2BIRA

Additivity of substrate binding in ribonuclease t1 (y42a mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKANNYEGFAFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonuclease
molecule keywords RIBONUCLEASE T1
publication title Additivity of protein-guanine interactions in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2birA00
1BIRA 1R4YA 1Q9EA 3WHOA 3AHSA 1AQZA 1BSBA 1RTUA 2RNTA 1BNSA 1GMPA 1BSEA 2HOHA 3AGOA 2RBIA 3DH2A 1BNRA 5HOHA 1BRHA 1LOYA 1RSNA 3HOHA 1BUJA 2KF3A 2KF5A 3D4AA 1MGWA 6GSPA 1BSAA 1RN4A 5BIRA 1BSDA 1BU4A 1I3IA 1I8VA 1B3SA 1RDSA 1RGEA 1BRIA 7RNTA 1BRKA 1RGKA 1RCLA 4J5KA 1BANA 6RNTA 8RNTA 1GOYA 1PYLA 1BRSA 1BNEA 3AHWA 1MGRA 1BNIA 3A5EA 1RMSA 1CH0A 1RNTA 4BIRA 1X1YA 1ZGXA 3D5IA 4RNTA 1X1XA 1GMRA 1B27A 1I3FA 3BIRA 1DE3A 1I70A 1RCKA 1SARA 2KF4A 4HOHA 1YGWA 5GSPA 3DGYA 1LOWA 1T2HA 4BU4A 1UCKA 1GOVA 1B2MA 1BSCA 1BRNL 1BNJA 1B20A 4J5GA 1BOXA 1UCLA 1I0XA 1YVSA 4GSPA 1B21A 3KCHA 1FUTA 1RLSA 1B2XA 2GSPA 9RNTA 2AAEA 1A2PA 1RGGA 1IYYA 1RNBA 1C54A 1RGFA 7GSPA 2F56A 3BU4A 1X1UA 1GOUA 1BGSA 1RGCA 2BIRA 5BU4A 1HYFA 1TTOA 1JBSA 1GMQA 1LRAA 1RGAA 1RGHA 1RN1A 1RGLA 1TRPA 2BU4A 1I2GA 1BVIA 1T2IA 4HAAA 2SARA 1UCIA 3D5GA 1JBRA 1AY7A 1B2UA 3WR2A 1RHLA 1I0VA 5RNTA 1BAOA 2C4BA 1BNFA 3SYUA 1I2EA 1JBTA 4GHOA 1GSPA 1G02A 3RNTA 1HZ1A 1LNIA 1UCJA 3GSPA 2F5MA 1BRGA 2F4YA 1DETA 2ZA4A 2KF6A 1FYSA 2KAAA 1YNVX 3URPA 3Q3FA 1BNGA 1B2ZA 3AGNA 1FZUA 1LOVA 2F5WA 1FUSA 1X1WA 1FW7A 1B2SA 1TRQA 1PY3A 2AADA 1I2FA 1BRJA
chains in the Genus database with same CATH superfamily
1AQZA 1BSBA 2CKFB 3CXC2 1O7WB 1ULIB 4KFEA 1GY6A 5IEOA 2HOHA 3AGOA 3WMDA 3Q90A 1OHSA 2MF7A 1A2VA 4N6V0 3S67A 1MGWA 3LH4A 6GSPA 3EC9A 3PZWA 5DRVA 4GB5A 4FMDA 1NNVA 4XBXA 2R41A 4TX4A 4HM3B 1EUIC 1JNQA 1BSDA 2GEYA 3GAXA 3UNLA 3MG3A 1B3SA 1OF5A 1RDSA 1TFKA 3OV4A 4HM7B 1BRIA 4O3VA 4L8PA 3OWSA 4HKVB 7RNTA 1PU4A 1ROAA 4MMZB 2CC3A 3CMA3 3X3ZA 2L4VA 1GD4A 2RGQA 1TU5A 1Q7HA 2IYJA 5KP4A 1VQ43 4BTWA 2BHMA 2HMJB 2CHCA 3WA2X 1W01A 1I70A 1O7HB 2IY2A 2KF4A 2XH9A 1OACA 4R80A 4MJDA 4KFFA 5GSPA 4CCVA 1UUWB 3G0KA 1S723 1LOXA 4BU4A 3BNBA 1YIT3 1GOVA 3E99A 2GEXA 1EQKA 2OQEC 1MWSA 1BRNL 1BNJA 3F40A 2P09A 1DVDA 1I0XA 3EB8A 3CCL3 1EKMA 1FW7A 1FUTA 4WWUC 2GSPA 2P0XA 3HIGA 3EN8A 1RGGA 3K63A 2PZVA 1DMQA 1C54A 1RGFA 2UUGC 3NX0A 1JJ22 1FGMA 2GBWB 2F56A 3EHCA 1T5YA 2E2VA 1VQ63 1KD14 4AEQA 4IPBA 1JBSA 3HIIA 2XSOB 4BTYA 3Q2PA 2CW9A 2OOVC 2ZDJA 2XGNA 3QK9A 4FMAA 1GS3A 1RGLA 2K0MA 2STDA 3DGOA 4AKZA 1STFI 3SX1A 1CEWI 2BU4A 1T2IA 4XB5A 3G4S3 3NV0A 3GZXB 3V98A 2BMOB 1TP6A 3EJVA 1NWWA 1OCVA 1WMOA 5IG0A 3D5GA 3B4PA 3LT8A 1Q40B 4OK0A 2XF3A 1RHLA 5D83A 2W56B 5RNTA 4KT3B 3FLJA 3SXXA 1BNFA 5AEUB 1UW1A 3KZTA 3NHXA 3SYUA 5IG5A 1JKGA 3OWYA 1TIJA 3EBYA 3CCQ3 1GSPA 1JV2B 2GBXB 1G02A 1UI7A 4HZ9B 4LSOA 1C7HA 1W6YA 1YI23 2F4YA 1O7NB 1MWTA 1QVG2 4XBTA 2Z76A 3BNCA 1OUNA 1BNGA 3VF1A 1FA3A 1DYUA 1LQMB 1ZX2A 3AGNA 3F14A 1LOVA 4H61A 1GY7A 4CJNA 2W03A 2F5WA 3LT9A 3N8BA 3LTCA 3M8CA 1D6YA 4ORLA 1N5HA 3FG1A 3U1WA 2BMRB 2E2TA 1B2SA 3DM8A 1IK3A 1TRQA 1JN5B 1E3VA 1PY3A 2AADA 1LXEA 1V58A 2WGOA 3RGRA 3VSYA 3WDGB 1VQP3 1BIRA 4IT7A 3I563 1UUVB 1MWUA 1RTUA 3GWRA 1QALA 3D9RA 4I5QA 1BNSA 3CD63 4HM2B 1BSEA 2IMJA 4LEHA 1SIIA 3DH2A 1BRHA 3SVAA 1RSNA 1IDPA 3HOHA 4BIRA 2HMLB 1RKYA 2KF5A 4FMCA 3DMCA 5AIFA 1JZDA 1K9M4 3LMLA 1BSAA 1EG9B 5AEWB 2C10A 1ROVA 2FXTA 1TUHA 1OHOA 3DGMA 5BIRA 4HM5B 4KFDA 1I3IA 1TJDA 3MSOA 4BL3A 2B24B 2QA43 4N6TA 3LTDA 4HM6B 6RNTA 1LNHA 3H3HA 8RNTA 1QMAA 3J7Yd 3JUQA 1Y4KA 2W2CA 3AMOA 3AHWA 3N9HA 1IV7A 1MGRA 3BLZA 3OXAA 1UGHI 3FCSB 1CH0A 4JF8A 3T8NA 3MYTA 2WOFA 2BO9B 2CK3H 2J8XB 5AIIA 1DE3A 1RCKA 1SARA 1IVVA 2P38A 5M1AA 1N9JA 2LYXA 3NBJA 4N6MA 5G1LA 1JB2A 1YGWA 3FSDA 4N3VA 2LQVA 4G1MB 3DGYA 2GU1A 1OH0A 1FGQA 2W04A 3VGNA 2CFDA 3T0UA 3SEDA 1SPUA 3NQYA 3L0RA 3CNXA 1B20A 1OGZA 4QWTA 1RJOA 2RCDA 1ULJB 3S28A 2XEPA 1VQM3 1RRLA 3WODG 3BNEA 3FKAA 3PCSA 1B21A 3ALAA 1JB5A 3NBRA 1A67A 9RNTA 1US1A 2M7OA 3F8XA 1NJI4 2V1LA 5EQLA 5FW5A 2UX0A 1GD3A 1FGOA 3KE7A 7GSPA 3BU4A 1X1UA 1BGSA 5IENA 1NO3A 2BIRA 4J8TA 5BU4A 3LXUX 2A15A 1V57A 1A90A 1RN1A 1TRPA 5M18A 1ASKA 3F7SA 3DXOA 1O7GB 3LZAA 1RRHA 5CLKA 2HMNB 5A0OB 1DMNA 1EA2A 2RSXA 1QVF2 6STDA 4RNYA 1K28A 2HMOB 2H0GA 1JZOA 1LQGC 2JDIH 1YJN3 3KSED 3DY5A 1AY7A 3S5CA 4EW5A 1FUWA 1QAFA 1ZO2A 2C4BA 2ZL8A 3HK4A 2CFKA 5LC6A 4DKIA 2F98A 3X3YA 1JBTA 4GHOA 2CX1A 1JRQA 1WTHA 2HMKB 3DGLA 3RNTA 3X3XA 3CCJ3 3F7XA 2D42A 1UDII 2CG1A 3DZLA 2F5MA 3NM7A 2ZA4A 1FYSA 1U8CB 2BT3A 2O3OA 5BVBA 4FCZA 1Z1SA 5AI1A 3CCM3 1WMPA 1B2ZA 2R4IA 3CCR3 1WNHA 4AKYA 1FUSA 1GYBA 4LZIA 1J2BA 1SIHA 3OW22 1KQS2 1BRJA 1DVCA 2INXA 5ELJA 3PYJA 1Q9EA 1UUGB 4EV5A 1JKGB 3AHSA 2WGQA 1N9EA 4FCJA 3LYGA 1OHPA 1W5ZA 1GMPA 1W6CA 4L8OA 3NM2A 4MMYB 5JBSA 1IVUA 2RBIA 4O2HA 1BNRA 5HOHA 1LOYA 4KZ1A 2YX9A 2KF3A 3ECFA 3D4AA 3CC73 5EVHA 1MNLA 3NQZA 4ILFA 2OTL3 3LTAA 5JPUA 3FZWA 2W0QA 3UB1A 3ZG0A 1BU4A 1I8VA 4K61A 1RGEA 3BNDA 4ZM8A 3KSPA 1M1XB 1TFOA 1RCLA 4RBNA 4J5KA 3U97A 1BANA 4BTXA 2QGUA 1GOYA 1AVKA 1SJWA 3FG3A 1BNEA 1VZZA 1WQLB 1V74A 2KCDA 3FH1A 3IJEB 1N8QA 3N54B 7STDA 4STDA 1CQSA 3PCRA 3I0YA 1RMSA 3LOYA 4NREA 4XM4A 1RNTA 3JUPA 2W56A 3EF8A 1X1YA 2CWVA 1CYVA 3F8HA 4PEJA 5G1KA 1L5GB 2BNGA 1YVBI 1ZGXA 3ROBA 1U5OA 1W2ZA 4KVHA 4RNTA 4WYKA 1M1K4 4EC6A 3RGAA 3DGNA 1B27A 3H51A 2IA7A 4LGQA 4EYCA 3KKGA 2OQEA 5KP3A 4K1VA 4EBGA 1YIJ3 2W9QA 5IG4A 1T2HA 4N6UA 1SQWA 4HM4B 4EXRA 1RN7A 5IF6A 3O8YA 5BXQA 2RFRA 2OWPA 4R9KA 5G2GA 1BOXA 3G8ZA 2XRXB 2KXGA 2MC8A 2Y73A 5AIHA 3I553 3PS8A 4GSPA 4I4KA 1W2B2 1RLSA 2YFLB 1JN5A 5D81A 2H0HA 1EEJA 3JUNA 3CME3 1D6ZA 3JUOA 1KWIA 3MHEA 5CF1A 1RNBA 1S5AA 3ZFZA 2OOVA 3CCS3 1W6GA 1VQL3 3X41A 4N6LA 1HKXA 1FGTA 1GOUA 1IT8A 1M9GA 2IUJA 1NDOB 3KN4A 1GMQA 1PFPA 1LRAA 3RDEA 1UI8A 3WOFB 1RGAA 3PXMA 3EN1B 1OF5B 3Q1CA 4EV2A 2XFTA 3S29A 1I2GA 1BVIA 1LVNA 5M19A 1Q7Y4 1OGXA 2KRTA 1AVLA 2PNCA 3OX9A 4HAAA 4O8SA 2XFSA 5CXOA 4R4KA 1UCIA 1VQK3 3G713 1AR0A 3D3LA 4BL2A 1K734 3V92A 1YJ93 1I0VA 3IMAB 3KFQC 4O02B 1VQO3 4Q53A 1E97A 2CH9A 3TDGA 4LYLB 4MEIA 3STDA 1I2EA 5TGNA 1O7MB 1HZ1A 1LNIA 3UJMA 2HMMB 5DREA 4CPKA 1JB4A 4HZBB 3GRDA 2FNQA 1FGRA 3MKIA 2CFWA 2L1SA 2XGLA 4RNZA 3URPA 3X40A 5IEPA 5D82A 3Q3FA 1KC84 3BB9A 1BUQA 5HGRA 1IV9A 1R4CA 2O9UX 1FZUA 3IPTA 5LC7A 4FR9A 3FF2A 2CIUA 1IT7A 1D6UA 1A2KA 1KSIA 1X1WA 3DUKA 1IVXA 2C11A 3B4OA 3F9SA 3EQQB 3K0ZA 1R4YA 5CK6A 1Q864 3WHOA 2RNTA 3G6E3 2ML5A 3MPHA 4HYZA 3UL5A 3ER7A 1MWRA 1STDA 1NB3I 2B1XB 3SLUA 5KP1A 3GZYB 4OVMA 1QJGA 5IG3A 1T3BA 5AYSC 2Z77A 1BUJA 4FMBA 2CWUA 3UL6A 1VQ53 1VQQA 3B8LA 2QIYA 2Z6BA 3EBTA 3NV0B 2Z7AA 1RN4A 8CHOA 2OCTA 3GZBA 5FGOA 4FCMA 3WOEB 2I9WA 4MMXB 1MOLA 3K5TA 1BRKA 1RGKA 2CG0A 1W02A 5JPPA 4X2OA 1VQN3 1HU9A 3CCU3 1PYLA 2D1WA 2P05A 3FF0A 2F99A 1BRSA 4HBRA 3HI7A 1M904 3A76A 1F8NA 3CPOA 1BNIA 1N5PA 3A5EA 4NPBA 3D79A 1UGIA 3QRDA 2ML6A 1Q814 2K54A 1IQ8A 2WOHA 3CNMA 4HVNA 4HM1B 4XDVA 2QEX3 1VQ73 3D5IA 1N8R4 3PGBA 2OTJ3 1X1XA 3OWUA 1GMRA 4HM0B 1I3FA 3BIRA 3S27A 1NB5I 2WO0A 2YFIB 4HOHA 3NUVA 1Q824 2CX0A 3CC43 4WP5A 3JUMA 3T8UA 3B7CA 2JQ5A 1LOWA 4OUQA 3SOAA 1UCKA 2BMQB 3CCV3 1B2MA 4WFOA 3MWZA 1BSCA 5IERA 3EX9A 2ZHXB 4J5GA 3KIIA 1UCLA 1DMMA 1W7CA 1YVSA 2F86B 4XDWA 3KCHA 4K1UA 1VQ83 1B2XA 5IW9A 2SBLA 2AAEA 3FG4A 4K90B 2IUKA 1Q40A 1A2PA 2K3DA 2P0MA 1W4NA 4R9LA 4WYKB 4CDLA 3HZPA 4JRFA 1AV4A 1IYYA 2H0IA 2XR8B 4WHAA 3MG2A 1E3RA 5I97A 2CFGA 3NBBA 4HJLB 4NHFA 3WA3A 2W6JH 4N6NB 1RGCA 1VQ93 1HYFA 1TTOA 5AYRB 2CWTA 3K7CA 3FGYA 1OPYA 1RGHA 1Q42A 2YFJB 2CFLA 4GL6A 4IIAA 1CYUA 5ELUA 5AIGA 2XSHB 3G16A 2UGIA 1IQYA 3EE1A 5CF2A 3CPW2 3K9MC 2W9PA 3GZRA 4X2HA 2SARA 1G0TA 1O7PB 1ZS7A 3AMOB 3HX8A 4H3UA 4HM8B 5EEOA 2Q07A 1YGEA 1ISKA 1JBRA 1K41A 1B2UA 3WR2A 1W00A 3CC23 3ZG5A 3CCE3 2FGTA 1IU7A 1BAOA 3SOYA 2GU3A 1K8A4 4U13A 3JVCA 1NU3A 1UCJA 3MG1A 3GSPA 1BRGA 2GXFA 3X42A 1DETA 2E2UA 2KF6A 3NXJA 1IQXA 1YHQ3 1IVWA 1YNVX 1GY5A 2KAAA 3V99A 4N6OB 1QAKA 4L7KA 4XBYA 4R1KA 4J9AA 3CU3A 3LTBA 5STDA 1G96A 4RZMA 1YJW3 1WMNA 4LMIA 1I2FA 2Y74A
chains in the Genus database with same CATH topology
1BIRA 1R4YA 1Q9EA 3WHOA 3AHSA 1AQZA 1BSBA 1RTUA 2RNTA 1BNSA 1GMPA 1BSEA 2HOHA 3AGOA 2RBIA 3DH2A 1BNRA 5HOHA 1BRHA 1LOYA 1RSNA 3HOHA 1BUJA 2KF3A 2KF5A 3D4AA 1MGWA 6GSPA 1BSAA 1RN4A 5BIRA 1BSDA 1BU4A 1I3IA 1I8VA 1B3SA 1RDSA 1RGEA 1BRIA 7RNTA 1BRKA 1RGKA 1RCLA 4J5KA 1BANA 6RNTA 8RNTA 1GOYA 1PYLA 1BRSA 1BNEA 3AHWA 1MGRA 1BNIA 3A5EA 1RMSA 1CH0A 1RNTA 4BIRA 1X1YA 1ZGXA 3D5IA 4RNTA 1X1XA 1GMRA 1B27A 1I3FA 3BIRA 1DE3A 1I70A 1RCKA 1SARA 2KF4A 4HOHA 1YGWA 5GSPA 3DGYA 1LOWA 1T2HA 4BU4A 1UCKA 1GOVA 1B2MA 1BSCA 1BRNL 1BNJA 1B20A 4J5GA 1BOXA 1UCLA 1I0XA 1YVSA 4GSPA 1B21A 3KCHA 1FUTA 1RLSA 1B2XA 2GSPA 9RNTA 2AAEA 1A2PA 1RGGA 1IYYA 1RNBA 1C54A 1RGFA 7GSPA 2F56A 3BU4A 1X1UA 1GOUA 1BGSA 1RGCA 2BIRA 5BU4A 1HYFA 1TTOA 1JBSA 1GMQA 1LRAA 1RGAA 1RGHA 1RN1A 1RGLA 1TRPA 2BU4A 1I2GA 1BVIA 1T2IA 4HAAA 2SARA 1UCIA 3D5GA 1JBRA 1AY7A 1B2UA 3WR2A 1RHLA 1I0VA 5RNTA 1BAOA 2C4BA 1BNFA 3SYUA 1I2EA 1JBTA 4GHOA 1GSPA 1G02A 3RNTA 1HZ1A 1LNIA 1UCJA 3GSPA 2F5MA 1BRGA 2F4YA 1DETA 2ZA4A 2KF6A 1FYSA 2KAAA 1YNVX 3URPA 3Q3FA 1BNGA 1B2ZA 3AGNA 1FZUA 1LOVA 2F5WA 1FUSA 1X1WA 1FW7A 1B2SA 1TRQA 1PY3A 2AADA 1I2FA 1BRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIR A;  1R4Y A;  1Q9E A;  3WHO A;  3AHS A;  1AQZ A;  1BSB A;  1RTU A;  2RNT A;  1BNS A;  1GMP A;  1BSE A;  2HOH A;  3AGO A;  2RBI A;  3DH2 A;  1BNR A;  5HOH A;  1BRH A;  1LOY A;  1RSN A;  3HOH A;  1BUJ A;  2KF3 A;  2KF5 A;  3D4A A;  1MGW A;  6GSP A;  1BSA A;  1RN4 A;  5BIR A;  1BSD A;  1BU4 A;  1I3I A;  1I8V A;  1B3S A;  1RDS A;  1RGE A;  1BRI A;  7RNT A;  1BRK A;  1RGK A;  1RCL A;  4J5K A;  1BAN A;  6RNT A;  8RNT A;  1GOY A;  1PYL A;  1BRS A;  1BNE A;  3AHW A;  1MGR A;  1BNI A;  3A5E A;  1RMS A;  1CH0 A;  1RNT A;  4BIR A;  1X1Y A;  1ZGX A;  3D5I A;  4RNT A;  1X1X A;  1GMR A;  1B27 A;  1I3F A;  3BIR A;  1DE3 A;  1I70 A;  1RCK A;  1SAR A;  2KF4 A;  4HOH A;  1YGW A;  5GSP A;  3DGY A;  1LOW A;  1T2H A;  4BU4 A;  1UCK A;  1GOV A;  1B2M A;  1BSC A;  1BRN L;  1BNJ A;  1B20 A;  4J5G A;  1BOX A;  1UCL A;  1I0X A;  1YVS A;  4GSP A;  1B21 A;  3KCH A;  1FUT A;  1RLS A;  1B2X A;  2GSP A;  9RNT A;  2AAE A;  1A2P A;  1RGG A;  1IYY A;  1RNB A;  1C54 A;  1RGF A;  7GSP A;  2F56 A;  3BU4 A;  1X1U A;  1GOU A;  1BGS A;  1RGC A;  2BIR A;  5BU4 A;  1HYF A;  1TTO A;  1JBS A;  1GMQ A;  1LRA A;  1RGA A;  1RGH A;  1RN1 A;  1RGL A;  1TRP A;  2BU4 A;  1I2G A;  1BVI A;  1T2I A;  4HAA A;  2SAR A;  1UCI A;  3D5G A;  1JBR A;  1AY7 A;  1B2U A;  3WR2 A;  1RHL A;  1I0V A;  5RNT A;  1BAO A;  2C4B A;  1BNF A;  3SYU A;  1I2E A;  1JBT A;  4GHO A;  1GSP A;  1G02 A;  3RNT A;  1HZ1 A;  1LNI A;  1UCJ A;  3GSP A;  2F5M A;  1BRG A;  2F4Y A;  1DET A;  2ZA4 A;  2KF6 A;  1FYS A;  2KAA A;  1YNV X;  3URP A;  3Q3F A;  1BNG A;  1B2Z A;  3AGN A;  1FZU A;  1LOV A;  2F5W A;  1FUS A;  1X1W A;  1FW7 A;  1B2S A;  1TRQ A;  1PY3 A;  2AAD A;  1I2F A;  1BRJ A; 
#chains in the Genus database with same CATH topology
 1AQZ A;  1BSB A;  2CKF B;  3CXC 2;  1O7W B;  1ULI B;  4KFE A;  1GY6 A;  5IEO A;  2HOH A;  3AGO A;  3WMD A;  3Q90 A;  1OHS A;  2MF7 A;  1A2V A;  4N6V 0;  3S67 A;  1MGW A;  3LH4 A;  6GSP A;  3EC9 A;  3PZW A;  5DRV A;  4GB5 A;  4FMD A;  1NNV A;  4XBX A;  2R41 A;  4TX4 A;  4HM3 B;  1EUI C;  1JNQ A;  1BSD A;  2GEY A;  3GAX A;  3UNL A;  3MG3 A;  1B3S A;  1OF5 A;  1RDS A;  1TFK A;  3OV4 A;  4HM7 B;  1BRI A;  4O3V A;  4L8P A;  3OWS A;  4HKV B;  7RNT A;  1PU4 A;  1ROA A;  4MMZ B;  2CC3 A;  3CMA 3;  3X3Z A;  2L4V A;  1GD4 A;  2RGQ A;  1TU5 A;  1Q7H A;  2IYJ A;  5KP4 A;  1VQ4 3;  4BTW A;  2BHM A;  2HMJ B;  2CHC A;  3WA2 X;  1W01 A;  1I70 A;  1O7H B;  2IY2 A;  2KF4 A;  2XH9 A;  1OAC A;  4R80 A;  4MJD A;  4KFF A;  5GSP A;  4CCV A;  1UUW B;  3G0K A;  1S72 3;  1LOX A;  4BU4 A;  3BNB A;  1YIT 3;  1GOV A;  3E99 A;  2GEX A;  1EQK A;  2OQE C;  1MWS A;  1BRN L;  1BNJ A;  3F40 A;  2P09 A;  1DVD A;  1I0X A;  3EB8 A;  3CCL 3;  1EKM A;  1FW7 A;  1FUT A;  4WWU C;  2GSP A;  2P0X A;  3HIG A;  3EN8 A;  1RGG A;  3K63 A;  2PZV A;  1DMQ A;  1C54 A;  1RGF A;  2UUG C;  3NX0 A;  1JJ2 2;  1FGM A;  2GBW B;  2F56 A;  3EHC A;  1T5Y A;  2E2V A;  1VQ6 3;  1KD1 4;  4AEQ A;  4IPB A;  1JBS A;  3HII A;  2XSO B;  4BTY A;  3Q2P A;  2CW9 A;  2OOV C;  2ZDJ A;  2XGN A;  3QK9 A;  4FMA A;  1GS3 A;  1RGL A;  2K0M A;  2STD A;  3DGO A;  4AKZ A;  1STF I;  3SX1 A;  1CEW I;  2BU4 A;  1T2I A;  4XB5 A;  3G4S 3;  3NV0 A;  3GZX B;  3V98 A;  2BMO B;  1TP6 A;  3EJV A;  1NWW A;  1OCV A;  1WMO A;  5IG0 A;  3D5G A;  3B4P A;  3LT8 A;  1Q40 B;  4OK0 A;  2XF3 A;  1RHL A;  5D83 A;  2W56 B;  5RNT A;  4KT3 B;  3FLJ A;  3SXX A;  1BNF A;  5AEU B;  1UW1 A;  3KZT A;  3NHX A;  3SYU A;  5IG5 A;  1JKG A;  3OWY A;  1TIJ A;  3EBY A;  3CCQ 3;  1GSP A;  1JV2 B;  2GBX B;  1G02 A;  1UI7 A;  4HZ9 B;  4LSO A;  1C7H A;  1W6Y A;  1YI2 3;  2F4Y A;  1O7N B;  1MWT A;  1QVG 2;  4XBT A;  2Z76 A;  3BNC A;  1OUN A;  1BNG A;  3VF1 A;  1FA3 A;  1DYU A;  1LQM B;  1ZX2 A;  3AGN A;  3F14 A;  1LOV A;  4H61 A;  1GY7 A;  4CJN A;  2W03 A;  2F5W A;  3LT9 A;  3N8B A;  3LTC A;  3M8C A;  1D6Y A;  4ORL A;  1N5H A;  3FG1 A;  3U1W A;  2BMR B;  2E2T A;  1B2S A;  3DM8 A;  1IK3 A;  1TRQ A;  1JN5 B;  1E3V A;  1PY3 A;  2AAD A;  1LXE A;  1V58 A;  2WGO A;  3RGR A;  3VSY A;  3WDG B;  1VQP 3;  1BIR A;  4IT7 A;  3I56 3;  1UUV B;  1MWU A;  1RTU A;  3GWR A;  1QAL A;  3D9R A;  4I5Q A;  1BNS A;  3CD6 3;  4HM2 B;  1BSE A;  2IMJ A;  4LEH A;  1SII A;  3DH2 A;  1BRH A;  3SVA A;  1RSN A;  1IDP A;  3HOH A;  4BIR A;  2HML B;  1RKY A;  2KF5 A;  4FMC A;  3DMC A;  5AIF A;  1JZD A;  1K9M 4;  3LML A;  1BSA A;  1EG9 B;  5AEW B;  2C10 A;  1ROV A;  2FXT A;  1TUH A;  1OHO A;  3DGM A;  5BIR A;  4HM5 B;  4KFD A;  1I3I A;  1TJD A;  3MSO A;  4BL3 A;  2B24 B;  2QA4 3;  4N6T A;  3LTD A;  4HM6 B;  6RNT A;  1LNH A;  3H3H A;  8RNT A;  1QMA A;  3J7Y d;  3JUQ A;  1Y4K A;  2W2C A;  3AMO A;  3AHW A;  3N9H A;  1IV7 A;  1MGR A;  3BLZ A;  3OXA A;  1UGH I;  3FCS B;  1CH0 A;  4JF8 A;  3T8N A;  3MYT A;  2WOF A;  2BO9 B;  2CK3 H;  2J8X B;  5AII A;  1DE3 A;  1RCK A;  1SAR A;  1IVV A;  2P38 A;  5M1A A;  1N9J A;  2LYX A;  3NBJ A;  4N6M A;  5G1L A;  1JB2 A;  1YGW A;  3FSD A;  4N3V A;  2LQV A;  4G1M B;  3DGY A;  2GU1 A;  1OH0 A;  1FGQ A;  2W04 A;  3VGN A;  2CFD A;  3T0U A;  3SED A;  1SPU A;  3NQY A;  3L0R A;  3CNX A;  1B20 A;  1OGZ A;  4QWT A;  1RJO A;  2RCD A;  1ULJ B;  3S28 A;  2XEP A;  1VQM 3;  1RRL A;  3WOD G;  3BNE A;  3FKA A;  3PCS A;  1B21 A;  3ALA A;  1JB5 A;  3NBR A;  1A67 A;  9RNT A;  1US1 A;  2M7O A;  3F8X A;  1NJI 4;  2V1L A;  5EQL A;  5FW5 A;  2UX0 A;  1GD3 A;  1FGO A;  3KE7 A;  7GSP A;  3BU4 A;  1X1U A;  1BGS A;  5IEN A;  1NO3 A;  2BIR A;  4J8T A;  5BU4 A;  3LXU X;  2A15 A;  1V57 A;  1A90 A;  1RN1 A;  1TRP A;  5M18 A;  1ASK A;  3F7S A;  3DXO A;  1O7G B;  3LZA A;  1RRH A;  5CLK A;  2HMN B;  5A0O B;  1DMN A;  1EA2 A;  2RSX A;  1QVF 2;  6STD A;  4RNY A;  1K28 A;  2HMO B;  2H0G A;  1JZO A;  1LQG C;  2JDI H;  1YJN 3;  3KSE D;  3DY5 A;  1AY7 A;  3S5C A;  4EW5 A;  1FUW A;  1QAF A;  1ZO2 A;  2C4B A;  2ZL8 A;  3HK4 A;  2CFK A;  5LC6 A;  4DKI A;  2F98 A;  3X3Y A;  1JBT A;  4GHO A;  2CX1 A;  1JRQ A;  1WTH A;  2HMK B;  3DGL A;  3RNT A;  3X3X A;  3CCJ 3;  3F7X A;  2D42 A;  1UDI I;  2CG1 A;  3DZL A;  2F5M A;  3NM7 A;  2ZA4 A;  1FYS A;  1U8C B;  2BT3 A;  2O3O A;  5BVB A;  4FCZ A;  1Z1S A;  5AI1 A;  3CCM 3;  1WMP A;  1B2Z A;  2R4I A;  3CCR 3;  1WNH A;  4AKY A;  1FUS A;  1GYB A;  4LZI A;  1J2B A;  1SIH A;  3OW2 2;  1KQS 2;  1BRJ A;  1DVC A;  2INX A;  5ELJ A;  3PYJ A;  1Q9E A;  1UUG B;  4EV5 A;  1JKG B;  3AHS A;  2WGQ A;  1N9E A;  4FCJ A;  3LYG A;  1OHP A;  1W5Z A;  1GMP A;  1W6C A;  4L8O A;  3NM2 A;  4MMY B;  5JBS A;  1IVU A;  2RBI A;  4O2H A;  1BNR A;  5HOH A;  1LOY A;  4KZ1 A;  2YX9 A;  2KF3 A;  3ECF A;  3D4A A;  3CC7 3;  5EVH A;  1MNL A;  3NQZ A;  4ILF A;  2OTL 3;  3LTA A;  5JPU A;  3FZW A;  2W0Q A;  3UB1 A;  3ZG0 A;  1BU4 A;  1I8V A;  4K61 A;  1RGE A;  3BND A;  4ZM8 A;  3KSP A;  1M1X B;  1TFO A;  1RCL A;  4RBN A;  4J5K A;  3U97 A;  1BAN A;  4BTX A;  2QGU A;  1GOY A;  1AVK A;  1SJW A;  3FG3 A;  1BNE A;  1VZZ A;  1WQL B;  1V74 A;  2KCD A;  3FH1 A;  3IJE B;  1N8Q A;  3N54 B;  7STD A;  4STD A;  1CQS A;  3PCR A;  3I0Y A;  1RMS A;  3LOY A;  4NRE A;  4XM4 A;  1RNT A;  3JUP A;  2W56 A;  3EF8 A;  1X1Y A;  2CWV A;  1CYV A;  3F8H A;  4PEJ A;  5G1K A;  1L5G B;  2BNG A;  1YVB I;  1ZGX A;  3ROB A;  1U5O A;  1W2Z A;  4KVH A;  4RNT A;  4WYK A;  1M1K 4;  4EC6 A;  3RGA A;  3DGN A;  1B27 A;  3H51 A;  2IA7 A;  4LGQ A;  4EYC A;  3KKG A;  2OQE A;  5KP3 A;  4K1V A;  4EBG A;  1YIJ 3;  2W9Q A;  5IG4 A;  1T2H A;  4N6U A;  1SQW A;  4HM4 B;  4EXR A;  1RN7 A;  5IF6 A;  3O8Y A;  5BXQ A;  2RFR A;  2OWP A;  4R9K A;  5G2G A;  1BOX A;  3G8Z A;  2XRX B;  2KXG A;  2MC8 A;  2Y73 A;  5AIH A;  3I55 3;  3PS8 A;  4GSP A;  4I4K A;  1W2B 2;  1RLS A;  2YFL B;  1JN5 A;  5D81 A;  2H0H A;  1EEJ A;  3JUN A;  3CME 3;  1D6Z A;  3JUO A;  1KWI A;  3MHE A;  5CF1 A;  1RNB A;  1S5A A;  3ZFZ A;  2OOV A;  3CCS 3;  1W6G A;  1VQL 3;  3X41 A;  4N6L A;  1HKX A;  1FGT A;  1GOU A;  1IT8 A;  1M9G A;  2IUJ A;  1NDO B;  3KN4 A;  1GMQ A;  1PFP A;  1LRA A;  3RDE A;  1UI8 A;  3WOF B;  1RGA A;  3PXM A;  3EN1 B;  1OF5 B;  3Q1C A;  4EV2 A;  2XFT A;  3S29 A;  1I2G A;  1BVI A;  1LVN A;  5M19 A;  1Q7Y 4;  1OGX A;  2KRT A;  1AVL A;  2PNC A;  3OX9 A;  4HAA A;  4O8S A;  2XFS A;  5CXO A;  4R4K A;  1UCI A;  1VQK 3;  3G71 3;  1AR0 A;  3D3L A;  4BL2 A;  1K73 4;  3V92 A;  1YJ9 3;  1I0V A;  3IMA B;  3KFQ C;  4O02 B;  1VQO 3;  4Q53 A;  1E97 A;  2CH9 A;  3TDG A;  4LYL B;  4MEI A;  3STD A;  1I2E A;  5TGN A;  1O7M B;  1HZ1 A;  1LNI A;  3UJM A;  2HMM B;  5DRE A;  4CPK A;  1JB4 A;  4HZB B;  3GRD A;  2FNQ A;  1FGR A;  3MKI A;  2CFW A;  2L1S A;  2XGL A;  4RNZ A;  3URP A;  3X40 A;  5IEP A;  5D82 A;  3Q3F A;  1KC8 4;  3BB9 A;  1BUQ A;  5HGR A;  1IV9 A;  1R4C A;  2O9U X;  1FZU A;  3IPT A;  5LC7 A;  4FR9 A;  3FF2 A;  2CIU A;  1IT7 A;  1D6U A;  1A2K A;  1KSI A;  1X1W A;  3DUK A;  1IVX A;  2C11 A;  3B4O A;  3F9S A;  3EQQ B;  3K0Z A;  1R4Y A;  5CK6 A;  1Q86 4;  3WHO A;  2RNT A;  3G6E 3;  2ML5 A;  3MPH A;  4HYZ A;  3UL5 A;  3ER7 A;  1MWR A;  1STD A;  1NB3 I;  2B1X B;  3SLU A;  5KP1 A;  3GZY B;  4OVM A;  1QJG A;  5IG3 A;  1T3B A;  5AYS C;  2Z77 A;  1BUJ A;  4FMB A;  2CWU A;  3UL6 A;  1VQ5 3;  1VQQ A;  3B8L A;  2QIY A;  2Z6B A;  3EBT A;  3NV0 B;  2Z7A A;  1RN4 A;  8CHO A;  2OCT A;  3GZB A;  5FGO A;  4FCM A;  3WOE B;  2I9W A;  4MMX B;  1MOL A;  3K5T A;  1BRK A;  1RGK A;  2CG0 A;  1W02 A;  5JPP A;  4X2O A;  1VQN 3;  1HU9 A;  3CCU 3;  1PYL A;  2D1W A;  2P05 A;  3FF0 A;  2F99 A;  1BRS A;  4HBR A;  3HI7 A;  1M90 4;  3A76 A;  1F8N A;  3CPO A;  1BNI A;  1N5P A;  3A5E A;  4NPB A;  3D79 A;  1UGI A;  3QRD A;  2ML6 A;  1Q81 4;  2K54 A;  1IQ8 A;  2WOH A;  3CNM A;  4HVN A;  4HM1 B;  4XDV A;  2QEX 3;  1VQ7 3;  3D5I A;  1N8R 4;  3PGB A;  2OTJ 3;  1X1X A;  3OWU A;  1GMR A;  4HM0 B;  1I3F A;  3BIR A;  3S27 A;  1NB5 I;  2WO0 A;  2YFI B;  4HOH A;  3NUV A;  1Q82 4;  2CX0 A;  3CC4 3;  4WP5 A;  3JUM A;  3T8U A;  3B7C A;  2JQ5 A;  1LOW A;  4OUQ A;  3SOA A;  1UCK A;  2BMQ B;  3CCV 3;  1B2M A;  4WFO A;  3MWZ A;  1BSC A;  5IER A;  3EX9 A;  2ZHX B;  4J5G A;  3KII A;  1UCL A;  1DMM A;  1W7C A;  1YVS A;  2F86 B;  4XDW A;  3KCH A;  4K1U A;  1VQ8 3;  1B2X A;  5IW9 A;  2SBL A;  2AAE A;  3FG4 A;  4K90 B;  2IUK A;  1Q40 A;  1A2P A;  2K3D A;  2P0M A;  1W4N A;  4R9L A;  4WYK B;  4CDL A;  3HZP A;  4JRF A;  1AV4 A;  1IYY A;  2H0I A;  2XR8 B;  4WHA A;  3MG2 A;  1E3R A;  5I97 A;  2CFG A;  3NBB A;  4HJL B;  4NHF A;  3WA3 A;  2W6J H;  4N6N B;  1RGC A;  1VQ9 3;  1HYF A;  1TTO A;  5AYR B;  2CWT A;  3K7C A;  3FGY A;  1OPY A;  1RGH A;  1Q42 A;  2YFJ B;  2CFL A;  4GL6 A;  4IIA A;  1CYU A;  5ELU A;  5AIG A;  2XSH B;  3G16 A;  2UGI A;  1IQY A;  3EE1 A;  5CF2 A;  3CPW 2;  3K9M C;  2W9P A;  3GZR A;  4X2H A;  2SAR A;  1G0T A;  1O7P B;  1ZS7 A;  3AMO B;  3HX8 A;  4H3U A;  4HM8 B;  5EEO A;  2Q07 A;  1YGE A;  1ISK A;  1JBR A;  1K41 A;  1B2U A;  3WR2 A;  1W00 A;  3CC2 3;  3ZG5 A;  3CCE 3;  2FGT A;  1IU7 A;  1BAO A;  3SOY A;  2GU3 A;  1K8A 4;  4U13 A;  3JVC A;  1NU3 A;  1UCJ A;  3MG1 A;  3GSP A;  1BRG A;  2GXF A;  3X42 A;  1DET A;  2E2U A;  2KF6 A;  3NXJ A;  1IQX A;  1YHQ 3;  1IVW A;  1YNV X;  1GY5 A;  2KAA A;  3V99 A;  4N6O B;  1QAK A;  4L7K A;  4XBY A;  4R1K A;  4J9A A;  3CU3 A;  3LTB A;  5STD A;  1G96 A;  4RZM A;  1YJW 3;  1WMN A;  4LMI A;  1I2F A;  2Y74 A; 
#chains in the Genus database with same CATH homology
 1BIR A;  1R4Y A;  1Q9E A;  3WHO A;  3AHS A;  1AQZ A;  1BSB A;  1RTU A;  2RNT A;  1BNS A;  1GMP A;  1BSE A;  2HOH A;  3AGO A;  2RBI A;  3DH2 A;  1BNR A;  5HOH A;  1BRH A;  1LOY A;  1RSN A;  3HOH A;  1BUJ A;  2KF3 A;  2KF5 A;  3D4A A;  1MGW A;  6GSP A;  1BSA A;  1RN4 A;  5BIR A;  1BSD A;  1BU4 A;  1I3I A;  1I8V A;  1B3S A;  1RDS A;  1RGE A;  1BRI A;  7RNT A;  1BRK A;  1RGK A;  1RCL A;  4J5K A;  1BAN A;  6RNT A;  8RNT A;  1GOY A;  1PYL A;  1BRS A;  1BNE A;  3AHW A;  1MGR A;  1BNI A;  3A5E A;  1RMS A;  1CH0 A;  1RNT A;  4BIR A;  1X1Y A;  1ZGX A;  3D5I A;  4RNT A;  1X1X A;  1GMR A;  1B27 A;  1I3F A;  3BIR A;  1DE3 A;  1I70 A;  1RCK A;  1SAR A;  2KF4 A;  4HOH A;  1YGW A;  5GSP A;  3DGY A;  1LOW A;  1T2H A;  4BU4 A;  1UCK A;  1GOV A;  1B2M A;  1BSC A;  1BRN L;  1BNJ A;  1B20 A;  4J5G A;  1BOX A;  1UCL A;  1I0X A;  1YVS A;  4GSP A;  1B21 A;  3KCH A;  1FUT A;  1RLS A;  1B2X A;  2GSP A;  9RNT A;  2AAE A;  1A2P A;  1RGG A;  1IYY A;  1RNB A;  1C54 A;  1RGF A;  7GSP A;  2F56 A;  3BU4 A;  1X1U A;  1GOU A;  1BGS A;  1RGC A;  2BIR A;  5BU4 A;  1HYF A;  1TTO A;  1JBS A;  1GMQ A;  1LRA A;  1RGA A;  1RGH A;  1RN1 A;  1RGL A;  1TRP A;  2BU4 A;  1I2G A;  1BVI A;  1T2I A;  4HAA A;  2SAR A;  1UCI A;  3D5G A;  1JBR A;  1AY7 A;  1B2U A;  3WR2 A;  1RHL A;  1I0V A;  5RNT A;  1BAO A;  2C4B A;  1BNF A;  3SYU A;  1I2E A;  1JBT A;  4GHO A;  1GSP A;  1G02 A;  3RNT A;  1HZ1 A;  1LNI A;  1UCJ A;  3GSP A;  2F5M A;  1BRG A;  2F4Y A;  1DET A;  2ZA4 A;  2KF6 A;  1FYS A;  2KAA A;  1YNV X;  3URP A;  3Q3F A;  1BNG A;  1B2Z A;  3AGN A;  1FZU A;  1LOV A;  2F5W A;  1FUS A;  1X1W A;  1FW7 A;  1B2S A;  1TRQ A;  1PY3 A;  2AAD A;  1I2F A;  1BRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...