2BIRA

Additivity of substrate binding in ribonuclease t1 (y42a mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKANNYEGFAFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Additivity of protein-guanine interactions in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Ribonuclease
molecule keywords RIBONUCLEASE T1
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2birA00
4GSPA 1TRPA 1T2IA 1RGEA 1HZ1A 1R4YA 1JBRA 1BSBA 1JBSA 1MGWA 1BRJA 1BRHA 1I2GA 3D5IA 1FYSA 5BIRA 1I3FA 2F4YA 4HAAA 1MGRA 1YVSA 1DE3A 1BNIA 1YNVX 3HOHA 1BRGA 1LOVA 1LOYA 1BANA 1GMRA 3A5EA 1RNBA 8RNTA 1PY3A 1Q9EA 1BSAA 2KAAA 1GOVA 1B2MA 2KF4A 4HOHA 2C4BA 3WHOA 3SYUA 1RLSA 1RCLA 1RGKA 1BRIA 1BVIA 1I3IA 1I0VA 1RGFA 1BSEA 2BIRA 1YGWA 4BU4A 1X1YA 3DH2A 2KF6A 1LOWA 1BRNL 1FW7A 1RCKA 1B2UA 1A2PA 1T2HA 2F5WA 2KF5A 4BIRA 1B3SA 1ZGXA 3AHSA 3KCHA 1PYLA 3BIRA 1RGLA 1B20A 1X1XA 1B21A 2AADA 1DETA 3DGYA 4J5KA 6GSPA 1C54A 1TRQA 5RNTA 3URPA 3WR2A 1GMQA 3AGNA 1UCLA 1BSCA 1SARA 1UCIA 1BUJA 1BOXA 1I2FA 1X1UA 2HOHA 1GSPA 2KF3A 2RBIA 1BNSA 1LNIA 1RDSA 4RNTA 3Q3FA 9RNTA 1HYFA 1GMPA 4J5GA 2ZA4A 3D4AA 1AY7A 1B2ZA 1RGGA 5GSPA 1RGAA 1RGCA 1X1WA 1B2SA 1FUTA 1I0XA 1RN4A 1UCJA 7GSPA 1I8VA 1BAOA 1GOYA 2F5MA 1BU4A 2GSPA 1B27A 7RNTA 3AHWA 1TTOA 3AGOA 4GHOA 1BSDA 1BGSA 1BNJA 2F56A 5HOHA 1BNFA 1RTUA 2BU4A 1BNGA 1G02A 1RSNA 3D5GA 1B2XA 1LRAA 3RNTA 6RNTA 1AQZA 3GSPA 2SARA 1FUSA 1I2EA 1RGHA 1BNRA 1GOUA 3BU4A 1BNEA 1BIRA 1RN1A 2RNTA 2AAEA 1RHLA 1JBTA 1CH0A 1RNTA 1BRSA 1RMSA 1BRKA 1IYYA 1FZUA 1UCKA 5BU4A 1I70A
chains in the Genus database with same CATH superfamily
4EV2A 4FMDA 1T2IA 1U5OA 2ML6A 2SBLA 3T0UA 1DMMA 4BL3A 1HZ1A 4MEIA 2CH9A 1D6ZA 1GYBA 1SJWA 1LOXA 4X2HA 1WMNA 1G96A 2CHCA 3V92A 1OF5A 3RGAA 2F4YA 2K54A 3OX9A 1IVUA 4HAAA 3SOYA 1M9GA 3HOHA 1JN5A 1IQ8A 1UDII 1YJN3 2IMJA 3LTDA 3M8CA 4IPBA 1RRLA 5FW5A 2OTL3 4H3UA 1IQYA 3UB1A 5G1LA 3LYGA 2D1WA 3LMLA 2E2UA 2LQVA 3BNDA 3GZRA 3WHOA 2OQEC 1IVVA 2H0GA 3VSYA 2FXTA 1PFPA 2RFRA 3FSDA 2B1XB 2IUJA 2A15A 2GXFA 1I0VA 4HZ9B 1M1K4 1Q824 1YGWA 4BU4A 2PZVA 5LC6A 1VQO3 3CNXA 3ER7A 3JUMA 4J8TA 4HM0B 3IMAB 2OOVC 3F14A 4JF8A 1T5YA 3S29A 4FCMA 4KVHA 5EQLA 1BRNL 3FKAA 4N6MA 1VZZA 4BIRA 1B3SA 1YIJ3 1FA3A 3ALAA 2XEPA 4O8SA 5JPPA 3MG3A 1J2BA 1OHPA 2CKFB 2QEX3 4LYLB 1RGLA 1U8CB 3X42A 1B21A 2AADA 1NB5I 5KP4A 1E3VA 2XFSA 3MYTA 2OWPA 2GEYA 1BUJA 1CYUA 3MKIA 4HM8B 3X3XA 1HU9A 1I2FA 1PU4A 1NDOB 4OUQA 1JB5A 4RNTA 2BMRB 4EC6A 3GWRA 4J5GA 1K41A 3G16A 1W2ZA 3HX8A 4K90B 1YIT3 4EV5A 3KE7A 1VQ83 5STDA 1OHSA 1IQXA 1RGCA 3LT9A 1FUTA 1Q40B 1I0XA 1IT7A 4EBGA 7GSPA 2H0IA 1VQK3 3EF8A 5M18A 3HK4A 3LOYA 4NREA 3EB8A 3FG1A 3LH4A 2GSPA 4LZIA 1QAFA 1B27A 1GD3A 2IYJA 3VGNA 3AHWA 7RNTA 1TTOA 3NQZA 1BGSA 1BNJA 1HKXA 4MMZB 1OUNA 2CW9A 4BTYA 2RGQA 3G713 1NU3A 4GB5A 2YX9A 1RJOA 4HM2B 1BNGA 1GD4A 2RSXA 4MMXB 1RSNA 3S27A 1LQGC 3BNEA 1FGOA 1JB4A 5IEOA 3NX0A 2CIUA 3CCQ3 3EBTA 3GSPA 4FMAA 2QGUA 1RKYA 3EN1B 2KXGA 1FUWA 1DYUA 1BNEA 1W01A 3BNBA 5M1AA 4DKIA 2AAEA 1RHLA 1OGZA 1CH0A 2XSOB 1VQP3 2CK3H 2CX1A 3GRDA 1FZUA 5KP1A 5CF2A 5IG0A 1W4NA 4GSPA 1TRPA 4XB5A 3CCS3 1A2VA 3K7CA 5IF6A 2GU3A 1JBRA 2PNCA 3S5CA 1JBSA 1EG9B 1OF5B 1IK3A 3KFQC 5I97A 1BRJA 3X40A 4LMIA 1US1A 3UJMA 3OWYA 3MWZA 3PZWA 4WWUC 3DGOA 1MGRA 1YVSA 4HYZA 1BNIA 2FNQA 3N8BA 2E2VA 6STDA 3CMA3 5DRVA 1O7HB 2V1LA 1RNBA 1V58A 1FGTA 1GS3A 3TDGA 8RNTA 1GY5A 3PS8A 3CME3 3CCM3 3NBJA 3CCJ3 3EC9A 1MWUA 3D9RA 1QAKA 2UUGC 3Q2PA 3GZYB 2KAAA 2W9QA 2KF4A 4HOHA 1Z1SA 3BNCA 5CLKA 4CJNA 1RLSA 2L1SA 3FGYA 4WHAA 3I553 2ZL8A 3U97A 3CCU3 4CCVA 1ASKA 1R4CA 1BRIA 2W9PA 2QA43 4XDVA 1JZOA 2XGNA 3CNMA 1RGFA 5KP3A 1L5GB 3J7Yd 1KD14 3D3LA 1NO3A 1OHOA 2CG0A 1NJI4 4HM3B 1X1YA 3DH2A 2Z76A 1YHQ3 3OWSA 3S28A 1WTHA 1A67A 1ROAA 2HMJB 1N5HA 1RCKA 1B2UA 2CC3A 3H3HA 3BLZA 3CCE3 3AHSA 4AEQA 3STDA 1BUQA 1RN7A 3QK9A 4FMCA 3CPOA 1W6CA 2O9UX 1GY6A 3F8HA 3OXAA 1YJ93 3ZG5A 4NHFA 1MNLA 1KSIA 2WOFA 1S723 3DMCA 3AGNA 1BSCA 2HMKB 2JQ5A 3JUNA 5AYSC 1BOXA 3MHEA 2CFDA 2UGIA 2BO9B 2HOHA 3FF0A 2KF3A 3NBBA 3DGLA 2H0HA 1GMPA 1TJDA 2CG1A 1TFOA 1OPYA 3WMDA 3LXUX 3T8UA 2W03A 2MC8A 3KKGA 4QWTA 5AIFA 1VQQA 4KFDA 1QALA 3DY5A 4R1KA 3BB9A 3KIIA 1SPUA 1STFI 3FZWA 1BAOA 2OTJ3 3EBYA 1Q7HA 1V57A 4GL6A 2W2CA 4I5QA 3SX1A 1BU4A 1UI8A 3JUPA 4HKVB 3WOFB 3WODG 5LC7A 1K8A4 3FH1A 1MOLA 1TUHA 3EQQB 1SQWA 5BVBA 1M904 3F7SA 1UUWB 1ZS7A 3K9MC 5IG3A 4NPBA 3Q1CA 4H61A 2BU4A 1CQSA 2GBWB 2P0MA 3NXJA 5ELJA 4BTXA 3D5GA 1B2XA 4IT7A 6RNTA 3HZPA 3NM2A 1S5AA 4J9AA 4Q53A 2P38A 1FUSA 1N9JA 1RGHA 4XBTA 4ZM8A 5IG5A 1GOUA 3I563 3D79A 3E99A 1FGMA 3S67A 1KQS2 1JB2A 3WA3A 2BHMA 2WGQA 2W6JH 1IVXA 5AYRB 5AIGA 2W56B 1BRSA 1RMSA 1JZDA 2BMQB 1BRKA 2XGLA 1VQ93 1IV9A 1W6GA 1Q814 2GEXA 2Z6BA 3HIGA 3MPHA 1UCKA 1Y4KA 5BU4A 2XFTA 1E97A 1RGEA 4N6TA 3OV4A 1RRHA 3NHXA 3IJEB 3SLUA 1BSBA 1EKMA 3MSOA 1VQ43 1MGWA 1O7MB 3LT8A 4HM6B 2Q07A 4XM4A 2GU1A 3RGRA 5IEPA 1FYSA 4WYKB 5BIRA 1DE3A 1BRGA 3EN8A 1K28A 1O7NB 2INXA 1QVG2 1LQMB 1BANA 1GMRA 1LOYA 3A5EA 3DUKA 4WYKA 3UL6A 1NWWA 3KZTA 3F40A 1O7GB 3G4S3 1BSAA 1N9EA 1O7WB 3FG4A 1LXEA 4HVNA 4N6LA 5CF1A 1Q7Y4 2K0MA 3CXC2 4OK0A 2STDA 3A76A 1GOVA 2J8XB 2XR8B 4LEHA 1DMNA 3NM7A 4R4KA 1EA2A 1OGXA 3EHCA 4TX4A 4XDWA 3SYUA 3QRDA 2BNGA 2C10A 3N54B 1RCLA 4K1UA 1RGKA 3U1WA 1AVLA 1GY7A 1BVIA 1E3RA 3Q90A 1BSEA 3PGBA 4HM5B 2UX0A 2I9WA 2JDIH 5D82A 3X3YA 5D83A 3CC43 2KF6A 1W7CA 4EW5A 2OQEA 5D81A 3CU3A 1A2PA 2F5WA 1T2HA 2CFGA 3LZAA 4CDLA 4WP5A 3CD63 1A90A 4X2OA 3GZBA 2RCDA 2R41A 2CFLA 3KCHA 3X3ZA 1PYLA 3DGNA 3BIRA 3OWUA 3RDEA 1Q864 3F8XA 1B20A 1X1XA 1Q42A 3PYJA 4J5KA 8CHOA 1DETA 3DGYA 3KSPA 1VQN3 2FGTA 6GSPA 1AR0A 4FR9A 1ISKA 3I0YA 3G8ZA 3CCR3 1OH0A 4CPKA 1K734 1SARA 1DVDA 5AEUB 2P05A 4L7KA 3V98A 2W56A 1VQ73 3SXXA 1UUGB 2GBXB 1GSPA 1WMPA 1ULIB 1BNSA 1LNIA 2RBIA 3GAXA 3H51A 4IIAA 4KZ1A 1T3BA 4FCZA 5EEOA 2OOVA 1CYVA 2ZA4A 5A0OB 1G0TA 1EUIC 1JN5B 2O3OA 1D6YA 1IVWA 1X1WA 1AVKA 1B2SA 1NNVA 3B8LA 1LVNA 3K0ZA 1W5ZA 4O02B 1RN4A 1UCJA 1JNQA 3DZLA 3LTBA 1I8VA 2F5MA 4HZBB 5DREA 2OCTA 2YFLB 3JVCA 4K1VA 3ZG0A 3K63A 3SVAA 2C11A 1LNHA 3ECFA 4RZMA 3AGOA 1BSDA 3JUOA 2P0XA 2F56A 2HMOB 4G1MB 2K3DA 1N5PA 1RTUA 1ULJB 1TIJA 4KFFA 3CCV3 1W00A 1UGIA 4PEJA 1G02A 1DMQA 3N9HA 4HJLB 3SOAA 1LRAA 3RNTA 2LYXA 2SARA 3LTAA 1ZO2A 4LGQA 3HIIA 3K5TA 4N6UA 1YJW3 4U13A 3BU4A 3CCL3 2Z7AA 1IDPA 1BIRA 1STDA 3LTCA 1YGEA 1MWRA 2CWVA 4STDA 4FCJA 4AKZA 5IG4A 3PXMA 2B24B 1W6YA 1TU5A 3X41A 1QJGA 4N3VA 5FGOA 5CXOA 1TFKA 1IYYA 3WA2X 3B7CA 1VQ63 1ZX2A 4XBXA 3EE1A 3AMOA 1I70A 3NQYA 4XBYA 2F86B 1R4YA 1KWIA 4BL2A 1JJ22 1FGQA 3GZXB 2IUKA 1MWTA 3B4OA 2CX0A 3DGMA 5BXQA 1CEWI 3ROBA 1BRHA 1I2GA 3D5IA 3FF2A 1QVF2 1I3FA 4R9LA 4RBNA 1YNVX 5JPUA 1YI23 1LOVA 5AIHA 2WOHA 1W02A 4HBRA 4I4KA 5ELUA 1SIIA 1PY3A 4OVMA 1Q9EA 3CPW2 1M1XB 5HGRA 1IT8A 1IU7A 2CWTA 3L0RA 3F7XA 2XF3A 1B2MA 2BMOB 1ROVA 2C4BA 2F99A 3NUVA 3NV0B 1UUVB 1KC84 1UGHI 2IA7A 5AEWB 4FMBA 4RNZA 3VF1A 1UW1A 4KFEA 1I3IA 1YVBI 2BIRA 3IPTA 4EYCA 1OCVA 2HMLB 1EEJA 3DXOA 5EVHA 3SEDA 1JV2B 1VQL3 4O3VA 1V74A 1DVCA 2ZDJA 5JBSA 1LOWA 4O2HA 4MJDA 1F8NA 1FW7A 3KN4A 5CK6A 2KF5A 2P09A 2XRXB 2CWUA 1JRQA 1ZGXA 3MG1A 4N6V0 1C7HA 4HM1B 3CC73 3AMOB 4BTWA 4HM4B 1QMAA 3WDGB 3EJVA 3PCRA 9RNTA 4N6NB 4HM7B 2Y73A 5AIIA 1TRQA 1C54A 3CC23 5RNTA 3URPA 5IW9A 3WR2A 1D6UA 1GMQA 3NV0A 1JKGB 1UCLA 3UNLA 5M19A 1UCIA 4K61A 2BT3A 4ORLA 4N6OB 1JKGA 2XH9A 1X1UA 5IERA 2YFIB 2WO0A 1SIHA 1RDSA 4EXRA 2XSHB 3EX9A 1HYFA 2HMMB 3Q3FA 3G0KA 3D4AA 1AY7A 1FGRA 1B2ZA 1Q40A 1RGGA 2KRTA 4ILFA 5GSPA 2W04A 2CFWA 7STDA 4MMYB 1RGAA 1VQM3 5G1KA 3OW22 2Z77A 1GOYA 4L8PA 2M7OA 2QIYA 3O8YA 3ZFZA 3JUQA 3FG3A 1AV4A 1WQLB 1NB3I 4AKYA 1EQKA 1A2KA 5G2GA 4GHOA 2F98A 2Y74A 1W2B2 4RNYA 3WOEB 4L8OA 5TGNA 1BNFA 5HOHA 1K9M4 3DM8A 3HI7A 3B4PA 1UI7A 1OACA 1TP6A 2HMNB 2WGOA 2D42A 2L4VA 2MF7A 1AQZA 3F9SA 4JRFA 3MG2A 3T8NA 3NBRA 1I2EA 5IENA 1BNRA 1O7PB 3KSED 3UL5A 1IV7A 2R4IA 4LSOA 1N8R4 1VQ53 2E2TA 4R9KA 2W0QA 3PCSA 1RN1A 2RNTA 1JBTA 2KCDA 5AI1A 3V99A 1WMOA 1WNHA 1RNTA 3G6E3 2CFKA 1N8QA 4KT3B 2ML5A 4WFOA 1MWSA 2YFJB 3FLJA 3FCSB 4R80A 2ZHXB 2IY2A
chains in the Genus database with same CATH topology
4GSPA 1TRPA 1T2IA 1RGEA 1HZ1A 1R4YA 1JBRA 1BSBA 1JBSA 1MGWA 1BRJA 1BRHA 1I2GA 3D5IA 1FYSA 5BIRA 1I3FA 2F4YA 4HAAA 1MGRA 1YVSA 1DE3A 1BNIA 1YNVX 3HOHA 1BRGA 1LOVA 1LOYA 1BANA 1GMRA 3A5EA 1RNBA 8RNTA 1PY3A 1Q9EA 1BSAA 2KAAA 1GOVA 1B2MA 2KF4A 4HOHA 2C4BA 3WHOA 3SYUA 1RLSA 1RCLA 1RGKA 1BRIA 1BVIA 1I3IA 1I0VA 1RGFA 1BSEA 2BIRA 1YGWA 4BU4A 1X1YA 3DH2A 2KF6A 1LOWA 1BRNL 1FW7A 1RCKA 1B2UA 1A2PA 1T2HA 2F5WA 2KF5A 4BIRA 1B3SA 1ZGXA 3AHSA 3KCHA 1PYLA 3BIRA 1RGLA 1B20A 1X1XA 1B21A 2AADA 1DETA 3DGYA 4J5KA 6GSPA 1C54A 1TRQA 5RNTA 3URPA 3WR2A 1GMQA 3AGNA 1UCLA 1BSCA 1SARA 1UCIA 1BUJA 1BOXA 1I2FA 1X1UA 2HOHA 1GSPA 2KF3A 2RBIA 1BNSA 1LNIA 1RDSA 4RNTA 3Q3FA 9RNTA 1HYFA 1GMPA 4J5GA 2ZA4A 3D4AA 1AY7A 1B2ZA 1RGGA 5GSPA 1RGAA 1RGCA 1X1WA 1B2SA 1FUTA 1I0XA 1RN4A 1UCJA 7GSPA 1I8VA 1BAOA 1GOYA 2F5MA 1BU4A 2GSPA 1B27A 7RNTA 3AHWA 1TTOA 3AGOA 4GHOA 1BSDA 1BGSA 1BNJA 2F56A 5HOHA 1BNFA 1RTUA 2BU4A 1BNGA 1G02A 1RSNA 3D5GA 1B2XA 1LRAA 3RNTA 6RNTA 1AQZA 3GSPA 2SARA 1FUSA 1I2EA 1RGHA 1BNRA 1GOUA 3BU4A 1BNEA 1BIRA 1RN1A 2RNTA 2AAEA 1RHLA 1JBTA 1CH0A 1RNTA 1BRSA 1RMSA 1BRKA 1IYYA 1FZUA 1UCKA 5BU4A 1I70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSP A;  1TRP A;  1T2I A;  1RGE A;  1HZ1 A;  1R4Y A;  1JBR A;  1BSB A;  1JBS A;  1MGW A;  1BRJ A;  1BRH A;  1I2G A;  3D5I A;  1FYS A;  5BIR A;  1I3F A;  2F4Y A;  4HAA A;  1MGR A;  1YVS A;  1DE3 A;  1BNI A;  1YNV X;  3HOH A;  1BRG A;  1LOV A;  1LOY A;  1BAN A;  1GMR A;  3A5E A;  1RNB A;  8RNT A;  1PY3 A;  1Q9E A;  1BSA A;  2KAA A;  1GOV A;  1B2M A;  2KF4 A;  4HOH A;  2C4B A;  3WHO A;  3SYU A;  1RLS A;  1RCL A;  1RGK A;  1BRI A;  1BVI A;  1I3I A;  1I0V A;  1RGF A;  1BSE A;  2BIR A;  1YGW A;  4BU4 A;  1X1Y A;  3DH2 A;  2KF6 A;  1LOW A;  1BRN L;  1FW7 A;  1RCK A;  1B2U A;  1A2P A;  1T2H A;  2F5W A;  2KF5 A;  4BIR A;  1B3S A;  1ZGX A;  3AHS A;  3KCH A;  1PYL A;  3BIR A;  1RGL A;  1B20 A;  1X1X A;  1B21 A;  2AAD A;  1DET A;  3DGY A;  4J5K A;  6GSP A;  1C54 A;  1TRQ A;  5RNT A;  3URP A;  3WR2 A;  1GMQ A;  3AGN A;  1UCL A;  1BSC A;  1SAR A;  1UCI A;  1BUJ A;  1BOX A;  1I2F A;  1X1U A;  2HOH A;  1GSP A;  2KF3 A;  2RBI A;  1BNS A;  1LNI A;  1RDS A;  4RNT A;  3Q3F A;  9RNT A;  1HYF A;  1GMP A;  4J5G A;  2ZA4 A;  3D4A A;  1AY7 A;  1B2Z A;  1RGG A;  5GSP A;  1RGA A;  1RGC A;  1X1W A;  1B2S A;  1FUT A;  1I0X A;  1RN4 A;  1UCJ A;  7GSP A;  1I8V A;  1BAO A;  1GOY A;  2F5M A;  1BU4 A;  2GSP A;  1B27 A;  7RNT A;  3AHW A;  1TTO A;  3AGO A;  4GHO A;  1BSD A;  1BGS A;  1BNJ A;  2F56 A;  5HOH A;  1BNF A;  1RTU A;  2BU4 A;  1BNG A;  1G02 A;  1RSN A;  3D5G A;  1B2X A;  1LRA A;  3RNT A;  6RNT A;  1AQZ A;  3GSP A;  2SAR A;  1FUS A;  1I2E A;  1RGH A;  1BNR A;  1GOU A;  3BU4 A;  1BNE A;  1BIR A;  1RN1 A;  2RNT A;  2AAE A;  1RHL A;  1JBT A;  1CH0 A;  1RNT A;  1BRS A;  1RMS A;  1BRK A;  1IYY A;  1FZU A;  1UCK A;  5BU4 A;  1I70 A; 
#chains in the Genus database with same CATH topology
 4EV2 A;  4FMD A;  1T2I A;  1U5O A;  2ML6 A;  2SBL A;  3T0U A;  1DMM A;  4BL3 A;  1HZ1 A;  4MEI A;  2CH9 A;  1D6Z A;  1GYB A;  1SJW A;  1LOX A;  4X2H A;  1WMN A;  1G96 A;  2CHC A;  3V92 A;  1OF5 A;  3RGA A;  2F4Y A;  2K54 A;  3OX9 A;  1IVU A;  4HAA A;  3SOY A;  1M9G A;  3HOH A;  1JN5 A;  1IQ8 A;  1UDI I;  1YJN 3;  2IMJ A;  3LTD A;  3M8C A;  4IPB A;  1RRL A;  5FW5 A;  2OTL 3;  4H3U A;  1IQY A;  3UB1 A;  5G1L A;  3LYG A;  2D1W A;  3LML A;  2E2U A;  2LQV A;  3BND A;  3GZR A;  3WHO A;  2OQE C;  1IVV A;  2H0G A;  3VSY A;  2FXT A;  1PFP A;  2RFR A;  3FSD A;  2B1X B;  2IUJ A;  2A15 A;  2GXF A;  1I0V A;  4HZ9 B;  1M1K 4;  1Q82 4;  1YGW A;  4BU4 A;  2PZV A;  5LC6 A;  1VQO 3;  3CNX A;  3ER7 A;  3JUM A;  4J8T A;  4HM0 B;  3IMA B;  2OOV C;  3F14 A;  4JF8 A;  1T5Y A;  3S29 A;  4FCM A;  4KVH A;  5EQL A;  1BRN L;  3FKA A;  4N6M A;  1VZZ A;  4BIR A;  1B3S A;  1YIJ 3;  1FA3 A;  3ALA A;  2XEP A;  4O8S A;  5JPP A;  3MG3 A;  1J2B A;  1OHP A;  2CKF B;  2QEX 3;  4LYL B;  1RGL A;  1U8C B;  3X42 A;  1B21 A;  2AAD A;  1NB5 I;  5KP4 A;  1E3V A;  2XFS A;  3MYT A;  2OWP A;  2GEY A;  1BUJ A;  1CYU A;  3MKI A;  4HM8 B;  3X3X A;  1HU9 A;  1I2F A;  1PU4 A;  1NDO B;  4OUQ A;  1JB5 A;  4RNT A;  2BMR B;  4EC6 A;  3GWR A;  4J5G A;  1K41 A;  3G16 A;  1W2Z A;  3HX8 A;  4K90 B;  1YIT 3;  4EV5 A;  3KE7 A;  1VQ8 3;  5STD A;  1OHS A;  1IQX A;  1RGC A;  3LT9 A;  1FUT A;  1Q40 B;  1I0X A;  1IT7 A;  4EBG A;  7GSP A;  2H0I A;  1VQK 3;  3EF8 A;  5M18 A;  3HK4 A;  3LOY A;  4NRE A;  3EB8 A;  3FG1 A;  3LH4 A;  2GSP A;  4LZI A;  1QAF A;  1B27 A;  1GD3 A;  2IYJ A;  3VGN A;  3AHW A;  7RNT A;  1TTO A;  3NQZ A;  1BGS A;  1BNJ A;  1HKX A;  4MMZ B;  1OUN A;  2CW9 A;  4BTY A;  2RGQ A;  3G71 3;  1NU3 A;  4GB5 A;  2YX9 A;  1RJO A;  4HM2 B;  1BNG A;  1GD4 A;  2RSX A;  4MMX B;  1RSN A;  3S27 A;  1LQG C;  3BNE A;  1FGO A;  1JB4 A;  5IEO A;  3NX0 A;  2CIU A;  3CCQ 3;  3EBT A;  3GSP A;  4FMA A;  2QGU A;  1RKY A;  3EN1 B;  2KXG A;  1FUW A;  1DYU A;  1BNE A;  1W01 A;  3BNB A;  5M1A A;  4DKI A;  2AAE A;  1RHL A;  1OGZ A;  1CH0 A;  2XSO B;  1VQP 3;  2CK3 H;  2CX1 A;  3GRD A;  1FZU A;  5KP1 A;  5CF2 A;  5IG0 A;  1W4N A;  4GSP A;  1TRP A;  4XB5 A;  3CCS 3;  1A2V A;  3K7C A;  5IF6 A;  2GU3 A;  1JBR A;  2PNC A;  3S5C A;  1JBS A;  1EG9 B;  1OF5 B;  1IK3 A;  3KFQ C;  5I97 A;  1BRJ A;  3X40 A;  4LMI A;  1US1 A;  3UJM A;  3OWY A;  3MWZ A;  3PZW A;  4WWU C;  3DGO A;  1MGR A;  1YVS A;  4HYZ A;  1BNI A;  2FNQ A;  3N8B A;  2E2V A;  6STD A;  3CMA 3;  5DRV A;  1O7H B;  2V1L A;  1RNB A;  1V58 A;  1FGT A;  1GS3 A;  3TDG A;  8RNT A;  1GY5 A;  3PS8 A;  3CME 3;  3CCM 3;  3NBJ A;  3CCJ 3;  3EC9 A;  1MWU A;  3D9R A;  1QAK A;  2UUG C;  3Q2P A;  3GZY B;  2KAA A;  2W9Q A;  2KF4 A;  4HOH A;  1Z1S A;  3BNC A;  5CLK A;  4CJN A;  1RLS A;  2L1S A;  3FGY A;  4WHA A;  3I55 3;  2ZL8 A;  3U97 A;  3CCU 3;  4CCV A;  1ASK A;  1R4C A;  1BRI A;  2W9P A;  2QA4 3;  4XDV A;  1JZO A;  2XGN A;  3CNM A;  1RGF A;  5KP3 A;  1L5G B;  3J7Y d;  1KD1 4;  3D3L A;  1NO3 A;  1OHO A;  2CG0 A;  1NJI 4;  4HM3 B;  1X1Y A;  3DH2 A;  2Z76 A;  1YHQ 3;  3OWS A;  3S28 A;  1WTH A;  1A67 A;  1ROA A;  2HMJ B;  1N5H A;  1RCK A;  1B2U A;  2CC3 A;  3H3H A;  3BLZ A;  3CCE 3;  3AHS A;  4AEQ A;  3STD A;  1BUQ A;  1RN7 A;  3QK9 A;  4FMC A;  3CPO A;  1W6C A;  2O9U X;  1GY6 A;  3F8H A;  3OXA A;  1YJ9 3;  3ZG5 A;  4NHF A;  1MNL A;  1KSI A;  2WOF A;  1S72 3;  3DMC A;  3AGN A;  1BSC A;  2HMK B;  2JQ5 A;  3JUN A;  5AYS C;  1BOX A;  3MHE A;  2CFD A;  2UGI A;  2BO9 B;  2HOH A;  3FF0 A;  2KF3 A;  3NBB A;  3DGL A;  2H0H A;  1GMP A;  1TJD A;  2CG1 A;  1TFO A;  1OPY A;  3WMD A;  3LXU X;  3T8U A;  2W03 A;  2MC8 A;  3KKG A;  4QWT A;  5AIF A;  1VQQ A;  4KFD A;  1QAL A;  3DY5 A;  4R1K A;  3BB9 A;  3KII A;  1SPU A;  1STF I;  3FZW A;  1BAO A;  2OTJ 3;  3EBY A;  1Q7H A;  1V57 A;  4GL6 A;  2W2C A;  4I5Q A;  3SX1 A;  1BU4 A;  1UI8 A;  3JUP A;  4HKV B;  3WOF B;  3WOD G;  5LC7 A;  1K8A 4;  3FH1 A;  1MOL A;  1TUH A;  3EQQ B;  1SQW A;  5BVB A;  1M90 4;  3F7S A;  1UUW B;  1ZS7 A;  3K9M C;  5IG3 A;  4NPB A;  3Q1C A;  4H61 A;  2BU4 A;  1CQS A;  2GBW B;  2P0M A;  3NXJ A;  5ELJ A;  4BTX A;  3D5G A;  1B2X A;  4IT7 A;  6RNT A;  3HZP A;  3NM2 A;  1S5A A;  4J9A A;  4Q53 A;  2P38 A;  1FUS A;  1N9J A;  1RGH A;  4XBT A;  4ZM8 A;  5IG5 A;  1GOU A;  3I56 3;  3D79 A;  3E99 A;  1FGM A;  3S67 A;  1KQS 2;  1JB2 A;  3WA3 A;  2BHM A;  2WGQ A;  2W6J H;  1IVX A;  5AYR B;  5AIG A;  2W56 B;  1BRS A;  1RMS A;  1JZD A;  2BMQ B;  1BRK A;  2XGL A;  1VQ9 3;  1IV9 A;  1W6G A;  1Q81 4;  2GEX A;  2Z6B A;  3HIG A;  3MPH A;  1UCK A;  1Y4K A;  5BU4 A;  2XFT A;  1E97 A;  1RGE A;  4N6T A;  3OV4 A;  1RRH A;  3NHX A;  3IJE B;  3SLU A;  1BSB A;  1EKM A;  3MSO A;  1VQ4 3;  1MGW A;  1O7M B;  3LT8 A;  4HM6 B;  2Q07 A;  4XM4 A;  2GU1 A;  3RGR A;  5IEP A;  1FYS A;  4WYK B;  5BIR A;  1DE3 A;  1BRG A;  3EN8 A;  1K28 A;  1O7N B;  2INX A;  1QVG 2;  1LQM B;  1BAN A;  1GMR A;  1LOY A;  3A5E A;  3DUK A;  4WYK A;  3UL6 A;  1NWW A;  3KZT A;  3F40 A;  1O7G B;  3G4S 3;  1BSA A;  1N9E A;  1O7W B;  3FG4 A;  1LXE A;  4HVN A;  4N6L A;  5CF1 A;  1Q7Y 4;  2K0M A;  3CXC 2;  4OK0 A;  2STD A;  3A76 A;  1GOV A;  2J8X B;  2XR8 B;  4LEH A;  1DMN A;  3NM7 A;  4R4K A;  1EA2 A;  1OGX A;  3EHC A;  4TX4 A;  4XDW A;  3SYU A;  3QRD A;  2BNG A;  2C10 A;  3N54 B;  1RCL A;  4K1U A;  1RGK A;  3U1W A;  1AVL A;  1GY7 A;  1BVI A;  1E3R A;  3Q90 A;  1BSE A;  3PGB A;  4HM5 B;  2UX0 A;  2I9W A;  2JDI H;  5D82 A;  3X3Y A;  5D83 A;  3CC4 3;  2KF6 A;  1W7C A;  4EW5 A;  2OQE A;  5D81 A;  3CU3 A;  1A2P A;  2F5W A;  1T2H A;  2CFG A;  3LZA A;  4CDL A;  4WP5 A;  3CD6 3;  1A90 A;  4X2O A;  3GZB A;  2RCD A;  2R41 A;  2CFL A;  3KCH A;  3X3Z A;  1PYL A;  3DGN A;  3BIR A;  3OWU A;  3RDE A;  1Q86 4;  3F8X A;  1B20 A;  1X1X A;  1Q42 A;  3PYJ A;  4J5K A;  8CHO A;  1DET A;  3DGY A;  3KSP A;  1VQN 3;  2FGT A;  6GSP A;  1AR0 A;  4FR9 A;  1ISK A;  3I0Y A;  3G8Z A;  3CCR 3;  1OH0 A;  4CPK A;  1K73 4;  1SAR A;  1DVD A;  5AEU B;  2P05 A;  4L7K A;  3V98 A;  2W56 A;  1VQ7 3;  3SXX A;  1UUG B;  2GBX B;  1GSP A;  1WMP A;  1ULI B;  1BNS A;  1LNI A;  2RBI A;  3GAX A;  3H51 A;  4IIA A;  4KZ1 A;  1T3B A;  4FCZ A;  5EEO A;  2OOV A;  1CYV A;  2ZA4 A;  5A0O B;  1G0T A;  1EUI C;  1JN5 B;  2O3O A;  1D6Y A;  1IVW A;  1X1W A;  1AVK A;  1B2S A;  1NNV A;  3B8L A;  1LVN A;  3K0Z A;  1W5Z A;  4O02 B;  1RN4 A;  1UCJ A;  1JNQ A;  3DZL A;  3LTB A;  1I8V A;  2F5M A;  4HZB B;  5DRE A;  2OCT A;  2YFL B;  3JVC A;  4K1V A;  3ZG0 A;  3K63 A;  3SVA A;  2C11 A;  1LNH A;  3ECF A;  4RZM A;  3AGO A;  1BSD A;  3JUO A;  2P0X A;  2F56 A;  2HMO B;  4G1M B;  2K3D A;  1N5P A;  1RTU A;  1ULJ B;  1TIJ A;  4KFF A;  3CCV 3;  1W00 A;  1UGI A;  4PEJ A;  1G02 A;  1DMQ A;  3N9H A;  4HJL B;  3SOA A;  1LRA A;  3RNT A;  2LYX A;  2SAR A;  3LTA A;  1ZO2 A;  4LGQ A;  3HII A;  3K5T A;  4N6U A;  1YJW 3;  4U13 A;  3BU4 A;  3CCL 3;  2Z7A A;  1IDP A;  1BIR A;  1STD A;  3LTC A;  1YGE A;  1MWR A;  2CWV A;  4STD A;  4FCJ A;  4AKZ A;  5IG4 A;  3PXM A;  2B24 B;  1W6Y A;  1TU5 A;  3X41 A;  1QJG A;  4N3V A;  5FGO A;  5CXO A;  1TFK A;  1IYY A;  3WA2 X;  3B7C A;  1VQ6 3;  1ZX2 A;  4XBX A;  3EE1 A;  3AMO A;  1I70 A;  3NQY A;  4XBY A;  2F86 B;  1R4Y A;  1KWI A;  4BL2 A;  1JJ2 2;  1FGQ A;  3GZX B;  2IUK A;  1MWT A;  3B4O A;  2CX0 A;  3DGM A;  5BXQ A;  1CEW I;  3ROB A;  1BRH A;  1I2G A;  3D5I A;  3FF2 A;  1QVF 2;  1I3F A;  4R9L A;  4RBN A;  1YNV X;  5JPU A;  1YI2 3;  1LOV A;  5AIH A;  2WOH A;  1W02 A;  4HBR A;  4I4K A;  5ELU A;  1SII A;  1PY3 A;  4OVM A;  1Q9E A;  3CPW 2;  1M1X B;  5HGR A;  1IT8 A;  1IU7 A;  2CWT A;  3L0R A;  3F7X A;  2XF3 A;  1B2M A;  2BMO B;  1ROV A;  2C4B A;  2F99 A;  3NUV A;  3NV0 B;  1UUV B;  1KC8 4;  1UGH I;  2IA7 A;  5AEW B;  4FMB A;  4RNZ A;  3VF1 A;  1UW1 A;  4KFE A;  1I3I A;  1YVB I;  2BIR A;  3IPT A;  4EYC A;  1OCV A;  2HML B;  1EEJ A;  3DXO A;  5EVH A;  3SED A;  1JV2 B;  1VQL 3;  4O3V A;  1V74 A;  1DVC A;  2ZDJ A;  5JBS A;  1LOW A;  4O2H A;  4MJD A;  1F8N A;  1FW7 A;  3KN4 A;  5CK6 A;  2KF5 A;  2P09 A;  2XRX B;  2CWU A;  1JRQ A;  1ZGX A;  3MG1 A;  4N6V 0;  1C7H A;  4HM1 B;  3CC7 3;  3AMO B;  4BTW A;  4HM4 B;  1QMA A;  3WDG B;  3EJV A;  3PCR A;  9RNT A;  4N6N B;  4HM7 B;  2Y73 A;  5AII A;  1TRQ A;  1C54 A;  3CC2 3;  5RNT A;  3URP A;  5IW9 A;  3WR2 A;  1D6U A;  1GMQ A;  3NV0 A;  1JKG B;  1UCL A;  3UNL A;  5M19 A;  1UCI A;  4K61 A;  2BT3 A;  4ORL A;  4N6O B;  1JKG A;  2XH9 A;  1X1U A;  5IER A;  2YFI B;  2WO0 A;  1SIH A;  1RDS A;  4EXR A;  2XSH B;  3EX9 A;  1HYF A;  2HMM B;  3Q3F A;  3G0K A;  3D4A A;  1AY7 A;  1FGR A;  1B2Z A;  1Q40 A;  1RGG A;  2KRT A;  4ILF A;  5GSP A;  2W04 A;  2CFW A;  7STD A;  4MMY B;  1RGA A;  1VQM 3;  5G1K A;  3OW2 2;  2Z77 A;  1GOY A;  4L8P A;  2M7O A;  2QIY A;  3O8Y A;  3ZFZ A;  3JUQ A;  3FG3 A;  1AV4 A;  1WQL B;  1NB3 I;  4AKY A;  1EQK A;  1A2K A;  5G2G A;  4GHO A;  2F98 A;  2Y74 A;  1W2B 2;  4RNY A;  3WOE B;  4L8O A;  5TGN A;  1BNF A;  5HOH A;  1K9M 4;  3DM8 A;  3HI7 A;  3B4P A;  1UI7 A;  1OAC A;  1TP6 A;  2HMN B;  2WGO A;  2D42 A;  2L4V A;  2MF7 A;  1AQZ A;  3F9S A;  4JRF A;  3MG2 A;  3T8N A;  3NBR A;  1I2E A;  5IEN A;  1BNR A;  1O7P B;  3KSE D;  3UL5 A;  1IV7 A;  2R4I A;  4LSO A;  1N8R 4;  1VQ5 3;  2E2T A;  4R9K A;  2W0Q A;  3PCS A;  1RN1 A;  2RNT A;  1JBT A;  2KCD A;  5AI1 A;  3V99 A;  1WMO A;  1WNH A;  1RNT A;  3G6E 3;  2CFK A;  1N8Q A;  4KT3 B;  2ML5 A;  4WFO A;  1MWS A;  2YFJ B;  3FLJ A;  3FCS B;  4R80 A;  2ZHX B;  2IY2 A; 
#chains in the Genus database with same CATH homology
 4GSP A;  1TRP A;  1T2I A;  1RGE A;  1HZ1 A;  1R4Y A;  1JBR A;  1BSB A;  1JBS A;  1MGW A;  1BRJ A;  1BRH A;  1I2G A;  3D5I A;  1FYS A;  5BIR A;  1I3F A;  2F4Y A;  4HAA A;  1MGR A;  1YVS A;  1DE3 A;  1BNI A;  1YNV X;  3HOH A;  1BRG A;  1LOV A;  1LOY A;  1BAN A;  1GMR A;  3A5E A;  1RNB A;  8RNT A;  1PY3 A;  1Q9E A;  1BSA A;  2KAA A;  1GOV A;  1B2M A;  2KF4 A;  4HOH A;  2C4B A;  3WHO A;  3SYU A;  1RLS A;  1RCL A;  1RGK A;  1BRI A;  1BVI A;  1I3I A;  1I0V A;  1RGF A;  1BSE A;  2BIR A;  1YGW A;  4BU4 A;  1X1Y A;  3DH2 A;  2KF6 A;  1LOW A;  1BRN L;  1FW7 A;  1RCK A;  1B2U A;  1A2P A;  1T2H A;  2F5W A;  2KF5 A;  4BIR A;  1B3S A;  1ZGX A;  3AHS A;  3KCH A;  1PYL A;  3BIR A;  1RGL A;  1B20 A;  1X1X A;  1B21 A;  2AAD A;  1DET A;  3DGY A;  4J5K A;  6GSP A;  1C54 A;  1TRQ A;  5RNT A;  3URP A;  3WR2 A;  1GMQ A;  3AGN A;  1UCL A;  1BSC A;  1SAR A;  1UCI A;  1BUJ A;  1BOX A;  1I2F A;  1X1U A;  2HOH A;  1GSP A;  2KF3 A;  2RBI A;  1BNS A;  1LNI A;  1RDS A;  4RNT A;  3Q3F A;  9RNT A;  1HYF A;  1GMP A;  4J5G A;  2ZA4 A;  3D4A A;  1AY7 A;  1B2Z A;  1RGG A;  5GSP A;  1RGA A;  1RGC A;  1X1W A;  1B2S A;  1FUT A;  1I0X A;  1RN4 A;  1UCJ A;  7GSP A;  1I8V A;  1BAO A;  1GOY A;  2F5M A;  1BU4 A;  2GSP A;  1B27 A;  7RNT A;  3AHW A;  1TTO A;  3AGO A;  4GHO A;  1BSD A;  1BGS A;  1BNJ A;  2F56 A;  5HOH A;  1BNF A;  1RTU A;  2BU4 A;  1BNG A;  1G02 A;  1RSN A;  3D5G A;  1B2X A;  1LRA A;  3RNT A;  6RNT A;  1AQZ A;  3GSP A;  2SAR A;  1FUS A;  1I2E A;  1RGH A;  1BNR A;  1GOU A;  3BU4 A;  1BNE A;  1BIR A;  1RN1 A;  2RNT A;  2AAE A;  1RHL A;  1JBT A;  1CH0 A;  1RNT A;  1BRS A;  1RMS A;  1BRK A;  1IYY A;  1FZU A;  1UCK A;  5BU4 A;  1I70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...