3STDA

Scytalone dehydratase and cyanocinnoline inhibitor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
162
Chain Sequence
GEITFSDYLGLMTCVYEWADSYDSKDWDRLRKVIAPTLRIDYRSFLDKLWEAMPAEEFVGMVSSKQVLGDPTLRTQHFIGGTRWEKVSEDEVIGYHQLRVPHQRYKDTTMKEVTMKGHAHSANLHWYKKIDGVWKFAGLKPDIRWGEFDFDRIFEDGRETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of potent inhibitors of scytalone dehydratase: displacement of a water molecule from the active site.
pubmed doi rcsb
source organism Magnaporthe grisea
molecule tags Lyase
molecule keywords PROTEIN (SCYTALONE DEHYDRATASE)
total genus 48
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 4.2.1.94: Scytalone dehydratase.
pdb deposition date 1998-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02982 Scytalone_dh Scytalone dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3stdA00
3NBRA 5AIGA 5CK6A 2YFLB 4ORLA 5BXQA 3HX8A 4WWUC 3NHXA 4R9LA 1OPYA 3ER7A 1UUVB 3H51A 3K0ZA 1O7HB 4STDA 3EQQB 2YFIB 4HM4B 4HM1B 3WMDA 2HMNB 3GZYB 4OVMA 3G8ZA 3FF0A 3KSPA 4HVNA 4XBTA 5AEWB 3CNXA 3CPOA 3GRDA 5IG0A 3DM8A 1NWWA 4WYKB 2F99A 1WQLB 1ISKA 6STDA 3BLZA 3F7XA 1Z1SA 2GBXB 3DXOA 3EF8A 5FW5A 1ZO2A 5CLKA 2B1XB 4LMIA 3MG1A 4X2HA 5G2GA 1OCVA 4H3UA 1ZX2A 2Z77A 4I4KA 1GY6A 1OUNA 1O7PB 3B8LA 1O7GB 1ASKA 1STDA 1CQSA 1NU3A 3NM2A 4MJDA 2BMQB 2RCDA 4GB5A 4XBYA 1C7HA 3ECFA 3RGAA 3RGRA 5IG3A 5D81A 4HZ9B 2Z7AA 3OX9A 3DMCA 1A2KA 3SEDA 3STDA 4XDWA 2RGQA 3FZWA 1SJWA 1TP6A 3GZBA 1UUWB 3LYGA 4XB5A 2HMLB 2K54A 4R1KA 3CNMA 1JB5A 3F14A 1K41A 3JUPA 4XDVA 1JKGA 1E3RA 5AIFA 4U13A 4K1VA 1JN5B 3FGYA 3UNLA 1DMMA 2F86B 3EHCA 3ROBA 5CF1A 1EG9B 4KVHA 5IEPA 1E3VA 2JQ5A 3LZAA 3NV0A 4J8TA 4WP5A 3F40A 2F98A 3JUMA 1IDPA 3FLJA 3M8CA 3OWYA 2OWPA 1JB2A 1EA2A 2BNGA 4HM6B 4HM2B 4HKVB 1QMAA 3NXJA 3OWSA 4LEHA 4XBXA 5EVHA 3I0YA 1Q40B 4L7KA 1OGZA 2STDA 3FF2A 3MHEA 3VGNA 2CHCA 4K1UA 2BMRB 2GEXA 1Q42A 3T8NA 1GY5A 3SOYA 1GY7A 1W02A 2R4IA 2RFRA 4WYKA 3VSYA 3HK4A 3D9RA 1GYBA 3F7SA 1AR0A 3EBYA 2A15A 3FSDA 4HZBB 5IG5A 4IIAA 3B4PA 3EJVA 2IMJA 5KP4A 5DREA 3DUKA 3FKAA 3NUVA 5JPPA 3H3HA 3JUNA 5D82A 1HKXA 4Q53A 2QIYA 4RZMA 1BUQA 5DRVA 3G0KA 4HJLB 3G16A 1Q40A 3FH1A 3K7CA 5D83A 5AIIA 1DMNA 3KZTA 1NDOB 1OHOA 1VZZA 3HZPA 3MYTA 1E97A 1OHPA 2I9WA 2CKFB 2YFJB 3EX9A 3IPTA 4HM7B 2GXFA 4R9KA 5CF2A 2HMMB 3MKIA 3F8HA 5AIHA 5STDA 4OUQA 3S5CA 2XSOB 2XSHB 1DMQA 1O7WB 2Z76A 3KE7A 4X2OA 5IG4A 3B7CA 2UX0A 3F9SA 3GZXB 2GEYA 3EN1B 3SOAA 3NV0B 1JN5A 1OH0A 2W2CA 2GBWB 1OF5B 1JKGB 1GS3A 2HMJB 3EN8A 3OXAA 4FCJA 3EBTA 1TUHA 5IEOA 3DZLA 4L8OA 1U5OA 3T8UA 5BVBA 3OV4A 5IERA 1S5AA 4FCMA 1ULJB 2HMOB 4J9AA 3MSOA 1W01A 3MG2A 4HM3B 1O7NB 2BMOB 4N3VA 3Q90A 1O7MB 4HM5B 1W6YA 3F8XA 3GZRA 3GWRA 3BB9A 1OHSA 3A76A 3JUOA 3JUQA 3KKGA 4L8PA 5KP3A 4CDLA 3MG3A 5IF6A 2XR8B 2B24B 2QGUA 4HM8B 5HGRA 2PZVA 2HMKB 5TGNA 8CHOA 4LGQA 2INXA 4XM4A 5KP1A 4PEJA 3E99A 4HM0B 1ULIB 3CU3A 1OF5A 1W00A 1JB4A 7STDA 5IENA 5AI1A 5CXOA 3UJMA 1OGXA 1QJGA 5AEUB 5JPUA 2XRXB 3EC9A 3B4OA 3OWUA
chains in the Genus database with same CATH superfamily
3ZFZA 3CCE3 1R4YA 3Q3FA 8RNTA 4EC6A 1Q814 1GMRA 3OW22 3K0ZA 4EV5A 1VQK3 1NB3I 5G1LA 1KWIA 1IQXA 4N6UA 2CW9A 2E2TA 3BNDA 1VQ63 4HM1B 1RGAA 3WMDA 2Y73A 1JBRA 1YJ93 3KSPA 1I2FA 5AEWB 2KF3A 1NWWA 1BNGA 1QAFA 1IT7A 3X41A 1KC84 2OTJ3 1ISKA 3BLZA 3FG4A 3Q2PA 1Y4KA 1YGEA 1TJDA 1J2BA 1T2IA 4RNTA 1B27A 1W4NA 1ZX2A 1FGOA 1OUNA 2W03A 3AHSA 3UB1A 1VQP3 1ZGXA 1CQSA 3DGNA 3S5CA 3RGRA 1SIIA 3CCQ3 1YNVX 2P0XA 1VQL3 4K90B 3NQZA 2Z7AA 4I5QA 4NREA 3PXMA 4BL2A 3CC43 4XDWA 1U8CB 1FUWA 5GSPA 1YGWA 4R1KA 2OQEC 1JB5A 3F14A 4RNYA 3SXXA 1RMSA 3WR2A 1YI23 4EBGA 1E3RA 1X1UA 5AIFA 1JN5B 1DMMA 3ROBA 2OTL3 5A0OB 2GU3A 2BO9B 3N8BA 2F98A 3OWYA 4BTWA 1JB2A 1DVDA 1IT8A 1IV9A 3S28A 2QEX3 3I553 2W0QA 1OGZA 1C54A 3HI7A 1TTOA 3FF2A 4KFEA 2C10A 3VGNA 3CCV3 1S723 2GEXA 1Q42A 2L1SA 1X1WA 1W02A 3CCM3 4FCZA 3MYTA 1N5PA 3GSPA 4NPBA 2W56A 1AR0A 3EBYA 5M18A 2Q07A 2P38A 4BIRA 1N5HA 1RGGA 1RRHA 2PNCA 3ALAA 3LT8A 4HAAA 1UW1A 5JPPA 4R80A 2QA43 4ILFA 3JUNA 1BUQA 1HKXA 4RZMA 4KFDA 2E2UA 2XEPA 1Q40A 1VQ53 1FA3A 3K7CA 5D83A 1ZS7A 1GD4A 1W5ZA 1E97A 1OHPA 1RNTA 1HU9A 2L4VA 2XFSA 3D3LA 1WTHA 1I0VA 3EX9A 4KZ1A 2HMMB 5STDA 5IG4A 1VQ43 1T3BA 2XSHB 2Z76A 1GOVA 4X2OA 1MWTA 1LOXA 3EN1B 1BIRA 1RN7A 3EN8A 1OF5B 1GS3A 1RCKA 3LMLA 3OXAA 1BSEA 4N6V0 4BU4A 1BNRA 4J9AA 2IY2A 3QRDA 1O7NB 4HM3B 4N3VA 3Q90A 1I0XA 1BRGA 1O7MB 3F8XA 2H0IA 3GWRA 3IMAB 3KKGA 1BNJA 1A2VA 2W9PA 3NUVA 2WOFA 5IW9A 3MG3A 1IVXA 3BNBA 5KP1A 1IK3A 4PEJA 2KXGA 1D6UA 4HM0B 1RN4A 1ULIB 1UCIA 2F5MA 1W00A 5IENA 1GMQA 3RDEA 5AEUB 4FR9A 1PY3A 1B2SA 1RTUA 3B4OA 1FUSA 2WGQA 3NBRA 3CD63 2W04A 3DH2A 1MWRA 3HX8A 4WWUC 1OPYA 3CXC2 1G96A 4EV2A 1RGKA 1TRQA 3EQQB 1VQQA 2YFIB 1Q7HA 4DKIA 4HM4B 4J5KA 3URPA 4OVMA 4HVNA 1BRJA 1M904 1RGFA 3DM8A 7GSPA 6STDA 1QVF2 4IPBA 1WNHA 1BSDA 3SLUA 1FGMA 3AMOA 1UCLA 3DXOA 3EF8A 5FW5A 1ZO2A 2HOHA 1K9M4 2B1XB 4X2HA 1YJW3 2Z77A 4I4KA 4BTXA 2CFDA 3B8LA 2KAAA 1ASKA 3LH4A 3NM2A 3PCRA 3U97A 2CWUA 1C7HA 1UGIA 1W2ZA 2P0MA 3X3XA 1BAOA 4HZ9B 3OX9A 1TU5A 1SJWA 3GZBA 1ROAA 1GSPA 4N6OB 2CFKA 1UUWB 3MWZA 1K41A 1JRQA 1US1A 1K734 1JKGA 1UUGB 1B2XA 4U13A 1B3SA 1FYSA 1YVSA 1FGQA 1N8QA 3FG3A 3JUMA 4AKZA 1IDPA 2C11A 1M9GA 4OK0A 3EB8A 3NXJA 3DGOA 4LEHA 5EVHA 1VQM3 2AAEA 4LZIA 2OCTA 4L7KA 1UGHI 1BNIA 1LOWA 2CC3A 4K1UA 3KCHA 1RKYA 1RGHA 2CWVA 3NBBA 1QAKA 3VF1A 3D79A 1GY7A 3PCSA 1CH0A 3VSYA 3D9RA 3KSED 3F7SA 4O2HA 3FSDA 4GL6A 4MMZB 2H0HA 1AV4A 1W2B2 1JV2B 1IQ8A 1BRKA 1AQZA 5KP4A 3FKAA 4O3VA 3KFQC 1BNFA 1A67A 3J7Yd 1NDOB 1OHOA 1VZZA 3HZPA 4HKVB 1FGRA 2I9WA 1WMOA 4GSPA 2CG1A 3GAXA 2GXFA 1GOYA 2WO0A 1I8VA 4MEIA 4R9KA 1YIJ3 2LQVA 1TIJA 1IU7A 3KE7A 1O7WB 3LTAA 1I3FA 1QALA 2XH9A 3WHOA 1OACA 2OQEA 1DETA 1BU4A 3NV0B 1A90A 2GBWB 4HBRA 2CFLA 3DZLA 2GSPA 2K3DA 3KN4A 1SPUA 4J5GA 4MMYB 5BVBA 2ZA4A 2MF7A 2CH9A 4FCMA 3MSOA 4AEQA 1W01A 2SARA 4HM5B 1W6YA 1I3IA 1MNLA 1OHSA 1SARA 2UGIA 3A76A 4CDLA 3CCS3 1YVBI 2BT3A 1IVWA 2B24B 2XFTA 2O9UX 4HM8B 1JNQA 1V58A 3CCJ3 4LGQA 3G713 3E99A 1UCKA 3LTDA 1D6ZA 1OF5A 5CXOA 3UJMA 1OGXA 2XRXB 1LRAA 2FNQA 1BVIA 2JDIH 3OWUA 3ZG0A 3G6E3 2CG0A 1B21A 2CWTA 5AIGA 5CK6A 4ORLA 3NX0A 1RGEA 2OOVA 5JBSA 3ER7A 3SYUA 1UUVB 3H51A 3UL6A 2IA7A 1Q9EA 3K63A 4STDA 4WHAA 1RSNA 1BRIA 3I563 3FF0A 1ROVA 3D5GA 3CPOA 2CFGA 3GRDA 2AADA 1MOLA 4WYKB 3D5IA 1EEJA 1LXEA 1NJI4 3CC23 2O3OA 3F7XA 3BIRA 4GHOA 1Z1SA 1LQGC 2BU4A 2CX0A 4WFOA 1RN1A 4LMIA 3MG1A 1VQ93 1MWSA 1OCVA 4H3UA 5ELUA 1GY6A 1Q7Y4 3WA3A 1O7GB 1STDA 1NU3A 4MJDA 2BMQB 2RCDA 3AGOA 3DGMA 1LOVA 1KSIA 3ECFA 3LOYA 1Q864 3EE1A 5D81A 4R4KA 4CPKA 1DVCA 1D6YA 1A2KA 2XGNA 3SEDA 1I70A 1MGWA 3STDA 2RGQA 3FZWA 3V98A 3CC73 1JJ22 3PGBA 1STFI 1W7CA 3BU4A 3NBJA 1DYUA 1FW7A 3LYGA 2K54A 1BNEA 1B2UA 1BRHA 1WMPA 2FGTA 3L0RA 1YJN3 3UNLA 1B2ZA 3FGYA 2F86B 3WODG 1EG9B 2ZL8A 1BOXA 2W56B 4KVHA 1E3VA 3V99A 5IEPA 5M19A 1VQO3 3F40A 1BUJA 1L5GB 2OWPA 2F5WA 1EA2A 2BNGA 1K28A 4H61A 4HM6B 1QMAA 1BRSA 1Q824 5EEOA 5LC6A 1BSAA 1GMPA 1GOUA 4O8SA 3A5EA 2STDA 1EUIC 3MHEA 1TFKA 1FUTA 1F8NA 2BMRB 3NM7A 3T8NA 1GY5A 3ZG5A 1UCJA 2R4IA 2RFRA 3HK4A 1N9EA 1I2GA 1FGTA 5IG5A 4HZBB 1X1YA 2A15A 3B4PA 4FMAA 1PYLA 2IMJA 5DREA 1T5YA 1B2MA 3SVAA 2CX1A 4Q53A 1W6CA 1JZOA 1M1K4 3G0KA 3DGLA 3FH1A 3G16A 3S67A 5G1KA 5AIIA 3KZTA 7RNTA 4IT7A 4HM7B 4N6LA 2YX9A 2CK3H 3LTBA 1A2PA 5AIHA 4OUQA 5AYSC 3DY5A 1DMQA 4ZM8A 1AY7A 1CYUA 1LOYA 2RSXA 1X1XA 1TRPA 2GEYA 2ZHXB 4HYZA 1BRNL 1OH0A 2W2CA 3CCU3 1JKGB 3SOYA 1TUHA 1U5OA 1YIT3 5BIRA 1S5AA 1RLSA 1ULJB 2HMOB 2RBIA 4N6TA 3MG2A 2BMOB 3TDGA 2CIUA 3MPHA 5M1AA 3T0UA 3GZRA 3PYJA 3BB9A 3JUQA 5IF6A 4L8PA 1GD3A 2XR8B 1W6GA 5HGRA 5TGNA 3BNEA 3CMA3 1IVUA 4XM4A 3CPW2 1EKMA 3IJEB 4QWTA 1JB4A 7STDA 4G1MB 2ZDJA 1LVNA 5JPUA 2BIRA 2KCDA 3SX1A 3EC9A 1K8A4 1HYFA 1RHLA 3AHWA 3S29A 4CJNA 2C4BA 4HOHA 3RNTA 2YFLB 4N6MA 5BXQA 1BSBA 3S27A 5LC7A 5I97A 1RDSA 3NHXA 4R9LA 1BSCA 1O7HB 1N9JA 5FGOA 1IQYA 2MC8A 4AKYA 1LQMB 3U1WA 2F56A 2HMNB 3GZYB 1BANA 3G8ZA 1M1XB 4XBTA 3CNXA 1IV7A 3Q1CA 5IG0A 2F99A 1WQLB 4LSOA 4RBNA 2P05A 3HOHA 5ELJA 1KD14 3WOEB 2GBXB 1CEWI 1V57A 2UUGC 3X3ZA 2D42A 5CLKA 1N8R4 5G2GA 4FMDA 1NB5I 2KF4A 4K61A 1VQ73 4EXRA 1IVVA 1O7PB 4MMXB 3BNCA 4XBYA 3WDGB 1BNSA 4GB5A 3RGAA 3CCR3 5IG3A 2P09A 3WA2X 1QVG2 3DMCA 1I2EA 1UI8A 2R41A 4CCVA 4KFFA 1TP6A 1LNIA 1RGLA 3K5TA 4O02B 4XB5A 2HMLB 1JZDA 3CNMA 3LXUX 2KF6A 4XDVA 3JUPA 1RJOA 3WOFB 1UI7A 4K1VA 4EW5A 4BTYA 1B20A 3EHCA 5CF1A 4JRFA 4NHFA 2D1WA 4LYLB 2JQ5A 3AGNA 3LZAA 3NV0A 4J8TA 4WP5A 4EYCA 2W6JH 1KQS2 2XF3A 3FLJA 3M8CA 1SIHA 1RRLA 4HM2B 3HIGA 1RNBA 3OWSA 4XBXA 1SQWA 1G0TA 5BU4A 3KIIA 3I0YA 2RNTA 2IUJA 1V74A 1Q40B 3N9HA 3NQYA 1AVKA 2H0GA 2CHCA 4N6NB 1NNVA 1RGCA 1WMNA 4WYKA 4JF8A 1IYYA 3X3YA 1HZ1A 2Y74A 1LNHA 1GYBA 3QK9A 5EQLA 4TX4A 2GU1A 3AMOB 9RNTA 1MGRA 3HIIA 4IIAA 3EJVA 3PS8A 3DUKA 1CYVA 3O8YA 2Z6BA 3H3HA 1VQ83 5D82A 2WGOA 1MWUA 3CME3 2QIYA 1NO3A 2ML5A 5HOHA 4HJLB 3D4AA 2CFWA 1DMNA 2ML6A 4KT3B 3X42A 1VQN3 3IPTA 2CKFB 2YFJB 5CF2A 4FMCA 3MKIA 1RCLA 3F8HA 2WOHA 3X40A 1PU4A 2XSOB 2IYJA 1EQKA 1G02A 3V92A 3LTCA 1T2HA 1UDII 3FG1A 4FMBA 3B7CA 2OOVC 2UX0A 3F9SA 3GZXB 3N54B 3SOAA 3CCL3 1JN5A 2F4YA 3FCSB 2HMJB 2XGLA 6RNTA 4FCJA 3EBTA 5IERA 5IEOA 3T8UA 4L8OA 1AVLA 1YHQ3 3OV4A 4BL3A 6GSPA 5RNTA 2E2VA 3UL5A 2SBLA 5AYRB 1FZUA 2KF5A 3K9MC 2LYXA 5DRVA 2FXTA 2V1LA 3G4S3 1DE3A 1TFOA 2K0MA 2M7OA 3JUOA 5KP3A 3LT9A 2QGUA 8CHOA 1BGSA 2PZVA 2HMKB 2IUKA 3JVCA 2INXA 2BHMA 2KRTA 1PFPA 3CU3A 3DGYA 2J8XB 5AI1A 1R4CA 1JBSA 2W9QA 1QJGA 3PZWA 4RNZA 1JBTA
chains in the Genus database with same CATH topology
3CCE3 4EC6A 1Q814 3OW22 3K0ZA 4EV5A 1VQK3 1NB3I 1KWIA 1IQXA 4N6UA 2CW9A 2E2TA 3BNDA 1VQ63 4HM1B 3WMDA 2Y73A 1YJ93 3KSPA 5AEWB 1NWWA 1QAFA 1IT7A 3X41A 1KC84 2OTJ3 1ISKA 3BLZA 3FG4A 3Q2PA 1Y4KA 1YGEA 1J2BA 1W4NA 1ZX2A 1FGOA 1OUNA 2W03A 3UB1A 1VQP3 3DGNA 1CQSA 3S5CA 3RGRA 1SIIA 3CCQ3 2P0XA 1VQL3 4K90B 3NQZA 2Z7AA 4NREA 3PXMA 3CC43 4XDWA 1U8CB 1FUWA 4R1KA 2OQEC 1JB5A 3F14A 4RNYA 3SXXA 1YI23 4EBGA 1E3RA 5AIFA 1JN5B 1DMMA 3ROBA 2OTL3 5A0OB 2GU3A 2BO9B 3N8BA 2F98A 3OWYA 4BTWA 1JB2A 1DVDA 1IT8A 1IV9A 3S28A 2QEX3 3I553 2W0QA 1OGZA 3HI7A 3VGNA 3FF2A 4KFEA 2C10A 3CCV3 1S723 2GEXA 1Q42A 1W02A 3CCM3 4FCZA 3MYTA 1N5PA 2W56A 1AR0A 3EBYA 2Q07A 2P38A 1N5HA 1RRHA 2PNCA 3ALAA 3LT8A 1UW1A 4R80A 2QA43 3JUNA 1BUQA 1HKXA 4RZMA 4KFDA 2E2UA 2XEPA 1Q40A 1VQ53 1FA3A 3K7CA 5D83A 2L4VA 1GD4A 2XFSA 1W5ZA 3D3LA 1E97A 1OHPA 1HU9A 3EX9A 1WTHA 4KZ1A 4MEIA 5JPPA 2HMMB 5STDA 5IG4A 1VQ43 2XSHB 2Z76A 4X2OA 1LOXA 3EN1B 1RN7A 3EN8A 1OF5B 1GS3A 3LMLA 3OXAA 4N6V0 4J9AA 3QRDA 1O7NB 4HM3B 4N3VA 3Q90A 1O7MB 3F8XA 3IMAB 3NUVA 3GWRA 3KKGA 2W9PA 1A2VA 5IW9A 2WOFA 3MG3A 1IVXA 3BNBA 5KP1A 1IK3A 4PEJA 2KXGA 1D6UA 4HM0B 1ULIB 5IENA 1W00A 3RDEA 5AEUB 4FR9A 3B4OA 2WGQA 3NBRA 3CD63 2W04A 3HX8A 4WWUC 1OPYA 3CXC2 1G96A 4EV2A 3EQQB 2YFIB 4HM4B 4OVMA 4HVNA 1M904 3DM8A 6STDA 1QVF2 4IPBA 1WNHA 3SLUA 1FGMA 3AMOA 3DXOA 3EF8A 1K9M4 5FW5A 1ZO2A 2B1XB 4X2HA 1YJW3 2Z77A 4I4KA 4BTXA 2CFDA 3B8LA 3LH4A 1ASKA 3NM2A 3PCRA 3U97A 2CWUA 1C7HA 1W2ZA 2P0MA 3X3XA 4HZ9B 3OX9A 1TU5A 1SJWA 3GZBA 1ROAA 4N6OB 2CFKA 1UUWB 3MWZA 1K41A 1JRQA 1US1A 1K734 1JKGA 4U13A 1FGQA 1N8QA 3FG3A 3JUMA 4AKZA 1IDPA 2C11A 1M9GA 4OK0A 3EB8A 3NXJA 3DGOA 4LEHA 5EVHA 1VQM3 4LZIA 2OCTA 4L7KA 2CC3A 1RKYA 4K1UA 2CWVA 3NBBA 1QAKA 3VF1A 1GY7A 3PCSA 3VSYA 3D9RA 3KSED 3F7SA 4O2HA 3FSDA 4GL6A 4MMZB 1W2B2 1AV4A 1JV2B 1IQ8A 5KP4A 3FKAA 4O3VA 3KFQC 1A67A 3J7Yd 1NDOB 1OHOA 1VZZA 3HZPA 4HKVB 1FGRA 2I9WA 1WMOA 2CG1A 3GAXA 2GXFA 2WO0A 4R9KA 1YIJ3 2LQVA 1TIJA 1IU7A 3KE7A 1O7WB 3LTAA 1QALA 2XH9A 1OACA 2OQEA 3NV0B 1A90A 2GBWB 4HBRA 2CFLA 3DZLA 3KN4A 1SPUA 5BVBA 4MMYB 2MF7A 2CH9A 4FCMA 3MSOA 4AEQA 1W01A 4HM5B 1W6YA 1MNLA 1OHSA 3A76A 4CDLA 3CCS3 1YVBI 2XFTA 2BT3A 1IVWA 2B24B 2O9UX 4HM8B 1JNQA 3CCJ3 4LGQA 3G713 3E99A 3LTDA 1D6ZA 1OF5A 5CXOA 3UJMA 1OGXA 2XRXB 2FNQA 2JDIH 3OWUA 3G6E3 2CG0A 2CWTA 5AIGA 5CK6A 4ORLA 3NX0A 2OOVA 5JBSA 3ER7A 1UUVB 3H51A 3UL6A 2IA7A 3K63A 4STDA 4WHAA 3I563 3FF0A 1ROVA 3CPOA 2CFGA 3GRDA 1MOLA 4WYKB 1NJI4 1LXEA 3CC23 2O3OA 3F7XA 1Z1SA 4WFOA 4LMIA 1VQ93 3MG1A 1OCVA 4H3UA 5ELUA 1GY6A 1Q7Y4 3WA3A 1O7GB 1STDA 1NU3A 4MJDA 2BMQB 2RCDA 3DGMA 3ECFA 1KSIA 3LOYA 1Q864 3EE1A 5D81A 4R4KA 1DVCA 1D6YA 1A2KA 2XGNA 3SEDA 3STDA 2RGQA 3FZWA 3V98A 3CC73 1JJ22 3PGBA 1STFI 1W7CA 3NBJA 1DYUA 3LYGA 2K54A 1WMPA 2FGTA 3L0RA 1YJN3 3UNLA 3FGYA 2F86B 3WODG 1EG9B 2ZL8A 4KVHA 2W56B 3V99A 1E3VA 5IEPA 1VQO3 3F40A 1L5GB 2OWPA 4H61A 1EA2A 2BNGA 1K28A 4HM6B 1QMAA 1Q824 5EEOA 5LC6A 4O8SA 2STDA 3MHEA 1TFKA 1F8NA 2BMRB 3NM7A 3T8NA 1GY5A 2R4IA 2RFRA 3HK4A 1N9EA 1FGTA 5IG5A 4HZBB 2A15A 3B4PA 4FMAA 2IMJA 5DREA 1T5YA 3SVAA 4Q53A 1W6CA 1M1K4 3G0KA 3DGLA 3FH1A 3G16A 3S67A 5AIIA 3KZTA 4IT7A 4HM7B 4N6LA 2YX9A 2CK3H 3LTBA 5AIHA 4OUQA 5AYSC 3DY5A 1DMQA 4ZM8A 1CYUA 2RSXA 2GEYA 4HYZA 1OH0A 2W2CA 3CCU3 1JKGB 3SOYA 1TUHA 1U5OA 1YIT3 1S5AA 4N6TA 1ULJB 2HMOB 3MG2A 2BMOB 3TDGA 2CIUA 3MPHA 3T0UA 3GZRA 3PYJA 3BB9A 3JUQA 5IF6A 4L8PA 1GD3A 2XR8B 1W6GA 5HGRA 5TGNA 3BNEA 3CMA3 1IVUA 4XM4A 3CPW2 1EKMA 3IJEB 4QWTA 1JB4A 7STDA 4G1MB 2ZDJA 1LVNA 5JPUA 2KCDA 3SX1A 3EC9A 1K8A4 3S29A 2YFLB 4N6MA 5BXQA 5I97A 3S27A 5LC7A 3NHXA 4R9LA 1O7HB 1N9JA 5FGOA 1IQYA 2MC8A 4AKYA 3U1WA 2HMNB 3GZYB 3G8ZA 1M1XB 4XBTA 3CNXA 1IV7A 3Q1CA 5IG0A 2F99A 1WQLB 4LSOA 4RBNA 2P05A 5ELJA 1KD14 3WOEB 2GBXB 1CEWI 3X3ZA 2D42A 5CLKA 1N8R4 5G2GA 4FMDA 1NB5I 4K61A 1VQ73 4EXRA 1IVVA 1O7PB 4MMXB 3BNCA 4XBYA 3WDGB 4GB5A 3RGAA 3CCR3 5IG3A 2P09A 3WA2X 1QVG2 3DMCA 1UI8A 4CCVA 4KFFA 1TP6A 3K5TA 4O02B 4XB5A 2HMLB 3CNMA 3LXUX 4XDVA 3JUPA 1RJOA 3WOFB 1UI7A 4K1VA 4BTYA 5CF1A 3EHCA 4JRFA 4NHFA 2D1WA 2JQ5A 3LZAA 3NV0A 4J8TA 4WP5A 4EYCA 1KQS2 2W6JH 2XF3A 3FLJA 3M8CA 1SIHA 1RRLA 4HM2B 3HIGA 3OWSA 4XBXA 1SQWA 3KIIA 3I0YA 2IUJA 1V74A 1Q40B 3N9HA 3NQYA 1AVKA 2CHCA 4N6NB 1WMNA 4WYKA 4JF8A 3X3YA 2Y74A 1LNHA 1GYBA 3QK9A 5EQLA 4TX4A 2GU1A 3AMOB 3HIIA 4IIAA 3EJVA 3PS8A 3DUKA 1CYVA 3O8YA 2Z6BA 3H3HA 1VQ83 5D82A 2WGOA 3CME3 2QIYA 1NO3A 2ML5A 4HJLB 2CFWA 1DMNA 2ML6A 3X42A 1VQN3 3IPTA 2YFJB 2CKFB 5CF2A 4FMCA 3MKIA 3F8HA 1PU4A 2WOHA 3X40A 2XSOB 1EQKA 3V92A 3LTCA 3FG1A 4FMBA 3B7CA 2OOVC 2UX0A 3F9SA 3GZXB 3N54B 3SOAA 3CCL3 1JN5A 3FCSB 2HMJB 2XGLA 4FCJA 3EBTA 5IERA 5IEOA 3T8UA 4L8OA 1AVLA 1YHQ3 3OV4A 2E2VA 3UL5A 2SBLA 5AYRB 3K9MC 2LYXA 5DRVA 2V1LA 2FXTA 3G4S3 1TFOA 2K0MA 2M7OA 3JUOA 5KP3A 3LT9A 2QGUA 8CHOA 2PZVA 2HMKB 2IUKA 3JVCA 2INXA 2BHMA 2KRTA 1PFPA 3CU3A 5AI1A 1R4CA 2W9QA 1QJGA 3PZWA 4RNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBR A;  5AIG A;  5CK6 A;  2YFL B;  4ORL A;  5BXQ A;  3HX8 A;  4WWU C;  3NHX A;  4R9L A;  1OPY A;  3ER7 A;  1UUV B;  3H51 A;  3K0Z A;  1O7H B;  4STD A;  3EQQ B;  2YFI B;  4HM4 B;  4HM1 B;  3WMD A;  2HMN B;  3GZY B;  4OVM A;  3G8Z A;  3FF0 A;  3KSP A;  4HVN A;  4XBT A;  5AEW B;  3CNX A;  3CPO A;  3GRD A;  5IG0 A;  3DM8 A;  1NWW A;  4WYK B;  2F99 A;  1WQL B;  1ISK A;  6STD A;  3BLZ A;  3F7X A;  1Z1S A;  2GBX B;  3DXO A;  3EF8 A;  5FW5 A;  1ZO2 A;  5CLK A;  2B1X B;  4LMI A;  3MG1 A;  4X2H A;  5G2G A;  1OCV A;  4H3U A;  1ZX2 A;  2Z77 A;  4I4K A;  1GY6 A;  1OUN A;  1O7P B;  3B8L A;  1O7G B;  1ASK A;  1STD A;  1CQS A;  1NU3 A;  3NM2 A;  4MJD A;  2BMQ B;  2RCD A;  4GB5 A;  4XBY A;  1C7H A;  3ECF A;  3RGA A;  3RGR A;  5IG3 A;  5D81 A;  4HZ9 B;  2Z7A A;  3OX9 A;  3DMC A;  1A2K A;  3SED A;  3STD A;  4XDW A;  2RGQ A;  3FZW A;  1SJW A;  1TP6 A;  3GZB A;  1UUW B;  3LYG A;  4XB5 A;  2HML B;  2K54 A;  4R1K A;  3CNM A;  1JB5 A;  3F14 A;  1K41 A;  3JUP A;  4XDV A;  1JKG A;  1E3R A;  5AIF A;  4U13 A;  4K1V A;  1JN5 B;  3FGY A;  3UNL A;  1DMM A;  2F86 B;  3EHC A;  3ROB A;  5CF1 A;  1EG9 B;  4KVH A;  5IEP A;  1E3V A;  2JQ5 A;  3LZA A;  3NV0 A;  4J8T A;  4WP5 A;  3F40 A;  2F98 A;  3JUM A;  1IDP A;  3FLJ A;  3M8C A;  3OWY A;  2OWP A;  1JB2 A;  1EA2 A;  2BNG A;  4HM6 B;  4HM2 B;  4HKV B;  1QMA A;  3NXJ A;  3OWS A;  4LEH A;  4XBX A;  5EVH A;  3I0Y A;  1Q40 B;  4L7K A;  1OGZ A;  2STD A;  3FF2 A;  3MHE A;  3VGN A;  2CHC A;  4K1U A;  2BMR B;  2GEX A;  1Q42 A;  3T8N A;  1GY5 A;  3SOY A;  1GY7 A;  1W02 A;  2R4I A;  2RFR A;  4WYK A;  3VSY A;  3HK4 A;  3D9R A;  1GYB A;  3F7S A;  1AR0 A;  3EBY A;  2A15 A;  3FSD A;  4HZB B;  5IG5 A;  4IIA A;  3B4P A;  3EJV A;  2IMJ A;  5KP4 A;  5DRE A;  3DUK A;  3FKA A;  3NUV A;  5JPP A;  3H3H A;  3JUN A;  5D82 A;  1HKX A;  4Q53 A;  2QIY A;  4RZM A;  1BUQ A;  5DRV A;  3G0K A;  4HJL B;  3G16 A;  1Q40 A;  3FH1 A;  3K7C A;  5D83 A;  5AII A;  1DMN A;  3KZT A;  1NDO B;  1OHO A;  1VZZ A;  3HZP A;  3MYT A;  1E97 A;  1OHP A;  2I9W A;  2CKF B;  2YFJ B;  3EX9 A;  3IPT A;  4HM7 B;  2GXF A;  4R9K A;  5CF2 A;  2HMM B;  3MKI A;  3F8H A;  5AIH A;  5STD A;  4OUQ A;  3S5C A;  2XSO B;  2XSH B;  1DMQ A;  1O7W B;  2Z76 A;  3KE7 A;  4X2O A;  5IG4 A;  3B7C A;  2UX0 A;  3F9S A;  3GZX B;  2GEY A;  3EN1 B;  3SOA A;  3NV0 B;  1JN5 A;  1OH0 A;  2W2C A;  2GBW B;  1OF5 B;  1JKG B;  1GS3 A;  2HMJ B;  3EN8 A;  3OXA A;  4FCJ A;  3EBT A;  1TUH A;  5IEO A;  3DZL A;  4L8O A;  1U5O A;  3T8U A;  5BVB A;  3OV4 A;  5IER A;  1S5A A;  4FCM A;  1ULJ B;  2HMO B;  4J9A A;  3MSO A;  1W01 A;  3MG2 A;  4HM3 B;  1O7N B;  2BMO B;  4N3V A;  3Q90 A;  1O7M B;  4HM5 B;  1W6Y A;  3F8X A;  3GZR A;  3GWR A;  3BB9 A;  1OHS A;  3A76 A;  3JUO A;  3JUQ A;  3KKG A;  4L8P A;  5KP3 A;  4CDL A;  3MG3 A;  5IF6 A;  2XR8 B;  2B24 B;  2QGU A;  4HM8 B;  5HGR A;  2PZV A;  2HMK B;  5TGN A;  8CHO A;  4LGQ A;  2INX A;  4XM4 A;  5KP1 A;  4PEJ A;  3E99 A;  4HM0 B;  1ULI B;  3CU3 A;  1OF5 A;  1W00 A;  1JB4 A;  7STD A;  5IEN A;  5AI1 A;  5CXO A;  3UJM A;  1OGX A;  1QJG A;  5AEU B;  5JPU A;  2XRX B;  3EC9 A;  3B4O A;  3OWU A; 
#chains in the Genus database with same CATH topology
 3ZFZ A;  3CCE 3;  1R4Y A;  3Q3F A;  8RNT A;  4EC6 A;  1Q81 4;  1GMR A;  3OW2 2;  3K0Z A;  4EV5 A;  1VQK 3;  1NB3 I;  5G1L A;  1KWI A;  1IQX A;  4N6U A;  2CW9 A;  2E2T A;  3BND A;  1VQ6 3;  4HM1 B;  1RGA A;  3WMD A;  2Y73 A;  1JBR A;  1YJ9 3;  3KSP A;  1I2F A;  5AEW B;  2KF3 A;  1NWW A;  1BNG A;  1QAF A;  1IT7 A;  3X41 A;  1KC8 4;  2OTJ 3;  1ISK A;  3BLZ A;  3FG4 A;  3Q2P A;  1Y4K A;  1YGE A;  1TJD A;  1J2B A;  1T2I A;  4RNT A;  1B27 A;  1W4N A;  1ZX2 A;  1FGO A;  1OUN A;  2W03 A;  3AHS A;  3UB1 A;  1VQP 3;  1ZGX A;  1CQS A;  3DGN A;  3S5C A;  3RGR A;  1SII A;  3CCQ 3;  1YNV X;  2P0X A;  1VQL 3;  4K90 B;  3NQZ A;  2Z7A A;  4I5Q A;  4NRE A;  3PXM A;  4BL2 A;  3CC4 3;  4XDW A;  1U8C B;  1FUW A;  5GSP A;  1YGW A;  4R1K A;  2OQE C;  1JB5 A;  3F14 A;  4RNY A;  3SXX A;  1RMS A;  3WR2 A;  1YI2 3;  4EBG A;  1E3R A;  1X1U A;  5AIF A;  1JN5 B;  1DMM A;  3ROB A;  2OTL 3;  5A0O B;  2GU3 A;  2BO9 B;  3N8B A;  2F98 A;  3OWY A;  4BTW A;  1JB2 A;  1DVD A;  1IT8 A;  1IV9 A;  3S28 A;  2QEX 3;  3I55 3;  2W0Q A;  1OGZ A;  1C54 A;  3HI7 A;  1TTO A;  3FF2 A;  4KFE A;  2C10 A;  3VGN A;  3CCV 3;  1S72 3;  2GEX A;  1Q42 A;  2L1S A;  1X1W A;  1W02 A;  3CCM 3;  4FCZ A;  3MYT A;  1N5P A;  3GSP A;  4NPB A;  2W56 A;  1AR0 A;  3EBY A;  5M18 A;  2Q07 A;  2P38 A;  4BIR A;  1N5H A;  1RGG A;  1RRH A;  2PNC A;  3ALA A;  3LT8 A;  4HAA A;  1UW1 A;  5JPP A;  4R80 A;  2QA4 3;  4ILF A;  3JUN A;  1BUQ A;  1HKX A;  4RZM A;  4KFD A;  2E2U A;  2XEP A;  1Q40 A;  1VQ5 3;  1FA3 A;  3K7C A;  5D83 A;  1ZS7 A;  1GD4 A;  1W5Z A;  1E97 A;  1OHP A;  1RNT A;  1HU9 A;  2L4V A;  2XFS A;  3D3L A;  1WTH A;  1I0V A;  3EX9 A;  4KZ1 A;  2HMM B;  5STD A;  5IG4 A;  1VQ4 3;  1T3B A;  2XSH B;  2Z76 A;  1GOV A;  4X2O A;  1MWT A;  1LOX A;  3EN1 B;  1BIR A;  1RN7 A;  3EN8 A;  1OF5 B;  1GS3 A;  1RCK A;  3LML A;  3OXA A;  1BSE A;  4N6V 0;  4BU4 A;  1BNR A;  4J9A A;  2IY2 A;  3QRD A;  1O7N B;  4HM3 B;  4N3V A;  3Q90 A;  1I0X A;  1BRG A;  1O7M B;  3F8X A;  2H0I A;  3GWR A;  3IMA B;  3KKG A;  1BNJ A;  1A2V A;  2W9P A;  3NUV A;  2WOF A;  5IW9 A;  3MG3 A;  1IVX A;  3BNB A;  5KP1 A;  1IK3 A;  4PEJ A;  2KXG A;  1D6U A;  4HM0 B;  1RN4 A;  1ULI B;  1UCI A;  2F5M A;  1W00 A;  5IEN A;  1GMQ A;  3RDE A;  5AEU B;  4FR9 A;  1PY3 A;  1B2S A;  1RTU A;  3B4O A;  1FUS A;  2WGQ A;  3NBR A;  3CD6 3;  2W04 A;  3DH2 A;  1MWR A;  3HX8 A;  4WWU C;  1OPY A;  3CXC 2;  1G96 A;  4EV2 A;  1RGK A;  1TRQ A;  3EQQ B;  1VQQ A;  2YFI B;  1Q7H A;  4DKI A;  4HM4 B;  4J5K A;  3URP A;  4OVM A;  4HVN A;  1BRJ A;  1M90 4;  1RGF A;  3DM8 A;  7GSP A;  6STD A;  1QVF 2;  4IPB A;  1WNH A;  1BSD A;  3SLU A;  1FGM A;  3AMO A;  1UCL A;  3DXO A;  3EF8 A;  5FW5 A;  1ZO2 A;  2HOH A;  1K9M 4;  2B1X B;  4X2H A;  1YJW 3;  2Z77 A;  4I4K A;  4BTX A;  2CFD A;  3B8L A;  2KAA A;  1ASK A;  3LH4 A;  3NM2 A;  3PCR A;  3U97 A;  2CWU A;  1C7H A;  1UGI A;  1W2Z A;  2P0M A;  3X3X A;  1BAO A;  4HZ9 B;  3OX9 A;  1TU5 A;  1SJW A;  3GZB A;  1ROA A;  1GSP A;  4N6O B;  2CFK A;  1UUW B;  3MWZ A;  1K41 A;  1JRQ A;  1US1 A;  1K73 4;  1JKG A;  1UUG B;  1B2X A;  4U13 A;  1B3S A;  1FYS A;  1YVS A;  1FGQ A;  1N8Q A;  3FG3 A;  3JUM A;  4AKZ A;  1IDP A;  2C11 A;  1M9G A;  4OK0 A;  3EB8 A;  3NXJ A;  3DGO A;  4LEH A;  5EVH A;  1VQM 3;  2AAE A;  4LZI A;  2OCT A;  4L7K A;  1UGH I;  1BNI A;  1LOW A;  2CC3 A;  4K1U A;  3KCH A;  1RKY A;  1RGH A;  2CWV A;  3NBB A;  1QAK A;  3VF1 A;  3D79 A;  1GY7 A;  3PCS A;  1CH0 A;  3VSY A;  3D9R A;  3KSE D;  3F7S A;  4O2H A;  3FSD A;  4GL6 A;  4MMZ B;  2H0H A;  1AV4 A;  1W2B 2;  1JV2 B;  1IQ8 A;  1BRK A;  1AQZ A;  5KP4 A;  3FKA A;  4O3V A;  3KFQ C;  1BNF A;  1A67 A;  3J7Y d;  1NDO B;  1OHO A;  1VZZ A;  3HZP A;  4HKV B;  1FGR A;  2I9W A;  1WMO A;  4GSP A;  2CG1 A;  3GAX A;  2GXF A;  1GOY A;  2WO0 A;  1I8V A;  4MEI A;  4R9K A;  1YIJ 3;  2LQV A;  1TIJ A;  1IU7 A;  3KE7 A;  1O7W B;  3LTA A;  1I3F A;  1QAL A;  2XH9 A;  3WHO A;  1OAC A;  2OQE A;  1DET A;  1BU4 A;  3NV0 B;  1A90 A;  2GBW B;  4HBR A;  2CFL A;  3DZL A;  2GSP A;  2K3D A;  3KN4 A;  1SPU A;  4J5G A;  4MMY B;  5BVB A;  2ZA4 A;  2MF7 A;  2CH9 A;  4FCM A;  3MSO A;  4AEQ A;  1W01 A;  2SAR A;  4HM5 B;  1W6Y A;  1I3I A;  1MNL A;  1OHS A;  1SAR A;  2UGI A;  3A76 A;  4CDL A;  3CCS 3;  1YVB I;  2BT3 A;  1IVW A;  2B24 B;  2XFT A;  2O9U X;  4HM8 B;  1JNQ A;  1V58 A;  3CCJ 3;  4LGQ A;  3G71 3;  3E99 A;  1UCK A;  3LTD A;  1D6Z A;  1OF5 A;  5CXO A;  3UJM A;  1OGX A;  2XRX B;  1LRA A;  2FNQ A;  1BVI A;  2JDI H;  3OWU A;  3ZG0 A;  3G6E 3;  2CG0 A;  1B21 A;  2CWT A;  5AIG A;  5CK6 A;  4ORL A;  3NX0 A;  1RGE A;  2OOV A;  5JBS A;  3ER7 A;  3SYU A;  1UUV B;  3H51 A;  3UL6 A;  2IA7 A;  1Q9E A;  3K63 A;  4STD A;  4WHA A;  1RSN A;  1BRI A;  3I56 3;  3FF0 A;  1ROV A;  3D5G A;  3CPO A;  2CFG A;  3GRD A;  2AAD A;  1MOL A;  4WYK B;  3D5I A;  1EEJ A;  1LXE A;  1NJI 4;  3CC2 3;  2O3O A;  3F7X A;  3BIR A;  4GHO A;  1Z1S A;  1LQG C;  2BU4 A;  2CX0 A;  4WFO A;  1RN1 A;  4LMI A;  3MG1 A;  1VQ9 3;  1MWS A;  1OCV A;  4H3U A;  5ELU A;  1GY6 A;  1Q7Y 4;  3WA3 A;  1O7G B;  1STD A;  1NU3 A;  4MJD A;  2BMQ B;  2RCD A;  3AGO A;  3DGM A;  1LOV A;  1KSI A;  3ECF A;  3LOY A;  1Q86 4;  3EE1 A;  5D81 A;  4R4K A;  4CPK A;  1DVC A;  1D6Y A;  1A2K A;  2XGN A;  3SED A;  1I70 A;  1MGW A;  3STD A;  2RGQ A;  3FZW A;  3V98 A;  3CC7 3;  1JJ2 2;  3PGB A;  1STF I;  1W7C A;  3BU4 A;  3NBJ A;  1DYU A;  1FW7 A;  3LYG A;  2K54 A;  1BNE A;  1B2U A;  1BRH A;  1WMP A;  2FGT A;  3L0R A;  1YJN 3;  3UNL A;  1B2Z A;  3FGY A;  2F86 B;  3WOD G;  1EG9 B;  2ZL8 A;  1BOX A;  2W56 B;  4KVH A;  1E3V A;  3V99 A;  5IEP A;  5M19 A;  1VQO 3;  3F40 A;  1BUJ A;  1L5G B;  2OWP A;  2F5W A;  1EA2 A;  2BNG A;  1K28 A;  4H61 A;  4HM6 B;  1QMA A;  1BRS A;  1Q82 4;  5EEO A;  5LC6 A;  1BSA A;  1GMP A;  1GOU A;  4O8S A;  3A5E A;  2STD A;  1EUI C;  3MHE A;  1TFK A;  1FUT A;  1F8N A;  2BMR B;  3NM7 A;  3T8N A;  1GY5 A;  3ZG5 A;  1UCJ A;  2R4I A;  2RFR A;  3HK4 A;  1N9E A;  1I2G A;  1FGT A;  5IG5 A;  4HZB B;  1X1Y A;  2A15 A;  3B4P A;  4FMA A;  1PYL A;  2IMJ A;  5DRE A;  1T5Y A;  1B2M A;  3SVA A;  2CX1 A;  4Q53 A;  1W6C A;  1JZO A;  1M1K 4;  3G0K A;  3DGL A;  3FH1 A;  3G16 A;  3S67 A;  5G1K A;  5AII A;  3KZT A;  7RNT A;  4IT7 A;  4HM7 B;  4N6L A;  2YX9 A;  2CK3 H;  3LTB A;  1A2P A;  5AIH A;  4OUQ A;  5AYS C;  3DY5 A;  1DMQ A;  4ZM8 A;  1AY7 A;  1CYU A;  1LOY A;  2RSX A;  1X1X A;  1TRP A;  2GEY A;  2ZHX B;  4HYZ A;  1BRN L;  1OH0 A;  2W2C A;  3CCU 3;  1JKG B;  3SOY A;  1TUH A;  1U5O A;  1YIT 3;  5BIR A;  1S5A A;  1RLS A;  1ULJ B;  2HMO B;  2RBI A;  4N6T A;  3MG2 A;  2BMO B;  3TDG A;  2CIU A;  3MPH A;  5M1A A;  3T0U A;  3GZR A;  3PYJ A;  3BB9 A;  3JUQ A;  5IF6 A;  4L8P A;  1GD3 A;  2XR8 B;  1W6G A;  5HGR A;  5TGN A;  3BNE A;  3CMA 3;  1IVU A;  4XM4 A;  3CPW 2;  1EKM A;  3IJE B;  4QWT A;  1JB4 A;  7STD A;  4G1M B;  2ZDJ A;  1LVN A;  5JPU A;  2BIR A;  2KCD A;  3SX1 A;  3EC9 A;  1K8A 4;  1HYF A;  1RHL A;  3AHW A;  3S29 A;  4CJN A;  2C4B A;  4HOH A;  3RNT A;  2YFL B;  4N6M A;  5BXQ A;  1BSB A;  3S27 A;  5LC7 A;  5I97 A;  1RDS A;  3NHX A;  4R9L A;  1BSC A;  1O7H B;  1N9J A;  5FGO A;  1IQY A;  2MC8 A;  4AKY A;  1LQM B;  3U1W A;  2F56 A;  2HMN B;  3GZY B;  1BAN A;  3G8Z A;  1M1X B;  4XBT A;  3CNX A;  1IV7 A;  3Q1C A;  5IG0 A;  2F99 A;  1WQL B;  4LSO A;  4RBN A;  2P05 A;  3HOH A;  5ELJ A;  1KD1 4;  3WOE B;  2GBX B;  1CEW I;  1V57 A;  2UUG C;  3X3Z A;  2D42 A;  5CLK A;  1N8R 4;  5G2G A;  4FMD A;  1NB5 I;  2KF4 A;  4K61 A;  1VQ7 3;  4EXR A;  1IVV A;  1O7P B;  4MMX B;  3BNC A;  4XBY A;  3WDG B;  1BNS A;  4GB5 A;  3RGA A;  3CCR 3;  5IG3 A;  2P09 A;  3WA2 X;  1QVG 2;  3DMC A;  1I2E A;  1UI8 A;  2R41 A;  4CCV A;  4KFF A;  1TP6 A;  1LNI A;  1RGL A;  3K5T A;  4O02 B;  4XB5 A;  2HML B;  1JZD A;  3CNM A;  3LXU X;  2KF6 A;  4XDV A;  3JUP A;  1RJO A;  3WOF B;  1UI7 A;  4K1V A;  4EW5 A;  4BTY A;  1B20 A;  3EHC A;  5CF1 A;  4JRF A;  4NHF A;  2D1W A;  4LYL B;  2JQ5 A;  3AGN A;  3LZA A;  3NV0 A;  4J8T A;  4WP5 A;  4EYC A;  2W6J H;  1KQS 2;  2XF3 A;  3FLJ A;  3M8C A;  1SIH A;  1RRL A;  4HM2 B;  3HIG A;  1RNB A;  3OWS A;  4XBX A;  1SQW A;  1G0T A;  5BU4 A;  3KII A;  3I0Y A;  2RNT A;  2IUJ A;  1V74 A;  1Q40 B;  3N9H A;  3NQY A;  1AVK A;  2H0G A;  2CHC A;  4N6N B;  1NNV A;  1RGC A;  1WMN A;  4WYK A;  4JF8 A;  1IYY A;  3X3Y A;  1HZ1 A;  2Y74 A;  1LNH A;  1GYB A;  3QK9 A;  5EQL A;  4TX4 A;  2GU1 A;  3AMO B;  9RNT A;  1MGR A;  3HII A;  4IIA A;  3EJV A;  3PS8 A;  3DUK A;  1CYV A;  3O8Y A;  2Z6B A;  3H3H A;  1VQ8 3;  5D82 A;  2WGO A;  1MWU A;  3CME 3;  2QIY A;  1NO3 A;  2ML5 A;  5HOH A;  4HJL B;  3D4A A;  2CFW A;  1DMN A;  2ML6 A;  4KT3 B;  3X42 A;  1VQN 3;  3IPT A;  2CKF B;  2YFJ B;  5CF2 A;  4FMC A;  3MKI A;  1RCL A;  3F8H A;  2WOH A;  3X40 A;  1PU4 A;  2XSO B;  2IYJ A;  1EQK A;  1G02 A;  3V92 A;  3LTC A;  1T2H A;  1UDI I;  3FG1 A;  4FMB A;  3B7C A;  2OOV C;  2UX0 A;  3F9S A;  3GZX B;  3N54 B;  3SOA A;  3CCL 3;  1JN5 A;  2F4Y A;  3FCS B;  2HMJ B;  2XGL A;  6RNT A;  4FCJ A;  3EBT A;  5IER A;  5IEO A;  3T8U A;  4L8O A;  1AVL A;  1YHQ 3;  3OV4 A;  4BL3 A;  6GSP A;  5RNT A;  2E2V A;  3UL5 A;  2SBL A;  5AYR B;  1FZU A;  2KF5 A;  3K9M C;  2LYX A;  5DRV A;  2FXT A;  2V1L A;  3G4S 3;  1DE3 A;  1TFO A;  2K0M A;  2M7O A;  3JUO A;  5KP3 A;  3LT9 A;  2QGU A;  8CHO A;  1BGS A;  2PZV A;  2HMK B;  2IUK A;  3JVC A;  2INX A;  2BHM A;  2KRT A;  1PFP A;  3CU3 A;  3DGY A;  2J8X B;  5AI1 A;  1R4C A;  1JBS A;  2W9Q A;  1QJG A;  3PZW A;  4RNZ A;  1JBT A; 
#chains in the Genus database with same CATH homology
 3CCE 3;  4EC6 A;  1Q81 4;  3OW2 2;  3K0Z A;  4EV5 A;  1VQK 3;  1NB3 I;  1KWI A;  1IQX A;  4N6U A;  2CW9 A;  2E2T A;  3BND A;  1VQ6 3;  4HM1 B;  3WMD A;  2Y73 A;  1YJ9 3;  3KSP A;  5AEW B;  1NWW A;  1QAF A;  1IT7 A;  3X41 A;  1KC8 4;  2OTJ 3;  1ISK A;  3BLZ A;  3FG4 A;  3Q2P A;  1Y4K A;  1YGE A;  1J2B A;  1W4N A;  1ZX2 A;  1FGO A;  1OUN A;  2W03 A;  3UB1 A;  1VQP 3;  3DGN A;  1CQS A;  3S5C A;  3RGR A;  1SII A;  3CCQ 3;  2P0X A;  1VQL 3;  4K90 B;  3NQZ A;  2Z7A A;  4NRE A;  3PXM A;  3CC4 3;  4XDW A;  1U8C B;  1FUW A;  4R1K A;  2OQE C;  1JB5 A;  3F14 A;  4RNY A;  3SXX A;  1YI2 3;  4EBG A;  1E3R A;  5AIF A;  1JN5 B;  1DMM A;  3ROB A;  2OTL 3;  5A0O B;  2GU3 A;  2BO9 B;  3N8B A;  2F98 A;  3OWY A;  4BTW A;  1JB2 A;  1DVD A;  1IT8 A;  1IV9 A;  3S28 A;  2QEX 3;  3I55 3;  2W0Q A;  1OGZ A;  3HI7 A;  3VGN A;  3FF2 A;  4KFE A;  2C10 A;  3CCV 3;  1S72 3;  2GEX A;  1Q42 A;  1W02 A;  3CCM 3;  4FCZ A;  3MYT A;  1N5P A;  2W56 A;  1AR0 A;  3EBY A;  2Q07 A;  2P38 A;  1N5H A;  1RRH A;  2PNC A;  3ALA A;  3LT8 A;  1UW1 A;  4R80 A;  2QA4 3;  3JUN A;  1BUQ A;  1HKX A;  4RZM A;  4KFD A;  2E2U A;  2XEP A;  1Q40 A;  1VQ5 3;  1FA3 A;  3K7C A;  5D83 A;  2L4V A;  1GD4 A;  2XFS A;  1W5Z A;  3D3L A;  1E97 A;  1OHP A;  1HU9 A;  3EX9 A;  1WTH A;  4KZ1 A;  4MEI A;  5JPP A;  2HMM B;  5STD A;  5IG4 A;  1VQ4 3;  2XSH B;  2Z76 A;  4X2O A;  1LOX A;  3EN1 B;  1RN7 A;  3EN8 A;  1OF5 B;  1GS3 A;  3LML A;  3OXA A;  4N6V 0;  4J9A A;  3QRD A;  1O7N B;  4HM3 B;  4N3V A;  3Q90 A;  1O7M B;  3F8X A;  3IMA B;  3NUV A;  3GWR A;  3KKG A;  2W9P A;  1A2V A;  5IW9 A;  2WOF A;  3MG3 A;  1IVX A;  3BNB A;  5KP1 A;  1IK3 A;  4PEJ A;  2KXG A;  1D6U A;  4HM0 B;  1ULI B;  5IEN A;  1W00 A;  3RDE A;  5AEU B;  4FR9 A;  3B4O A;  2WGQ A;  3NBR A;  3CD6 3;  2W04 A;  3HX8 A;  4WWU C;  1OPY A;  3CXC 2;  1G96 A;  4EV2 A;  3EQQ B;  2YFI B;  4HM4 B;  4OVM A;  4HVN A;  1M90 4;  3DM8 A;  6STD A;  1QVF 2;  4IPB A;  1WNH A;  3SLU A;  1FGM A;  3AMO A;  3DXO A;  3EF8 A;  1K9M 4;  5FW5 A;  1ZO2 A;  2B1X B;  4X2H A;  1YJW 3;  2Z77 A;  4I4K A;  4BTX A;  2CFD A;  3B8L A;  3LH4 A;  1ASK A;  3NM2 A;  3PCR A;  3U97 A;  2CWU A;  1C7H A;  1W2Z A;  2P0M A;  3X3X A;  4HZ9 B;  3OX9 A;  1TU5 A;  1SJW A;  3GZB A;  1ROA A;  4N6O B;  2CFK A;  1UUW B;  3MWZ A;  1K41 A;  1JRQ A;  1US1 A;  1K73 4;  1JKG A;  4U13 A;  1FGQ A;  1N8Q A;  3FG3 A;  3JUM A;  4AKZ A;  1IDP A;  2C11 A;  1M9G A;  4OK0 A;  3EB8 A;  3NXJ A;  3DGO A;  4LEH A;  5EVH A;  1VQM 3;  4LZI A;  2OCT A;  4L7K A;  2CC3 A;  1RKY A;  4K1U A;  2CWV A;  3NBB A;  1QAK A;  3VF1 A;  1GY7 A;  3PCS A;  3VSY A;  3D9R A;  3KSE D;  3F7S A;  4O2H A;  3FSD A;  4GL6 A;  4MMZ B;  1W2B 2;  1AV4 A;  1JV2 B;  1IQ8 A;  5KP4 A;  3FKA A;  4O3V A;  3KFQ C;  1A67 A;  3J7Y d;  1NDO B;  1OHO A;  1VZZ A;  3HZP A;  4HKV B;  1FGR A;  2I9W A;  1WMO A;  2CG1 A;  3GAX A;  2GXF A;  2WO0 A;  4R9K A;  1YIJ 3;  2LQV A;  1TIJ A;  1IU7 A;  3KE7 A;  1O7W B;  3LTA A;  1QAL A;  2XH9 A;  1OAC A;  2OQE A;  3NV0 B;  1A90 A;  2GBW B;  4HBR A;  2CFL A;  3DZL A;  3KN4 A;  1SPU A;  5BVB A;  4MMY B;  2MF7 A;  2CH9 A;  4FCM A;  3MSO A;  4AEQ A;  1W01 A;  4HM5 B;  1W6Y A;  1MNL A;  1OHS A;  3A76 A;  4CDL A;  3CCS 3;  1YVB I;  2XFT A;  2BT3 A;  1IVW A;  2B24 B;  2O9U X;  4HM8 B;  1JNQ A;  3CCJ 3;  4LGQ A;  3G71 3;  3E99 A;  3LTD A;  1D6Z A;  1OF5 A;  5CXO A;  3UJM A;  1OGX A;  2XRX B;  2FNQ A;  2JDI H;  3OWU A;  3G6E 3;  2CG0 A;  2CWT A;  5AIG A;  5CK6 A;  4ORL A;  3NX0 A;  2OOV A;  5JBS A;  3ER7 A;  1UUV B;  3H51 A;  3UL6 A;  2IA7 A;  3K63 A;  4STD A;  4WHA A;  3I56 3;  3FF0 A;  1ROV A;  3CPO A;  2CFG A;  3GRD A;  1MOL A;  4WYK B;  1NJI 4;  1LXE A;  3CC2 3;  2O3O A;  3F7X A;  1Z1S A;  4WFO A;  4LMI A;  1VQ9 3;  3MG1 A;  1OCV A;  4H3U A;  5ELU A;  1GY6 A;  1Q7Y 4;  3WA3 A;  1O7G B;  1STD A;  1NU3 A;  4MJD A;  2BMQ B;  2RCD A;  3DGM A;  3ECF A;  1KSI A;  3LOY A;  1Q86 4;  3EE1 A;  5D81 A;  4R4K A;  1DVC A;  1D6Y A;  1A2K A;  2XGN A;  3SED A;  3STD A;  2RGQ A;  3FZW A;  3V98 A;  3CC7 3;  1JJ2 2;  3PGB A;  1STF I;  1W7C A;  3NBJ A;  1DYU A;  3LYG A;  2K54 A;  1WMP A;  2FGT A;  3L0R A;  1YJN 3;  3UNL A;  3FGY A;  2F86 B;  3WOD G;  1EG9 B;  2ZL8 A;  4KVH A;  2W56 B;  3V99 A;  1E3V A;  5IEP A;  1VQO 3;  3F40 A;  1L5G B;  2OWP A;  4H61 A;  1EA2 A;  2BNG A;  1K28 A;  4HM6 B;  1QMA A;  1Q82 4;  5EEO A;  5LC6 A;  4O8S A;  2STD A;  3MHE A;  1TFK A;  1F8N A;  2BMR B;  3NM7 A;  3T8N A;  1GY5 A;  2R4I A;  2RFR A;  3HK4 A;  1N9E A;  1FGT A;  5IG5 A;  4HZB B;  2A15 A;  3B4P A;  4FMA A;  2IMJ A;  5DRE A;  1T5Y A;  3SVA A;  4Q53 A;  1W6C A;  1M1K 4;  3G0K A;  3DGL A;  3FH1 A;  3G16 A;  3S67 A;  5AII A;  3KZT A;  4IT7 A;  4HM7 B;  4N6L A;  2YX9 A;  2CK3 H;  3LTB A;  5AIH A;  4OUQ A;  5AYS C;  3DY5 A;  1DMQ A;  4ZM8 A;  1CYU A;  2RSX A;  2GEY A;  4HYZ A;  1OH0 A;  2W2C A;  3CCU 3;  1JKG B;  3SOY A;  1TUH A;  1U5O A;  1YIT 3;  1S5A A;  4N6T A;  1ULJ B;  2HMO B;  3MG2 A;  2BMO B;  3TDG A;  2CIU A;  3MPH A;  3T0U A;  3GZR A;  3PYJ A;  3BB9 A;  3JUQ A;  5IF6 A;  4L8P A;  1GD3 A;  2XR8 B;  1W6G A;  5HGR A;  5TGN A;  3BNE A;  3CMA 3;  1IVU A;  4XM4 A;  3CPW 2;  1EKM A;  3IJE B;  4QWT A;  1JB4 A;  7STD A;  4G1M B;  2ZDJ A;  1LVN A;  5JPU A;  2KCD A;  3SX1 A;  3EC9 A;  1K8A 4;  3S29 A;  2YFL B;  4N6M A;  5BXQ A;  5I97 A;  3S27 A;  5LC7 A;  3NHX A;  4R9L A;  1O7H B;  1N9J A;  5FGO A;  1IQY A;  2MC8 A;  4AKY A;  3U1W A;  2HMN B;  3GZY B;  3G8Z A;  1M1X B;  4XBT A;  3CNX A;  1IV7 A;  3Q1C A;  5IG0 A;  2F99 A;  1WQL B;  4LSO A;  4RBN A;  2P05 A;  5ELJ A;  1KD1 4;  3WOE B;  2GBX B;  1CEW I;  3X3Z A;  2D42 A;  5CLK A;  1N8R 4;  5G2G A;  4FMD A;  1NB5 I;  4K61 A;  1VQ7 3;  4EXR A;  1IVV A;  1O7P B;  4MMX B;  3BNC A;  4XBY A;  3WDG B;  4GB5 A;  3RGA A;  3CCR 3;  5IG3 A;  2P09 A;  3WA2 X;  1QVG 2;  3DMC A;  1UI8 A;  4CCV A;  4KFF A;  1TP6 A;  3K5T A;  4O02 B;  4XB5 A;  2HML B;  3CNM A;  3LXU X;  4XDV A;  3JUP A;  1RJO A;  3WOF B;  1UI7 A;  4K1V A;  4BTY A;  5CF1 A;  3EHC A;  4JRF A;  4NHF A;  2D1W A;  2JQ5 A;  3LZA A;  3NV0 A;  4J8T A;  4WP5 A;  4EYC A;  1KQS 2;  2W6J H;  2XF3 A;  3FLJ A;  3M8C A;  1SIH A;  1RRL A;  4HM2 B;  3HIG A;  3OWS A;  4XBX A;  1SQW A;  3KII A;  3I0Y A;  2IUJ A;  1V74 A;  1Q40 B;  3N9H A;  3NQY A;  1AVK A;  2CHC A;  4N6N B;  1WMN A;  4WYK A;  4JF8 A;  3X3Y A;  2Y74 A;  1LNH A;  1GYB A;  3QK9 A;  5EQL A;  4TX4 A;  2GU1 A;  3AMO B;  3HII A;  4IIA A;  3EJV A;  3PS8 A;  3DUK A;  1CYV A;  3O8Y A;  2Z6B A;  3H3H A;  1VQ8 3;  5D82 A;  2WGO A;  3CME 3;  2QIY A;  1NO3 A;  2ML5 A;  4HJL B;  2CFW A;  1DMN A;  2ML6 A;  3X42 A;  1VQN 3;  3IPT A;  2YFJ B;  2CKF B;  5CF2 A;  4FMC A;  3MKI A;  3F8H A;  1PU4 A;  2WOH A;  3X40 A;  2XSO B;  1EQK A;  3V92 A;  3LTC A;  3FG1 A;  4FMB A;  3B7C A;  2OOV C;  2UX0 A;  3F9S A;  3GZX B;  3N54 B;  3SOA A;  3CCL 3;  1JN5 A;  3FCS B;  2HMJ B;  2XGL A;  4FCJ A;  3EBT A;  5IER A;  5IEO A;  3T8U A;  4L8O A;  1AVL A;  1YHQ 3;  3OV4 A;  2E2V A;  3UL5 A;  2SBL A;  5AYR B;  3K9M C;  2LYX A;  5DRV A;  2V1L A;  2FXT A;  3G4S 3;  1TFO A;  2K0M A;  2M7O A;  3JUO A;  5KP3 A;  3LT9 A;  2QGU A;  8CHO A;  2PZV A;  2HMK B;  2IUK A;  3JVC A;  2INX A;  2BHM A;  2KRT A;  1PFP A;  3CU3 A;  5AI1 A;  1R4C A;  2W9Q A;  1QJG A;  3PZW A;  4RNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...