4ZM8A

Crystal structure of sialostatin l
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
111
structure length
109
Chain Sequence
b'FGGYSERHQANPEFLNLAHYATSTWSAQQPGKTHFDTVAEVVKVETQVVAGTNYRLTLKVAESTCELTSTYNKDTCLPKADAAHRTCTTVVFENLQGDKSVSPFECEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative secreted cystatin
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Hydrolase inhibitor
total genus 13
structure length 109
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4zm8A00
1MNLA 3Q2PA 2OCTA 4N6V0 5ELJA 3PXMA 3NX0A 5EQLA 4LZIA 1RN7A 1TIJA 5LC6A 1LXEA 1NB3I 1GD4A 3KFQC 3PYJA 4N6TA 1PFPA 1DVCA 3UL6A 2BO9B 4EYCA 1A67A 1STFI 1IV9A 1A90A 1N5HA 3PS8A 2CH9A 4N6MA 1M9GA 1IV7A 1CEWI 2W9QA 3LH4A 4ZM8A 1MOLA 1CYVA 3MWZA 1N5PA 4IT7A 1N9JA 3S67A 1DVDA 1ROAA 5A0OB 1NB5I 1KWIA 2KXGA 4N6NB 1CYUA 3GAXA 1FUWA 2W9PA 5LC7A 4N6UA 1FA3A 1EQKA 1G96A 3SVAA 5ELUA 1WNHA 4N6LA 3IMAB 2O9UX 1R4CA 3K9MC 1GD3A 3QRDA 3UL5A 4CCVA 4N6OB 4TX4A 1YVBI 3KSED 3L0RA
chains in the Genus database with same CATH superfamily
1X1UA 2J8XB 3D9RA 1W01A 2OCTA 5AYSC 3DM8A 3KZTA 3NV0B 5AEUB 2W03A 3FSDA 4K1UA 2HMLB 4R4KA 1UW1A 4HZBB 1RGAA 4HVNA 4LZIA 1BOXA 4EW5A 2IMJA 5M1AA 6GSPA 1FGOA 1UCIA 1JKGB 2HMJB 3EBYA 3EN1B 3LYGA 1QVG2 1EEJA 3WOEB 4MJDA 3EF8A 3V98A 3X3XA 1TTOA 1F8NA 3OW22 1VQQA 1VQK3 2GXFA 3RNTA 4HM6B 1IQYA 1HU9A 3CXC2 2H0HA 1LNHA 1RGKA 1TFKA 1US1A 1X1YA 2BIRA 2GEYA 3MG1A 2M7OA 4K90B 3MPHA 3U97A 4BU4A 1RNBA 1OUNA 4WYKB 4BL3A 3A5EA 4N6TA 3VSYA 3AMOA 3OWUA 3LOYA 3G4S3 2ML6A 1ZX2A 3NQYA 5IG5A 1GMQA 1SQWA 1BAOA 1Q40B 4DKIA 5CK6A 4HOHA 1RN1A 2BO9B 2PNCA 1K9M4 2AADA 2GSPA 3NHXA 4J5GA 1STFI 1IQXA 5AIIA 3ZFZA 5I97A 2R4IA 3HIIA 4BTXA 3AHWA 2E2VA 4LMIA 3BU4A 2F98A 3FF0A 1RMSA 2W56A 3T0UA 2D1WA 1LNIA 2F99A 2Z76A 4WP5A 4J5KA 4G1MB 1W2B2 1UGHI 1YIJ3 1VQ53 2CC3A 2FGTA 1IV7A 2P38A 2XFSA 5CLKA 3DY5A 3URPA 1DMNA 2P09A 1KSIA 1WMNA 1DMMA 1G02A 3BIRA 4ILFA 5G2GA 1VQN3 1SIIA 1N8QA 1GS3A 1B3SA 5M19A 1NNVA 1K28A 4FMAA 1CYVA 3PCSA 2XSOB 3K7CA 3ZG5A 2QGUA 1X1WA 3KIIA 1FGQA 4IT7A 2IY2A 1N9JA 3EC9A 3MG2A 4R9KA 5BIRA 1ZGXA 1M1XB 3S67A 1WMPA 2CFWA 2MF7A 2Y74A 1I3FA 1RRLA 3FZWA 2K0MA 3RGAA 2GU3A 1BRHA 1CQSA 6STDA 1LRAA 3Q90A 1M904 2F56A 3GAXA 4NPBA 1JRQA 3N9HA 5AI1A 1LOWA 1JNQA 2OOVA 1BRNL 5CF2A 5IF6A 2Q07A 4O8SA 2CFLA 3MSOA 1G96A 1B2ZA 1O7WB 2JDIH 4U13A 4CDLA 3F7XA 1VQ93 3CMA3 3AHSA 1EA2A 1L5GB 3U1WA 3DGOA 3N8BA 5IW9A 1JBSA 1OCVA 2Y73A 8RNTA 1WNHA 4N6LA 1Q864 3S27A 1S723 3WA2X 4OUQA 3SX1A 2RNTA 2XH9A 1R4CA 3K9MC 4AEQA 3FKAA 1VQ73 2ZL8A 3G16A 3KCHA 1YHQ3 1IYYA 4J8TA 7STDA 1S5AA 2HOHA 3S28A 1BANA 1VQ83 2ML5A 1JBTA 1Q824 3KSED 1W6CA 4RNYA 4RZMA 1W00A 1YVSA 2BMQB 3ER7A 3Q2PA 2FXTA 2CFGA 3LTAA 4N6V0 4NREA 3EN8A 5KP3A 3G0KA 4KFEA 5ELJA 3NX0A 3DGNA 3LT9A 4Q53A 4BIRA 3I0YA 3OWSA 2MC8A 2R41A 1ISKA 2KF4A 2KF3A 4LEHA 1RN7A 3BB9A 1T2IA 3VF1A 1YI23 1J2BA 4AKYA 1RRHA 3LTBA 2OOVC 1O7MB 3OV4A 3MHEA 4O3VA 3JUQA 3CC43 2RBIA 1JKGA 1NB3I 3GWRA 5TGNA 1GY7A 2GU1A 2UGIA 2B1XB 3GZXB 3WDGB 5IEPA 1QAKA 1BSAA 1OHOA 3D4AA 3KE7A 3MG3A 3CPOA 1QAFA 3A76A 4KVHA 2SARA 3EJVA 2W2CA 1STDA 3FCSB 2OTJ3 1BRSA 1DVCA 2YFIB 2H0GA 2GEXA 2Z77A 1Q9EA 4WYKA 3F14A 3CME3 1E3VA 1GSPA 1YGEA 4XDWA 4EBGA 3SOAA 4WWUC 5AIGA 1A67A 1T5YA 2HMKB 3S5CA 4PEJA 4GHOA 1AVKA 1B27A 1G0TA 1Q40A 1ZO2A 1TRPA 1BNIA 3DGLA 3SEDA 1K41A 2KF5A 4OK0A 1LOXA 4CJNA 1UCJA 3SLUA 4OVMA 4ORLA 1IV9A 3FG3A 1BNGA 2F5MA 4N6MA 3ECFA 2WO0A 1WMOA 2CX0A 3N54B 4R1KA 1RGGA 1M9GA 3DH2A 4WHAA 1JN5B 1GOYA 1D6UA 1C54A 3NXJA 2QEX3 1UGIA 3HX8A 1E97A 2KAAA 4IPBA 3V92A 1HKXA 4LGQA 1SPUA 3LMLA 1CEWI 4HJLB 1B2UA 1Q814 4GB5A 1AV4A 1OGZA 3LH4A 1OH0A 1BIRA 3FGYA 3Q3FA 4HYZA 2BNGA 3LTCA 2CG0A 3MWZA 2HMMB 2HMOB 3OX9A 3G713 3EHCA 1IDPA 1RSNA 1V58A 3CCQ3 3DGMA 2CG1A 1IU7A 1DE3A 3D3LA 3I553 3KKGA 3NBRA 3ROBA 1OF5B 1NB5I 3HK4A 1BUQA 1I2GA 1Y4KA 3EB8A 1B21A 2F86B 4X2HA 1HZ1A 1JB4A 1FW7A 1JZOA 1PYLA 3M8CA 4N6NB 1CYUA 4KT3B 4FCJA 1Q7HA 1FYSA 1Q42A 3D5GA 4HAAA 4N6UA 1K8A4 1NO3A 3O8YA 3MYTA 1FGRA 3RDEA 1ZS7A 3G8ZA 1QALA 2CW9A 5KP1A 3MKIA 5AIHA 3V99A 1T2HA 3OXAA 3FG4A 1KC84 1O7NB 3F7SA 2XEPA 4RBNA 5HGRA 1W6GA 1T3BA 1TP6A 2A15A 4HM7B 7GSPA 1AR0A 1GY6A 1RGLA 1RJOA 2C4BA 3IMAB 1SARA 3SXXA 3HI7A 2O9UX 2HMNB 2INXA 3WOFB 4CCVA 3F8XA 1W6YA 1W7CA 2XGNA 1BNEA 3DXOA 4L8OA 3RGRA 1OGXA 4TX4A 3BLZA 4FMBA 1VQO3 1YVBI 2XR8B 4H61A 3NBJA 3WA3A 2JQ5A 2XGLA 4KZ1A 4I4KA 2C11A 1I2FA 3CCL3 1MNLA 3WR2A 1VQ43 1UI7A 3WMDA 2CFDA 1UUWB 2ZA4A 3D79A 4MEIA 1OHPA 1AY7A 3CCM3 1I0XA 3AGNA 3GZYB 4NHFA 3CCV3 3NM7A 2W0QA 5EQLA 5JBSA 3GZBA 3CCE3 5IG0A 1RGCA 5FGOA 1MWSA 2CX1A 1BSEA 1EUIC 1FUSA 2C10A 1TIJA 1GOVA 3PGBA 3FG1A 3GZRA 1BRJA 3NQZA 2YFJB 4K1VA 2KRTA 1ULIB 1PU4A 3KSPA 3LTDA 4XBYA 1LQGC 1BGSA 2I9WA 1LOYA 2XF3A 3PYJA 3PZWA 3NBBA 3CNXA 3X3ZA 3J7Yd 1IQ8A 4EXRA 1RNTA 1I70A 2KF6A 1BNRA 1OHSA 1PFPA 3EQQB 2OTL3 2W04A 3UL6A 3F40A 3HIGA 5BU4A 3JVCA 2RGQA 5BXQA 4JRFA 4EYCA 5IG4A 3HZPA 2CWUA 3B8LA 2GBXB 3QK9A 1YJW3 3NV0A 3CU3A 4J9AA 1BSBA 2UX0A 3FH1A 5DREA 5G1LA 4FMDA 1IT7A 1NJI4 1BVIA 5GSPA 4BTYA 2WGOA 2BT3A 3DGYA 1N5HA 3PS8A 2IA7A 2E2TA 2Z6BA 1RCKA 1W4NA 3EBTA 1DETA 1LVNA 1EKMA 5AEWB 5IEOA 1IVWA 5EVHA 1SJWA 1UUVB 2XSHB 4QWTA 1VZZA 5FW5A 3DUKA 3G6E3 1TJDA 3BNDA 4FMCA 2W9QA 1JN5A 3WODG 1OPYA 2WGQA 1DMQA 1MOLA 1O7PB 1ULJB 4IIAA 1NDOB 5STDA 1N5PA 3BNCA 5DRVA 3CPW2 5G1KA 1RGFA 3CNMA 1IVXA 1RGEA 1BNFA 4MMYB 1N8R4 1I0VA 4STDA 1FGMA 1RHLA 3UB1A 1QMAA 1RN4A 1ROVA 4EC6A 1TU5A 3UJMA 1Z1SA 1W5ZA 5CF1A 1BUJA 4HBRA 4RNTA 1M1K4 2IYJA 2KXGA 2RFRA 1SIHA 3B7CA 3UNLA 1V74A 1I8VA 2L4VA 4H3UA 1PY3A 1OF5A 3KN4A 1FUWA 3T8NA 1LOVA 1FUTA 5LC7A 1JZDA 3E99A 3EE1A 4LSOA 3I563 1N9EA 4XB5A 2QIYA 3F9SA 1IVVA 1BNJA 3Q1CA 2BMOB 1EQKA 1LQMB 7RNTA 3X3YA 1AVLA 2FNQA 1Q7Y4 2YX9A 1BSDA 3SVAA 2QA43 1E3RA 3B4PA 5AYRB 1BRGA 5ELUA 2V1LA 5D82A 1JB2A 3ALAA 3H3HA 3T8UA 4MMZB 3DZLA 2CWVA 2ZHXB 4K61A 2RCDA 3CCR3 4MMXB 3EX9A 1GD3A 3JUNA 3QRDA 2Z7AA 4N6OB 1K734 2CWTA 4JF8A 1GYBA 1GMRA 5KP4A 1YJ93 4O2HA 3FLJA 4HZ9B 1IK3A 2BHMA 5D83A 1KQS2 4BL2A 1MWTA 3BNBA 3HOHA 3K0ZA 3L0RA 2F4YA 2K3DA 4GSPA 2F5WA 3JUMA 5HOHA 1YIT3 3VGNA 3CC23 4N3VA 2STDA 4HM3B 1UDII 5D81A 3PXMA 3BNEA 1MGRA 1NWWA 1BRKA 1QJGA 1UUGB 2BMRB 3JUOA 2OQEA 1BU4A 1CH0A 2UUGC 1VQM3 3D5IA 3CC73 1QVF2 3JUPA 1ASKA 2B24B 1JBRA 4O02B 5LC6A 1YJN3 1LXEA 3SOYA 1GD4A 1JB5A 3KFQC 1DYUA 3AMOB 1U5OA 1D6ZA 4HM8B 3X41A 3ZG0A 1GY5A 1GMPA 1MGWA 4EV2A 5JPPA 2D42A 5IERA 1TUHA 2CHCA 3SYUA 2XRXB 1TFOA 4AKZA 4RNZA 1V57A 1AQZA 2CIUA 1U8CB 2GBWB 4FR9A 1I2EA 2W56B 1KD14 4HM4B 1B20A 1YGWA 4I5QA 1W2ZA 5AIFA 1FZUA 3STDA 2IUKA 1HYFA 1B2MA 4XBTA 1A90A 2BU4A 4HM5B 4X2OA 3K5TA 3OWYA 2IUJA 3X40A 4XM4A 2CH9A 1R4YA 2WOFA 3F8HA 4L8PA 6RNTA 1RCLA 2O3OA 1RLSA 1VQP3 3B4OA 5CXOA 4HKVB 1OACA 8CHOA 4R80A 2LYXA 1VQ63 3CCS3 1W02A 1RDSA 4GL6A 5IG3A 2KCDA 1VQL3 2OQEC 4ZM8A 3TDGA 1JV2B 1UI8A 2ZDJA 3GRDA 3X42A 4L7KA 3AGOA 3LZAA 3DMCA 5JPUA 4HM1B 3IJEB 5RNTA 5IENA 1MWRA 3WHOA 4EV5A 1DVDA 1ROAA 1RTUA 1UCLA 2CK3H 4HM2B 3LT8A 2CFKA 4XDVA 5A0OB 4LYLB 1KWIA 1IT8A 4KFFA 1IVUA 5BVBA 1RGHA 1JJ22 1A2PA 5EEOA 1EG9B 3CCJ3 1GOUA 2W9PA 3FF2A 4HM0B 1WTHA 2E2UA 1YNVX 2P0XA 3NM2A 1FA3A 1WQLB 3H51A 1BNSA 2W6JH 2CKFB 4R9LA 2PZVA 1MWUA 3K63A 2YFLB 1A2VA 3CCU3 4FCZA 2OWPA 3LXUX 2SBLA 1BRIA 4XBXA 2WOHA 3CD63 1C7HA 1FGTA 1A2KA 2L1SA 2LQVA 3NUVA 1O7HB 1TRQA 2K54A 4FCMA 3S29A 3UL5A 3PCRA 1D6YA 5M18A 4WFOA 2XFTA 3GSPA 2AAEA 1NU3A 2RSXA 9RNTA 1X1XA 3IPTA 4BTWA 1UCKA 2H0IA 2P0MA 1B2XA 1B2SA 4KFDA 4CPKA 1RKYA 1O7GB 1BSCA 1I3IA 2P05A
chains in the Genus database with same CATH topology
3D9RA 1W01A 2OCTA 5AYSC 3DM8A 3KZTA 3NV0B 2W03A 3FSDA 4K1UA 2HMLB 4R4KA 1UW1A 4HZBB 4HVNA 4LZIA 2IMJA 1FGOA 1JKGB 2HMJB 3EBYA 3EN1B 3LYGA 1QVG2 3WOEB 4MJDA 3EF8A 3V98A 3X3XA 1VQK3 1F8NA 3OW22 2GXFA 4HM6B 1IQYA 1HU9A 3CXC2 1LNHA 1TFKA 1US1A 2GEYA 3MG1A 4K90B 2M7OA 3U97A 3MPHA 1OUNA 4WYKB 4N6TA 3VSYA 3AMOA 3OWUA 3LOYA 3G4S3 2ML6A 1ZX2A 3NQYA 5IG5A 1SQWA 1Q40B 5CK6A 2BO9B 2PNCA 1K9M4 3NHXA 1STFI 1IQXA 5AIIA 5I97A 2R4IA 3HIIA 4BTXA 2E2VA 4LMIA 3FF0A 2F98A 2W56A 3T0UA 2D1WA 2F99A 2Z76A 4WP5A 4G1MB 1W2B2 1YIJ3 1VQ53 2CC3A 2FGTA 1IV7A 2P38A 2XFSA 5CLKA 3DY5A 1DMNA 2P09A 1KSIA 1WMNA 1DMMA 5G2GA 1VQN3 1SIIA 1N8QA 1GS3A 1K28A 4FMAA 1CYVA 3PCSA 2XSOB 3K7CA 5IG3A 2QGUA 3KIIA 4R9KA 1FGQA 4IT7A 1N9JA 3EC9A 3MG2A 3S67A 1M1XB 1WMPA 2CFWA 2MF7A 2Y74A 1RRLA 3FZWA 2K0MA 3RGAA 2GU3A 1CQSA 6STDA 3Q90A 1M904 3GAXA 1JRQA 3N9HA 5AI1A 1JNQA 2OOVA 5CF2A 5IF6A 2Q07A 4O8SA 2CFLA 3MSOA 1G96A 1O7WB 2JDIH 4U13A 4CDLA 1VQ93 3F7XA 3CMA3 1EA2A 1L5GB 3U1WA 3DGOA 3N8BA 5IW9A 1OCVA 2Y73A 1WNHA 4N6LA 1Q864 3S27A 1S723 3WA2X 4OUQA 3SX1A 2XH9A 1R4CA 3K9MC 4AEQA 3FKAA 1VQ73 2ZL8A 3G16A 1YHQ3 4J8TA 7STDA 1S5AA 3S28A 1VQ83 2ML5A 1Q824 3KSED 1W6CA 4RNYA 4RZMA 1W00A 2BMQB 3ER7A 3Q2PA 2FXTA 2CFGA 3LTAA 4N6V0 4NREA 3EN8A 5KP3A 3G0KA 4KFEA 5ELJA 3NX0A 3DGNA 3LT9A 4Q53A 3I0YA 3OWSA 2MC8A 1ISKA 4LEHA 1RN7A 3BB9A 3VF1A 1YI23 4AKYA 1RRHA 3LTBA 2OOVC 1O7MB 3OV4A 3MHEA 4O3VA 3JUQA 3CC43 1JKGA 1NB3I 3GWRA 5TGNA 1GY7A 2GU1A 3GZXB 2B1XB 3WDGB 5IEPA 1QAKA 1OHOA 3KE7A 3MG3A 3CPOA 1QAFA 3A76A 4KVHA 3EJVA 2W2CA 1STDA 3FCSB 2OTJ3 1DVCA 2YFIB 2GEXA 2Z77A 4WYKA 3CME3 3F14A 1E3VA 1YGEA 4XDWA 4EBGA 3SOAA 4WWUC 5AIGA 1A67A 1T5YA 2HMKB 3S5CA 4PEJA 5AEUB 1AVKA 1Q40A 1ZO2A 3DGLA 3SEDA 1K41A 4OK0A 1LOXA 3SLUA 4OVMA 4ORLA 1IV9A 3FG3A 4N6MA 3ECFA 2WO0A 1WMOA 3N54B 4R1KA 1J2BA 1M9GA 4WHAA 1JN5B 1D6UA 3NXJA 2QEX3 3HX8A 1E97A 4IPBA 3V92A 1HKXA 4LGQA 1SPUA 3LMLA 1CEWI 4HJLB 1Q814 4GB5A 1AV4A 1OGZA 3LH4A 1OH0A 3FGYA 4HYZA 2BNGA 3LTCA 2CG0A 3MWZA 2HMMB 2HMOB 3OX9A 3G713 3EHCA 1IDPA 3CCQ3 3DGMA 2CG1A 1IU7A 3D3LA 3I553 3KKGA 3NBRA 3ROBA 1OF5B 1NB5I 3HK4A 1BUQA 1Y4KA 3EB8A 2F86B 4X2HA 1JB4A 3M8CA 4N6NB 1CYUA 4FCJA 1Q42A 4N6UA 1K8A4 1NO3A 3O8YA 3MYTA 1FGRA 3RDEA 3G8ZA 1QALA 2CW9A 5KP1A 3MKIA 5AIHA 3V99A 3OXAA 3FG4A 1KC84 1O7NB 3F7SA 2XEPA 4RBNA 5HGRA 1W6GA 2A15A 1TP6A 4HM7B 1AR0A 1GY6A 1RJOA 3IMAB 3SXXA 3HI7A 2O9UX 2HMNB 2INXA 3WOFB 4CCVA 3F8XA 1W6YA 1W7CA 2XGNA 3DXOA 4L8OA 3RGRA 1OGXA 4TX4A 3BLZA 4FMBA 1VQO3 1YVBI 2XR8B 4H61A 3NBJA 3WA3A 2JQ5A 2XGLA 4KZ1A 4I4KA 2C11A 3CCL3 1MNLA 1VQ43 1UI7A 3WMDA 2CFDA 1UUWB 4MEIA 1OHPA 3CCM3 3GZYB 4NHFA 3CCV3 3NM7A 2W0QA 5EQLA 5JBSA 3GZBA 3CCE3 5IG0A 5FGOA 2C10A 1TIJA 3PGBA 3FG1A 3GZRA 3NQZA 2YFJB 4K1VA 2KRTA 1ULIB 1PU4A 3KSPA 3LTDA 4XBYA 2I9WA 3PYJA 2XF3A 3PZWA 3NBBA 3CNXA 3X3ZA 3J7Yd 1IQ8A 4EXRA 1OHSA 1PFPA 3EQQB 2OTL3 2W04A 3UL6A 3F40A 3HIGA 3JVCA 2RGQA 5BXQA 4JRFA 4EYCA 5IG4A 3HZPA 2CWUA 3B8LA 2GBXB 3QK9A 1YJW3 3NV0A 3CU3A 4J9AA 2UX0A 3FH1A 5DREA 1NJI4 4FMDA 1IT7A 4BTYA 2WGOA 2BT3A 1N5HA 3PS8A 2IA7A 2E2TA 2Z6BA 1W4NA 3EBTA 1LVNA 1EKMA 5AEWB 5IEOA 1IVWA 5EVHA 1SJWA 1UUVB 2XSHB 4QWTA 1VZZA 5FW5A 3DUKA 3G6E3 3BNDA 4FMCA 2W9QA 1JN5A 3WODG 1OPYA 2WGQA 1DMQA 1MOLA 1O7PB 1ULJB 4IIAA 1NDOB 5STDA 1N5PA 3BNCA 5DRVA 3CPW2 3CNMA 1IVXA 4MMYB 1N8R4 4STDA 1FGMA 3UB1A 1QMAA 4EC6A 1ROVA 1TU5A 3UJMA 1Z1SA 1W5ZA 5CF1A 4HBRA 1M1K4 2KXGA 2RFRA 1SIHA 3B7CA 3UNLA 1V74A 2L4VA 4H3UA 1OF5A 3KN4A 1FUWA 3T8NA 5LC7A 3EE1A 3E99A 4LSOA 3I563 1N9EA 4XB5A 2QIYA 3F9SA 1IVVA 3Q1CA 2BMOB 1EQKA 3X3YA 1AVLA 2FNQA 1Q7Y4 2YX9A 3SVAA 2QA43 1E3RA 3B4PA 5AYRB 5ELUA 2V1LA 5D82A 1JB2A 3ALAA 3H3HA 3T8UA 4MMZB 3DZLA 2CWVA 4K61A 2RCDA 3CCR3 4MMXB 3EX9A 1GD3A 3JUNA 3QRDA 2Z7AA 4N6OB 1K734 2CWTA 4JF8A 1GYBA 5KP4A 1YJ93 4O2HA 3FLJA 4HZ9B 1IK3A 2BHMA 5D83A 1KQS2 3BNBA 3K0ZA 3L0RA 1YIT3 3JUMA 3VGNA 3CC23 4N3VA 2STDA 4HM3B 5D81A 3PXMA 3BNEA 1NWWA 1QJGA 2BMRB 3JUOA 2OQEA 1VQM3 3CC73 1QVF2 3JUPA 1ASKA 2B24B 4O02B 5LC6A 1YJN3 1LXEA 3SOYA 1GD4A 1JB5A 3KFQC 1DYUA 3AMOB 1U5OA 1D6ZA 4HM8B 3X41A 1GY5A 4EV2A 5JPPA 2D42A 5IERA 1TUHA 2CHCA 4AKZA 2XRXB 1TFOA 4RNZA 2CIUA 1U8CB 2GBWB 4FR9A 2W56B 1KD14 4HM4B 1W2ZA 5AIFA 3STDA 2IUKA 4XBTA 1A90A 4HM5B 4X2OA 3K5TA 3OWYA 2IUJA 3X40A 4XM4A 2CH9A 2WOFA 3F8HA 4L8PA 2O3OA 1VQP3 3B4OA 5CXOA 4HKVB 1OACA 8CHOA 4R80A 2LYXA 1VQ63 3CCS3 1W02A 4GL6A 2KCDA 1VQL3 2OQEC 4ZM8A 3TDGA 1JV2B 1UI8A 2ZDJA 3GRDA 3X42A 4L7KA 3LZAA 3DMCA 5JPUA 4HM1B 3IJEB 5IENA 1DVDA 4EV5A 1ROAA 2CK3H 4HM2B 3LT8A 2CFKA 4XDVA 5A0OB 1KWIA 1IT8A 4KFFA 1IVUA 5BVBA 1JJ22 5EEOA 1EG9B 3CCJ3 2W9PA 3FF2A 4HM0B 1WTHA 2E2UA 2P0XA 3NM2A 1FA3A 1WQLB 3H51A 2W6JH 2CKFB 4R9LA 2PZVA 3K63A 2YFLB 1A2VA 3CCU3 4FCZA 2OWPA 3LXUX 2SBLA 4XBXA 2WOHA 3CD63 1C7HA 1FGTA 1A2KA 2LQVA 3NUVA 1O7HB 2K54A 3S29A 4FCMA 3UL5A 3PCRA 1D6YA 4WFOA 2XFTA 2RSXA 1NU3A 3IPTA 4BTWA 2P0MA 4KFDA 1RKYA 1O7GB 2P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MNL A;  3Q2P A;  2OCT A;  4N6V 0;  5ELJ A;  3PXM A;  3NX0 A;  5EQL A;  4LZI A;  1RN7 A;  1TIJ A;  5LC6 A;  1LXE A;  1NB3 I;  1GD4 A;  3KFQ C;  3PYJ A;  4N6T A;  1PFP A;  1DVC A;  3UL6 A;  2BO9 B;  4EYC A;  1A67 A;  1STF I;  1IV9 A;  1A90 A;  1N5H A;  3PS8 A;  2CH9 A;  4N6M A;  1M9G A;  1IV7 A;  1CEW I;  2W9Q A;  3LH4 A;  4ZM8 A;  1MOL A;  1CYV A;  3MWZ A;  1N5P A;  4IT7 A;  1N9J A;  3S67 A;  1DVD A;  1ROA A;  5A0O B;  1NB5 I;  1KWI A;  2KXG A;  4N6N B;  1CYU A;  3GAX A;  1FUW A;  2W9P A;  5LC7 A;  4N6U A;  1FA3 A;  1EQK A;  1G96 A;  3SVA A;  5ELU A;  1WNH A;  4N6L A;  3IMA B;  2O9U X;  1R4C A;  3K9M C;  1GD3 A;  3QRD A;  3UL5 A;  4CCV A;  4N6O B;  4TX4 A;  1YVB I;  3KSE D;  3L0R A; 
#chains in the Genus database with same CATH topology
 1X1U A;  2J8X B;  3D9R A;  1W01 A;  2OCT A;  5AYS C;  3DM8 A;  3KZT A;  3NV0 B;  5AEU B;  2W03 A;  3FSD A;  4K1U A;  2HML B;  4R4K A;  1UW1 A;  4HZB B;  1RGA A;  4HVN A;  4LZI A;  1BOX A;  4EW5 A;  2IMJ A;  5M1A A;  6GSP A;  1FGO A;  1UCI A;  1JKG B;  2HMJ B;  3EBY A;  3EN1 B;  3LYG A;  1QVG 2;  1EEJ A;  3WOE B;  4MJD A;  3EF8 A;  3V98 A;  3X3X A;  1TTO A;  1F8N A;  3OW2 2;  1VQQ A;  1VQK 3;  2GXF A;  3RNT A;  4HM6 B;  1IQY A;  1HU9 A;  3CXC 2;  2H0H A;  1LNH A;  1RGK A;  1TFK A;  1US1 A;  1X1Y A;  2BIR A;  2GEY A;  3MG1 A;  2M7O A;  4K90 B;  3MPH A;  3U97 A;  4BU4 A;  1RNB A;  1OUN A;  4WYK B;  4BL3 A;  3A5E A;  4N6T A;  3VSY A;  3AMO A;  3OWU A;  3LOY A;  3G4S 3;  2ML6 A;  1ZX2 A;  3NQY A;  5IG5 A;  1GMQ A;  1SQW A;  1BAO A;  1Q40 B;  4DKI A;  5CK6 A;  4HOH A;  1RN1 A;  2BO9 B;  2PNC A;  1K9M 4;  2AAD A;  2GSP A;  3NHX A;  4J5G A;  1STF I;  1IQX A;  5AII A;  3ZFZ A;  5I97 A;  2R4I A;  3HII A;  4BTX A;  3AHW A;  2E2V A;  4LMI A;  3BU4 A;  2F98 A;  3FF0 A;  1RMS A;  2W56 A;  3T0U A;  2D1W A;  1LNI A;  2F99 A;  2Z76 A;  4WP5 A;  4J5K A;  4G1M B;  1W2B 2;  1UGH I;  1YIJ 3;  1VQ5 3;  2CC3 A;  2FGT A;  1IV7 A;  2P38 A;  2XFS A;  5CLK A;  3DY5 A;  3URP A;  1DMN A;  2P09 A;  1KSI A;  1WMN A;  1DMM A;  1G02 A;  3BIR A;  4ILF A;  5G2G A;  1VQN 3;  1SII A;  1N8Q A;  1GS3 A;  1B3S A;  5M19 A;  1NNV A;  1K28 A;  4FMA A;  1CYV A;  3PCS A;  2XSO B;  3K7C A;  3ZG5 A;  2QGU A;  1X1W A;  3KII A;  1FGQ A;  4IT7 A;  2IY2 A;  1N9J A;  3EC9 A;  3MG2 A;  4R9K A;  5BIR A;  1ZGX A;  1M1X B;  3S67 A;  1WMP A;  2CFW A;  2MF7 A;  2Y74 A;  1I3F A;  1RRL A;  3FZW A;  2K0M A;  3RGA A;  2GU3 A;  1BRH A;  1CQS A;  6STD A;  1LRA A;  3Q90 A;  1M90 4;  2F56 A;  3GAX A;  4NPB A;  1JRQ A;  3N9H A;  5AI1 A;  1LOW A;  1JNQ A;  2OOV A;  1BRN L;  5CF2 A;  5IF6 A;  2Q07 A;  4O8S A;  2CFL A;  3MSO A;  1G96 A;  1B2Z A;  1O7W B;  2JDI H;  4U13 A;  4CDL A;  3F7X A;  1VQ9 3;  3CMA 3;  3AHS A;  1EA2 A;  1L5G B;  3U1W A;  3DGO A;  3N8B A;  5IW9 A;  1JBS A;  1OCV A;  2Y73 A;  8RNT A;  1WNH A;  4N6L A;  1Q86 4;  3S27 A;  1S72 3;  3WA2 X;  4OUQ A;  3SX1 A;  2RNT A;  2XH9 A;  1R4C A;  3K9M C;  4AEQ A;  3FKA A;  1VQ7 3;  2ZL8 A;  3G16 A;  3KCH A;  1YHQ 3;  1IYY A;  4J8T A;  7STD A;  1S5A A;  2HOH A;  3S28 A;  1BAN A;  1VQ8 3;  2ML5 A;  1JBT A;  1Q82 4;  3KSE D;  1W6C A;  4RNY A;  4RZM A;  1W00 A;  1YVS A;  2BMQ B;  3ER7 A;  3Q2P A;  2FXT A;  2CFG A;  3LTA A;  4N6V 0;  4NRE A;  3EN8 A;  5KP3 A;  3G0K A;  4KFE A;  5ELJ A;  3NX0 A;  3DGN A;  3LT9 A;  4Q53 A;  4BIR A;  3I0Y A;  3OWS A;  2MC8 A;  2R41 A;  1ISK A;  2KF4 A;  2KF3 A;  4LEH A;  1RN7 A;  3BB9 A;  1T2I A;  3VF1 A;  1YI2 3;  1J2B A;  4AKY A;  1RRH A;  3LTB A;  2OOV C;  1O7M B;  3OV4 A;  3MHE A;  4O3V A;  3JUQ A;  3CC4 3;  2RBI A;  1JKG A;  1NB3 I;  3GWR A;  5TGN A;  1GY7 A;  2GU1 A;  2UGI A;  2B1X B;  3GZX B;  3WDG B;  5IEP A;  1QAK A;  1BSA A;  1OHO A;  3D4A A;  3KE7 A;  3MG3 A;  3CPO A;  1QAF A;  3A76 A;  4KVH A;  2SAR A;  3EJV A;  2W2C A;  1STD A;  3FCS B;  2OTJ 3;  1BRS A;  1DVC A;  2YFI B;  2H0G A;  2GEX A;  2Z77 A;  1Q9E A;  4WYK A;  3F14 A;  3CME 3;  1E3V A;  1GSP A;  1YGE A;  4XDW A;  4EBG A;  3SOA A;  4WWU C;  5AIG A;  1A67 A;  1T5Y A;  2HMK B;  3S5C A;  4PEJ A;  4GHO A;  1AVK A;  1B27 A;  1G0T A;  1Q40 A;  1ZO2 A;  1TRP A;  1BNI A;  3DGL A;  3SED A;  1K41 A;  2KF5 A;  4OK0 A;  1LOX A;  4CJN A;  1UCJ A;  3SLU A;  4OVM A;  4ORL A;  1IV9 A;  3FG3 A;  1BNG A;  2F5M A;  4N6M A;  3ECF A;  2WO0 A;  1WMO A;  2CX0 A;  3N54 B;  4R1K A;  1RGG A;  1M9G A;  3DH2 A;  4WHA A;  1JN5 B;  1GOY A;  1D6U A;  1C54 A;  3NXJ A;  2QEX 3;  1UGI A;  3HX8 A;  1E97 A;  2KAA A;  4IPB A;  3V92 A;  1HKX A;  4LGQ A;  1SPU A;  3LML A;  1CEW I;  4HJL B;  1B2U A;  1Q81 4;  4GB5 A;  1AV4 A;  1OGZ A;  3LH4 A;  1OH0 A;  1BIR A;  3FGY A;  3Q3F A;  4HYZ A;  2BNG A;  3LTC A;  2CG0 A;  3MWZ A;  2HMM B;  2HMO B;  3OX9 A;  3G71 3;  3EHC A;  1IDP A;  1RSN A;  1V58 A;  3CCQ 3;  3DGM A;  2CG1 A;  1IU7 A;  1DE3 A;  3D3L A;  3I55 3;  3KKG A;  3NBR A;  3ROB A;  1OF5 B;  1NB5 I;  3HK4 A;  1BUQ A;  1I2G A;  1Y4K A;  3EB8 A;  1B21 A;  2F86 B;  4X2H A;  1HZ1 A;  1JB4 A;  1FW7 A;  1JZO A;  1PYL A;  3M8C A;  4N6N B;  1CYU A;  4KT3 B;  4FCJ A;  1Q7H A;  1FYS A;  1Q42 A;  3D5G A;  4HAA A;  4N6U A;  1K8A 4;  1NO3 A;  3O8Y A;  3MYT A;  1FGR A;  3RDE A;  1ZS7 A;  3G8Z A;  1QAL A;  2CW9 A;  5KP1 A;  3MKI A;  5AIH A;  3V99 A;  1T2H A;  3OXA A;  3FG4 A;  1KC8 4;  1O7N B;  3F7S A;  2XEP A;  4RBN A;  5HGR A;  1W6G A;  1T3B A;  1TP6 A;  2A15 A;  4HM7 B;  7GSP A;  1AR0 A;  1GY6 A;  1RGL A;  1RJO A;  2C4B A;  3IMA B;  1SAR A;  3SXX A;  3HI7 A;  2O9U X;  2HMN B;  2INX A;  3WOF B;  4CCV A;  3F8X A;  1W6Y A;  1W7C A;  2XGN A;  1BNE A;  3DXO A;  4L8O A;  3RGR A;  1OGX A;  4TX4 A;  3BLZ A;  4FMB A;  1VQO 3;  1YVB I;  2XR8 B;  4H61 A;  3NBJ A;  3WA3 A;  2JQ5 A;  2XGL A;  4KZ1 A;  4I4K A;  2C11 A;  1I2F A;  3CCL 3;  1MNL A;  3WR2 A;  1VQ4 3;  1UI7 A;  3WMD A;  2CFD A;  1UUW B;  2ZA4 A;  3D79 A;  4MEI A;  1OHP A;  1AY7 A;  3CCM 3;  1I0X A;  3AGN A;  3GZY B;  4NHF A;  3CCV 3;  3NM7 A;  2W0Q A;  5EQL A;  5JBS A;  3GZB A;  3CCE 3;  5IG0 A;  1RGC A;  5FGO A;  1MWS A;  2CX1 A;  1BSE A;  1EUI C;  1FUS A;  2C10 A;  1TIJ A;  1GOV A;  3PGB A;  3FG1 A;  3GZR A;  1BRJ A;  3NQZ A;  2YFJ B;  4K1V A;  2KRT A;  1ULI B;  1PU4 A;  3KSP A;  3LTD A;  4XBY A;  1LQG C;  1BGS A;  2I9W A;  1LOY A;  2XF3 A;  3PYJ A;  3PZW A;  3NBB A;  3CNX A;  3X3Z A;  3J7Y d;  1IQ8 A;  4EXR A;  1RNT A;  1I70 A;  2KF6 A;  1BNR A;  1OHS A;  1PFP A;  3EQQ B;  2OTL 3;  2W04 A;  3UL6 A;  3F40 A;  3HIG A;  5BU4 A;  3JVC A;  2RGQ A;  5BXQ A;  4JRF A;  4EYC A;  5IG4 A;  3HZP A;  2CWU A;  3B8L A;  2GBX B;  3QK9 A;  1YJW 3;  3NV0 A;  3CU3 A;  4J9A A;  1BSB A;  2UX0 A;  3FH1 A;  5DRE A;  5G1L A;  4FMD A;  1IT7 A;  1NJI 4;  1BVI A;  5GSP A;  4BTY A;  2WGO A;  2BT3 A;  3DGY A;  1N5H A;  3PS8 A;  2IA7 A;  2E2T A;  2Z6B A;  1RCK A;  1W4N A;  3EBT A;  1DET A;  1LVN A;  1EKM A;  5AEW B;  5IEO A;  1IVW A;  5EVH A;  1SJW A;  1UUV B;  2XSH B;  4QWT A;  1VZZ A;  5FW5 A;  3DUK A;  3G6E 3;  1TJD A;  3BND A;  4FMC A;  2W9Q A;  1JN5 A;  3WOD G;  1OPY A;  2WGQ A;  1DMQ A;  1MOL A;  1O7P B;  1ULJ B;  4IIA A;  1NDO B;  5STD A;  1N5P A;  3BNC A;  5DRV A;  3CPW 2;  5G1K A;  1RGF A;  3CNM A;  1IVX A;  1RGE A;  1BNF A;  4MMY B;  1N8R 4;  1I0V A;  4STD A;  1FGM A;  1RHL A;  3UB1 A;  1QMA A;  1RN4 A;  1ROV A;  4EC6 A;  1TU5 A;  3UJM A;  1Z1S A;  1W5Z A;  5CF1 A;  1BUJ A;  4HBR A;  4RNT A;  1M1K 4;  2IYJ A;  2KXG A;  2RFR A;  1SIH A;  3B7C A;  3UNL A;  1V74 A;  1I8V A;  2L4V A;  4H3U A;  1PY3 A;  1OF5 A;  3KN4 A;  1FUW A;  3T8N A;  1LOV A;  1FUT A;  5LC7 A;  1JZD A;  3E99 A;  3EE1 A;  4LSO A;  3I56 3;  1N9E A;  4XB5 A;  2QIY A;  3F9S A;  1IVV A;  1BNJ A;  3Q1C A;  2BMO B;  1EQK A;  1LQM B;  7RNT A;  3X3Y A;  1AVL A;  2FNQ A;  1Q7Y 4;  2YX9 A;  1BSD A;  3SVA A;  2QA4 3;  1E3R A;  3B4P A;  5AYR B;  1BRG A;  5ELU A;  2V1L A;  5D82 A;  1JB2 A;  3ALA A;  3H3H A;  3T8U A;  4MMZ B;  3DZL A;  2CWV A;  2ZHX B;  4K61 A;  2RCD A;  3CCR 3;  4MMX B;  3EX9 A;  1GD3 A;  3JUN A;  3QRD A;  2Z7A A;  4N6O B;  1K73 4;  2CWT A;  4JF8 A;  1GYB A;  1GMR A;  5KP4 A;  1YJ9 3;  4O2H A;  3FLJ A;  4HZ9 B;  1IK3 A;  2BHM A;  5D83 A;  1KQS 2;  4BL2 A;  1MWT A;  3BNB A;  3HOH A;  3K0Z A;  3L0R A;  2F4Y A;  2K3D A;  4GSP A;  2F5W A;  3JUM A;  5HOH A;  1YIT 3;  3VGN A;  3CC2 3;  4N3V A;  2STD A;  4HM3 B;  1UDI I;  5D81 A;  3PXM A;  3BNE A;  1MGR A;  1NWW A;  1BRK A;  1QJG A;  1UUG B;  2BMR B;  3JUO A;  2OQE A;  1BU4 A;  1CH0 A;  2UUG C;  1VQM 3;  3D5I A;  3CC7 3;  1QVF 2;  3JUP A;  1ASK A;  2B24 B;  1JBR A;  4O02 B;  5LC6 A;  1YJN 3;  1LXE A;  3SOY A;  1GD4 A;  1JB5 A;  3KFQ C;  1DYU A;  3AMO B;  1U5O A;  1D6Z A;  4HM8 B;  3X41 A;  3ZG0 A;  1GY5 A;  1GMP A;  1MGW A;  4EV2 A;  5JPP A;  2D42 A;  5IER A;  1TUH A;  2CHC A;  3SYU A;  2XRX B;  1TFO A;  4AKZ A;  4RNZ A;  1V57 A;  1AQZ A;  2CIU A;  1U8C B;  2GBW B;  4FR9 A;  1I2E A;  2W56 B;  1KD1 4;  4HM4 B;  1B20 A;  1YGW A;  4I5Q A;  1W2Z A;  5AIF A;  1FZU A;  3STD A;  2IUK A;  1HYF A;  1B2M A;  4XBT A;  1A90 A;  2BU4 A;  4HM5 B;  4X2O A;  3K5T A;  3OWY A;  2IUJ A;  3X40 A;  4XM4 A;  2CH9 A;  1R4Y A;  2WOF A;  3F8H A;  4L8P A;  6RNT A;  1RCL A;  2O3O A;  1RLS A;  1VQP 3;  3B4O A;  5CXO A;  4HKV B;  1OAC A;  8CHO A;  4R80 A;  2LYX A;  1VQ6 3;  3CCS 3;  1W02 A;  1RDS A;  4GL6 A;  5IG3 A;  2KCD A;  1VQL 3;  2OQE C;  4ZM8 A;  3TDG A;  1JV2 B;  1UI8 A;  2ZDJ A;  3GRD A;  3X42 A;  4L7K A;  3AGO A;  3LZA A;  3DMC A;  5JPU A;  4HM1 B;  3IJE B;  5RNT A;  5IEN A;  1MWR A;  3WHO A;  4EV5 A;  1DVD A;  1ROA A;  1RTU A;  1UCL A;  2CK3 H;  4HM2 B;  3LT8 A;  2CFK A;  4XDV A;  5A0O B;  4LYL B;  1KWI A;  1IT8 A;  4KFF A;  1IVU A;  5BVB A;  1RGH A;  1JJ2 2;  1A2P A;  5EEO A;  1EG9 B;  3CCJ 3;  1GOU A;  2W9P A;  3FF2 A;  4HM0 B;  1WTH A;  2E2U A;  1YNV X;  2P0X A;  3NM2 A;  1FA3 A;  1WQL B;  3H51 A;  1BNS A;  2W6J H;  2CKF B;  4R9L A;  2PZV A;  1MWU A;  3K63 A;  2YFL B;  1A2V A;  3CCU 3;  4FCZ A;  2OWP A;  3LXU X;  2SBL A;  1BRI A;  4XBX A;  2WOH A;  3CD6 3;  1C7H A;  1FGT A;  1A2K A;  2L1S A;  2LQV A;  3NUV A;  1O7H B;  1TRQ A;  2K54 A;  4FCM A;  3S29 A;  3UL5 A;  3PCR A;  1D6Y A;  5M18 A;  4WFO A;  2XFT A;  3GSP A;  2AAE A;  1NU3 A;  2RSX A;  9RNT A;  1X1X A;  3IPT A;  4BTW A;  1UCK A;  2H0I A;  2P0M A;  1B2X A;  1B2S A;  4KFD A;  4CPK A;  1RKY A;  1O7G B;  1BSC A;  1I3I A;  2P05 A; 
#chains in the Genus database with same CATH homology
 3D9R A;  1W01 A;  2OCT A;  5AYS C;  3DM8 A;  3KZT A;  3NV0 B;  2W03 A;  3FSD A;  4K1U A;  2HML B;  4R4K A;  1UW1 A;  4HZB B;  4HVN A;  4LZI A;  2IMJ A;  1FGO A;  1JKG B;  2HMJ B;  3EBY A;  3EN1 B;  3LYG A;  1QVG 2;  3WOE B;  4MJD A;  3EF8 A;  3V98 A;  3X3X A;  1VQK 3;  1F8N A;  3OW2 2;  2GXF A;  4HM6 B;  1IQY A;  1HU9 A;  3CXC 2;  1LNH A;  1TFK A;  1US1 A;  2GEY A;  3MG1 A;  4K90 B;  2M7O A;  3U97 A;  3MPH A;  1OUN A;  4WYK B;  4N6T A;  3VSY A;  3AMO A;  3OWU A;  3LOY A;  3G4S 3;  2ML6 A;  1ZX2 A;  3NQY A;  5IG5 A;  1SQW A;  1Q40 B;  5CK6 A;  2BO9 B;  2PNC A;  1K9M 4;  3NHX A;  1STF I;  1IQX A;  5AII A;  5I97 A;  2R4I A;  3HII A;  4BTX A;  2E2V A;  4LMI A;  3FF0 A;  2F98 A;  2W56 A;  3T0U A;  2D1W A;  2F99 A;  2Z76 A;  4WP5 A;  4G1M B;  1W2B 2;  1YIJ 3;  1VQ5 3;  2CC3 A;  2FGT A;  1IV7 A;  2P38 A;  2XFS A;  5CLK A;  3DY5 A;  1DMN A;  2P09 A;  1KSI A;  1WMN A;  1DMM A;  5G2G A;  1VQN 3;  1SII A;  1N8Q A;  1GS3 A;  1K28 A;  4FMA A;  1CYV A;  3PCS A;  2XSO B;  3K7C A;  5IG3 A;  2QGU A;  3KII A;  4R9K A;  1FGQ A;  4IT7 A;  1N9J A;  3EC9 A;  3MG2 A;  3S67 A;  1M1X B;  1WMP A;  2CFW A;  2MF7 A;  2Y74 A;  1RRL A;  3FZW A;  2K0M A;  3RGA A;  2GU3 A;  1CQS A;  6STD A;  3Q90 A;  1M90 4;  3GAX A;  1JRQ A;  3N9H A;  5AI1 A;  1JNQ A;  2OOV A;  5CF2 A;  5IF6 A;  2Q07 A;  4O8S A;  2CFL A;  3MSO A;  1G96 A;  1O7W B;  2JDI H;  4U13 A;  4CDL A;  1VQ9 3;  3F7X A;  3CMA 3;  1EA2 A;  1L5G B;  3U1W A;  3DGO A;  3N8B A;  5IW9 A;  1OCV A;  2Y73 A;  1WNH A;  4N6L A;  1Q86 4;  3S27 A;  1S72 3;  3WA2 X;  4OUQ A;  3SX1 A;  2XH9 A;  1R4C A;  3K9M C;  4AEQ A;  3FKA A;  1VQ7 3;  2ZL8 A;  3G16 A;  1YHQ 3;  4J8T A;  7STD A;  1S5A A;  3S28 A;  1VQ8 3;  2ML5 A;  1Q82 4;  3KSE D;  1W6C A;  4RNY A;  4RZM A;  1W00 A;  2BMQ B;  3ER7 A;  3Q2P A;  2FXT A;  2CFG A;  3LTA A;  4N6V 0;  4NRE A;  3EN8 A;  5KP3 A;  3G0K A;  4KFE A;  5ELJ A;  3NX0 A;  3DGN A;  3LT9 A;  4Q53 A;  3I0Y A;  3OWS A;  2MC8 A;  1ISK A;  4LEH A;  1RN7 A;  3BB9 A;  3VF1 A;  1YI2 3;  4AKY A;  1RRH A;  3LTB A;  2OOV C;  1O7M B;  3OV4 A;  3MHE A;  4O3V A;  3JUQ A;  3CC4 3;  1JKG A;  1NB3 I;  3GWR A;  5TGN A;  1GY7 A;  2GU1 A;  3GZX B;  2B1X B;  3WDG B;  5IEP A;  1QAK A;  1OHO A;  3KE7 A;  3MG3 A;  3CPO A;  1QAF A;  3A76 A;  4KVH A;  3EJV A;  2W2C A;  1STD A;  3FCS B;  2OTJ 3;  1DVC A;  2YFI B;  2GEX A;  2Z77 A;  4WYK A;  3CME 3;  3F14 A;  1E3V A;  1YGE A;  4XDW A;  4EBG A;  3SOA A;  4WWU C;  5AIG A;  1A67 A;  1T5Y A;  2HMK B;  3S5C A;  4PEJ A;  5AEU B;  1AVK A;  1Q40 A;  1ZO2 A;  3DGL A;  3SED A;  1K41 A;  4OK0 A;  1LOX A;  3SLU A;  4OVM A;  4ORL A;  1IV9 A;  3FG3 A;  4N6M A;  3ECF A;  2WO0 A;  1WMO A;  3N54 B;  4R1K A;  1J2B A;  1M9G A;  4WHA A;  1JN5 B;  1D6U A;  3NXJ A;  2QEX 3;  3HX8 A;  1E97 A;  4IPB A;  3V92 A;  1HKX A;  4LGQ A;  1SPU A;  3LML A;  1CEW I;  4HJL B;  1Q81 4;  4GB5 A;  1AV4 A;  1OGZ A;  3LH4 A;  1OH0 A;  3FGY A;  4HYZ A;  2BNG A;  3LTC A;  2CG0 A;  3MWZ A;  2HMM B;  2HMO B;  3OX9 A;  3G71 3;  3EHC A;  1IDP A;  3CCQ 3;  3DGM A;  2CG1 A;  1IU7 A;  3D3L A;  3I55 3;  3KKG A;  3NBR A;  3ROB A;  1OF5 B;  1NB5 I;  3HK4 A;  1BUQ A;  1Y4K A;  3EB8 A;  2F86 B;  4X2H A;  1JB4 A;  3M8C A;  4N6N B;  1CYU A;  4FCJ A;  1Q42 A;  4N6U A;  1K8A 4;  1NO3 A;  3O8Y A;  3MYT A;  1FGR A;  3RDE A;  3G8Z A;  1QAL A;  2CW9 A;  5KP1 A;  3MKI A;  5AIH A;  3V99 A;  3OXA A;  3FG4 A;  1KC8 4;  1O7N B;  3F7S A;  2XEP A;  4RBN A;  5HGR A;  1W6G A;  2A15 A;  1TP6 A;  4HM7 B;  1AR0 A;  1GY6 A;  1RJO A;  3IMA B;  3SXX A;  3HI7 A;  2O9U X;  2HMN B;  2INX A;  3WOF B;  4CCV A;  3F8X A;  1W6Y A;  1W7C A;  2XGN A;  3DXO A;  4L8O A;  3RGR A;  1OGX A;  4TX4 A;  3BLZ A;  4FMB A;  1VQO 3;  1YVB I;  2XR8 B;  4H61 A;  3NBJ A;  3WA3 A;  2JQ5 A;  2XGL A;  4KZ1 A;  4I4K A;  2C11 A;  3CCL 3;  1MNL A;  1VQ4 3;  1UI7 A;  3WMD A;  2CFD A;  1UUW B;  4MEI A;  1OHP A;  3CCM 3;  3GZY B;  4NHF A;  3CCV 3;  3NM7 A;  2W0Q A;  5EQL A;  5JBS A;  3GZB A;  3CCE 3;  5IG0 A;  5FGO A;  2C10 A;  1TIJ A;  3PGB A;  3FG1 A;  3GZR A;  3NQZ A;  2YFJ B;  4K1V A;  2KRT A;  1ULI B;  1PU4 A;  3KSP A;  3LTD A;  4XBY A;  2I9W A;  3PYJ A;  2XF3 A;  3PZW A;  3NBB A;  3CNX A;  3X3Z A;  3J7Y d;  1IQ8 A;  4EXR A;  1OHS A;  1PFP A;  3EQQ B;  2OTL 3;  2W04 A;  3UL6 A;  3F40 A;  3HIG A;  3JVC A;  2RGQ A;  5BXQ A;  4JRF A;  4EYC A;  5IG4 A;  3HZP A;  2CWU A;  3B8L A;  2GBX B;  3QK9 A;  1YJW 3;  3NV0 A;  3CU3 A;  4J9A A;  2UX0 A;  3FH1 A;  5DRE A;  1NJI 4;  4FMD A;  1IT7 A;  4BTY A;  2WGO A;  2BT3 A;  1N5H A;  3PS8 A;  2IA7 A;  2E2T A;  2Z6B A;  1W4N A;  3EBT A;  1LVN A;  1EKM A;  5AEW B;  5IEO A;  1IVW A;  5EVH A;  1SJW A;  1UUV B;  2XSH B;  4QWT A;  1VZZ A;  5FW5 A;  3DUK A;  3G6E 3;  3BND A;  4FMC A;  2W9Q A;  1JN5 A;  3WOD G;  1OPY A;  2WGQ A;  1DMQ A;  1MOL A;  1O7P B;  1ULJ B;  4IIA A;  1NDO B;  5STD A;  1N5P A;  3BNC A;  5DRV A;  3CPW 2;  3CNM A;  1IVX A;  4MMY B;  1N8R 4;  4STD A;  1FGM A;  3UB1 A;  1QMA A;  4EC6 A;  1ROV A;  1TU5 A;  3UJM A;  1Z1S A;  1W5Z A;  5CF1 A;  4HBR A;  1M1K 4;  2KXG A;  2RFR A;  1SIH A;  3B7C A;  3UNL A;  1V74 A;  2L4V A;  4H3U A;  1OF5 A;  3KN4 A;  1FUW A;  3T8N A;  5LC7 A;  3EE1 A;  3E99 A;  4LSO A;  3I56 3;  1N9E A;  4XB5 A;  2QIY A;  3F9S A;  1IVV A;  3Q1C A;  2BMO B;  1EQK A;  3X3Y A;  1AVL A;  2FNQ A;  1Q7Y 4;  2YX9 A;  3SVA A;  2QA4 3;  1E3R A;  3B4P A;  5AYR B;  5ELU A;  2V1L A;  5D82 A;  1JB2 A;  3ALA A;  3H3H A;  3T8U A;  4MMZ B;  3DZL A;  2CWV A;  4K61 A;  2RCD A;  3CCR 3;  4MMX B;  3EX9 A;  1GD3 A;  3JUN A;  3QRD A;  2Z7A A;  4N6O B;  1K73 4;  2CWT A;  4JF8 A;  1GYB A;  5KP4 A;  1YJ9 3;  4O2H A;  3FLJ A;  4HZ9 B;  1IK3 A;  2BHM A;  5D83 A;  1KQS 2;  3BNB A;  3K0Z A;  3L0R A;  1YIT 3;  3JUM A;  3VGN A;  3CC2 3;  4N3V A;  2STD A;  4HM3 B;  5D81 A;  3PXM A;  3BNE A;  1NWW A;  1QJG A;  2BMR B;  3JUO A;  2OQE A;  1VQM 3;  3CC7 3;  1QVF 2;  3JUP A;  1ASK A;  2B24 B;  4O02 B;  5LC6 A;  1YJN 3;  1LXE A;  3SOY A;  1GD4 A;  1JB5 A;  3KFQ C;  1DYU A;  3AMO B;  1U5O A;  1D6Z A;  4HM8 B;  3X41 A;  1GY5 A;  4EV2 A;  5JPP A;  2D42 A;  5IER A;  1TUH A;  2CHC A;  4AKZ A;  2XRX B;  1TFO A;  4RNZ A;  2CIU A;  1U8C B;  2GBW B;  4FR9 A;  2W56 B;  1KD1 4;  4HM4 B;  1W2Z A;  5AIF A;  3STD A;  2IUK A;  4XBT A;  1A90 A;  4HM5 B;  4X2O A;  3K5T A;  3OWY A;  2IUJ A;  3X40 A;  4XM4 A;  2CH9 A;  2WOF A;  3F8H A;  4L8P A;  2O3O A;  1VQP 3;  3B4O A;  5CXO A;  4HKV B;  1OAC A;  8CHO A;  4R80 A;  2LYX A;  1VQ6 3;  3CCS 3;  1W02 A;  4GL6 A;  2KCD A;  1VQL 3;  2OQE C;  4ZM8 A;  3TDG A;  1JV2 B;  1UI8 A;  2ZDJ A;  3GRD A;  3X42 A;  4L7K A;  3LZA A;  3DMC A;  5JPU A;  4HM1 B;  3IJE B;  5IEN A;  1DVD A;  4EV5 A;  1ROA A;  2CK3 H;  4HM2 B;  3LT8 A;  2CFK A;  4XDV A;  5A0O B;  1KWI A;  1IT8 A;  4KFF A;  1IVU A;  5BVB A;  1JJ2 2;  5EEO A;  1EG9 B;  3CCJ 3;  2W9P A;  3FF2 A;  4HM0 B;  1WTH A;  2E2U A;  2P0X A;  3NM2 A;  1FA3 A;  1WQL B;  3H51 A;  2W6J H;  2CKF B;  4R9L A;  2PZV A;  3K63 A;  2YFL B;  1A2V A;  3CCU 3;  4FCZ A;  2OWP A;  3LXU X;  2SBL A;  4XBX A;  2WOH A;  3CD6 3;  1C7H A;  1FGT A;  1A2K A;  2LQV A;  3NUV A;  1O7H B;  2K54 A;  3S29 A;  4FCM A;  3UL5 A;  3PCR A;  1D6Y A;  4WFO A;  2XFT A;  2RSX A;  1NU3 A;  3IPT A;  4BTW A;  2P0M A;  4KFD A;  1RKY A;  1O7G B;  2P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...