4ZM8A

Crystal structure of sialostatin l
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
111
structure length
109
Chain Sequence
FGGYSERHQANPEFLNLAHYATSTWSAQQPGKTHFDTVAEVVKVETQVVAGTNYRLTLKVAESTCELTSTYNKDTCLPKADAAHRTCTTVVFENLQGDKSVSPFECEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Putative secreted cystatin
publication title The crystal structures of two salivary cystatins from the tick Ixodes scapularis and the effect of these inhibitors on the establishment of Borrelia burgdorferi infection in a murine model.
pubmed doi rcsb
source organism Ixodes scapularis
total genus 13
structure length 109
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4zm8A00
1M9GA 3PYJA 3L0RA 1G96A 1ROAA 5EQLA 1GD3A 3SVAA 1STFI 1IV7A 3Q2PA 3QRDA 1PFPA 3KFQC 3PXMA 1LXEA 1N5PA 1FUWA 1A67A 4CCVA 3UL5A 5LC7A 4N6OB 1WNHA 5ELUA 4EYCA 1IV9A 1A90A 2OCTA 5ELJA 4N6TA 3NX0A 5A0OB 3MWZA 1YVBI 3IMAB 2BO9B 1N5HA 4N6V0 1R4CA 1NB3I 4LZIA 3KSED 1RN7A 4TX4A 1N9JA 3GAXA 4IT7A 4N6NB 1DVCA 1CEWI 3S67A 3LH4A 2KXGA 4N6LA 1EQKA 2CH9A 1CYUA 3K9MC 1CYVA 2W9PA 1DVDA 1NB5I 4N6MA 2O9UX 4ZM8A 1MOLA 1GD4A 5LC6A 2W9QA 3PS8A 1FA3A 1MNLA 1TIJA 1KWIA 4N6UA 3UL6A
chains in the Genus database with same CATH superfamily
1RTUA 1O7MB 1X1UA 1FUTA 3S28A 2QA43 1B21A 3NQYA 1O7GB 1I0VA 4K1VA 3CPOA 1JJ22 1BNEA 2M7OA 3OXAA 1JRQA 3IJEB 3UB1A 1NWWA 1UI7A 3KZTA 1BNJA 3AGOA 3H3HA 3NUVA 1JN5B 2YX9A 1JB2A 2K54A 2ZDJA 1IT8A 5TGNA 5IEOA 1ULJB 2ML6A 1QALA 3ZFZA 1PU4A 1FGRA 1EKMA 1W2ZA 1IDPA 3QK9A 1FUSA 2D42A 1SARA 4MMZB 1GMQA 3VGNA 1DMQA 1I3IA 1JV2B 3KFQC 1Q7Y4 1VQ83 3WDGB 3CCS3 4RNTA 1NU3A 2AADA 3DM8A 3CME3 6STDA 3MPHA 4R9KA 4JF8A 5IG3A 3EQQB 3B8LA 1M1K4 2RBIA 4MMXB 2V1LA 8CHOA 4R1KA 4WYKA 3Q90A 1M1XB 1B3SA 2CX1A 2XEPA 5CK6A 2OQEA 3JUQA 1UCLA 1OHOA 2IUKA 3WR2A 1FW7A 1BSCA 3B7CA 2W04A 2XRXB 4HOHA 5DRVA 4OUQA 3UJMA 1RGAA 3WODG 1ROVA 4EYCA 1BSAA 4WHAA 1HYFA 3DY5A 5IG0A 3BNCA 2KF5A 3RGRA 3ROBA 3WOFB 3WA2X 1W6CA 1JNQA 3U97A 1ISKA 3Q1CA 2QIYA 3DGYA 3RNTA 1N8R4 4OVMA 4XBXA 1OF5B 4RNYA 1TP6A 3MG3A 2YFLB 4GB5A 4MJDA 5ELJA 4N6TA 3RDEA 2XF3A 3NX0A 1IQYA 1W5ZA 3K5TA 5CLKA 5D81A 3X40A 5HOHA 1BSBA 2ML5A 2F86B 1W4NA 4FCMA 1RHLA 2L4VA 3DGMA 1W02A 3MKIA 1MWTA 3MSOA 1YJW3 1YVBI 1YJ93 4O2HA 1BANA 4XBYA 3G8ZA 1VQN3 1UUGB 2OOVC 3G0KA 3GWRA 4RBNA 5JPPA 3FF0A 2GEXA 1NB3I 3LTDA 2CWVA 4LZIA 3KSED 3SLUA 1OHSA 3CC23 1QVG2 4HVNA 1VQ63 3EF8A 1U5OA 1TU5A 3T8NA 1MGWA 2WOFA 4IT7A 4LYLB 1G02A 1WQLB 2HMLB 4LGQA 2OTJ3 1GSPA 1YNVX 2GSPA 3V92A 1C7HA 1FGTA 3LH4A 1YIJ3 2BT3A 2CW9A 1MGRA 4FMCA 1JBTA 2P38A 2K3DA 4R4KA 1EQKA 1VQM3 3EHCA 3EC9A 1RNTA 1V74A 1DE3A 1A2PA 1CYVA 2W9PA 4WYKB 3EB8A 4EBGA 2OTL3 3HK4A 1FGMA 2CK3H 1SQWA 3GZRA 3CXC2 1ZX2A 1CQSA 3S27A 5KP1A 1Q814 3FZWA 5IEPA 4I4KA 1YHQ3 5AIFA 2IA7A 2E2TA 5M1AA 1GD4A 4BTWA 1IQ8A 1B2XA 1RGCA 1ZO2A 5EVHA 3VSYA 3K7CA 4G1MB 3CCJ3 3ECFA 3FG1A 3NBJA 2W9QA 3FLJA 4FCZA 4H3UA 3B4PA 4KFFA 1I8VA 1FA3A 1KWIA 3I553 3G4S3 3LZAA 3A76A 1M9GA 2SARA 4LMIA 1X1WA 4LSOA 2XSOB 2CFWA 4CDLA 4KVHA 4BIRA 1T3BA 5I97A 1RGGA 3SEDA 3OW22 2E2VA 3LYGA 4BL2A 2PZVA 1ROAA 5EQLA 1GY7A 5BVBA 1N8QA 1MWUA 2HMNB 1HZ1A 1D6ZA 3MYTA 4XB5A 1IV7A 3PGBA 4X2OA 1LNIA 2ZL8A 1W2B2 3CMA3 3F8HA 3UNLA 3QRDA 3S5CA 1JBRA 5IW9A 2F4YA 2HOHA 3CCV3 1N5PA 1WMOA 2XSHB 4KFDA 5AIHA 3K0ZA 3RGAA 1MWSA 3DGNA 1GOYA 1BUJA 4X2HA 1YJN3 3D9RA 3FCSB 1PY3A 1QAKA 2CWUA 3CC73 2J8XB 4HM7B 1GYBA 3OWSA 1JKGA 1OPYA 2YFIB 1BRSA 4HAAA 4STDA 3UL5A 1FGOA 2CC3A 4HKVB 1WMNA 5LC7A 1AVLA 2GXFA 4N6OB 1I3FA 2ZHXB 3HZPA 3H51A 1IQXA 1UCJA 1DYUA 1Q9EA 1WNHA 2FXTA 3CC43 2P09A 1IV9A 3CCQ3 1UI8A 3LXUX 2XGNA 4CJNA 1IVUA 1BRKA 4HM4B 3D4AA 1SIHA 1K734 2GU1A 1ASKA 2WGOA 2I9WA 1K8A4 2KF6A 1L5GB 1TFKA 1YGWA 3PZWA 3AGNA 3J7Yd 5CF2A 4GSPA 3F14A 3CCM3 1IVXA 3NBRA 3LTCA 5BU4A 3BNDA 1AVKA 3CCU3 1IVVA 2KF3A 3F7SA 3F9SA 2FGTA 4ILFA 3GRDA 3JUMA 3IMAB 5FGOA 2K0MA 2BO9B 1N5HA 4KFEA 3DGLA 4QWTA 4FR9A 4XDWA 4DKIA 1I2FA 3D3LA 1GS3A 1RN7A 5GSPA 4TX4A 2BIRA 1ZS7A 2GBWB 1E3RA 3X3ZA 1RGLA 4BL3A 2R41A 3SOAA 2KAAA 4FMDA 2KXGA 1QMAA 1RJOA 5KP4A 5KP3A 1GMPA 1O7PB 1IVWA 3MG1A 4HBRA 4HM3B 2CH9A 1Y4KA 2UX0A 3K9MC 1CYUA 1DVDA 2KCDA 3AHSA 2P0MA 2MC8A 1LQGC 3BLZA 5AIIA 3D5GA 3KN4A 2INXA 1JKGB 3SOYA 1QVF2 1RN1A 1GOVA 2STDA 3NXJA 4N6MA 2O9UX 1VQO3 5M18A 4XDVA 1A2VA 2PNCA 2BMQB 3E99A 1Q40A 5LC6A 4J5GA 2QGUA 1KD14 1MNLA 4HM6B 1LOYA 4J8TA 4LEHA 1TIJA 4N6UA 4NHFA 1UUWB 5IG5A 1J2BA 2OOVA 1DMMA 3UL6A 5G1KA 1IYYA 1G0TA 1BVIA 1BNSA 4HM5B 1BRHA 2IMJA 4MEIA 2W2CA 3CCR3 3L0RA 9RNTA 1R4YA 1BIRA 3JVCA 1GD3A 3ER7A 1W00A 5G1LA 2HMMB 3X42A 5IF6A 1RKYA 1BRGA 3ZG5A 1UDII 3FGYA 1W7CA 2CX0A 1IT7A 1BRJA 5M19A 1Q824 3SXXA 2WGQA 1OGXA 3EJVA 1M904 2GU3A 1BGSA 2XFSA 4JRFA 2W03A 1YVSA 1PFPA 1RGFA 4HZ9B 4IIAA 5IG4A 2H0IA 1TRPA 1VZZA 2F5WA 3AMOA 2Z6BA 2P0XA 1I70A 1IU7A 4NREA 1BRIA 1E97A 4HYZA 1A67A 3EBTA 3NV0A 1UGHI 1I0XA 4L7KA 1JB4A 1Q42A 5IENA 1BUQA 2RFRA 1B2ZA 3LMLA 3JUOA 1HKXA 3B4OA 1N9EA 3V99A 5RNTA 1D6UA 1ULIB 4BU4A 5ELUA 2E2UA 4K90B 3DUKA 3G16A 5EEOA 3G6E3 1RGHA 3GSPA 1US1A 1RCKA 4OK0A 4U13A 1I2EA 1NJI4 1ZGXA 1LNHA 1RRLA 1VQ43 2D1WA 3CNXA 2W56A 1Q40B 3PCRA 2P05A 2FNQA 3DMCA 2OCTA 2A15A 1E3VA 2BU4A 3BU4A 3HIIA 2CG0A 1VQQA 1OUNA 3OV4A 5A0OB 3KCHA 6GSPA 3CCL3 4R80A 1VQL3 4RNZA 1GY5A 3MWZA 1KC84 2H0HA 3CD63 3G713 3URPA 3T8UA 7RNTA 2Y74A 1EG9B 1T5YA 4N3VA 1VQ53 2BHMA 1OH0A 3N54B 5BXQA 4N6V0 3F8XA 3Q3FA 1RGKA 4BTXA 2CFDA 4RZMA 3LT8A 3NBBA 3HOHA 2BNGA 4HM8B 1SJWA 1GY6A 2O3OA 3FF2A 1IK3A 1RRHA 2F99A 1RSNA 1HU9A 4HM2B 1DETA 1B2SA 1N9JA 1RLSA 3GAXA 4EC6A 1UUVB 2L1SA 3DGOA 1GOUA 3GZBA 4N6NB 1DVCA 7STDA 5D83A 3AMOB 1YGEA 1AY7A 1CEWI 2WOHA 4BTYA 5BIRA 3CCE3 2C11A 4N6LA 1TRQA 3X3YA 3M8CA 5STDA 2CWTA 1Q864 1KSIA 3CU3A 1BOXA 1C54A 3BNEA 3NV0B 1BNFA 3DH2A 2GEYA 2XH9A 3EE1A 3FH1A 1OHPA 3HX8A 5CXOA 3LOYA 1NNVA 2LYXA 2Z76A 4KZ1A 1GMRA 2YFJB 4AEQA 1Q7HA 2OQEC 5CF1A 4WP5A 1SPUA 3MHEA 1LQMB 1EA2A 1AV4A 3KSPA 3PS8A 1LOVA 1TJDA 2B1XB 2CFKA 1FYSA 3CNMA 1WMPA 3AHWA 1QAFA 3T0UA 1RCLA 2W56B 4ORLA 4I5QA 1K9M4 1AQZA 3KIIA 1RN4A 4HM0B 3PYJA 4AKYA 3SX1A 1FGQA 2R4IA 1G96A 1LOWA 2W6JH 3SVAA 4EV2A 1W01A 1K28A 1CH0A 3BIRA 1STFI 2CIUA 2Z77A 5IERA 4HJLB 1YI23 1K41A 3FG4A 2KF4A 4XBTA 4XM4A 4HM1B 1UW1A 3Q2PA 1QJGA 1UGIA 3NQZA 1MWRA 3N8BA 3X3XA 3GZYB 1BNRA 2OWPA 3EN1B 3PXMA 2C10A 5AEUB 3LT9A 2CKFB 1LXEA 1RDSA 2HMJB 2IY2A 1S723 1FUWA 2LQVA 3OWUA 2F98A 4NPBA 3NM7A 3D5IA 2IUJA 2CG1A 1LRAA 2C4BA 2Y73A 4FMBA 1B2UA 3BNBA 4EXRA 2RNTA 4CCVA 7GSPA 4WFOA 3OWYA 2UUGC 3KKGA 3WOEB 4Q53A 4GL6A 2JDIH 5HGRA 3EX9A 3JUNA 1LVNA 1YIT3 3U1WA 2W0QA 3FG3A 1EEJA 4GHOA 3WMDA 1SIIA 3EN8A 3WA3A 2H0GA 5AIGA 2KRTA 1DMNA 1A90A 8RNTA 1LOXA 4L8OA 4L8PA 3FKAA 3TDGA 2HMOB 5DREA 1W6YA 1F8NA 2BMRB 4R9LA 5JBSA 3A5EA 1T2IA 2XR8B 3LTBA 3IPTA 1D6YA 4KT3B 4CPKA 4EW5A 2CFGA 1RGEA 1U8CB 1BSDA 5AYRB 3F40A 4K61A 2RGQA 3PCSA 1O7HB 2IYJA 2XFTA 1JBSA 4J9AA 1NO3A 1UCIA 1VQK3 1FZUA 1I2GA 4FMAA 3DZLA 1JN5A 4O02B 3I0YA 3NHXA 1AR0A 1V57A 1Z1SA 3VF1A 2SBLA 2Z7AA 4K1UA 3KE7A 2QEX3 3HIGA 1OGZA 1BRNL 4O8SA 1B2MA 2WO0A 3JUPA 1R4CA 1X1XA 3D79A 2MF7A 1VQ93 4EV5A 3MG2A 1BNGA 1EUIC 2RCDA 1RNBA 2BMOB 3S29A 1VQP3 2F56A 4IPBA 1X1YA 3V98A 1UCKA 4J5KA 5D82A 3N9HA 4PEJA 5JPUA 2ZA4A 3ALAA 1PYLA 2XGLA 1TFOA 2UGIA 2RSXA 3BB9A 3NM2A 1BU4A 1OCVA 1OACA 2F5MA 3WHOA 4H61A 1BNIA 1TTOA 3S67A 1VQ73 4MMYB 1S5AA 1A2KA 5AI1A 3I563 5AYSC 1BSEA 1V58A 3F7XA 3SYUA 3ZG0A 1TUHA 1NDOB 1KQS2 2JQ5A 3O8YA 6RNTA 2Q07A 1NB5I 1O7WB 2CFLA 1BAOA 3STDA 1O7NB 2B24B 1B20A 4FCJA 1W6GA 2AAEA 3X41A 3GZXB 3LTAA 1RMSA 2GBXB 3EBYA 2HMKB 3K63A 5FW5A 4ZM8A 5AEWB 1JZDA 1MOLA 1STDA 3DXOA 3FSDA 3CPW2 1OF5A 4HZBB 2CHCA 1T2HA 3OX9A 4AKZA 4O3VA 4WWUC 1WTHA 5G2GA 3HI7A 1JZOA 1JB5A 1B27A
chains in the Genus database with same CATH topology
1O7MB 3S28A 2QA43 3NQYA 1O7GB 4K1VA 3CPOA 1JJ22 2M7OA 3OXAA 1JRQA 3IJEB 3UB1A 1NWWA 1UI7A 3KZTA 3NUVA 3H3HA 1JN5B 2YX9A 1JB2A 2K54A 2ZDJA 1IT8A 5TGNA 5IEOA 1ULJB 2ML6A 1QALA 1PU4A 1FGRA 1EKMA 1W2ZA 1IDPA 3QK9A 2D42A 4MMZB 3VGNA 1DMQA 1JV2B 3KFQC 1Q7Y4 1VQ83 3WDGB 3CCS3 1NU3A 3DM8A 3CME3 6STDA 3MPHA 4R9KA 4JF8A 5IG3A 3EQQB 3B8LA 1M1K4 4MMXB 2V1LA 8CHOA 4R1KA 4WYKA 3Q90A 1M1XB 2XEPA 5CK6A 2OQEA 3JUQA 1OHOA 2IUKA 3B7CA 2W04A 2XRXB 5DRVA 4OUQA 3UJMA 3WODG 1ROVA 4EYCA 4WHAA 3DY5A 5IG0A 3BNCA 3RGRA 3ROBA 3WOFB 3WA2X 1W6CA 1JNQA 3U97A 1ISKA 3Q1CA 2QIYA 1N8R4 4OVMA 4XBXA 1OF5B 4RNYA 1TP6A 3MG3A 2YFLB 4GB5A 4MJDA 5ELJA 4N6TA 3RDEA 2XF3A 3NX0A 1IQYA 1W5ZA 3K5TA 5CLKA 5D81A 3X40A 2ML5A 4FCMA 2F86B 1W4NA 2L4VA 3DGMA 1W02A 3MKIA 3MSOA 1YJW3 1YVBI 1YJ93 4O2HA 4XBYA 3G8ZA 1VQN3 3GWRA 2OOVC 3G0KA 4RBNA 5JPPA 3FF0A 2GEXA 1NB3I 3LTDA 2CWVA 4LZIA 3KSED 3SLUA 1OHSA 3CC23 1QVG2 4HVNA 1VQ63 3EF8A 1U5OA 1TU5A 3T8NA 4IT7A 2WOFA 1WQLB 4LGQA 2HMLB 2OTJ3 3V92A 1FGTA 1C7HA 3LH4A 1YIJ3 2BT3A 2CW9A 4FMCA 2P38A 4R4KA 1EQKA 1VQM3 3EHCA 3EC9A 1V74A 1CYVA 2W9PA 4WYKB 3EB8A 4EBGA 2OTL3 3HK4A 1FGMA 2CK3H 1SQWA 3GZRA 3CXC2 1ZX2A 1CQSA 3S27A 5KP1A 1Q814 3FZWA 5IEPA 4I4KA 1YHQ3 5AIFA 2IA7A 2E2TA 1GD4A 4BTWA 1IQ8A 5EVHA 3VSYA 1ZO2A 3K7CA 4G1MB 3CCJ3 3ECFA 3FG1A 3NBJA 2W9QA 3FLJA 4FCZA 4H3UA 3B4PA 4KFFA 1FA3A 1KWIA 3I553 3G4S3 3LZAA 3A76A 1M9GA 4LMIA 4LSOA 2XSOB 2CFWA 4CDLA 4KVHA 5I97A 3SEDA 3OW22 2E2VA 3LYGA 2PZVA 1ROAA 5EQLA 1GY7A 5BVBA 1N8QA 2HMNB 1D6ZA 3MYTA 4XB5A 1IV7A 3PGBA 4X2OA 2ZL8A 1W2B2 3CMA3 3F8HA 3UNLA 3QRDA 3S5CA 5IW9A 3CCV3 1N5PA 1WMOA 2XSHB 4KFDA 5AIHA 3K0ZA 3RGAA 3DGNA 4X2HA 1YJN3 3D9RA 3FCSB 1QAKA 2CWUA 3CC73 4HM7B 1GYBA 3OWSA 1JKGA 1OPYA 2YFIB 4STDA 3UL5A 3CCE3 1FGOA 2CC3A 4HKVB 1WMNA 5LC7A 1AVLA 2GXFA 4N6OB 3HZPA 3H51A 1IQXA 1WNHA 1DYUA 2FXTA 3CC43 2P09A 1IV9A 3CCQ3 1UI8A 3LXUX 2XGNA 1IVUA 4HM4B 1K734 1SIHA 2GU1A 1ASKA 2WGOA 2I9WA 1K8A4 1L5GB 1TFKA 3PZWA 3J7Yd 5CF2A 3CCM3 3F14A 1IVXA 3NBRA 3LTCA 3BNDA 1AVKA 3CCU3 1IVVA 3F7SA 3F9SA 2FGTA 3GRDA 3JUMA 3IMAB 5FGOA 2K0MA 2BO9B 1N5HA 4KFEA 3DGLA 4QWTA 4FR9A 4XDWA 3D3LA 1GS3A 1RN7A 4TX4A 2GBWB 1E3RA 3X3ZA 3SOAA 4FMDA 2KXGA 1QMAA 1RJOA 5KP4A 5KP3A 1O7PB 1IVWA 3MG1A 4HBRA 4HM3B 2CH9A 1Y4KA 2UX0A 3K9MC 1CYUA 1DVDA 2KCDA 2P0MA 2MC8A 3BLZA 5AIIA 3SOYA 3KN4A 2INXA 1JKGB 1QVF2 2STDA 3NXJA 4N6MA 2O9UX 1VQO3 4XDVA 1A2VA 2PNCA 2BMQB 3E99A 1Q40A 5LC6A 2QGUA 1KD14 1MNLA 4HM6B 4NHFA 4J8TA 4LEHA 1TIJA 4N6UA 5IG5A 1UUWB 1J2BA 2OOVA 1DMMA 3UL6A 3CCR3 4HM5B 2IMJA 4MEIA 2W2CA 3L0RA 3JVCA 1GD3A 3ER7A 1W00A 3X42A 2HMMB 5IF6A 1RKYA 3FGYA 1W7CA 1IT7A 1Q824 3SXXA 2WGQA 1OGXA 3EJVA 1M904 2GU3A 2XFSA 4JRFA 2W03A 1PFPA 4HZ9B 5IG4A 4IIAA 3AMOA 1VZZA 2Z6BA 2P0XA 1IU7A 4NREA 1E97A 4HYZA 1A67A 3EBTA 3NV0A 4L7KA 1JB4A 1Q42A 5IENA 1BUQA 2RFRA 3LMLA 3JUOA 1HKXA 3B4OA 1N9EA 3V99A 1D6UA 1ULIB 5ELUA 2E2UA 4K90B 3DUKA 3G16A 5EEOA 3G6E3 1US1A 4OK0A 4U13A 1NJI4 1VQ43 1LNHA 1RRLA 2D1WA 3CNXA 2W56A 1Q40B 3PCRA 2P05A 2FNQA 3DMCA 2OCTA 2A15A 1E3VA 3HIIA 2CG0A 1OUNA 3OV4A 5A0OB 3CCL3 4R80A 1VQL3 4RNZA 1GY5A 3MWZA 1KC84 3G713 3T8UA 2Y74A 1EG9B 1T5YA 4N3VA 1VQ53 2BHMA 1OH0A 3N54B 5BXQA 4N6V0 3F8XA 4BTXA 2CFDA 4RZMA 3LT8A 3NBBA 2BNGA 4HM8B 1SJWA 1GY6A 2O3OA 3FF2A 1IK3A 1RRHA 2F99A 1HU9A 4HM2B 1N9JA 4EC6A 3GAXA 1UUVB 3DGOA 3GZBA 4N6NB 7STDA 1DVCA 5D83A 3AMOB 1YGEA 2WOHA 1CEWI 4BTYA 2C11A 4N6LA 3X3YA 3M8CA 5STDA 2CWTA 1Q864 1KSIA 3CU3A 3BNEA 3NV0B 2GEYA 2XH9A 3EE1A 3FH1A 1OHPA 3HX8A 5CXOA 3LOYA 2LYXA 2Z76A 4KZ1A 2YFJB 4AEQA 2OQEC 5CF1A 4WP5A 1SPUA 3MHEA 1EA2A 1AV4A 3KSPA 3PS8A 2B1XB 2CFKA 3CNMA 1WMPA 1QAFA 3T0UA 2W56B 4ORLA 1K9M4 3KIIA 4HM0B 3PYJA 4AKYA 3SX1A 1FGQA 2R4IA 1G96A 2W6JH 3SVAA 4EV2A 1W01A 1K28A 1STFI 2CIUA 2Z77A 5IERA 4HJLB 1YI23 1K41A 3FG4A 4XBTA 4XM4A 4HM1B 1UW1A 3Q2PA 1QJGA 3NQZA 3N8BA 3X3XA 3GZYB 2OWPA 3EN1B 3PXMA 2C10A 5AEUB 3LT9A 2CKFB 1LXEA 2HMJB 1S723 1FUWA 2LQVA 3OWUA 2F98A 3NM7A 2IUJA 2CG1A 2Y73A 4FMBA 3BNBA 4EXRA 4CCVA 4WFOA 3OWYA 3KKGA 3WOEB 4Q53A 4GL6A 2JDIH 5HGRA 3EX9A 3JUNA 1LVNA 1YIT3 3U1WA 2W0QA 3FG3A 3WMDA 1SIIA 3EN8A 3WA3A 5AIGA 2KRTA 1DMNA 1A90A 1LOXA 4L8OA 4L8PA 3FKAA 3TDGA 2HMOB 5DREA 1W6YA 1F8NA 2BMRB 4R9LA 5JBSA 2XR8B 3LTBA 3IPTA 1D6YA 2CFGA 1U8CB 5AYRB 3F40A 4K61A 2RGQA 3PCSA 1O7HB 2XFTA 4J9AA 1NO3A 1VQK3 4FMAA 3DZLA 1JN5A 4O02B 3I0YA 3NHXA 1AR0A 1Z1SA 3VF1A 2SBLA 2Z7AA 4K1UA 3KE7A 2QEX3 3HIGA 1OGZA 4O8SA 1VQ93 2WO0A 3JUPA 1R4CA 2MF7A 4EV5A 3MG2A 2RCDA 2BMOB 3S29A 1VQP3 4IPBA 3V98A 5D82A 3N9HA 4PEJA 5JPUA 3ALAA 2XGLA 1TFOA 3NM2A 2RSXA 3BB9A 3CD63 1OCVA 1OACA 4H61A 3S67A 1VQ73 4MMYB 1S5AA 1A2KA 5AI1A 3I563 5AYSC 3F7XA 1TUHA 1NDOB 1KQS2 2JQ5A 3O8YA 2Q07A 1NB5I 1O7WB 2CFLA 3STDA 1O7NB 2B24B 4FCJA 3X41A 1W6GA 3GZXB 3LTAA 2GBXB 3EBYA 2HMKB 3K63A 5FW5A 4ZM8A 5AEWB 1MOLA 1STDA 3DXOA 3CPW2 3FSDA 1OF5A 4HZBB 2CHCA 3OX9A 4AKZA 4O3VA 4WWUC 1WTHA 5G2GA 3HI7A 1JB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9G A;  3PYJ A;  3L0R A;  1G96 A;  1ROA A;  5EQL A;  1GD3 A;  3SVA A;  1STF I;  1IV7 A;  3Q2P A;  3QRD A;  1PFP A;  3KFQ C;  3PXM A;  1LXE A;  1N5P A;  1FUW A;  1A67 A;  4CCV A;  3UL5 A;  5LC7 A;  4N6O B;  1WNH A;  5ELU A;  4EYC A;  1IV9 A;  1A90 A;  2OCT A;  5ELJ A;  4N6T A;  3NX0 A;  5A0O B;  3MWZ A;  1YVB I;  3IMA B;  2BO9 B;  1N5H A;  4N6V 0;  1R4C A;  1NB3 I;  4LZI A;  3KSE D;  1RN7 A;  4TX4 A;  1N9J A;  3GAX A;  4IT7 A;  4N6N B;  1DVC A;  1CEW I;  3S67 A;  3LH4 A;  2KXG A;  4N6L A;  1EQK A;  2CH9 A;  1CYU A;  3K9M C;  1CYV A;  2W9P A;  1DVD A;  1NB5 I;  4N6M A;  2O9U X;  4ZM8 A;  1MOL A;  1GD4 A;  5LC6 A;  2W9Q A;  3PS8 A;  1FA3 A;  1MNL A;  1TIJ A;  1KWI A;  4N6U A;  3UL6 A; 
#chains in the Genus database with same CATH topology
 1RTU A;  1O7M B;  1X1U A;  1FUT A;  3S28 A;  2QA4 3;  1B21 A;  3NQY A;  1O7G B;  1I0V A;  4K1V A;  3CPO A;  1JJ2 2;  1BNE A;  2M7O A;  3OXA A;  1JRQ A;  3IJE B;  3UB1 A;  1NWW A;  1UI7 A;  3KZT A;  1BNJ A;  3AGO A;  3H3H A;  3NUV A;  1JN5 B;  2YX9 A;  1JB2 A;  2K54 A;  2ZDJ A;  1IT8 A;  5TGN A;  5IEO A;  1ULJ B;  2ML6 A;  1QAL A;  3ZFZ A;  1PU4 A;  1FGR A;  1EKM A;  1W2Z A;  1IDP A;  3QK9 A;  1FUS A;  2D42 A;  1SAR A;  4MMZ B;  1GMQ A;  3VGN A;  1DMQ A;  1I3I A;  1JV2 B;  3KFQ C;  1Q7Y 4;  1VQ8 3;  3WDG B;  3CCS 3;  4RNT A;  1NU3 A;  2AAD A;  3DM8 A;  3CME 3;  6STD A;  3MPH A;  4R9K A;  4JF8 A;  5IG3 A;  3EQQ B;  3B8L A;  1M1K 4;  2RBI A;  4MMX B;  2V1L A;  8CHO A;  4R1K A;  4WYK A;  3Q90 A;  1M1X B;  1B3S A;  2CX1 A;  2XEP A;  5CK6 A;  2OQE A;  3JUQ A;  1UCL A;  1OHO A;  2IUK A;  3WR2 A;  1FW7 A;  1BSC A;  3B7C A;  2W04 A;  2XRX B;  4HOH A;  5DRV A;  4OUQ A;  3UJM A;  1RGA A;  3WOD G;  1ROV A;  4EYC A;  1BSA A;  4WHA A;  1HYF A;  3DY5 A;  5IG0 A;  3BNC A;  2KF5 A;  3RGR A;  3ROB A;  3WOF B;  3WA2 X;  1W6C A;  1JNQ A;  3U97 A;  1ISK A;  3Q1C A;  2QIY A;  3DGY A;  3RNT A;  1N8R 4;  4OVM A;  4XBX A;  1OF5 B;  4RNY A;  1TP6 A;  3MG3 A;  2YFL B;  4GB5 A;  4MJD A;  5ELJ A;  4N6T A;  3RDE A;  2XF3 A;  3NX0 A;  1IQY A;  1W5Z A;  3K5T A;  5CLK A;  5D81 A;  3X40 A;  5HOH A;  1BSB A;  2ML5 A;  2F86 B;  1W4N A;  4FCM A;  1RHL A;  2L4V A;  3DGM A;  1W02 A;  3MKI A;  1MWT A;  3MSO A;  1YJW 3;  1YVB I;  1YJ9 3;  4O2H A;  1BAN A;  4XBY A;  3G8Z A;  1VQN 3;  1UUG B;  2OOV C;  3G0K A;  3GWR A;  4RBN A;  5JPP A;  3FF0 A;  2GEX A;  1NB3 I;  3LTD A;  2CWV A;  4LZI A;  3KSE D;  3SLU A;  1OHS A;  3CC2 3;  1QVG 2;  4HVN A;  1VQ6 3;  3EF8 A;  1U5O A;  1TU5 A;  3T8N A;  1MGW A;  2WOF A;  4IT7 A;  4LYL B;  1G02 A;  1WQL B;  2HML B;  4LGQ A;  2OTJ 3;  1GSP A;  1YNV X;  2GSP A;  3V92 A;  1C7H A;  1FGT A;  3LH4 A;  1YIJ 3;  2BT3 A;  2CW9 A;  1MGR A;  4FMC A;  1JBT A;  2P38 A;  2K3D A;  4R4K A;  1EQK A;  1VQM 3;  3EHC A;  3EC9 A;  1RNT A;  1V74 A;  1DE3 A;  1A2P A;  1CYV A;  2W9P A;  4WYK B;  3EB8 A;  4EBG A;  2OTL 3;  3HK4 A;  1FGM A;  2CK3 H;  1SQW A;  3GZR A;  3CXC 2;  1ZX2 A;  1CQS A;  3S27 A;  5KP1 A;  1Q81 4;  3FZW A;  5IEP A;  4I4K A;  1YHQ 3;  5AIF A;  2IA7 A;  2E2T A;  5M1A A;  1GD4 A;  4BTW A;  1IQ8 A;  1B2X A;  1RGC A;  1ZO2 A;  5EVH A;  3VSY A;  3K7C A;  4G1M B;  3CCJ 3;  3ECF A;  3FG1 A;  3NBJ A;  2W9Q A;  3FLJ A;  4FCZ A;  4H3U A;  3B4P A;  4KFF A;  1I8V A;  1FA3 A;  1KWI A;  3I55 3;  3G4S 3;  3LZA A;  3A76 A;  1M9G A;  2SAR A;  4LMI A;  1X1W A;  4LSO A;  2XSO B;  2CFW A;  4CDL A;  4KVH A;  4BIR A;  1T3B A;  5I97 A;  1RGG A;  3SED A;  3OW2 2;  2E2V A;  3LYG A;  4BL2 A;  2PZV A;  1ROA A;  5EQL A;  1GY7 A;  5BVB A;  1N8Q A;  1MWU A;  2HMN B;  1HZ1 A;  1D6Z A;  3MYT A;  4XB5 A;  1IV7 A;  3PGB A;  4X2O A;  1LNI A;  2ZL8 A;  1W2B 2;  3CMA 3;  3F8H A;  3UNL A;  3QRD A;  3S5C A;  1JBR A;  5IW9 A;  2F4Y A;  2HOH A;  3CCV 3;  1N5P A;  1WMO A;  2XSH B;  4KFD A;  5AIH A;  3K0Z A;  3RGA A;  1MWS A;  3DGN A;  1GOY A;  1BUJ A;  4X2H A;  1YJN 3;  3D9R A;  3FCS B;  1PY3 A;  1QAK A;  2CWU A;  3CC7 3;  2J8X B;  4HM7 B;  1GYB A;  3OWS A;  1JKG A;  1OPY A;  2YFI B;  1BRS A;  4HAA A;  4STD A;  3UL5 A;  1FGO A;  2CC3 A;  4HKV B;  1WMN A;  5LC7 A;  1AVL A;  2GXF A;  4N6O B;  1I3F A;  2ZHX B;  3HZP A;  3H51 A;  1IQX A;  1UCJ A;  1DYU A;  1Q9E A;  1WNH A;  2FXT A;  3CC4 3;  2P09 A;  1IV9 A;  3CCQ 3;  1UI8 A;  3LXU X;  2XGN A;  4CJN A;  1IVU A;  1BRK A;  4HM4 B;  3D4A A;  1SIH A;  1K73 4;  2GU1 A;  1ASK A;  2WGO A;  2I9W A;  1K8A 4;  2KF6 A;  1L5G B;  1TFK A;  1YGW A;  3PZW A;  3AGN A;  3J7Y d;  5CF2 A;  4GSP A;  3F14 A;  3CCM 3;  1IVX A;  3NBR A;  3LTC A;  5BU4 A;  3BND A;  1AVK A;  3CCU 3;  1IVV A;  2KF3 A;  3F7S A;  3F9S A;  2FGT A;  4ILF A;  3GRD A;  3JUM A;  3IMA B;  5FGO A;  2K0M A;  2BO9 B;  1N5H A;  4KFE A;  3DGL A;  4QWT A;  4FR9 A;  4XDW A;  4DKI A;  1I2F A;  3D3L A;  1GS3 A;  1RN7 A;  5GSP A;  4TX4 A;  2BIR A;  1ZS7 A;  2GBW B;  1E3R A;  3X3Z A;  1RGL A;  4BL3 A;  2R41 A;  3SOA A;  2KAA A;  4FMD A;  2KXG A;  1QMA A;  1RJO A;  5KP4 A;  5KP3 A;  1GMP A;  1O7P B;  1IVW A;  3MG1 A;  4HBR A;  4HM3 B;  2CH9 A;  1Y4K A;  2UX0 A;  3K9M C;  1CYU A;  1DVD A;  2KCD A;  3AHS A;  2P0M A;  2MC8 A;  1LQG C;  3BLZ A;  5AII A;  3D5G A;  3KN4 A;  2INX A;  1JKG B;  3SOY A;  1QVF 2;  1RN1 A;  1GOV A;  2STD A;  3NXJ A;  4N6M A;  2O9U X;  1VQO 3;  5M18 A;  4XDV A;  1A2V A;  2PNC A;  2BMQ B;  3E99 A;  1Q40 A;  5LC6 A;  4J5G A;  2QGU A;  1KD1 4;  1MNL A;  4HM6 B;  1LOY A;  4J8T A;  4LEH A;  1TIJ A;  4N6U A;  4NHF A;  1UUW B;  5IG5 A;  1J2B A;  2OOV A;  1DMM A;  3UL6 A;  5G1K A;  1IYY A;  1G0T A;  1BVI A;  1BNS A;  4HM5 B;  1BRH A;  2IMJ A;  4MEI A;  2W2C A;  3CCR 3;  3L0R A;  9RNT A;  1R4Y A;  1BIR A;  3JVC A;  1GD3 A;  3ER7 A;  1W00 A;  5G1L A;  2HMM B;  3X42 A;  5IF6 A;  1RKY A;  1BRG A;  3ZG5 A;  1UDI I;  3FGY A;  1W7C A;  2CX0 A;  1IT7 A;  1BRJ A;  5M19 A;  1Q82 4;  3SXX A;  2WGQ A;  1OGX A;  3EJV A;  1M90 4;  2GU3 A;  1BGS A;  2XFS A;  4JRF A;  2W03 A;  1YVS A;  1PFP A;  1RGF A;  4HZ9 B;  4IIA A;  5IG4 A;  2H0I A;  1TRP A;  1VZZ A;  2F5W A;  3AMO A;  2Z6B A;  2P0X A;  1I70 A;  1IU7 A;  4NRE A;  1BRI A;  1E97 A;  4HYZ A;  1A67 A;  3EBT A;  3NV0 A;  1UGH I;  1I0X A;  4L7K A;  1JB4 A;  1Q42 A;  5IEN A;  1BUQ A;  2RFR A;  1B2Z A;  3LML A;  3JUO A;  1HKX A;  3B4O A;  1N9E A;  3V99 A;  5RNT A;  1D6U A;  1ULI B;  4BU4 A;  5ELU A;  2E2U A;  4K90 B;  3DUK A;  3G16 A;  5EEO A;  3G6E 3;  1RGH A;  3GSP A;  1US1 A;  1RCK A;  4OK0 A;  4U13 A;  1I2E A;  1NJI 4;  1ZGX A;  1LNH A;  1RRL A;  1VQ4 3;  2D1W A;  3CNX A;  2W56 A;  1Q40 B;  3PCR A;  2P05 A;  2FNQ A;  3DMC A;  2OCT A;  2A15 A;  1E3V A;  2BU4 A;  3BU4 A;  3HII A;  2CG0 A;  1VQQ A;  1OUN A;  3OV4 A;  5A0O B;  3KCH A;  6GSP A;  3CCL 3;  4R80 A;  1VQL 3;  4RNZ A;  1GY5 A;  3MWZ A;  1KC8 4;  2H0H A;  3CD6 3;  3G71 3;  3URP A;  3T8U A;  7RNT A;  2Y74 A;  1EG9 B;  1T5Y A;  4N3V A;  1VQ5 3;  2BHM A;  1OH0 A;  3N54 B;  5BXQ A;  4N6V 0;  3F8X A;  3Q3F A;  1RGK A;  4BTX A;  2CFD A;  4RZM A;  3LT8 A;  3NBB A;  3HOH A;  2BNG A;  4HM8 B;  1SJW A;  1GY6 A;  2O3O A;  3FF2 A;  1IK3 A;  1RRH A;  2F99 A;  1RSN A;  1HU9 A;  4HM2 B;  1DET A;  1B2S A;  1N9J A;  1RLS A;  3GAX A;  4EC6 A;  1UUV B;  2L1S A;  3DGO A;  1GOU A;  3GZB A;  4N6N B;  1DVC A;  7STD A;  5D83 A;  3AMO B;  1YGE A;  1AY7 A;  1CEW I;  2WOH A;  4BTY A;  5BIR A;  3CCE 3;  2C11 A;  4N6L A;  1TRQ A;  3X3Y A;  3M8C A;  5STD A;  2CWT A;  1Q86 4;  1KSI A;  3CU3 A;  1BOX A;  1C54 A;  3BNE A;  3NV0 B;  1BNF A;  3DH2 A;  2GEY A;  2XH9 A;  3EE1 A;  3FH1 A;  1OHP A;  3HX8 A;  5CXO A;  3LOY A;  1NNV A;  2LYX A;  2Z76 A;  4KZ1 A;  1GMR A;  2YFJ B;  4AEQ A;  1Q7H A;  2OQE C;  5CF1 A;  4WP5 A;  1SPU A;  3MHE A;  1LQM B;  1EA2 A;  1AV4 A;  3KSP A;  3PS8 A;  1LOV A;  1TJD A;  2B1X B;  2CFK A;  1FYS A;  3CNM A;  1WMP A;  3AHW A;  1QAF A;  3T0U A;  1RCL A;  2W56 B;  4ORL A;  4I5Q A;  1K9M 4;  1AQZ A;  3KII A;  1RN4 A;  4HM0 B;  3PYJ A;  4AKY A;  3SX1 A;  1FGQ A;  2R4I A;  1G96 A;  1LOW A;  2W6J H;  3SVA A;  4EV2 A;  1W01 A;  1K28 A;  1CH0 A;  3BIR A;  1STF I;  2CIU A;  2Z77 A;  5IER A;  4HJL B;  1YI2 3;  1K41 A;  3FG4 A;  2KF4 A;  4XBT A;  4XM4 A;  4HM1 B;  1UW1 A;  3Q2P A;  1QJG A;  1UGI A;  3NQZ A;  1MWR A;  3N8B A;  3X3X A;  3GZY B;  1BNR A;  2OWP A;  3EN1 B;  3PXM A;  2C10 A;  5AEU B;  3LT9 A;  2CKF B;  1LXE A;  1RDS A;  2HMJ B;  2IY2 A;  1S72 3;  1FUW A;  2LQV A;  3OWU A;  2F98 A;  4NPB A;  3NM7 A;  3D5I A;  2IUJ A;  2CG1 A;  1LRA A;  2C4B A;  2Y73 A;  4FMB A;  1B2U A;  3BNB A;  4EXR A;  2RNT A;  4CCV A;  7GSP A;  4WFO A;  3OWY A;  2UUG C;  3KKG A;  3WOE B;  4Q53 A;  4GL6 A;  2JDI H;  5HGR A;  3EX9 A;  3JUN A;  1LVN A;  1YIT 3;  3U1W A;  2W0Q A;  3FG3 A;  1EEJ A;  4GHO A;  3WMD A;  1SII A;  3EN8 A;  3WA3 A;  2H0G A;  5AIG A;  2KRT A;  1DMN A;  1A90 A;  8RNT A;  1LOX A;  4L8O A;  4L8P A;  3FKA A;  3TDG A;  2HMO B;  5DRE A;  1W6Y A;  1F8N A;  2BMR B;  4R9L A;  5JBS A;  3A5E A;  1T2I A;  2XR8 B;  3LTB A;  3IPT A;  1D6Y A;  4KT3 B;  4CPK A;  4EW5 A;  2CFG A;  1RGE A;  1U8C B;  1BSD A;  5AYR B;  3F40 A;  4K61 A;  2RGQ A;  3PCS A;  1O7H B;  2IYJ A;  2XFT A;  1JBS A;  4J9A A;  1NO3 A;  1UCI A;  1VQK 3;  1FZU A;  1I2G A;  4FMA A;  3DZL A;  1JN5 A;  4O02 B;  3I0Y A;  3NHX A;  1AR0 A;  1V57 A;  1Z1S A;  3VF1 A;  2SBL A;  2Z7A A;  4K1U A;  3KE7 A;  2QEX 3;  3HIG A;  1OGZ A;  1BRN L;  4O8S A;  1B2M A;  2WO0 A;  3JUP A;  1R4C A;  1X1X A;  3D79 A;  2MF7 A;  1VQ9 3;  4EV5 A;  3MG2 A;  1BNG A;  1EUI C;  2RCD A;  1RNB A;  2BMO B;  3S29 A;  1VQP 3;  2F56 A;  4IPB A;  1X1Y A;  3V98 A;  1UCK A;  4J5K A;  5D82 A;  3N9H A;  4PEJ A;  5JPU A;  2ZA4 A;  3ALA A;  1PYL A;  2XGL A;  1TFO A;  2UGI A;  2RSX A;  3BB9 A;  3NM2 A;  1BU4 A;  1OCV A;  1OAC A;  2F5M A;  3WHO A;  4H61 A;  1BNI A;  1TTO A;  3S67 A;  1VQ7 3;  4MMY B;  1S5A A;  1A2K A;  5AI1 A;  3I56 3;  5AYS C;  1BSE A;  1V58 A;  3F7X A;  3SYU A;  3ZG0 A;  1TUH A;  1NDO B;  1KQS 2;  2JQ5 A;  3O8Y A;  6RNT A;  2Q07 A;  1NB5 I;  1O7W B;  2CFL A;  1BAO A;  3STD A;  1O7N B;  2B24 B;  1B20 A;  4FCJ A;  1W6G A;  2AAE A;  3X41 A;  3GZX B;  3LTA A;  1RMS A;  2GBX B;  3EBY A;  2HMK B;  3K63 A;  5FW5 A;  4ZM8 A;  5AEW B;  1JZD A;  1MOL A;  1STD A;  3DXO A;  3FSD A;  3CPW 2;  1OF5 A;  4HZB B;  2CHC A;  1T2H A;  3OX9 A;  4AKZ A;  4O3V A;  4WWU C;  1WTH A;  5G2G A;  3HI7 A;  1JZO A;  1JB5 A;  1B27 A; 
#chains in the Genus database with same CATH homology
 1O7M B;  3S28 A;  2QA4 3;  3NQY A;  1O7G B;  4K1V A;  3CPO A;  1JJ2 2;  2M7O A;  3OXA A;  1JRQ A;  3IJE B;  3UB1 A;  1NWW A;  1UI7 A;  3KZT A;  3NUV A;  3H3H A;  1JN5 B;  2YX9 A;  1JB2 A;  2K54 A;  2ZDJ A;  1IT8 A;  5TGN A;  5IEO A;  1ULJ B;  2ML6 A;  1QAL A;  1PU4 A;  1FGR A;  1EKM A;  1W2Z A;  1IDP A;  3QK9 A;  2D42 A;  4MMZ B;  3VGN A;  1DMQ A;  1JV2 B;  3KFQ C;  1Q7Y 4;  1VQ8 3;  3WDG B;  3CCS 3;  1NU3 A;  3DM8 A;  3CME 3;  6STD A;  3MPH A;  4R9K A;  4JF8 A;  5IG3 A;  3EQQ B;  3B8L A;  1M1K 4;  4MMX B;  2V1L A;  8CHO A;  4R1K A;  4WYK A;  3Q90 A;  1M1X B;  2XEP A;  5CK6 A;  2OQE A;  3JUQ A;  1OHO A;  2IUK A;  3B7C A;  2W04 A;  2XRX B;  5DRV A;  4OUQ A;  3UJM A;  3WOD G;  1ROV A;  4EYC A;  4WHA A;  3DY5 A;  5IG0 A;  3BNC A;  3RGR A;  3ROB A;  3WOF B;  3WA2 X;  1W6C A;  1JNQ A;  3U97 A;  1ISK A;  3Q1C A;  2QIY A;  1N8R 4;  4OVM A;  4XBX A;  1OF5 B;  4RNY A;  1TP6 A;  3MG3 A;  2YFL B;  4GB5 A;  4MJD A;  5ELJ A;  4N6T A;  3RDE A;  2XF3 A;  3NX0 A;  1IQY A;  1W5Z A;  3K5T A;  5CLK A;  5D81 A;  3X40 A;  2ML5 A;  4FCM A;  2F86 B;  1W4N A;  2L4V A;  3DGM A;  1W02 A;  3MKI A;  3MSO A;  1YJW 3;  1YVB I;  1YJ9 3;  4O2H A;  4XBY A;  3G8Z A;  1VQN 3;  3GWR A;  2OOV C;  3G0K A;  4RBN A;  5JPP A;  3FF0 A;  2GEX A;  1NB3 I;  3LTD A;  2CWV A;  4LZI A;  3KSE D;  3SLU A;  1OHS A;  3CC2 3;  1QVG 2;  4HVN A;  1VQ6 3;  3EF8 A;  1U5O A;  1TU5 A;  3T8N A;  4IT7 A;  2WOF A;  1WQL B;  4LGQ A;  2HML B;  2OTJ 3;  3V92 A;  1FGT A;  1C7H A;  3LH4 A;  1YIJ 3;  2BT3 A;  2CW9 A;  4FMC A;  2P38 A;  4R4K A;  1EQK A;  1VQM 3;  3EHC A;  3EC9 A;  1V74 A;  1CYV A;  2W9P A;  4WYK B;  3EB8 A;  4EBG A;  2OTL 3;  3HK4 A;  1FGM A;  2CK3 H;  1SQW A;  3GZR A;  3CXC 2;  1ZX2 A;  1CQS A;  3S27 A;  5KP1 A;  1Q81 4;  3FZW A;  5IEP A;  4I4K A;  1YHQ 3;  5AIF A;  2IA7 A;  2E2T A;  1GD4 A;  4BTW A;  1IQ8 A;  5EVH A;  3VSY A;  1ZO2 A;  3K7C A;  4G1M B;  3CCJ 3;  3ECF A;  3FG1 A;  3NBJ A;  2W9Q A;  3FLJ A;  4FCZ A;  4H3U A;  3B4P A;  4KFF A;  1FA3 A;  1KWI A;  3I55 3;  3G4S 3;  3LZA A;  3A76 A;  1M9G A;  4LMI A;  4LSO A;  2XSO B;  2CFW A;  4CDL A;  4KVH A;  5I97 A;  3SED A;  3OW2 2;  2E2V A;  3LYG A;  2PZV A;  1ROA A;  5EQL A;  1GY7 A;  5BVB A;  1N8Q A;  2HMN B;  1D6Z A;  3MYT A;  4XB5 A;  1IV7 A;  3PGB A;  4X2O A;  2ZL8 A;  1W2B 2;  3CMA 3;  3F8H A;  3UNL A;  3QRD A;  3S5C A;  5IW9 A;  3CCV 3;  1N5P A;  1WMO A;  2XSH B;  4KFD A;  5AIH A;  3K0Z A;  3RGA A;  3DGN A;  4X2H A;  1YJN 3;  3D9R A;  3FCS B;  1QAK A;  2CWU A;  3CC7 3;  4HM7 B;  1GYB A;  3OWS A;  1JKG A;  1OPY A;  2YFI B;  4STD A;  3UL5 A;  3CCE 3;  1FGO A;  2CC3 A;  4HKV B;  1WMN A;  5LC7 A;  1AVL A;  2GXF A;  4N6O B;  3HZP A;  3H51 A;  1IQX A;  1WNH A;  1DYU A;  2FXT A;  3CC4 3;  2P09 A;  1IV9 A;  3CCQ 3;  1UI8 A;  3LXU X;  2XGN A;  1IVU A;  4HM4 B;  1K73 4;  1SIH A;  2GU1 A;  1ASK A;  2WGO A;  2I9W A;  1K8A 4;  1L5G B;  1TFK A;  3PZW A;  3J7Y d;  5CF2 A;  3CCM 3;  3F14 A;  1IVX A;  3NBR A;  3LTC A;  3BND A;  1AVK A;  3CCU 3;  1IVV A;  3F7S A;  3F9S A;  2FGT A;  3GRD A;  3JUM A;  3IMA B;  5FGO A;  2K0M A;  2BO9 B;  1N5H A;  4KFE A;  3DGL A;  4QWT A;  4FR9 A;  4XDW A;  3D3L A;  1GS3 A;  1RN7 A;  4TX4 A;  2GBW B;  1E3R A;  3X3Z A;  3SOA A;  4FMD A;  2KXG A;  1QMA A;  1RJO A;  5KP4 A;  5KP3 A;  1O7P B;  1IVW A;  3MG1 A;  4HBR A;  4HM3 B;  2CH9 A;  1Y4K A;  2UX0 A;  3K9M C;  1CYU A;  1DVD A;  2KCD A;  2P0M A;  2MC8 A;  3BLZ A;  5AII A;  3SOY A;  3KN4 A;  2INX A;  1JKG B;  1QVF 2;  2STD A;  3NXJ A;  4N6M A;  2O9U X;  1VQO 3;  4XDV A;  1A2V A;  2PNC A;  2BMQ B;  3E99 A;  1Q40 A;  5LC6 A;  2QGU A;  1KD1 4;  1MNL A;  4HM6 B;  4NHF A;  4J8T A;  4LEH A;  1TIJ A;  4N6U A;  5IG5 A;  1UUW B;  1J2B A;  2OOV A;  1DMM A;  3UL6 A;  3CCR 3;  4HM5 B;  2IMJ A;  4MEI A;  2W2C A;  3L0R A;  3JVC A;  1GD3 A;  3ER7 A;  1W00 A;  3X42 A;  2HMM B;  5IF6 A;  1RKY A;  3FGY A;  1W7C A;  1IT7 A;  1Q82 4;  3SXX A;  2WGQ A;  1OGX A;  3EJV A;  1M90 4;  2GU3 A;  2XFS A;  4JRF A;  2W03 A;  1PFP A;  4HZ9 B;  5IG4 A;  4IIA A;  3AMO A;  1VZZ A;  2Z6B A;  2P0X A;  1IU7 A;  4NRE A;  1E97 A;  4HYZ A;  1A67 A;  3EBT A;  3NV0 A;  4L7K A;  1JB4 A;  1Q42 A;  5IEN A;  1BUQ A;  2RFR A;  3LML A;  3JUO A;  1HKX A;  3B4O A;  1N9E A;  3V99 A;  1D6U A;  1ULI B;  5ELU A;  2E2U A;  4K90 B;  3DUK A;  3G16 A;  5EEO A;  3G6E 3;  1US1 A;  4OK0 A;  4U13 A;  1NJI 4;  1VQ4 3;  1LNH A;  1RRL A;  2D1W A;  3CNX A;  2W56 A;  1Q40 B;  3PCR A;  2P05 A;  2FNQ A;  3DMC A;  2OCT A;  2A15 A;  1E3V A;  3HII A;  2CG0 A;  1OUN A;  3OV4 A;  5A0O B;  3CCL 3;  4R80 A;  1VQL 3;  4RNZ A;  1GY5 A;  3MWZ A;  1KC8 4;  3G71 3;  3T8U A;  2Y74 A;  1EG9 B;  1T5Y A;  4N3V A;  1VQ5 3;  2BHM A;  1OH0 A;  3N54 B;  5BXQ A;  4N6V 0;  3F8X A;  4BTX A;  2CFD A;  4RZM A;  3LT8 A;  3NBB A;  2BNG A;  4HM8 B;  1SJW A;  1GY6 A;  2O3O A;  3FF2 A;  1IK3 A;  1RRH A;  2F99 A;  1HU9 A;  4HM2 B;  1N9J A;  4EC6 A;  3GAX A;  1UUV B;  3DGO A;  3GZB A;  4N6N B;  7STD A;  1DVC A;  5D83 A;  3AMO B;  1YGE A;  2WOH A;  1CEW I;  4BTY A;  2C11 A;  4N6L A;  3X3Y A;  3M8C A;  5STD A;  2CWT A;  1Q86 4;  1KSI A;  3CU3 A;  3BNE A;  3NV0 B;  2GEY A;  2XH9 A;  3EE1 A;  3FH1 A;  1OHP A;  3HX8 A;  5CXO A;  3LOY A;  2LYX A;  2Z76 A;  4KZ1 A;  2YFJ B;  4AEQ A;  2OQE C;  5CF1 A;  4WP5 A;  1SPU A;  3MHE A;  1EA2 A;  1AV4 A;  3KSP A;  3PS8 A;  2B1X B;  2CFK A;  3CNM A;  1WMP A;  1QAF A;  3T0U A;  2W56 B;  4ORL A;  1K9M 4;  3KII A;  4HM0 B;  3PYJ A;  4AKY A;  3SX1 A;  1FGQ A;  2R4I A;  1G96 A;  2W6J H;  3SVA A;  4EV2 A;  1W01 A;  1K28 A;  1STF I;  2CIU A;  2Z77 A;  5IER A;  4HJL B;  1YI2 3;  1K41 A;  3FG4 A;  4XBT A;  4XM4 A;  4HM1 B;  1UW1 A;  3Q2P A;  1QJG A;  3NQZ A;  3N8B A;  3X3X A;  3GZY B;  2OWP A;  3EN1 B;  3PXM A;  2C10 A;  5AEU B;  3LT9 A;  2CKF B;  1LXE A;  2HMJ B;  1S72 3;  1FUW A;  2LQV A;  3OWU A;  2F98 A;  3NM7 A;  2IUJ A;  2CG1 A;  2Y73 A;  4FMB A;  3BNB A;  4EXR A;  4CCV A;  4WFO A;  3OWY A;  3KKG A;  3WOE B;  4Q53 A;  4GL6 A;  2JDI H;  5HGR A;  3EX9 A;  3JUN A;  1LVN A;  1YIT 3;  3U1W A;  2W0Q A;  3FG3 A;  3WMD A;  1SII A;  3EN8 A;  3WA3 A;  5AIG A;  2KRT A;  1DMN A;  1A90 A;  1LOX A;  4L8O A;  4L8P A;  3FKA A;  3TDG A;  2HMO B;  5DRE A;  1W6Y A;  1F8N A;  2BMR B;  4R9L A;  5JBS A;  2XR8 B;  3LTB A;  3IPT A;  1D6Y A;  2CFG A;  1U8C B;  5AYR B;  3F40 A;  4K61 A;  2RGQ A;  3PCS A;  1O7H B;  2XFT A;  4J9A A;  1NO3 A;  1VQK 3;  4FMA A;  3DZL A;  1JN5 A;  4O02 B;  3I0Y A;  3NHX A;  1AR0 A;  1Z1S A;  3VF1 A;  2SBL A;  2Z7A A;  4K1U A;  3KE7 A;  2QEX 3;  3HIG A;  1OGZ A;  4O8S A;  1VQ9 3;  2WO0 A;  3JUP A;  1R4C A;  2MF7 A;  4EV5 A;  3MG2 A;  2RCD A;  2BMO B;  3S29 A;  1VQP 3;  4IPB A;  3V98 A;  5D82 A;  3N9H A;  4PEJ A;  5JPU A;  3ALA A;  2XGL A;  1TFO A;  3NM2 A;  2RSX A;  3BB9 A;  3CD6 3;  1OCV A;  1OAC A;  4H61 A;  3S67 A;  1VQ7 3;  4MMY B;  1S5A A;  1A2K A;  5AI1 A;  3I56 3;  5AYS C;  3F7X A;  1TUH A;  1NDO B;  1KQS 2;  2JQ5 A;  3O8Y A;  2Q07 A;  1NB5 I;  1O7W B;  2CFL A;  3STD A;  1O7N B;  2B24 B;  4FCJ A;  3X41 A;  1W6G A;  3GZX B;  3LTA A;  2GBX B;  3EBY A;  2HMK B;  3K63 A;  5FW5 A;  4ZM8 A;  5AEW B;  1MOL A;  1STD A;  3DXO A;  3CPW 2;  3FSD A;  1OF5 A;  4HZB B;  2CHC A;  3OX9 A;  4AKZ A;  4O3V A;  4WWU C;  1WTH A;  5G2G A;  3HI7 A;  1JB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...