3NM7A

Crystal structure of borrelia burgdorferi pur-alpha
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
84
Chain Sequence
ERGEVYSEKLFTESERTYFFNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENINEFESNLLKAIAVIKQKVSTGSSARHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleic acid binding protein
molecule keywords Uncharacterized protein
publication title Of Bits and Bugs - on the use of bioinformatics and a bacterial crystal structure to solve a eukaryotic repeat-protein structure.
rcsb
source organism Borrelia burgdorferi
total genus 18
structure length 84
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11680 DUF3276 Protein of unknown function (DUF3276)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nm7A00
3N8BA 3NM7A 5FGOA
chains in the Genus database with same CATH superfamily
3LT9A 4CDLA 3HOHA 1YVSA 5STDA 1BNFA 5GSPA 8CHOA 5KP3A 3CCS3 2CFGA 1W6CA 3FCSB 3X3ZA 4RNTA 1TRPA 3OV4A 2CWUA 1BSCA 2WOHA 1TTOA 2Z77A 4WYKA 7STDA 1TFKA 1B20A 3CNXA 3LTDA 1DMMA 3LTAA 2RFRA 1I8VA 1M1XB 2GEYA 6STDA 1LRAA 4GHOA 1I0XA 1O7HB 2B1XB 1MOLA 1RDSA 5G2GA 1I3IA 2B24B 3A5EA 3FF0A 1B2SA 2SARA 1QMAA 1U5OA 3S67A 5M19A 4HZ9B 4I5QA 3K63A 1I70A 1AQZA 1MGRA 1Q40B 3DGMA 1BSAA 4FMBA 3JVCA 3FGYA 4BL3A 5IW9A 2YX9A 1CH0A 1Q40A 2JQ5A 1TP6A 5CLKA 1GOYA 1BRHA 4LSOA 4K1UA 2YFLB 3HI7A 1FYSA 1FUSA 3QRDA 3NQYA 3IPTA 5D81A 3I563 1O7PB 2F86B 4R9KA 3VGNA 2F56A 4NPBA 3CC73 3OWYA 1N8QA 3AGNA 1L5GB 5AEUB 3CC23 5HGRA 4J5KA 2GEXA 2XFTA 5EEOA 1RGAA 3E99A 3N8BA 3CMA3 5IENA 5AYRB 3VF1A 1OGXA 2CFLA 1UDII 1Z1SA 3CCV3 3CPW2 2PZVA 3LH4A 1IQXA 3UL5A 4HOHA 5BXQA 1RLSA 1X1UA 3CXC2 1PFPA 4H61A 4LEHA 4N6TA 1I2FA 2W2CA 1BGSA 1GMPA 1PYLA 1QAKA 2XF3A 3EC9A 3UB1A 1BAOA 1IDPA 1VQL3 3DM8A 1FGMA 3WMDA 3OWUA 1CQSA 1LOVA 2V1LA 6RNTA 1JBSA 4HM4B 1VQM3 3BNCA 3KCHA 3WDGB 3I0YA 4BTXA 4O8SA 1VQK3 1K9M4 2OCTA 3CCE3 1ZX2A 2W03A 3TDGA 3UL6A 1GOVA 1DMNA 1BRIA 3EQQB 1AV4A 3SEDA 1KWIA 3U1WA 3ZFZA 2P09A 2CWVA 3DGYA 2CG0A 3B4OA 3OX9A 4I4KA 3MG1A 3T8UA 1YGWA 3V98A 3V99A 1M1K4 1W5ZA 3ZG5A 3SX1A 2OQEA 1WQLB 1STDA 1RGKA 1HZ1A 1W4NA 1X1WA 2RBIA 3CNMA 3DGNA 1VQ83 3GZXB 4XB5A 3UNLA 1SJWA 3KSED 6GSPA 1NB3I 1BANA 3PXMA 1W01A 4WHAA 1VQP3 1I2EA 1BNSA 3GWRA 2C4BA 2WGQA 2GSPA 3FF2A 3HX8A 2FNQA 4X2HA 3DZLA 1Q824 3G0KA 3HK4A 4O02B 3NHXA 3S5CA 4OVMA 1N8R4 3H51A 3D9RA 3OXAA 3FG3A 1D6ZA 2K54A 3X40A 1NO3A 4LZIA 1ISKA 1Q9EA 4NHFA 1BNJA 2J8XB 3JUOA 4FCJA 4HM5B 1JZDA 1MWSA 4GL6A 1US1A 3AMOA 3PZWA 1DE3A 3NBRA 3F8HA 4RNYA 1RMSA 2HOHA 5TGNA 1RGLA 1AY7A 1LXEA 1LVNA 4L7KA 1E97A 3D5GA 1MNLA 4L8PA 1O7MB 5IG5A 3KZTA 3ALAA 2WGOA 3G8ZA 3SOYA 1BNEA 3G6E3 5CK6A 1OHOA 4CPKA 3RNTA 5I97A 2XGNA 4FMCA 3NV0B 3EN1B 2IUJA 4KVHA 4MMYB 2H0IA 2UX0A 1G02A 2BU4A 2C10A 2CH9A 5AIIA 3NV0A 1UI7A 1DETA 2KRTA 3EHCA 1G0TA 2OWPA 5G1KA 4R1KA 1RRLA 4R9LA 2BHMA 2ML5A 3MG3A 3O8YA 1AVKA 4BTWA 2CW9A 2W0QA 1FUTA 2Y73A 1E3RA 1EQKA 2INXA 5DRVA 4WYKB 1GMRA 4KFDA 1PU4A 1UUGB 1Y4KA 1B2XA 3HZPA 2P0XA 3NBJA 4JF8A 2IYJA 2W9PA 1LNHA 4BTYA 1GMQA 4LGQA 2XSOB 2ZL8A 3PCSA 1CYUA 1FGTA 3Q90A 3WOEB 3SLUA 1BSEA 2HMKB 1ZS7A 3B7CA 1SPUA 2IY2A 3HIGA 1BNIA 1YNVX 3NUVA 1JB4A 1OH0A 1JB5A 3BLZA 1R4CA 1OPYA 3SVAA 1GOUA 1B2ZA 1RJOA 3KE7A 1MWTA 1JN5A 3GZYB 1LOXA 1ZO2A 1SIIA 3MSOA 1YJW3 3WODG 7RNTA 3KSPA 4OK0A 4OUQA 2IUKA 1NDOB 2BT3A 4EV5A 4EV2A 2W56B 2PNCA 1LOYA 3VSYA 3I553 4L8OA 4WP5A 1CYVA 2GU3A 2HMJB 2LYXA 2W56A 3HIIA 1N5HA 1NU3A 4BL2A 1B27A 1LNIA 1RGEA 1WMNA 4XBTA 2F5WA 1WMPA 4HM2B 4HM1B 3EX9A 2H0GA 2BMOB 2OOVC 3X3XA 1FGOA 3NXJA 1ASKA 1F8NA 2W6JH 3S27A 1UCLA 2F98A 4HBRA 5BIRA 1EKMA 2CFKA 2QEX3 3D3LA 4LYLB 3FSDA 4N6V0 3FG1A 4IPBA 2BNGA 1K28A 3DMCA 1SQWA 3K9MC 2A15A 1BRKA 1YJN3 4GSPA 2Z6BA 5DREA 2F5MA 1B3SA 2CIUA 2D1WA 3N9HA 2K3DA 3K0ZA 3SOAA 1W2ZA 5M1AA 2XSHB 5LC7A 1MWUA 1QALA 1VQN3 3LMLA 3CC43 1D6UA 1RN4A 1W00A 4EW5A 5KP4A 3MYTA 1YIT3 1UW1A 4IT7A 5AI1A 2CK3H 1YI23 1RNBA 3EBTA 1IT7A 4IIAA 5ELJA 4AKZA 3H3HA 1S723 1TU5A 2CFWA 1T5YA 1JKGB 2O3OA 3BNBA 4GB5A 1W7CA 4O2HA 5G1LA 4ZM8A 2E2VA 5BVBA 1K8A4 3G4S3 1GD3A 2F4YA 1RCLA 1JKGA 2WO0A 2KF4A 4HKVB 3BNEA 2CG1A 4FCZA 1R4YA 2IA7A 1RGFA 1N9JA 3KFQC 1N9EA 1UGHI 5EQLA 3BB9A 3ER7A 3B8LA 1IV7A 3DGOA 2F99A 1I2GA 1T2IA 3F40A 3WOFB 4HM7B 1UUVB 3L0RA 3LOYA 3N54B 1JBRA 4N3VA 1MGWA 4MMXB 1YHQ3 2LQVA 4XDWA 3EF8A 1VQ93 3JUPA 2KF6A 4BU4A 1I0VA 1Q864 4EYCA 3MKIA 3FZWA 3KIIA 1HU9A 1TIJA 4TX4A 3WA2X 3CCQ3 2CFDA 1W2B2 1RN1A 5FGOA 1BUQA 1RNTA 1UCKA 1WNHA 1Q42A 1LOWA 1J2BA 3LTCA 2P38A 4CCVA 1PY3A 1YIJ3 4ILFA 4XBXA 1STFI 2CX1A 4HVNA 4G1MB 4XM4A 5AEWB 2GU1A 3LXUX 3WA3A 2K0MA 1CEWI 3LZAA 1ZGXA 3AMOB 1Q7HA 1ROAA 1DYUA 2WOFA 3EBYA 3T8NA 1A90A 2D42A 3Q2PA 3UJMA 1IQ8A 1X1YA 3DUKA 3FG4A 4J9AA 1ROVA 3B4PA 1EUIC 3DXOA 5ELUA 1BRNL 1GD4A 2L4VA 2Y74A 3DGLA 3LYGA 3CCR3 1GY7A 3WHOA 1UCJA 1HKXA 1BU4A 2RGQA 5KP1A 4Q53A 1KD14 1IVVA 3PS8A 3M8CA 3Q3FA 2ML6A 2BMRB 2RCDA 3CCM3 2ZA4A 1X1XA 2MF7A 3AHWA 2CX0A 4LMIA 5CXOA 3RGRA 1C7HA 4N6MA 1RGCA 1BSDA 4XDVA 5IEOA 4HYZA 2GBXB 4J5GA 3MHEA 4HM6B 1EEJA 1TRQA 1S5AA 5D83A 5CF2A 1IK3A 3T0UA 1SIHA 1V58A 4RZMA 1VQ73 1A2PA 1GY6A 3S29A 1A67A 1O7WB 3IJEB 3FLJA 4MJDA 4RNZA 1OHSA 3EJVA 2KXGA 3DH2A 1K41A 1NWWA 3CME3 1JJ22 5IF6A 1DMQA 3CU3A 3WR2A 1EA2A 3NM7A 2OTJ3 1BNRA 2BMQB 2OTL3 3BU4A 2SBLA 4HAAA 3F14A 5CF1A 2HMNB 1KC84 1JN5B 3ECFA 4MMZB 1FA3A 4N6UA 1BRJA 1AR0A 1FGQA 3D4AA 5IEPA 2YFIB 3NBBA 3RDEA 2KF3A 1BVIA 3GSPA 2YFJB 3U97A 2BIRA 4KT3B 1Q814 4AEQA 3CPOA 3F7SA 3NM2A 1JB2A 1IYYA 3BNDA 1QJGA 1BSBA 1D6YA 2FGTA 1TUHA 3URPA 1V57A 1NJI4 3KN4A 3STDA 1JBTA 2IMJA 1WTHA 1V74A 1WMOA 1KSIA 2E2UA 3NX0A 2M7OA 3F7XA 2R41A 3CCL3 4K1VA 4R4KA 3V92A 2XEPA 2KCDA 1BOXA 1OGZA 5LC6A 3GZRA 2GBWB 3D79A 2L1SA 4O3VA 9RNTA 3KKGA 1UUWB 4N6OB 5AIHA 1IT8A 1G96A 2UGIA 3EB8A 3ZG0A 1BIRA 1IQYA 5IG0A 3S28A 1IVWA 2W04A 4H3UA 3FH1A 1NNVA 2CKFB 1U8CB 2OOVA 2AAEA 1JZOA 1BRGA 3GRDA 3IMAB 5AIFA 3CCJ3 1VQ43 3JUMA 1OF5B 2BO9B 1T3BA 3JUNA 2KAAA 3AGOA 4HJLB 1T2HA 2QGUA 1OF5A 4KFFA 5HOHA 1GS3A 3CD63 1UCIA 2P0MA 1KQS2 4BIRA 3PGBA 2CWTA 4EBGA 1K734 3FKAA 4K90B 1AVLA 2FXTA 1GSPA 2Q07A 4MEIA 2STDA 2AADA 1OUNA 1N5PA 3SXXA 4DKIA 2JDIH 1JNQA 1VQO3 3X41A 4J8TA 2Z7AA 1BRSA 4R80A 4X2OA 4K61A 1I3FA 5FW5A 1Q7Y4 4CJNA 2QA43 3F8XA 4JRFA 2XGLA 3F9SA 1A2KA 1FW7A 2KF5A 1RHLA 3Q1CA 3X3YA 2HMOB 1YVBI 4NREA 3J7Yd 1GYBA 3ROBA 1SARA 1LQMB 4HM8B 1OHPA 1RRHA 2RSXA 4KFEA 2HMLB 2OQEC 5JPPA 4WFOA 5AIGA 5RNTA 1BUJA 2Z76A 3PCRA 1QVG2 4FMAA 1UGIA 5IG3A 2XH9A 2GXFA 8RNTA 1VQ53 1OCVA 1FZUA 2QIYA 2H0HA 1TFOA 1RGGA 3PYJA 4N6NB 1VQQA 3OWSA 1IVXA 1JRQA 3QK9A 1IU7A 1VQ63 1W6GA 4FCMA 1W6YA 1RGHA 3X42A 1IVUA 5IG4A 1O7GB 4AKYA 3JUQA 1GY5A 2ZHXB 5IERA 2RNTA 1RTUA 3EE1A 5A0OB 1RSNA 2MC8A 3G713 3D5IA 1ULJB 3G16A 4PEJA 3A76A 1UI8A 2HMMB 3MWZA 4RBNA 1MWRA 1O7NB 3LT8A 4HM3B 2ZDJA 1ULIB 4FR9A 1M904 1RCKA 2E2TA 3K7CA 1B2UA 2R4IA 4XBYA 1LQGC 3GZBA 1BNGA 1B21A 1HYFA 3CCU3 1TJDA 5M18A 3K5TA 4KZ1A 4WWUC 3AHSA 4ORLA 3GAXA 4FMDA 4HZBB 4N6LA 1IV9A 1FGRA 1NB5I 5BU4A 1RKYA 1A2VA 1QAFA 3NQZA 2I9WA 7GSPA 2UUGC 2W9QA 4EC6A 1C54A 3OW22 3SYUA 1YGEA 2C11A 1FUWA 2O9UX 1B2MA 3MPHA 4HM0B 1M9GA 2CC3A 1W02A 2XR8B 2XFSA 2P05A 4QWTA 1VZZA 5JPUA 3LTBA 4U13A 5AYSC 1DVDA 1E3VA 5EVHA 3RGAA 1YJ93 3EN8A 1OACA 3BIRA 2CHCA 3DY5A 1EG9B 3MG2A 5D82A 1QVF2 1DVCA 5JBSA 2XRXB 4STDA 1RN7A 4EXRA 1JV2B
chains in the Genus database with same CATH topology
3LT9A 4CDLA 5STDA 8CHOA 5KP3A 3CCS3 2CFGA 1W6CA 3FCSB 3X3ZA 3OV4A 2CWUA 2WOHA 4WYKA 2Z77A 7STDA 1TFKA 3CNXA 3LTDA 1DMMA 3LTAA 2RFRA 6STDA 1M1XB 2GEYA 1O7HB 2B1XB 1MOLA 5G2GA 2B24B 3FF0A 3S67A 1QMAA 1U5OA 4HZ9B 3K63A 1Q40B 3DGMA 4FMBA 3JVCA 3FGYA 5IW9A 2YX9A 1Q40A 2JQ5A 1TP6A 5CLKA 4LSOA 4K1UA 2YFLB 3HI7A 3QRDA 3NQYA 3IPTA 5D81A 3I563 1O7PB 2F86B 4R9KA 3VGNA 3CC73 3OWYA 1N8QA 1L5GB 5AEUB 3CC23 5HGRA 2GEXA 2XFTA 5EEOA 3E99A 3N8BA 3CMA3 5IENA 5AYRB 3VF1A 1OGXA 2CFLA 1Z1SA 3CCV3 3CPW2 2PZVA 3LH4A 1IQXA 3UL5A 5BXQA 3CXC2 1PFPA 4H61A 4LEHA 4N6TA 2W2CA 1QAKA 2XF3A 3EC9A 3UB1A 1IDPA 1VQL3 3DM8A 1FGMA 3WMDA 3OWUA 1CQSA 2V1LA 4HM4B 1VQM3 3BNCA 3WDGB 3I0YA 4BTXA 4O8SA 1VQK3 1K9M4 2OCTA 3CCE3 1ZX2A 2W03A 3TDGA 3UL6A 1DMNA 3EQQB 1AV4A 3SEDA 1KWIA 3U1WA 2P09A 2CWVA 3OX9A 2CG0A 3B4OA 4I4KA 3V98A 3MG1A 3T8UA 3V99A 1M1K4 1W5ZA 3SX1A 2OQEA 1WQLB 1STDA 1W4NA 1VQ83 3CNMA 3DGNA 3GZXB 4XB5A 3UNLA 1SJWA 3KSED 1NB3I 3PXMA 1W01A 4WHAA 1VQP3 3GWRA 2WGQA 3FF2A 3HX8A 2FNQA 4X2HA 3DZLA 1Q824 3G0KA 3HK4A 4O02B 3NHXA 3S5CA 4OVMA 1N8R4 3H51A 3D9RA 3OXAA 3FG3A 1D6ZA 2K54A 3X40A 1NO3A 4LZIA 1ISKA 4NHFA 3JUOA 4FCJA 4HM5B 4GL6A 1US1A 3AMOA 3PZWA 3NBRA 3F8HA 4RNYA 5TGNA 1LXEA 1LVNA 4L7KA 1E97A 4L8PA 1MNLA 1O7MB 5IG5A 3KZTA 3ALAA 2WGOA 3G8ZA 3SOYA 3G6E3 5CK6A 1OHOA 5I97A 2XGNA 4FMCA 3NV0B 3EN1B 2IUJA 4KVHA 4MMYB 2UX0A 2C10A 2CH9A 5AIIA 3NV0A 1UI7A 2KRTA 3EHCA 2OWPA 4R1KA 1RRLA 4R9LA 2BHMA 2ML5A 3MG3A 3O8YA 1AVKA 4BTWA 2CW9A 2W0QA 2Y73A 1E3RA 1EQKA 2INXA 5DRVA 4WYKB 4KFDA 1PU4A 1Y4KA 3HZPA 2P0XA 3NBJA 4JF8A 2W9PA 1LNHA 4BTYA 4LGQA 2XSOB 2ZL8A 3PCSA 1CYUA 1FGTA 3Q90A 3WOEB 3SLUA 2HMKB 3B7CA 1SPUA 3HIGA 3NUVA 1JB4A 1OH0A 1JB5A 3BLZA 1R4CA 1OPYA 3SVAA 1RJOA 3KE7A 1JN5A 3GZYB 1LOXA 1ZO2A 1SIIA 3MSOA 1YJW3 3WODG 3KSPA 4OK0A 4OUQA 2IUKA 1NDOB 2BT3A 4EV5A 4EV2A 2W56B 2PNCA 3VSYA 3I553 4L8OA 4WP5A 1CYVA 2GU3A 2HMJB 2LYXA 2W56A 3HIIA 1N5HA 1NU3A 1WMNA 4XBTA 1WMPA 4HM2B 4HM1B 3EX9A 2BMOB 2OOVC 3X3XA 1FGOA 3NXJA 1ASKA 1F8NA 2W6JH 3S27A 2F98A 4HBRA 1EKMA 2CFKA 2QEX3 3D3LA 3FSDA 4N6V0 3FG1A 4IPBA 2BNGA 1K28A 3DMCA 1SQWA 3K9MC 2A15A 1YJN3 2Z6BA 5DREA 3N9HA 2CIUA 2D1WA 3K0ZA 3SOAA 1W2ZA 2XSHB 5LC7A 1QALA 1VQN3 3LMLA 3CC43 1D6UA 1W00A 5KP4A 3MYTA 1YIT3 1UW1A 4IT7A 5AI1A 2CK3H 1YI23 3EBTA 1IT7A 4IIAA 5ELJA 4AKZA 3H3HA 1S723 1TU5A 2CFWA 1T5YA 1JKGB 2O3OA 3BNBA 4GB5A 1W7CA 4O2HA 4ZM8A 5BVBA 2E2VA 1K8A4 3G4S3 1GD3A 1JKGA 2WO0A 4HKVB 3BNEA 2CG1A 4FCZA 2IA7A 1N9JA 3KFQC 1N9EA 5EQLA 3BB9A 3ER7A 3B8LA 1IV7A 3DGOA 2F99A 3F40A 3WOFB 4HM7B 1UUVB 3L0RA 3LOYA 3N54B 4N3VA 1YHQ3 4MMXB 2LQVA 4XDWA 3EF8A 1VQ93 3JUPA 1Q864 4EYCA 3MKIA 3FZWA 3KIIA 1HU9A 1TIJA 4TX4A 3WA2X 3CCQ3 2CFDA 1W2B2 5FGOA 1BUQA 1WNHA 1Q42A 1J2BA 3LTCA 2P38A 4CCVA 1YIJ3 4XBXA 1STFI 4HVNA 5AEWB 4G1MB 4XM4A 2GU1A 3LXUX 3WA3A 2K0MA 1CEWI 3LZAA 3AMOB 3T8NA 1ROAA 1DYUA 2WOFA 3EBYA 1A90A 2D42A 3Q2PA 3UJMA 1IQ8A 3DUKA 3FG4A 4J9AA 1ROVA 3B4PA 3DXOA 5ELUA 1GD4A 2L4VA 2Y74A 3DGLA 3LYGA 3CCR3 1GY7A 1HKXA 2RGQA 5KP1A 4Q53A 1KD14 1IVVA 3PS8A 3M8CA 2ML6A 2BMRB 2RCDA 3CCM3 2MF7A 4LMIA 5CXOA 3RGRA 1C7HA 4N6MA 5IEOA 4XDVA 4HYZA 2GBXB 3MHEA 4HM6B 1S5AA 5D83A 5CF2A 1IK3A 3T0UA 1SIHA 1VQ73 4RZMA 1GY6A 3S29A 1A67A 1O7WB 3IJEB 3FLJA 4MJDA 4RNZA 1OHSA 3EJVA 2KXGA 1K41A 1NWWA 3CME3 1JJ22 5IF6A 1DMQA 3CU3A 1EA2A 3NM7A 2OTJ3 2BMQB 2OTL3 2SBLA 3F14A 5CF1A 2HMNB 1KC84 1JN5B 3ECFA 4MMZB 1FA3A 4N6UA 1AR0A 1FGQA 5IEPA 2YFIB 3NBBA 3RDEA 2YFJB 3U97A 1Q814 4AEQA 3CPOA 3F7SA 3NM2A 1JB2A 3BNDA 1QJGA 1D6YA 2FGTA 1NJI4 1TUHA 3KN4A 3STDA 2IMJA 1WTHA 1V74A 1WMOA 1KSIA 2E2UA 3NX0A 2M7OA 3F7XA 3CCL3 4K1VA 4R4KA 3V92A 2XEPA 2KCDA 1OGZA 5LC6A 3GZRA 2GBWB 4O3VA 3KKGA 1UUWB 4N6OB 5AIHA 1IT8A 1G96A 3EB8A 1IQYA 5IG0A 3S28A 1IVWA 2W04A 4H3UA 3FH1A 2CKFB 1U8CB 2OOVA 5AIFA 3GRDA 3IMAB 3CCJ3 1VQ43 3JUMA 1OF5B 2BO9B 3JUNA 4HJLB 2QGUA 1OF5A 4KFFA 1GS3A 3CD63 2P0MA 1KQS2 3PGBA 2CWTA 4EBGA 1K734 3FKAA 4K90B 1AVLA 2FXTA 2Q07A 4MEIA 2STDA 3SXXA 1OUNA 1N5PA 2JDIH 1JNQA 1VQO3 3X41A 4J8TA 2Z7AA 4R80A 4X2OA 5FW5A 4K61A 1Q7Y4 2QA43 3F8XA 4JRFA 2XGLA 3F9SA 1A2KA 3Q1CA 3X3YA 2HMOB 1YVBI 4NREA 3J7Yd 1GYBA 3ROBA 4HM8B 1OHPA 1RRHA 2RSXA 4KFEA 2HMLB 2OQEC 5JPPA 4WFOA 5AIGA 2Z76A 3PCRA 1QVG2 4FMAA 5IG3A 2XH9A 2GXFA 1VQ53 1OCVA 2QIYA 4N6NB 1TFOA 3PYJA 3OWSA 1JRQA 1IVXA 3QK9A 1IU7A 1VQ63 1W6GA 4FCMA 1W6YA 3X42A 5IG4A 1IVUA 1O7GB 4AKYA 3JUQA 1GY5A 5IERA 3EE1A 5A0OB 3G713 2MC8A 1ULJB 3G16A 4PEJA 3A76A 1UI8A 2HMMB 3MWZA 4RBNA 1O7NB 3LT8A 4HM3B 2ZDJA 1ULIB 4FR9A 1M904 2E2TA 3K7CA 2R4IA 4XBYA 3GZBA 3CCU3 3K5TA 4KZ1A 4WWUC 4ORLA 3GAXA 4FMDA 4HZBB 4N6LA 1IV9A 1FGRA 1NB5I 1RKYA 1A2VA 1QAFA 3NQZA 2I9WA 2W9QA 4EC6A 3OW22 1YGEA 2C11A 1FUWA 2O9UX 3MPHA 4HM0B 1M9GA 2CC3A 1W02A 2XR8B 2XFSA 2P05A 4QWTA 1VZZA 5JPUA 3LTBA 4U13A 5AYSC 1DVDA 1E3VA 5EVHA 3RGAA 1YJ93 3EN8A 1OACA 3DY5A 2CHCA 5D82A 1EG9B 3MG2A 1QVF2 1DVCA 5JBSA 2XRXB 4STDA 1RN7A 4EXRA 1JV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8B A;  3NM7 A;  5FGO A; 
#chains in the Genus database with same CATH topology
 3LT9 A;  4CDL A;  3HOH A;  1YVS A;  5STD A;  1BNF A;  5GSP A;  8CHO A;  5KP3 A;  3CCS 3;  2CFG A;  1W6C A;  3FCS B;  3X3Z A;  4RNT A;  1TRP A;  3OV4 A;  2CWU A;  1BSC A;  2WOH A;  1TTO A;  2Z77 A;  4WYK A;  7STD A;  1TFK A;  1B20 A;  3CNX A;  3LTD A;  1DMM A;  3LTA A;  2RFR A;  1I8V A;  1M1X B;  2GEY A;  6STD A;  1LRA A;  4GHO A;  1I0X A;  1O7H B;  2B1X B;  1MOL A;  1RDS A;  5G2G A;  1I3I A;  2B24 B;  3A5E A;  3FF0 A;  1B2S A;  2SAR A;  1QMA A;  1U5O A;  3S67 A;  5M19 A;  4HZ9 B;  4I5Q A;  3K63 A;  1I70 A;  1AQZ A;  1MGR A;  1Q40 B;  3DGM A;  1BSA A;  4FMB A;  3JVC A;  3FGY A;  4BL3 A;  5IW9 A;  2YX9 A;  1CH0 A;  1Q40 A;  2JQ5 A;  1TP6 A;  5CLK A;  1GOY A;  1BRH A;  4LSO A;  4K1U A;  2YFL B;  3HI7 A;  1FYS A;  1FUS A;  3QRD A;  3NQY A;  3IPT A;  5D81 A;  3I56 3;  1O7P B;  2F86 B;  4R9K A;  3VGN A;  2F56 A;  4NPB A;  3CC7 3;  3OWY A;  1N8Q A;  3AGN A;  1L5G B;  5AEU B;  3CC2 3;  5HGR A;  4J5K A;  2GEX A;  2XFT A;  5EEO A;  1RGA A;  3E99 A;  3N8B A;  3CMA 3;  5IEN A;  5AYR B;  3VF1 A;  1OGX A;  2CFL A;  1UDI I;  1Z1S A;  3CCV 3;  3CPW 2;  2PZV A;  3LH4 A;  1IQX A;  3UL5 A;  4HOH A;  5BXQ A;  1RLS A;  1X1U A;  3CXC 2;  1PFP A;  4H61 A;  4LEH A;  4N6T A;  1I2F A;  2W2C A;  1BGS A;  1GMP A;  1PYL A;  1QAK A;  2XF3 A;  3EC9 A;  3UB1 A;  1BAO A;  1IDP A;  1VQL 3;  3DM8 A;  1FGM A;  3WMD A;  3OWU A;  1CQS A;  1LOV A;  2V1L A;  6RNT A;  1JBS A;  4HM4 B;  1VQM 3;  3BNC A;  3KCH A;  3WDG B;  3I0Y A;  4BTX A;  4O8S A;  1VQK 3;  1K9M 4;  2OCT A;  3CCE 3;  1ZX2 A;  2W03 A;  3TDG A;  3UL6 A;  1GOV A;  1DMN A;  1BRI A;  3EQQ B;  1AV4 A;  3SED A;  1KWI A;  3U1W A;  3ZFZ A;  2P09 A;  2CWV A;  3DGY A;  2CG0 A;  3B4O A;  3OX9 A;  4I4K A;  3MG1 A;  3T8U A;  1YGW A;  3V98 A;  3V99 A;  1M1K 4;  1W5Z A;  3ZG5 A;  3SX1 A;  2OQE A;  1WQL B;  1STD A;  1RGK A;  1HZ1 A;  1W4N A;  1X1W A;  2RBI A;  3CNM A;  3DGN A;  1VQ8 3;  3GZX B;  4XB5 A;  3UNL A;  1SJW A;  3KSE D;  6GSP A;  1NB3 I;  1BAN A;  3PXM A;  1W01 A;  4WHA A;  1VQP 3;  1I2E A;  1BNS A;  3GWR A;  2C4B A;  2WGQ A;  2GSP A;  3FF2 A;  3HX8 A;  2FNQ A;  4X2H A;  3DZL A;  1Q82 4;  3G0K A;  3HK4 A;  4O02 B;  3NHX A;  3S5C A;  4OVM A;  1N8R 4;  3H51 A;  3D9R A;  3OXA A;  3FG3 A;  1D6Z A;  2K54 A;  3X40 A;  1NO3 A;  4LZI A;  1ISK A;  1Q9E A;  4NHF A;  1BNJ A;  2J8X B;  3JUO A;  4FCJ A;  4HM5 B;  1JZD A;  1MWS A;  4GL6 A;  1US1 A;  3AMO A;  3PZW A;  1DE3 A;  3NBR A;  3F8H A;  4RNY A;  1RMS A;  2HOH A;  5TGN A;  1RGL A;  1AY7 A;  1LXE A;  1LVN A;  4L7K A;  1E97 A;  3D5G A;  1MNL A;  4L8P A;  1O7M B;  5IG5 A;  3KZT A;  3ALA A;  2WGO A;  3G8Z A;  3SOY A;  1BNE A;  3G6E 3;  5CK6 A;  1OHO A;  4CPK A;  3RNT A;  5I97 A;  2XGN A;  4FMC A;  3NV0 B;  3EN1 B;  2IUJ A;  4KVH A;  4MMY B;  2H0I A;  2UX0 A;  1G02 A;  2BU4 A;  2C10 A;  2CH9 A;  5AII A;  3NV0 A;  1UI7 A;  1DET A;  2KRT A;  3EHC A;  1G0T A;  2OWP A;  5G1K A;  4R1K A;  1RRL A;  4R9L A;  2BHM A;  2ML5 A;  3MG3 A;  3O8Y A;  1AVK A;  4BTW A;  2CW9 A;  2W0Q A;  1FUT A;  2Y73 A;  1E3R A;  1EQK A;  2INX A;  5DRV A;  4WYK B;  1GMR A;  4KFD A;  1PU4 A;  1UUG B;  1Y4K A;  1B2X A;  3HZP A;  2P0X A;  3NBJ A;  4JF8 A;  2IYJ A;  2W9P A;  1LNH A;  4BTY A;  1GMQ A;  4LGQ A;  2XSO B;  2ZL8 A;  3PCS A;  1CYU A;  1FGT A;  3Q90 A;  3WOE B;  3SLU A;  1BSE A;  2HMK B;  1ZS7 A;  3B7C A;  1SPU A;  2IY2 A;  3HIG A;  1BNI A;  1YNV X;  3NUV A;  1JB4 A;  1OH0 A;  1JB5 A;  3BLZ A;  1R4C A;  1OPY A;  3SVA A;  1GOU A;  1B2Z A;  1RJO A;  3KE7 A;  1MWT A;  1JN5 A;  3GZY B;  1LOX A;  1ZO2 A;  1SII A;  3MSO A;  1YJW 3;  3WOD G;  7RNT A;  3KSP A;  4OK0 A;  4OUQ A;  2IUK A;  1NDO B;  2BT3 A;  4EV5 A;  4EV2 A;  2W56 B;  2PNC A;  1LOY A;  3VSY A;  3I55 3;  4L8O A;  4WP5 A;  1CYV A;  2GU3 A;  2HMJ B;  2LYX A;  2W56 A;  3HII A;  1N5H A;  1NU3 A;  4BL2 A;  1B27 A;  1LNI A;  1RGE A;  1WMN A;  4XBT A;  2F5W A;  1WMP A;  4HM2 B;  4HM1 B;  3EX9 A;  2H0G A;  2BMO B;  2OOV C;  3X3X A;  1FGO A;  3NXJ A;  1ASK A;  1F8N A;  2W6J H;  3S27 A;  1UCL A;  2F98 A;  4HBR A;  5BIR A;  1EKM A;  2CFK A;  2QEX 3;  3D3L A;  4LYL B;  3FSD A;  4N6V 0;  3FG1 A;  4IPB A;  2BNG A;  1K28 A;  3DMC A;  1SQW A;  3K9M C;  2A15 A;  1BRK A;  1YJN 3;  4GSP A;  2Z6B A;  5DRE A;  2F5M A;  1B3S A;  2CIU A;  2D1W A;  3N9H A;  2K3D A;  3K0Z A;  3SOA A;  1W2Z A;  5M1A A;  2XSH B;  5LC7 A;  1MWU A;  1QAL A;  1VQN 3;  3LML A;  3CC4 3;  1D6U A;  1RN4 A;  1W00 A;  4EW5 A;  5KP4 A;  3MYT A;  1YIT 3;  1UW1 A;  4IT7 A;  5AI1 A;  2CK3 H;  1YI2 3;  1RNB A;  3EBT A;  1IT7 A;  4IIA A;  5ELJ A;  4AKZ A;  3H3H A;  1S72 3;  1TU5 A;  2CFW A;  1T5Y A;  1JKG B;  2O3O A;  3BNB A;  4GB5 A;  1W7C A;  4O2H A;  5G1L A;  4ZM8 A;  2E2V A;  5BVB A;  1K8A 4;  3G4S 3;  1GD3 A;  2F4Y A;  1RCL A;  1JKG A;  2WO0 A;  2KF4 A;  4HKV B;  3BNE A;  2CG1 A;  4FCZ A;  1R4Y A;  2IA7 A;  1RGF A;  1N9J A;  3KFQ C;  1N9E A;  1UGH I;  5EQL A;  3BB9 A;  3ER7 A;  3B8L A;  1IV7 A;  3DGO A;  2F99 A;  1I2G A;  1T2I A;  3F40 A;  3WOF B;  4HM7 B;  1UUV B;  3L0R A;  3LOY A;  3N54 B;  1JBR A;  4N3V A;  1MGW A;  4MMX B;  1YHQ 3;  2LQV A;  4XDW A;  3EF8 A;  1VQ9 3;  3JUP A;  2KF6 A;  4BU4 A;  1I0V A;  1Q86 4;  4EYC A;  3MKI A;  3FZW A;  3KII A;  1HU9 A;  1TIJ A;  4TX4 A;  3WA2 X;  3CCQ 3;  2CFD A;  1W2B 2;  1RN1 A;  5FGO A;  1BUQ A;  1RNT A;  1UCK A;  1WNH A;  1Q42 A;  1LOW A;  1J2B A;  3LTC A;  2P38 A;  4CCV A;  1PY3 A;  1YIJ 3;  4ILF A;  4XBX A;  1STF I;  2CX1 A;  4HVN A;  4G1M B;  4XM4 A;  5AEW B;  2GU1 A;  3LXU X;  3WA3 A;  2K0M A;  1CEW I;  3LZA A;  1ZGX A;  3AMO B;  1Q7H A;  1ROA A;  1DYU A;  2WOF A;  3EBY A;  3T8N A;  1A90 A;  2D42 A;  3Q2P A;  3UJM A;  1IQ8 A;  1X1Y A;  3DUK A;  3FG4 A;  4J9A A;  1ROV A;  3B4P A;  1EUI C;  3DXO A;  5ELU A;  1BRN L;  1GD4 A;  2L4V A;  2Y74 A;  3DGL A;  3LYG A;  3CCR 3;  1GY7 A;  3WHO A;  1UCJ A;  1HKX A;  1BU4 A;  2RGQ A;  5KP1 A;  4Q53 A;  1KD1 4;  1IVV A;  3PS8 A;  3M8C A;  3Q3F A;  2ML6 A;  2BMR B;  2RCD A;  3CCM 3;  2ZA4 A;  1X1X A;  2MF7 A;  3AHW A;  2CX0 A;  4LMI A;  5CXO A;  3RGR A;  1C7H A;  4N6M A;  1RGC A;  1BSD A;  4XDV A;  5IEO A;  4HYZ A;  2GBX B;  4J5G A;  3MHE A;  4HM6 B;  1EEJ A;  1TRQ A;  1S5A A;  5D83 A;  5CF2 A;  1IK3 A;  3T0U A;  1SIH A;  1V58 A;  4RZM A;  1VQ7 3;  1A2P A;  1GY6 A;  3S29 A;  1A67 A;  1O7W B;  3IJE B;  3FLJ A;  4MJD A;  4RNZ A;  1OHS A;  3EJV A;  2KXG A;  3DH2 A;  1K41 A;  1NWW A;  3CME 3;  1JJ2 2;  5IF6 A;  1DMQ A;  3CU3 A;  3WR2 A;  1EA2 A;  3NM7 A;  2OTJ 3;  1BNR A;  2BMQ B;  2OTL 3;  3BU4 A;  2SBL A;  4HAA A;  3F14 A;  5CF1 A;  2HMN B;  1KC8 4;  1JN5 B;  3ECF A;  4MMZ B;  1FA3 A;  4N6U A;  1BRJ A;  1AR0 A;  1FGQ A;  3D4A A;  5IEP A;  2YFI B;  3NBB A;  3RDE A;  2KF3 A;  1BVI A;  3GSP A;  2YFJ B;  3U97 A;  2BIR A;  4KT3 B;  1Q81 4;  4AEQ A;  3CPO A;  3F7S A;  3NM2 A;  1JB2 A;  1IYY A;  3BND A;  1QJG A;  1BSB A;  1D6Y A;  2FGT A;  1TUH A;  3URP A;  1V57 A;  1NJI 4;  3KN4 A;  3STD A;  1JBT A;  2IMJ A;  1WTH A;  1V74 A;  1WMO A;  1KSI A;  2E2U A;  3NX0 A;  2M7O A;  3F7X A;  2R41 A;  3CCL 3;  4K1V A;  4R4K A;  3V92 A;  2XEP A;  2KCD A;  1BOX A;  1OGZ A;  5LC6 A;  3GZR A;  2GBW B;  3D79 A;  2L1S A;  4O3V A;  9RNT A;  3KKG A;  1UUW B;  4N6O B;  5AIH A;  1IT8 A;  1G96 A;  2UGI A;  3EB8 A;  3ZG0 A;  1BIR A;  1IQY A;  5IG0 A;  3S28 A;  1IVW A;  2W04 A;  4H3U A;  3FH1 A;  1NNV A;  2CKF B;  1U8C B;  2OOV A;  2AAE A;  1JZO A;  1BRG A;  3GRD A;  3IMA B;  5AIF A;  3CCJ 3;  1VQ4 3;  3JUM A;  1OF5 B;  2BO9 B;  1T3B A;  3JUN A;  2KAA A;  3AGO A;  4HJL B;  1T2H A;  2QGU A;  1OF5 A;  4KFF A;  5HOH A;  1GS3 A;  3CD6 3;  1UCI A;  2P0M A;  1KQS 2;  4BIR A;  3PGB A;  2CWT A;  4EBG A;  1K73 4;  3FKA A;  4K90 B;  1AVL A;  2FXT A;  1GSP A;  2Q07 A;  4MEI A;  2STD A;  2AAD A;  1OUN A;  1N5P A;  3SXX A;  4DKI A;  2JDI H;  1JNQ A;  1VQO 3;  3X41 A;  4J8T A;  2Z7A A;  1BRS A;  4R80 A;  4X2O A;  4K61 A;  1I3F A;  5FW5 A;  1Q7Y 4;  4CJN A;  2QA4 3;  3F8X A;  4JRF A;  2XGL A;  3F9S A;  1A2K A;  1FW7 A;  2KF5 A;  1RHL A;  3Q1C A;  3X3Y A;  2HMO B;  1YVB I;  4NRE A;  3J7Y d;  1GYB A;  3ROB A;  1SAR A;  1LQM B;  4HM8 B;  1OHP A;  1RRH A;  2RSX A;  4KFE A;  2HML B;  2OQE C;  5JPP A;  4WFO A;  5AIG A;  5RNT A;  1BUJ A;  2Z76 A;  3PCR A;  1QVG 2;  4FMA A;  1UGI A;  5IG3 A;  2XH9 A;  2GXF A;  8RNT A;  1VQ5 3;  1OCV A;  1FZU A;  2QIY A;  2H0H A;  1TFO A;  1RGG A;  3PYJ A;  4N6N B;  1VQQ A;  3OWS A;  1IVX A;  1JRQ A;  3QK9 A;  1IU7 A;  1VQ6 3;  1W6G A;  4FCM A;  1W6Y A;  1RGH A;  3X42 A;  1IVU A;  5IG4 A;  1O7G B;  4AKY A;  3JUQ A;  1GY5 A;  2ZHX B;  5IER A;  2RNT A;  1RTU A;  3EE1 A;  5A0O B;  1RSN A;  2MC8 A;  3G71 3;  3D5I A;  1ULJ B;  3G16 A;  4PEJ A;  3A76 A;  1UI8 A;  2HMM B;  3MWZ A;  4RBN A;  1MWR A;  1O7N B;  3LT8 A;  4HM3 B;  2ZDJ A;  1ULI B;  4FR9 A;  1M90 4;  1RCK A;  2E2T A;  3K7C A;  1B2U A;  2R4I A;  4XBY A;  1LQG C;  3GZB A;  1BNG A;  1B21 A;  1HYF A;  3CCU 3;  1TJD A;  5M18 A;  3K5T A;  4KZ1 A;  4WWU C;  3AHS A;  4ORL A;  3GAX A;  4FMD A;  4HZB B;  4N6L A;  1IV9 A;  1FGR A;  1NB5 I;  5BU4 A;  1RKY A;  1A2V A;  1QAF A;  3NQZ A;  2I9W A;  7GSP A;  2UUG C;  2W9Q A;  4EC6 A;  1C54 A;  3OW2 2;  3SYU A;  1YGE A;  2C11 A;  1FUW A;  2O9U X;  1B2M A;  3MPH A;  4HM0 B;  1M9G A;  2CC3 A;  1W02 A;  2XR8 B;  2XFS A;  2P05 A;  4QWT A;  1VZZ A;  5JPU A;  3LTB A;  4U13 A;  5AYS C;  1DVD A;  1E3V A;  5EVH A;  3RGA A;  1YJ9 3;  3EN8 A;  1OAC A;  3BIR A;  2CHC A;  3DY5 A;  1EG9 B;  3MG2 A;  5D82 A;  1QVF 2;  1DVC A;  5JBS A;  2XRX B;  4STD A;  1RN7 A;  4EXR A;  1JV2 B; 
#chains in the Genus database with same CATH homology
 3LT9 A;  4CDL A;  5STD A;  8CHO A;  5KP3 A;  3CCS 3;  2CFG A;  1W6C A;  3FCS B;  3X3Z A;  3OV4 A;  2CWU A;  2WOH A;  4WYK A;  2Z77 A;  7STD A;  1TFK A;  3CNX A;  3LTD A;  1DMM A;  3LTA A;  2RFR A;  6STD A;  1M1X B;  2GEY A;  1O7H B;  2B1X B;  1MOL A;  5G2G A;  2B24 B;  3FF0 A;  3S67 A;  1QMA A;  1U5O A;  4HZ9 B;  3K63 A;  1Q40 B;  3DGM A;  4FMB A;  3JVC A;  3FGY A;  5IW9 A;  2YX9 A;  1Q40 A;  2JQ5 A;  1TP6 A;  5CLK A;  4LSO A;  4K1U A;  2YFL B;  3HI7 A;  3QRD A;  3NQY A;  3IPT A;  5D81 A;  3I56 3;  1O7P B;  2F86 B;  4R9K A;  3VGN A;  3CC7 3;  3OWY A;  1N8Q A;  1L5G B;  5AEU B;  3CC2 3;  5HGR A;  2GEX A;  2XFT A;  5EEO A;  3E99 A;  3N8B A;  3CMA 3;  5IEN A;  5AYR B;  3VF1 A;  1OGX A;  2CFL A;  1Z1S A;  3CCV 3;  3CPW 2;  2PZV A;  3LH4 A;  1IQX A;  3UL5 A;  5BXQ A;  3CXC 2;  1PFP A;  4H61 A;  4LEH A;  4N6T A;  2W2C A;  1QAK A;  2XF3 A;  3EC9 A;  3UB1 A;  1IDP A;  1VQL 3;  3DM8 A;  1FGM A;  3WMD A;  3OWU A;  1CQS A;  2V1L A;  4HM4 B;  1VQM 3;  3BNC A;  3WDG B;  3I0Y A;  4BTX A;  4O8S A;  1VQK 3;  1K9M 4;  2OCT A;  3CCE 3;  1ZX2 A;  2W03 A;  3TDG A;  3UL6 A;  1DMN A;  3EQQ B;  1AV4 A;  3SED A;  1KWI A;  3U1W A;  2P09 A;  2CWV A;  3OX9 A;  2CG0 A;  3B4O A;  4I4K A;  3V98 A;  3MG1 A;  3T8U A;  3V99 A;  1M1K 4;  1W5Z A;  3SX1 A;  2OQE A;  1WQL B;  1STD A;  1W4N A;  1VQ8 3;  3CNM A;  3DGN A;  3GZX B;  4XB5 A;  3UNL A;  1SJW A;  3KSE D;  1NB3 I;  3PXM A;  1W01 A;  4WHA A;  1VQP 3;  3GWR A;  2WGQ A;  3FF2 A;  3HX8 A;  2FNQ A;  4X2H A;  3DZL A;  1Q82 4;  3G0K A;  3HK4 A;  4O02 B;  3NHX A;  3S5C A;  4OVM A;  1N8R 4;  3H51 A;  3D9R A;  3OXA A;  3FG3 A;  1D6Z A;  2K54 A;  3X40 A;  1NO3 A;  4LZI A;  1ISK A;  4NHF A;  3JUO A;  4FCJ A;  4HM5 B;  4GL6 A;  1US1 A;  3AMO A;  3PZW A;  3NBR A;  3F8H A;  4RNY A;  5TGN A;  1LXE A;  1LVN A;  4L7K A;  1E97 A;  4L8P A;  1MNL A;  1O7M B;  5IG5 A;  3KZT A;  3ALA A;  2WGO A;  3G8Z A;  3SOY A;  3G6E 3;  5CK6 A;  1OHO A;  5I97 A;  2XGN A;  4FMC A;  3NV0 B;  3EN1 B;  2IUJ A;  4KVH A;  4MMY B;  2UX0 A;  2C10 A;  2CH9 A;  5AII A;  3NV0 A;  1UI7 A;  2KRT A;  3EHC A;  2OWP A;  4R1K A;  1RRL A;  4R9L A;  2BHM A;  2ML5 A;  3MG3 A;  3O8Y A;  1AVK A;  4BTW A;  2CW9 A;  2W0Q A;  2Y73 A;  1E3R A;  1EQK A;  2INX A;  5DRV A;  4WYK B;  4KFD A;  1PU4 A;  1Y4K A;  3HZP A;  2P0X A;  3NBJ A;  4JF8 A;  2W9P A;  1LNH A;  4BTY A;  4LGQ A;  2XSO B;  2ZL8 A;  3PCS A;  1CYU A;  1FGT A;  3Q90 A;  3WOE B;  3SLU A;  2HMK B;  3B7C A;  1SPU A;  3HIG A;  3NUV A;  1JB4 A;  1OH0 A;  1JB5 A;  3BLZ A;  1R4C A;  1OPY A;  3SVA A;  1RJO A;  3KE7 A;  1JN5 A;  3GZY B;  1LOX A;  1ZO2 A;  1SII A;  3MSO A;  1YJW 3;  3WOD G;  3KSP A;  4OK0 A;  4OUQ A;  2IUK A;  1NDO B;  2BT3 A;  4EV5 A;  4EV2 A;  2W56 B;  2PNC A;  3VSY A;  3I55 3;  4L8O A;  4WP5 A;  1CYV A;  2GU3 A;  2HMJ B;  2LYX A;  2W56 A;  3HII A;  1N5H A;  1NU3 A;  1WMN A;  4XBT A;  1WMP A;  4HM2 B;  4HM1 B;  3EX9 A;  2BMO B;  2OOV C;  3X3X A;  1FGO A;  3NXJ A;  1ASK A;  1F8N A;  2W6J H;  3S27 A;  2F98 A;  4HBR A;  1EKM A;  2CFK A;  2QEX 3;  3D3L A;  3FSD A;  4N6V 0;  3FG1 A;  4IPB A;  2BNG A;  1K28 A;  3DMC A;  1SQW A;  3K9M C;  2A15 A;  1YJN 3;  2Z6B A;  5DRE A;  3N9H A;  2CIU A;  2D1W A;  3K0Z A;  3SOA A;  1W2Z A;  2XSH B;  5LC7 A;  1QAL A;  1VQN 3;  3LML A;  3CC4 3;  1D6U A;  1W00 A;  5KP4 A;  3MYT A;  1YIT 3;  1UW1 A;  4IT7 A;  5AI1 A;  2CK3 H;  1YI2 3;  3EBT A;  1IT7 A;  4IIA A;  5ELJ A;  4AKZ A;  3H3H A;  1S72 3;  1TU5 A;  2CFW A;  1T5Y A;  1JKG B;  2O3O A;  3BNB A;  4GB5 A;  1W7C A;  4O2H A;  4ZM8 A;  5BVB A;  2E2V A;  1K8A 4;  3G4S 3;  1GD3 A;  1JKG A;  2WO0 A;  4HKV B;  3BNE A;  2CG1 A;  4FCZ A;  2IA7 A;  1N9J A;  3KFQ C;  1N9E A;  5EQL A;  3BB9 A;  3ER7 A;  3B8L A;  1IV7 A;  3DGO A;  2F99 A;  3F40 A;  3WOF B;  4HM7 B;  1UUV B;  3L0R A;  3LOY A;  3N54 B;  4N3V A;  1YHQ 3;  4MMX B;  2LQV A;  4XDW A;  3EF8 A;  1VQ9 3;  3JUP A;  1Q86 4;  4EYC A;  3MKI A;  3FZW A;  3KII A;  1HU9 A;  1TIJ A;  4TX4 A;  3WA2 X;  3CCQ 3;  2CFD A;  1W2B 2;  5FGO A;  1BUQ A;  1WNH A;  1Q42 A;  1J2B A;  3LTC A;  2P38 A;  4CCV A;  1YIJ 3;  4XBX A;  1STF I;  4HVN A;  5AEW B;  4G1M B;  4XM4 A;  2GU1 A;  3LXU X;  3WA3 A;  2K0M A;  1CEW I;  3LZA A;  3AMO B;  3T8N A;  1ROA A;  1DYU A;  2WOF A;  3EBY A;  1A90 A;  2D42 A;  3Q2P A;  3UJM A;  1IQ8 A;  3DUK A;  3FG4 A;  4J9A A;  1ROV A;  3B4P A;  3DXO A;  5ELU A;  1GD4 A;  2L4V A;  2Y74 A;  3DGL A;  3LYG A;  3CCR 3;  1GY7 A;  1HKX A;  2RGQ A;  5KP1 A;  4Q53 A;  1KD1 4;  1IVV A;  3PS8 A;  3M8C A;  2ML6 A;  2BMR B;  2RCD A;  3CCM 3;  2MF7 A;  4LMI A;  5CXO A;  3RGR A;  1C7H A;  4N6M A;  5IEO A;  4XDV A;  4HYZ A;  2GBX B;  3MHE A;  4HM6 B;  1S5A A;  5D83 A;  5CF2 A;  1IK3 A;  3T0U A;  1SIH A;  1VQ7 3;  4RZM A;  1GY6 A;  3S29 A;  1A67 A;  1O7W B;  3IJE B;  3FLJ A;  4MJD A;  4RNZ A;  1OHS A;  3EJV A;  2KXG A;  1K41 A;  1NWW A;  3CME 3;  1JJ2 2;  5IF6 A;  1DMQ A;  3CU3 A;  1EA2 A;  3NM7 A;  2OTJ 3;  2BMQ B;  2OTL 3;  2SBL A;  3F14 A;  5CF1 A;  2HMN B;  1KC8 4;  1JN5 B;  3ECF A;  4MMZ B;  1FA3 A;  4N6U A;  1AR0 A;  1FGQ A;  5IEP A;  2YFI B;  3NBB A;  3RDE A;  2YFJ B;  3U97 A;  1Q81 4;  4AEQ A;  3CPO A;  3F7S A;  3NM2 A;  1JB2 A;  3BND A;  1QJG A;  1D6Y A;  2FGT A;  1NJI 4;  1TUH A;  3KN4 A;  3STD A;  2IMJ A;  1WTH A;  1V74 A;  1WMO A;  1KSI A;  2E2U A;  3NX0 A;  2M7O A;  3F7X A;  3CCL 3;  4K1V A;  4R4K A;  3V92 A;  2XEP A;  2KCD A;  1OGZ A;  5LC6 A;  3GZR A;  2GBW B;  4O3V A;  3KKG A;  1UUW B;  4N6O B;  5AIH A;  1IT8 A;  1G96 A;  3EB8 A;  1IQY A;  5IG0 A;  3S28 A;  1IVW A;  2W04 A;  4H3U A;  3FH1 A;  2CKF B;  1U8C B;  2OOV A;  5AIF A;  3GRD A;  3IMA B;  3CCJ 3;  1VQ4 3;  3JUM A;  1OF5 B;  2BO9 B;  3JUN A;  4HJL B;  2QGU A;  1OF5 A;  4KFF A;  1GS3 A;  3CD6 3;  2P0M A;  1KQS 2;  3PGB A;  2CWT A;  4EBG A;  1K73 4;  3FKA A;  4K90 B;  1AVL A;  2FXT A;  2Q07 A;  4MEI A;  2STD A;  3SXX A;  1OUN A;  1N5P A;  2JDI H;  1JNQ A;  1VQO 3;  3X41 A;  4J8T A;  2Z7A A;  4R80 A;  4X2O A;  5FW5 A;  4K61 A;  1Q7Y 4;  2QA4 3;  3F8X A;  4JRF A;  2XGL A;  3F9S A;  1A2K A;  3Q1C A;  3X3Y A;  2HMO B;  1YVB I;  4NRE A;  3J7Y d;  1GYB A;  3ROB A;  4HM8 B;  1OHP A;  1RRH A;  2RSX A;  4KFE A;  2HML B;  2OQE C;  5JPP A;  4WFO A;  5AIG A;  2Z76 A;  3PCR A;  1QVG 2;  4FMA A;  5IG3 A;  2XH9 A;  2GXF A;  1VQ5 3;  1OCV A;  2QIY A;  4N6N B;  1TFO A;  3PYJ A;  3OWS A;  1JRQ A;  1IVX A;  3QK9 A;  1IU7 A;  1VQ6 3;  1W6G A;  4FCM A;  1W6Y A;  3X42 A;  5IG4 A;  1IVU A;  1O7G B;  4AKY A;  3JUQ A;  1GY5 A;  5IER A;  3EE1 A;  5A0O B;  3G71 3;  2MC8 A;  1ULJ B;  3G16 A;  4PEJ A;  3A76 A;  1UI8 A;  2HMM B;  3MWZ A;  4RBN A;  1O7N B;  3LT8 A;  4HM3 B;  2ZDJ A;  1ULI B;  4FR9 A;  1M90 4;  2E2T A;  3K7C A;  2R4I A;  4XBY A;  3GZB A;  3CCU 3;  3K5T A;  4KZ1 A;  4WWU C;  4ORL A;  3GAX A;  4FMD A;  4HZB B;  4N6L A;  1IV9 A;  1FGR A;  1NB5 I;  1RKY A;  1A2V A;  1QAF A;  3NQZ A;  2I9W A;  2W9Q A;  4EC6 A;  3OW2 2;  1YGE A;  2C11 A;  1FUW A;  2O9U X;  3MPH A;  4HM0 B;  1M9G A;  2CC3 A;  1W02 A;  2XR8 B;  2XFS A;  2P05 A;  4QWT A;  1VZZ A;  5JPU A;  3LTB A;  4U13 A;  5AYS C;  1DVD A;  1E3V A;  5EVH A;  3RGA A;  1YJ9 3;  3EN8 A;  1OAC A;  3DY5 A;  2CHC A;  5D82 A;  1EG9 B;  3MG2 A;  1QVF 2;  1DVC A;  5JBS A;  2XRX B;  4STD A;  1RN7 A;  4EXR A;  1JV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...