K41A 3JUNA 1S5AA 1OH0A 4J8TA 3X3ZA 2W04A 5AIGA 1N5PA 2XRXB 3BNEA 5AEUB 1BUQA 3WA2X 3X40A 1JRQA 4WWUC 3LXUX 1W6YA 4BTXA 2Z6BA 3KIIA 1ASKA 4XBTA 2XGLA 1WNHA 4KFDA 5IF6A 3QK9A 1Y4KA 1MOLA 1YJW3 2I9WA 2K0MA 2WOFA 3FCSB 4KZ1A 3DM8A 2SBLA 1K28A 1IV9A 1O7MB 1W6CA 3FG1A 3NM2A 1ISKA 3AMOA 2ML6A 2W2CA 5ELJA 3FGYA 1IT8A 1SIIA 3NQYA 3PZWA 1IDPA 1O7GB 1LVNA 1JN5A 3F8XA 4U13A 3PS8A 2HMNB 1Q814 3WA3A 2BMQB 3S27A 3U1WA 3SEDA 3X3YA 1ROVA 5IG0A 1W02A 1J2BA 5D81A 3HK4A 4HM7B 1STFI 1CYVA 1M9GA 1SQWA 2P0MA 2LYXA 1YJN3 1DMMA 3BB9A 1YIT3 4RBNA 3HI7A 3KSED 3DY5A 2XEPA 3N8BA 1O7WB 5AYSC 2XF3A 1VQK3 1G96A 3CCE3 1YJ93 1W4NA 3JUMA 2YX9A 5D83A 5AI1A 1GYBA 1KQS2 2MF7A 2OWPA 3NV0B 3VF1A 1NDOB 4EBGA 3CME3 1VQ63 1VQN3 1Q40B 5DRVA 4IIAA 3LYGA 2CIUA 4XDVA 3K5TA 1A67A 3V92A 3ROBA 2CK3H 3DGNA 1QJGA 3LOYA 3O8YA 2V1LA 3LMLA 2BNGA 4XBYA 3Q90A 4LGQA 4FR9A 2A15A 1D6YA 2CH9A 1VQ73 3MG1A 1TU5A 1NWWA 2HMOB 4I4KA 4HM8B 3GZYB 1FGMA 4FCJA 1LXEA 3F7XA 2ML5A 1W2ZA 2W9PA 3HIGA 2XFSA 2W9QA 1HKXA 1RKYA 1E3RA 3ECFA 3QRDA 1D6UA 4BTWA 1IVXA 3FF0A 3KSPA 2W56B 5AYRB 3CPW2 4HZ9B 4RZMA 2W0QA 3B4OA 5EQLA 2Z77A 5KP1A 4HM3B 3SOYA 3TDGA 4STDA 4LMIA 3CC43 3EB8A 3NV0A 2XSOB 5AIIA 5AIHA 2GEXA 1ZX2A 2CHCA 2O9UX 4LEHA 4EV2A 3G16A 4ZM8A 3EN8A 1EG9B 3UL6A 4CCVA 1PU4A 4WFOA 4HBRA 2E2TA 3FLJA 3EHCA 3FH1A 4WYKB 1NU3A 5CF1A 1TIJA 3CMA3 1O7PB 3G0KA 2W03A 3HZPA 1V74A 1GY7A 4O02B 2R4IA 2IA7A 1NO3A 1T5YA 3GRDA 3I0YA 1FUWA 3CC73 4EXRA 3ALAA 4K90B 2XFTA 3RGAA 3S28A 3S29A 4WP5A 3EJVA 3IMAB 1KWIA 5BXQA 1LOXA 4FMAA 3CCQ3 4FMDA 2CKFB 5IERA 1IQXA 4WHAA 1ULJB 1VQ43 2W56A 1GD3A 3WOFB 1UI7A 1IVWA 2P38A 1F8NA 2XH9A 5CK6A 3JUQA 1FGOA 3NHXA 3DUKA 3SVAA 1IK3A 2XGNA 5ELUA 2HMKB 4FCZA 1E3VA 3CCJ3 7STDA 1IVVA 3LT9A 2CG1A 3L0RA 3N54B 1JNQA 3S67A 1D6ZA 3F7SA 1STDA 2GXFA 4R1KA 3N9HA 1M1K4 1LNHA 1R4CA 3GWRA 3K0ZA 4N6MA 5I97A 1AVKA 1WQLB 1K9M4 1JKGB 1US1A 1TFKA 3PCRA 1KSIA 1DMQA 3G8ZA 1VQ93 3LTDA 3KZTA 2FGTA 4NHFA 2YFIB 1OHSA 3OV4A 1OCVA 1UUVB 3BNDA 4FMCA 3NBRA 4HM0B 3OWYA 1OPYA 1QAFA 5HGRA 2CFKA 3DXOA 1IQYA 1ULIB 2C10A 2HMJB 3BNBA 1QALA 1YGEA 2OCTA 3CCL3 1QAKA 4L8OA 1MNLA 2QIYA 2C11A 1ROAA 5CLKA 1SPUA 3CCU3 1EA2A 4IPBA 1OACA 2E2UA 3JVCA 1YVBI 2RCDA 3LTAA 1TFOA 3Q2PA 4K1VA 1A2VA 1N9JA 3F8HA 4KVHA 4HZBB 1A90A 2QGUA 4MEIA 4R9KA 3F40A 3H51A 3NM7A 3F14A 4EC6A 1OHPA 1WMOA 2GEYA 1O7NB 2F98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG3 A;  2Z7A A;  5AEW B;  4R9L A;  3LZA A;  4Q53 A;  1OGX A;  5EVH A;  1TUH A;  3T8U A;  2HMM B;  2YFL B;  1OHO A;  1OF5 B;  1GS3 A;  5IG5 A;  3CNM A;  3VGN A;  4J9A A;  2K54 A;  2STD A;  2XR8 B;  3S5C A;  3HX8 A;  4X2O A;  1SJW A;  3D9R A;  5IEP A;  4OVM A;  4HM1 B;  1Q40 A;  5AIF A;  4CDL A;  3EX9 A;  1Q42 A;  3MHE A;  5IEO A;  4K1U A;  1GY6 A;  2B24 B;  3MYT A;  1UUW B;  2GBX B;  1W00 A;  2INX A;  1Z1S A;  2HML B;  1ZO2 A;  2JQ5 A;  3VSY A;  2GBW B;  1C7H A;  3NUV A;  8CHO A;  2PZV A;  3E99 A;  1JN5 B;  4ORL A;  4XDW A;  4HM2 B;  4OUQ A;  3DMC A;  1QMA A;  2XSH B;  3MG2 A;  4GB5 A;  5DRE A;  3BLZ A;  4HM4 B;  3IPT A;  1OGZ A;  1TP6 A;  3JUO A;  3A76 A;  3K7C A;  2RFR A;  3MSO A;  3FSD A;  5KP4 A;  1OUN A;  1GY5 A;  4WYK A;  3F9S A;  3GZR A;  1O7H B;  1U5O A;  3KKG A;  4HVN A;  5D82 A;  4H3U A;  1JB5 A;  2F99 A;  3UJM A;  1JB2 A;  3FZW A;  3DZL A;  4HKV B;  4XM4 A;  4FCM A;  3EBT A;  5KP3 A;  3MKI A;  5STD A;  3GZB A;  1CQS A;  1DMN A;  3STD A;  3SOA A;  3T8N A;  3OWU A;  3EQQ B;  5IG3 A;  2YFJ B;  4N3V A;  3ER7 A;  4XB5 A;  1JKG A;  4L8P A;  4HM6 B;  4XBX A;  3B8L A;  2UX0 A;  3M8C A;  1A2K A;  1VZZ A;  1W01 A;  5JPU A;  2F86 B;  4HM5 B;  3EN1 B;  3KE7 A;  5JPP A;  3H3H A;  2Z76 A;  3NXJ A;  3JUP A;  3WMD A;  3EC9 A;  3B7C A;  3EF8 A;  1E97 A;  4PEJ A;  5BVB A;  5FW5 A;  2BMR B;  5CF2 A;  3CNX A;  4HJL B;  5IG4 A;  6STD A;  4MJD A;  3B4P A;  3FF2 A;  5CXO A;  5TGN A;  3OXA A;  5IEN A;  3OX9 A;  4L7K A;  3CPO A;  3EBY A;  4X2H A;  3CU3 A;  2IMJ A;  1AR0 A;  3OWS A;  2RGQ A;  3FKA A;  5G2G A;  1OF5 A;  2B1X B;  3RGR A;  2BMO B;  3UNL A;  3GZX B;  1JB4 A;  1K41 A;  3JUN A;  1S5A A;  1OH0 A;  4J8T A;  5AIG A;  2XRX B;  5AEU B;  1BUQ A;  4WWU C;  1W6Y A;  1ASK A;  4XBT A;  5IF6 A;  2I9W A;  3DM8 A;  1O7M B;  3NM2 A;  1ISK A;  2W2C A;  3FGY A;  1IDP A;  1O7G B;  3F8X A;  1JN5 A;  4U13 A;  2HMN B;  2BMQ B;  3SED A;  5IG0 A;  1W02 A;  5D81 A;  3HK4 A;  4HM7 B;  1DMM A;  3BB9 A;  1O7W B;  3JUM A;  5D83 A;  5AI1 A;  1GYB A;  2OWP A;  3NV0 B;  1NDO B;  1Q40 B;  5DRV A;  4IIA A;  3LYG A;  4XDV A;  3ROB A;  1QJG A;  2BNG A;  4XBY A;  3Q90 A;  4LGQ A;  2A15 A;  3MG1 A;  1NWW A;  2HMO B;  4I4K A;  4HM8 B;  3GZY B;  4FCJ A;  3F7X A;  1HKX A;  1E3R A;  3ECF A;  3FF0 A;  3KSP A;  4HZ9 B;  4RZM A;  3B4O A;  2Z77 A;  5KP1 A;  4HM3 B;  3SOY A;  4STD A;  4LMI A;  5AII A;  3NV0 A;  2XSO B;  5AIH A;  2GEX A;  1ZX2 A;  2CHC A;  4LEH A;  3G16 A;  3EN8 A;  1EG9 B;  3FLJ A;  3EHC A;  3FH1 A;  4WYK B;  1NU3 A;  5CF1 A;  1O7P B;  3G0K A;  3HZP A;  1GY7 A;  2R4I A;  3GRD A;  3I0Y A;  3RGA A;  4WP5 A;  3EJV A;  5BXQ A;  2CKF B;  5IER A;  1ULJ B;  5CK6 A;  3JUQ A;  3NHX A;  3DUK A;  2HMK B;  1E3V A;  7STD A;  3F7S A;  1STD A;  2GXF A;  4R1K A;  3GWR A;  3K0Z A;  1WQL B;  1JKG B;  1DMQ A;  3G8Z A;  3KZT A;  2YFI B;  1OHS A;  3OV4 A;  1OCV A;  1UUV B;  3NBR A;  4HM0 B;  3OWY A;  1OPY A;  5HGR A;  3DXO A;  1ULI B;  2HMJ B;  4L8O A;  2QIY A;  5CLK A;  1EA2 A;  2RCD A;  4K1V A;  3F8H A;  4KVH A;  4HZB B;  2QGU A;  4R9K A;  3F40 A;  3H51 A;  3F14 A;  1OHP A;  2GEY A;  1O7N B;  2F98 A; 
#chains in the Genus database with same CATH topology
 3MG3 A;  2KF4 A;  2P05 A;  1I2F A;  2WOH A;  4GHO A;  2Z7A A;  2IUJ A;  5AEW B;  1RHL A;  4RNT A;  4R9L A;  1X1W A;  3LZA A;  1U8C B;  3PYJ A;  4Q53 A;  1OGX A;  5EVH A;  1EUI C;  2OOV A;  3KFQ C;  2CFL A;  3OW2 2;  4H61 A;  4JF8 A;  1TUH A;  4N6L A;  3T8U A;  2HMM B;  2YFL B;  1B2S A;  1OHO A;  1RRL A;  1RRH A;  3X42 A;  3MPH A;  3J7Y d;  1RGL A;  1WTH A;  1OF5 B;  3PCS A;  1GS3 A;  1A2P A;  4BL3 A;  5IG5 A;  1B2M A;  3CNM A;  3VGN A;  4J9A A;  1PY3 A;  3URP A;  4O8S A;  2K54 A;  2BHM A;  2STD A;  2XR8 B;  2Y74 A;  3DH2 A;  2ZDJ A;  4O3V A;  2KAA A;  3IJE B;  3S5C A;  1M90 4;  3HX8 A;  4X2O A;  1SJW A;  3D9R A;  3X41 A;  1I3F A;  5IEP A;  5IW9 A;  4OVM A;  1IV7 A;  1DYU A;  4HM1 B;  4CJN A;  3G71 3;  1VQ8 3;  1VQM 3;  2M7O A;  4AEQ A;  1Q40 A;  2BO9 B;  2O3O A;  5AIF A;  1FA3 A;  4CDL A;  1K73 4;  3CCM 3;  2CWU A;  2JDI H;  2OTJ 3;  3EX9 A;  1RDS A;  2P0X A;  3SX1 A;  1Q42 A;  3MHE A;  5IEO A;  4K1U A;  4MMZ B;  3MWZ A;  2GU1 A;  4TX4 A;  4O2H A;  3CCR 3;  1RCK A;  7RNT A;  1GY6 A;  2B24 B;  3MYT A;  1X1U A;  4GL6 A;  2CFD A;  1UUW B;  2IUK A;  2GBX B;  1W00 A;  2INX A;  4N6V 0;  2Y73 A;  2ZL8 A;  1Z1S A;  4N6U A;  1L5G B;  3K63 A;  2HML B;  1KC8 4;  3I55 3;  1ZO2 A;  2JQ5 A;  3AMO B;  3VSY A;  2GBW B;  1C7H A;  2RBI A;  3NUV A;  8CHO A;  3X3X A;  1W6G A;  3RDE A;  2PZV A;  3E99 A;  1BNS A;  1VQ5 3;  1VQQ A;  5LC6 A;  4RNZ A;  2RSX A;  1FYS A;  3DGM A;  1JN5 B;  2KRT A;  1VQP 3;  2GU3 A;  4IT7 A;  3LH4 A;  1BSD A;  4ORL A;  4EYC A;  5G1L A;  4XDW A;  1RSN A;  4HM2 B;  1PFP A;  2UUG C;  4NRE A;  1BOX A;  1IT7 A;  1N9E A;  1W2B 2;  3LTC A;  4K61 A;  3LTB A;  1HU9 A;  4OUQ A;  3DMC A;  3V98 A;  1K8A 4;  1FW7 A;  1QMA A;  1T2H A;  2CWV A;  2XSH B;  3KN4 A;  3MG2 A;  1RMS A;  4GB5 A;  3BLZ A;  1FGR A;  1UGI A;  5DRE A;  1Q86 4;  4KFF A;  4HM4 B;  1Q7Y 4;  3IPT A;  1BGS A;  1BNG A;  1OGZ A;  3AGN A;  2D1W A;  1TP6 A;  1AV4 A;  3NQZ A;  3WDG B;  3JUO A;  1BU4 A;  1FGQ A;  1FGT A;  3A76 A;  2GSP A;  1S72 3;  2AAD A;  2WGQ A;  2KXG A;  3K7C A;  1VQO 3;  2RFR A;  3MSO A;  1BRJ A;  3FSD A;  4BU4 A;  5KP4 A;  1QVF 2;  1YGW A;  1OUN A;  3G6E 3;  1YIJ 3;  1GY5 A;  2FNQ A;  4LZI A;  4WYK A;  1JZD A;  2QA4 3;  3F9S A;  3GZR A;  1O7H B;  1BRK A;  1U5O A;  1YHQ 3;  3KKG A;  1BNI A;  1BRG A;  3FG4 A;  4HVN A;  1DVD A;  5D82 A;  4H3U A;  1Q82 4;  3SLU A;  1JB5 A;  2OOV C;  3UL5 A;  3WOD G;  4EW5 A;  1NB5 I;  2F99 A;  3UJM A;  1TRP A;  1JB2 A;  2D42 A;  3FZW A;  3DGO A;  4R80 A;  1RGK A;  1UW1 A;  1N8Q A;  1BRH A;  3DZL A;  4HOH A;  2AAE A;  1BUJ A;  1JV2 B;  3BU4 A;  4HKV B;  2OQE C;  1I70 A;  3T0U A;  1BIR A;  1EKM A;  4XM4 A;  1B2U A;  4FCM A;  2WO0 A;  5FGO A;  3UB1 A;  1NB3 I;  3EBT A;  3I56 3;  4EV5 A;  4OK0 A;  5KP3 A;  3CD6 3;  3MKI A;  1RGC A;  3NBB A;  1LQM B;  4N6O B;  5LC7 A;  5STD A;  2IY2 A;  4N6N B;  3GZB A;  1RGH A;  1RGG A;  1N8R 4;  1CQS A;  2CWT A;  8RNT A;  4R4K A;  1DMN A;  3STD A;  1ZGX A;  1DVC A;  3SOA A;  2H0G A;  3T8N A;  3OWU A;  1BNR A;  3K9M C;  2R41 A;  3CC2 3;  1B20 A;  3EQQ B;  1NJI 4;  1Q9E A;  2YFJ B;  3D3L A;  2L4V A;  5IG3 A;  4N3V A;  7GSP A;  3PXM A;  3ER7 A;  3NBJ A;  3SXX A;  1W5Z A;  2E2V A;  1ZS7 A;  3ZG5 A;  4XB5 A;  1W7C A;  4BL2 A;  1JKG A;  4L8P A;  4HM6 B;  4BTY A;  1RN7 A;  1N5H A;  4XBX A;  3B8L A;  3CXC 2;  3U97 A;  1T2I A;  1KD1 4;  2CX0 A;  2CFG A;  2CC3 A;  2OQE A;  2UX0 A;  2CX1 A;  1BSA A;  3M8C A;  1SIH A;  1GOU A;  3LT8 A;  2OTL 3;  1YVS A;  1YI2 3;  2CFW A;  5RNT A;  1A2K A;  2BT3 A;  1HYF A;  1PYL A;  1VZZ A;  3GAX A;  1W01 A;  5JPU A;  3CCV 3;  2Q07 A;  2F86 B;  4HM5 B;  3EN1 B;  5M1A A;  3KE7 A;  4KFE A;  5JPP A;  1SAR A;  4HYZ A;  2IYJ A;  1JJ2 2;  1EEJ A;  2SAR A;  3FG3 A;  1RJO A;  1R4Y A;  3H3H A;  2Z76 A;  3HOH A;  4G1M B;  5G1K A;  1I2G A;  3WOE B;  1UGH I;  1FZU A;  1G0T A;  1B3S A;  3JUP A;  2WGO A;  3NXJ A;  4MMX B;  3G4S 3;  3WMD A;  1I2E A;  1JBR A;  2MC8 A;  2F5M A;  3EC9 A;  2LQV A;  1MWR A;  3B7C A;  3EF8 A;  1E97 A;  3PGB A;  4AKY A;  4PEJ A;  5JBS A;  5M19 A;  2ZHX B;  1CYU A;  1IU7 A;  4J5K A;  4FMB A;  5BVB A;  5FW5 A;  3CCS 3;  3BNC A;  2BMR B;  5CF2 A;  1UUG B;  1WMP A;  3CNX A;  3A5E A;  4HJL B;  5IG4 A;  1CEW I;  1QVG 2;  6STD A;  4MJD A;  3B4P A;  1UI8 A;  3FF2 A;  5CXO A;  1M1X B;  1B2X A;  3Q1C A;  3OXA A;  5TGN A;  3V99 A;  1AVL A;  3HII A;  2P09 A;  4JRF A;  2CW9 A;  3NX0 A;  5IEN A;  3OX9 A;  4L7K A;  2KCD A;  3EE1 A;  1BSB A;  3CPO A;  1GD4 A;  1IQ8 A;  3EBY A;  4X2H A;  1T3B A;  3CU3 A;  4HAA A;  1VQL 3;  2IMJ A;  1AR0 A;  2PNC A;  3OWS A;  2RGQ A;  2KF3 A;  3D5I A;  1JZO A;  3FKA A;  2CG0 A;  5G2G A;  1OF5 A;  2B1X B;  3Q3F A;  2BMO B;  4LSO A;  3RGR A;  3UNL A;  2W6J H;  3GZX B;  4DKI A;  5EEO A;  1EQK A;  3RNT A;  2QEX 3;  1JB4 A;  2FXT A;  1BAN A;  1G02 A;  1WMN A;  4QWT A;  1IVU A;  4RNY A;  5A0O B;  3DGL A;  4MMY B;  4AKZ A;  4N6T A;  3D5G A;  1K41 A;  1I0X A;  1S5A A;  1OH0 A;  3JUN A;  4J8T A;  2W04 A;  3X3Z A;  1GSP A;  2C4B A;  5AIG A;  1N5P A;  2XRX B;  3BNE A;  5AEU B;  1BUQ A;  1FUT A;  3WA2 X;  1LOW A;  3X40 A;  1LOY A;  1JRQ A;  4WWU C;  3LXU X;  2F4Y A;  1W6Y A;  4BTX A;  2Z6B A;  3AHW A;  3KII A;  1ASK A;  4XBT A;  2XGL A;  1WNH A;  4KFD A;  5HOH A;  5IF6 A;  3QK9 A;  1Y4K A;  1UCI A;  1MOL A;  4ILF A;  1YJW 3;  2I9W A;  2K0M A;  1RGF A;  2WOF A;  3FCS B;  4KZ1 A;  3DM8 A;  2SBL A;  1IV9 A;  1K28 A;  1O7M B;  1W6C A;  3AHS A;  3FG1 A;  3NM2 A;  1ISK A;  1I0V A;  3AMO A;  2ML6 A;  1NNV A;  1TRQ A;  2W2C A;  3FGY A;  5ELJ A;  1IT8 A;  1SII A;  1AY7 A;  3NQY A;  3PZW A;  1IDP A;  1O7G B;  1LVN A;  1JN5 A;  3F8X A;  4U13 A;  3PS8 A;  2HMN B;  2F56 A;  1Q81 4;  4CPK A;  3WA3 A;  1LRA A;  2BMQ B;  3S27 A;  3U1W A;  3SED A;  3X3Y A;  1ROV A;  5IG0 A;  1W02 A;  1J2B A;  5D81 A;  3DGY A;  3HK4 A;  4HM7 B;  1STF I;  1CYV A;  1M9G A;  1SQW A;  2P0M A;  2LYX A;  1YJN 3;  1DMM A;  1BNE A;  3BB9 A;  1YIT 3;  2J8X B;  4RBN A;  2RNT A;  3HI7 A;  3KSE D;  3DY5 A;  2XEP A;  3N8B A;  1O7W B;  5AYS C;  2XF3 A;  2HOH A;  1G96 A;  1VQK 3;  3CCE 3;  1YJ9 3;  1W4N A;  3ZG0 A;  1C54 A;  3JUM A;  2YX9 A;  1LOV A;  5AI1 A;  1GYB A;  5D83 A;  2MF7 A;  2OWP A;  3NV0 B;  5BIR A;  1KQS 2;  1DE3 A;  3VF1 A;  1NDO B;  3D4A A;  4EBG A;  3CME 3;  1VQ6 3;  1VQN 3;  1Q40 B;  5DRV A;  4IIA A;  3LYG A;  2CIU A;  4XDV A;  3K5T A;  1A67 A;  1GMQ A;  3V92 A;  3ROB A;  2CK3 H;  3DGN A;  4BIR A;  1QJG A;  3LOY A;  3O8Y A;  1RGA A;  2V1L A;  3LML A;  2BNG A;  2KF6 A;  1JBT A;  4XBY A;  3Q90 A;  4LGQ A;  4FR9 A;  2A15 A;  1D6Y A;  2ZA4 A;  1TJD A;  2CH9 A;  1VQ7 3;  3MG1 A;  1TU5 A;  1NWW A;  1B21 A;  2HMO B;  4I4K A;  4HM8 B;  3GZY B;  1FGM A;  4FCJ A;  1LNI A;  1LXE A;  3AGO A;  3F7X A;  2ML5 A;  1W2Z A;  2W9P A;  1X1Y A;  3HIG A;  5BU4 A;  2W9Q A;  1HKX A;  2H0I A;  2XFS A;  1RKY A;  1E3R A;  1IYY A;  3ECF A;  2UGI A;  3QRD A;  1D6U A;  4BTW A;  4LYL B;  1IVX A;  3FF0 A;  3KSP A;  2W56 B;  1RN1 A;  5AYR B;  3CPW 2;  1B27 A;  4HZ9 B;  4RZM A;  1HZ1 A;  2W0Q A;  3B4O A;  5EQL A;  4J5G A;  2Z77 A;  5KP1 A;  4HM3 B;  3D79 A;  3SOY A;  3TDG A;  1TTO A;  4STD A;  4LMI A;  5GSP A;  3CC4 3;  3EB8 A;  3NV0 A;  2XSO B;  5AII A;  5AIH A;  2GEX A;  1ZX2 A;  1BNF A;  2CHC A;  2O9U X;  4LEH A;  3BIR A;  4EV2 A;  3G16 A;  4ZM8 A;  3EN8 A;  6GSP A;  1EG9 B;  3KCH A;  3UL6 A;  2L1S A;  4CCV A;  1PU4 A;  4WFO A;  1RNB A;  1MGR A;  1UCJ A;  2BIR A;  4HBR A;  2E2T A;  3FLJ A;  3EHC A;  4I5Q A;  3FH1 A;  4WYK B;  2F5W A;  1NU3 A;  5CF1 A;  1BSE A;  1BAO A;  1TIJ A;  2BU4 A;  3CMA 3;  1O7P B;  3G0K A;  2W03 A;  1GMP A;  3HZP A;  3ZFZ A;  1V74 A;  1CH0 A;  1GY7 A;  4O02 B;  1BNJ A;  4KT3 B;  4NPB A;  2R4I A;  2IA7 A;  1NO3 A;  1T5Y A;  3GRD A;  3I0Y A;  1FUW A;  3CC7 3;  4EXR A;  3ALA A;  4K90 B;  3SYU A;  2XFT A;  3RGA A;  3S28 A;  3S29 A;  4WP5 A;  3EJV A;  3IMA B;  1KWI A;  3GSP A;  1LOX A;  5BXQ A;  4FMA A;  1Q7H A;  1BSC A;  3CCQ 3;  4FMD A;  2CKF B;  5IER A;  1RCL A;  1IQX A;  4WHA A;  1ULJ B;  1V57 A;  2W56 A;  1VQ4 3;  1GD3 A;  1GOY A;  1LQG C;  3WOF B;  1UI7 A;  1IVW A;  2P38 A;  1F8N A;  2XH9 A;  5CK6 A;  3JUQ A;  1FGO A;  3NHX A;  1BRN L;  3DUK A;  1RLS A;  3SVA A;  1IK3 A;  2XGN A;  5ELU A;  2HMK B;  2K3D A;  4FCZ A;  1E3V A;  3CCJ 3;  7STD A;  1IVV A;  3LT9 A;  1MWT A;  2CG1 A;  3L0R A;  1BRS A;  3N54 B;  1JNQ A;  3S67 A;  1JBS A;  1D6Z A;  1UCL A;  3F7S A;  1STD A;  2GXF A;  4R1K A;  1I8V A;  1I3I A;  1X1X A;  2KF5 A;  3N9H A;  3WR2 A;  1MGW A;  5M18 A;  1M1K 4;  1LNH A;  1R4C A;  2H0H A;  3GWR A;  3K0Z A;  4N6M A;  1AVK A;  1WQL B;  5I97 A;  1K9M 4;  1JKG B;  1US1 A;  1TFK A;  3PCR A;  1KSI A;  1RTU A;  1MWU A;  1DMQ A;  3G8Z A;  1RGE A;  1VQ9 3;  3LTD A;  3KZT A;  2FGT A;  1RN4 A;  4NHF A;  2YFI B;  1OHS A;  3OV4 A;  1OCV A;  1UUV B;  3BND A;  4FMC A;  3NBR A;  4HM0 B;  3OWY A;  1OPY A;  1QAF A;  1BRI A;  1GOV A;  1V58 A;  5HGR A;  1BVI A;  2CFK A;  1AQZ A;  3DXO A;  1IQY A;  1ULI B;  2C10 A;  2HMJ B;  6RNT A;  3BNB A;  1QAL A;  1YGE A;  2OCT A;  3CCL 3;  1FUS A;  1QAK A;  1RNT A;  1MNL A;  1YNV X;  2C11 A;  1ROA A;  2QIY A;  4L8O A;  1SPU A;  5CLK A;  1EA2 A;  4IPB A;  1OAC A;  2E2U A;  3JVC A;  3WHO A;  3CCU 3;  1B2Z A;  1YVB I;  2RCD A;  1MWS A;  1UDI I;  3LTA A;  1TFO A;  3Q2P A;  1UCK A;  1A2V A;  4GSP A;  4K1V A;  1N9J A;  3F8H A;  9RNT A;  4KVH A;  4HZB B;  1A90 A;  2QGU A;  4MEI A;  1GMR A;  4R9K A;  3F40 A;  3H51 A;  3NM7 A;  3F14 A;  4EC6 A;  1OHP A;  1DET A;  1WMO A;  2GEY A;  1O7N B;  2F98 A; 
#chains in the Genus database with same CATH homology
 3MG3 A;  2P05 A;  2WOH A;  2Z7A A;  2IUJ A;  5AEW B;  4R9L A;  3LZA A;  1U8C B;  3PYJ A;  4Q53 A;  1OGX A;  5EVH A;  2OOV A;  3KFQ C;  2CFL A;  3OW2 2;  4H61 A;  4JF8 A;  1TUH A;  4N6L A;  3T8U A;  2HMM B;  2YFL B;  1RRH A;  1OHO A;  1RRL A;  3X42 A;  3MPH A;  3J7Y d;  1WTH A;  1OF5 B;  3PCS A;  1GS3 A;  5IG5 A;  3CNM A;  3VGN A;  4J9A A;  4O8S A;  2K54 A;  2BHM A;  2STD A;  2XR8 B;  2Y74 A;  4O3V A;  2ZDJ A;  3S5C A;  3IJE B;  1M90 4;  3HX8 A;  4X2O A;  1SJW A;  3D9R A;  3X41 A;  5IEP A;  5IW9 A;  4OVM A;  1IV7 A;  1DYU A;  4HM1 B;  3G71 3;  1VQ8 3;  1VQM 3;  2M7O A;  4AEQ A;  1Q40 A;  2BO9 B;  2O3O A;  5AIF A;  1FA3 A;  4CDL A;  1K73 4;  3CCM 3;  2CWU A;  2JDI H;  2OTJ 3;  3EX9 A;  2P0X A;  3SX1 A;  1Q42 A;  3MHE A;  5IEO A;  4K1U A;  4MMZ B;  3MWZ A;  2GU1 A;  4TX4 A;  4O2H A;  3CCR 3;  1GY6 A;  2B24 B;  3MYT A;  4GL6 A;  2CFD A;  1UUW B;  2IUK A;  2GBX B;  1W00 A;  2INX A;  4N6V 0;  2Y73 A;  2ZL8 A;  1Z1S A;  4N6U A;  1L5G B;  3K63 A;  2HML B;  1KC8 4;  3I55 3;  1ZO2 A;  2JQ5 A;  3AMO B;  3VSY A;  2GBW B;  1C7H A;  3NUV A;  8CHO A;  3X3X A;  1W6G A;  3RDE A;  2PZV A;  3E99 A;  1VQ5 3;  5LC6 A;  4RNZ A;  2RSX A;  3DGM A;  1JN5 B;  2KRT A;  1VQP 3;  2GU3 A;  4IT7 A;  3LH4 A;  4ORL A;  4EYC A;  4XDW A;  4HM2 B;  1PFP A;  4NRE A;  1W2B 2;  1IT7 A;  1N9E A;  3LTC A;  4K61 A;  3LTB A;  1HU9 A;  4OUQ A;  3DMC A;  3V98 A;  1K8A 4;  1QMA A;  2CWV A;  2XSH B;  3KN4 A;  3MG2 A;  4GB5 A;  5DRE A;  3BLZ A;  1FGR A;  1Q86 4;  4KFF A;  4HM4 B;  1Q7Y 4;  3IPT A;  1OGZ A;  2D1W A;  1TP6 A;  1AV4 A;  3NQZ A;  3WDG B;  3JUO A;  1FGQ A;  3A76 A;  1FGT A;  1S72 3;  2WGQ A;  2KXG A;  3K7C A;  1VQO 3;  2RFR A;  3MSO A;  3FSD A;  5KP4 A;  1QVF 2;  1OUN A;  3G6E 3;  1YIJ 3;  1GY5 A;  2FNQ A;  4LZI A;  4WYK A;  2QA4 3;  3F9S A;  3GZR A;  1O7H B;  1YHQ 3;  1U5O A;  3KKG A;  1DVD A;  3FG4 A;  4HVN A;  5D82 A;  4H3U A;  1Q82 4;  3SLU A;  1JB5 A;  2OOV C;  3UL5 A;  3WOD G;  1NB5 I;  2F99 A;  3UJM A;  1JB2 A;  2D42 A;  3FZW A;  3DGO A;  4R80 A;  1UW1 A;  1N8Q A;  3DZL A;  1JV2 B;  4HKV B;  2OQE C;  3T0U A;  1EKM A;  4XM4 A;  4FCM A;  2WO0 A;  5FGO A;  3UB1 A;  1NB3 I;  3EBT A;  3I56 3;  4EV5 A;  4OK0 A;  5KP3 A;  3CD6 3;  3MKI A;  3NBB A;  4N6O B;  5LC7 A;  5STD A;  4N6N B;  3GZB A;  1N8R 4;  1CQS A;  2CWT A;  4R4K A;  1DMN A;  3STD A;  1DVC A;  3SOA A;  3T8N A;  3OWU A;  3K9M C;  3CC2 3;  1NJI 4;  3EQQ B;  3D3L A;  2YFJ B;  5IG3 A;  2L4V A;  4N3V A;  3PXM A;  3ER7 A;  3NBJ A;  3SXX A;  1W5Z A;  2E2V A;  4XB5 A;  1W7C A;  1JKG A;  4L8P A;  4HM6 B;  4BTY A;  1RN7 A;  1N5H A;  4XBX A;  3B8L A;  3CXC 2;  3U97 A;  1KD1 4;  2CFG A;  2CC3 A;  2OQE A;  2UX0 A;  3M8C A;  1SIH A;  3LT8 A;  2OTL 3;  1YI2 3;  2CFW A;  1A2K A;  2BT3 A;  1VZZ A;  3GAX A;  1W01 A;  5JPU A;  3CCV 3;  2Q07 A;  2F86 B;  4HM5 B;  3EN1 B;  3KE7 A;  4KFE A;  5JPP A;  4HYZ A;  1JJ2 2;  3FG3 A;  1RJO A;  3H3H A;  2Z76 A;  4G1M B;  3WOE B;  3NXJ A;  3JUP A;  2WGO A;  4MMX B;  3G4S 3;  3WMD A;  2MC8 A;  3EC9 A;  2LQV A;  3B7C A;  3EF8 A;  1E97 A;  3PGB A;  4AKY A;  4PEJ A;  5JBS A;  1CYU A;  1IU7 A;  5BVB A;  4FMB A;  5FW5 A;  3CCS 3;  3BNC A;  2BMR B;  5CF2 A;  1WMP A;  3CNX A;  4HJL B;  1QVG 2;  5IG4 A;  1CEW I;  6STD A;  4MJD A;  3B4P A;  1UI8 A;  3FF2 A;  5CXO A;  1M1X B;  3Q1C A;  5TGN A;  3OXA A;  3V99 A;  1AVL A;  3HII A;  2P09 A;  4JRF A;  2CW9 A;  3NX0 A;  5IEN A;  3OX9 A;  4L7K A;  2KCD A;  3EE1 A;  3CPO A;  1GD4 A;  1IQ8 A;  3EBY A;  4X2H A;  3CU3 A;  1VQL 3;  2IMJ A;  1AR0 A;  2PNC A;  3OWS A;  2RGQ A;  3FKA A;  5G2G A;  2CG0 A;  1OF5 A;  2B1X B;  4LSO A;  2BMO B;  3RGR A;  3UNL A;  2W6J H;  3GZX B;  5EEO A;  1EQK A;  2QEX 3;  1JB4 A;  2FXT A;  4QWT A;  1WMN A;  5A0O B;  1IVU A;  4RNY A;  3DGL A;  4MMY B;  4AKZ A;  4N6T A;  1K41 A;  3JUN A;  1S5A A;  1OH0 A;  4J8T A;  3X3Z A;  2W04 A;  5AIG A;  1N5P A;  2XRX B;  3BNE A;  5AEU B;  1BUQ A;  3WA2 X;  3X40 A;  1JRQ A;  4WWU C;  3LXU X;  1W6Y A;  4BTX A;  2Z6B A;  3KII A;  1ASK A;  4XBT A;  2XGL A;  1WNH A;  4KFD A;  5IF6 A;  3QK9 A;  1Y4K A;  1MOL A;  1YJW 3;  2I9W A;  2K0M A;  2WOF A;  3FCS B;  4KZ1 A;  3DM8 A;  2SBL A;  1K28 A;  1IV9 A;  1O7M B;  1W6C A;  3FG1 A;  3NM2 A;  1ISK A;  3AMO A;  2ML6 A;  2W2C A;  5ELJ A;  3FGY A;  1IT8 A;  1SII A;  3NQY A;  3PZW A;  1IDP A;  1O7G B;  1LVN A;  1JN5 A;  3F8X A;  4U13 A;  3PS8 A;  2HMN B;  1Q81 4;  3WA3 A;  2BMQ B;  3S27 A;  3U1W A;  3SED A;  3X3Y A;  1ROV A;  5IG0 A;  1W02 A;  1J2B A;  5D81 A;  3HK4 A;  4HM7 B;  1STF I;  1CYV A;  1M9G A;  1SQW A;  2P0M A;  2LYX A;  1YJN 3;  1DMM A;  3BB9 A;  1YIT 3;  4RBN A;  3HI7 A;  3KSE D;  3DY5 A;  2XEP A;  3N8B A;  1O7W B;  5AYS C;  2XF3 A;  1VQK 3;  1G96 A;  3CCE 3;  1YJ9 3;  1W4N A;  3JUM A;  2YX9 A;  5D83 A;  5AI1 A;  1GYB A;  1KQS 2;  2MF7 A;  2OWP A;  3NV0 B;  3VF1 A;  1NDO B;  4EBG A;  3CME 3;  1VQ6 3;  1VQN 3;  1Q40 B;  5DRV A;  4IIA A;  3LYG A;  2CIU A;  4XDV A;  3K5T A;  1A67 A;  3V92 A;  3ROB A;  2CK3 H;  3DGN A;  1QJG A;  3LOY A;  3O8Y A;  2V1L A;  3LML A;  2BNG A;  4XBY A;  3Q90 A;  4LGQ A;  4FR9 A;  2A15 A;  1D6Y A;  2CH9 A;  1VQ7 3;  3MG1 A;  1TU5 A;  1NWW A;  2HMO B;  4I4K A;  4HM8 B;  3GZY B;  1FGM A;  4FCJ A;  1LXE A;  3F7X A;  2ML5 A;  1W2Z A;  2W9P A;  3HIG A;  2XFS A;  2W9Q A;  1HKX A;  1RKY A;  1E3R A;  3ECF A;  3QRD A;  1D6U A;  4BTW A;  1IVX A;  3FF0 A;  3KSP A;  2W56 B;  5AYR B;  3CPW 2;  4HZ9 B;  4RZM A;  2W0Q A;  3B4O A;  5EQL A;  2Z77 A;  5KP1 A;  4HM3 B;  3SOY A;  3TDG A;  4STD A;  4LMI A;  3CC4 3;  3EB8 A;  3NV0 A;  2XSO B;  5AII A;  5AIH A;  2GEX A;  1ZX2 A;  2CHC A;  2O9U X;  4LEH A;  4EV2 A;  3G16 A;  4ZM8 A;  3EN8 A;  1EG9 B;  3UL6 A;  4CCV A;  1PU4 A;  4WFO A;  4HBR A;  2E2T A;  3FLJ A;  3EHC A;  3FH1 A;  4WYK B;  1NU3 A;  5CF1 A;  1TIJ A;  3CMA 3;  1O7P B;  3G0K A;  2W03 A;  3HZP A;  1V74 A;  1GY7 A;  4O02 B;  2R4I A;  2IA7 A;  1NO3 A;  1T5Y A;  3GRD A;  3I0Y A;  1FUW A;  3CC7 3;  4EXR A;  3ALA A;  4K90 B;  2XFT A;  3RGA A;  3S28 A;  3S29 A;  4WP5 A;  3EJV A;  3IMA B;  1KWI A;  5BXQ A;  1LOX A;  4FMA A;  3CCQ 3;  4FMD A;  2CKF B;  5IER A;  1IQX A;  4WHA A;  1ULJ B;  1VQ4 3;  2W56 A;  1GD3 A;  3WOF B;  1UI7 A;  1IVW A;  2P38 A;  1F8N A;  2XH9 A;  5CK6 A;  3JUQ A;  1FGO A;  3NHX A;  3DUK A;  3SVA A;  1IK3 A;  2XGN A;  5ELU A;  2HMK B;  4FCZ A;  1E3V A;  3CCJ 3;  7STD A;  1IVV A;  3LT9 A;  2CG1 A;  3L0R A;  3N54 B;  1JNQ A;  3S67 A;  1D6Z A;  3F7S A;  1STD A;  2GXF A;  4R1K A;  3N9H A;  1M1K 4;  1LNH A;  1R4C A;  3GWR A;  3K0Z A;  4N6M A;  5I97 A;  1AVK A;  1WQL B;  1K9M 4;  1JKG B;  1US1 A;  1TFK A;  3PCR A;  1KSI A;  1DMQ A;  3G8Z A;  1VQ9 3;  3LTD A;  3KZT A;  2FGT A;  4NHF A;  2YFI B;  1OHS A;  3OV4 A;  1OCV A;  1UUV B;  3BND A;  4FMC A;  3NBR A;  4HM0 B;  3OWY A;  1OPY A;  1QAF A;  5HGR A;  2CFK A;  3DXO A;  1IQY A;  1ULI B;  2C10 A;  2HMJ B;  3BNB A;  1QAL A;  1YGE A;  2OCT A;  3CCL 3;  1QAK A;  4L8O A;  1MNL A;  2QIY A;  2C11 A;  1ROA A;  5CLK A;  1SPU A;  3CCU 3;  1EA2 A;  4IPB A;  1OAC A;  2E2U A;  3JVC A;  1YVB I;  2RCD A;  3LTA A;  1TFO A;  3Q2P A;  4K1V A;  1A2V A;  1N9J A;  3F8H A;  4KVH A;  4HZB B;  1A90 A;  2QGU A;  4MEI A;  4R9K A;  3F40 A;  3H51 A;  3NM7 A;  3F14 A;  4EC6 A;  1OHP A;  1WMO A;  2GEY A;  1O7N B;  2F98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...