2BIRA

Additivity of substrate binding in ribonuclease t1 (y42a mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKANNYEGFAFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Additivity of protein-guanine interactions in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Ribonuclease
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2birA00
5BU4A 3A5EA 2KF5A 2RNTA 1BGSA 1TTOA 1G02A 1BNSA 1X1UA 1GMQA 7RNTA 1B20A 4GHOA 1BANA 1RDSA 2GSPA 1YNVX 1AQZA 1I2GA 2C4BA 1LOVA 1PY3A 1I0XA 1GOVA 1LNIA 3BIRA 3HOHA 4GSPA 1HZ1A 2KF3A 1BU4A 1UCLA 9RNTA 1UCKA 1B2ZA 1I3IA 3GSPA 1TRQA 1I0VA 1BSCA 1T2IA 1PYLA 1BNFA 1X1YA 3Q3FA 3RNTA 1GOYA 3AHSA 1UCIA 1GMRA 2SARA 1RN4A 1HYFA 1B2UA 1BRKA 1FZUA 1RCKA 1FUTA 3AGNA 1BOXA 1B3SA 1YGWA 1RHLA 2KF4A 1BIRA 8RNTA 1R4YA 3SYUA 2F5MA 5GSPA 4RNTA 1BRSA 1GMPA 1SARA 1YVSA 6GSPA 1BRNL 1BSBA 1IYYA 1I2EA 2ZA4A 3AGOA 1ZGXA 1RGKA 1RMSA 1BAOA 1I8VA 3KCHA 3URPA 1GOUA 2RBIA 3D5IA 1Q9EA 4J5GA 4BU4A 1BSDA 1JBSA 1FW7A 1RNBA 1C54A 1CH0A 1RLSA 1BNJA 2F4YA 1T2HA 3DGYA 2AADA 1RGEA 1JBTA 1UCJA 1LRAA 1B27A 1BRHA 1I70A 1RGAA 1RGLA 1RN1A 3WR2A 1B2SA 3D5GA 1RGHA 1I2FA 2F5WA 1DETA 1B2MA 1X1WA 1I3FA 6RNTA 1X1XA 1AY7A 2AAEA 4BIRA 1FUSA 1B2XA 4HOHA 1A2PA 1FYSA 2HOHA 3DH2A 1RGFA 1LOWA 4HAAA 1JBRA 1MGWA 1B21A 1MGRA 1RTUA 3WHOA 5HOHA 1BRJA 1BNRA 5RNTA 1LOYA 1RGCA 2KAAA 1BRGA 2F56A 1RSNA 7GSPA 3AHWA 1DE3A 1BUJA 1BNIA 1BSAA 1BNGA 3BU4A 2BU4A 1BSEA 1BVIA 1BNEA 1RGGA 1BRIA 1RCLA 5BIRA 2BIRA 1RNTA 1TRPA 3D4AA 1GSPA 2KF6A 4J5KA
chains in the Genus database with same CATH superfamily
5EQLA 1Q864 2OTL3 3B4PA 4CJNA 3CNXA 1TTOA 1SPUA 1RRHA 2Z6BA 1V57A 3GZBA 2CFWA 3ALAA 1BANA 4XDVA 2XFSA 5JBSA 3G8ZA 3O8YA 2Q07A 1TP6A 2CX0A 2GSPA 3BNBA 2CKFB 1IVWA 2GU1A 1K734 1PY3A 1IU7A 1GOVA 2OOVC 2H0HA 2P09A 3HI7A 2KF3A 1UCLA 5G2GA 1ZX2A 3WMDA 1TRQA 4Q53A 5IG4A 3NBRA 2F86B 4L8PA 3SOYA 1E3RA 3RNTA 4K90B 3AMOB 4BL2A 3SOAA 2OQEC 1GOYA 1OGXA 2XF3A 3M8CA 2CHCA 2SARA 1ROAA 3FLJA 1Q40B 3DGMA 3I0YA 1FA3A 2KCDA 1DYUA 3OV4A 2C10A 2L4VA 3AGNA 3BNCA 5G1KA 2F5MA 2FGTA 5GSPA 1VQM3 1GMPA 1W00A 4CPKA 3CCV3 3IPTA 3LT9A 5CF2A 2CK3H 2HMMB 5D82A 3DM8A 4KFFA 2ZA4A 1Q42A 2R41A 1ZGXA 1QVG2 5IEPA 4EBGA 1DMNA 3NUVA 1I8VA 2BMRB 2ML6A 4HM6B 3URPA 3ZG5A 4HM4B 2ZL8A 2RBIA 4WFOA 1M1XB 2D1WA 4BL3A 4I5QA 4I4KA 3DY5A 1EA2A 3U97A 1FW7A 1RNBA 2HMOB 2ZHXB 2UUGC 2F4YA 2CFLA 2CG0A 3MKIA 2AADA 3BNDA 3I563 1OUNA 1SJWA 3G6E3 1BRHA 1MWRA 3BB9A 1RGAA 2WOHA 5KP4A 4LMIA 4X2HA 3GWRA 3CNMA 3GZXB 1RGHA 5CF1A 1OH0A 1DETA 1HU9A 1X1XA 3DGOA 1W5ZA 3CPW2 8CHOA 4J8TA 1B2XA 1HKXA 3IJEB 4HOHA 3H3HA 1JJ22 4O02B 2PZVA 3DMCA 3DH2A 3KE7A 1CYVA 3MYTA 1RTUA 3EE1A 4MMYB 4WP5A 3N54B 1UI7A 5JPPA 5HOHA 3DGNA 5IEOA 3RGRA 2XEPA 3PYJA 1QJGA 4FMAA 1YJ93 1VQN3 1VQ53 1QALA 2FXTA 3G0KA 1MWTA 2Y74A 3PCRA 4J9AA 3BU4A 4MMZB 3STDA 1QVF2 3OXAA 4AEQA 1BUQA 3NV0A 1BSEA 1BVIA 1JB5A 1BNEA 2SBLA 1VQ43 3RGAA 3OX9A 5ELUA 1D6UA 1RNTA 5CLKA 3B7CA 1JNQA 4LSOA 3T8UA 1UUGB 2KF6A 4BTXA 5KP3A 2E2UA 1DMQA 3LTAA 3Q2PA 2IMJA 2CFGA 3G16A 3HZPA 3OWUA 2W9QA 2Y73A 1BNSA 2O9UX 4HM0B 4EXRA 2HMJB 2RCDA 1N5PA 4L7KA 1STDA 2CFKA 7RNTA 1NJI4 1B20A 1KQS2 3LT8A 3GAXA 1ISKA 4K1VA 1ZO2A 2W2CA 4JF8A 4X2OA 5IENA 1K9M4 3MSOA 2C4BA 4HJLB 1YHQ3 1DVDA 3FG4A 3HOHA 4GSPA 3OWYA 1US1A 1PU4A 2GU3A 1GY7A 3CU3A 1UDII 4KFEA 1YIJ3 1I0VA 1LQMB 2XR8B 1IT7A 3S28A 3JUOA 5EEOA 1MOLA 3ROBA 3A76A 2P05A 1WTHA 4EV5A 2LQVA 1BNFA 3Q3FA 1EUIC 2E2VA 1VQQA 3UJMA 1UCIA 2GXFA 2WO0A 3FF2A 1GMRA 3KSED 1RN4A 3HX8A 1B2UA 1BRKA 1W2ZA 1NU3A 4N6UA 1RCKA 5D83A 3T0UA 3X3ZA 1FUTA 1BOXA 1EKMA 2OWPA 1YGWA 3QRDA 3N9HA 3SYUA 3J7Yd 1TFKA 4IT7A 3T8NA 3FH1A 1ROVA 1UUWB 3B8LA 3Q90A 4K61A 1AVKA 3HK4A 3OW22 1RN7A 2BNGA 4IIAA 1OPYA 4HM3B 4XM4A 1YJW3 1NB5I 4R1KA 2BHMA 1OF5A 1WNHA 1OHPA 3KCHA 4KFDA 1N9JA 1JN5B 3D5IA 4G1MB 3CCU3 5AYSC 4J5GA 4N6OB 3CPOA 1GY6A 2M7OA 1IV9A 3FF0A 4LEHA 3G4S3 1JBSA 1G0TA 3S67A 4XBTA 1L5GB 2B1XB 1T2HA 1JKGA 1E97A 5CXOA 1IK3A 2JQ5A 3CCJ3 2YX9A 1VQP3 3F14A 1B27A 4HBRA 1RN1A 1D6YA 3WR2A 3DGLA 1NB3I 1CQSA 2F5WA 1KWIA 3CMA3 1V74A 3VGNA 3ECFA 4BIRA 1E3VA 1F8NA 5IG5A 1ZS7A 3PZWA 1FYSA 3JVCA 3LTDA 4OUQA 3EQQB 1FGQA 1YIT3 5AI1A 1MGWA 1MGRA 1NWWA 1ULJB 5ELJA 2KXGA 5G1LA 3FGYA 3GRDA 5RNTA 1LOYA 2RSXA 1RGCA 1KSIA 1BRGA 2KAAA 2WOFA 1RSNA 1W02A 3F8HA 3X41A 2OCTA 7GSPA 2P0MA 1T3BA 3LTBA 1BUJA 1OHSA 4N6MA 4U13A 3SEDA 2GEYA 5EVHA 2XFTA 4L8OA 2Z77A 6STDA 3K63A 4HZBB 1BRIA 3F9SA 2H0GA 1RCLA 1VQ73 3HIGA 4N3VA 2W0QA 1GD4A 4R9LA 2QGUA 3NM7A 5M19A 3LYGA 1GY5A 1U5OA 4NHFA 3EBTA 3UL6A 1WQLB 3EF8A 1G96A 3TDGA 1JRQA 1G02A 3NQYA 4NREA 4HYZA 1X1UA 4CDLA 1EEJA 2JDIH 1N9EA 1GMQA 1LVNA 1Q7HA 3JUQA 3FZWA 1OF5B 4N6TA 4RZMA 2Z7AA 5D81A 1AV4A 4GHOA 1RDSA 2K0MA 2W56A 4FCZA 5STDA 2INXA 1S5AA 3V92A 3X3XA 5TGNA 4O2HA 3D9RA 3PXMA 1AQZA 1I2GA 3LXUX 1LOVA 4HM2B 1I0XA 1LNIA 3BIRA 1HZ1A 5AEWB 3LZAA 4H3UA 3GZRA 5DREA 1UCKA 9RNTA 1I3IA 1IDPA 3NM2A 3FCSB 3H51A 3V99A 4K1UA 2R4IA 3EC9A 3JUNA 4FCJA 3FSDA 4HZ9B 1O7HB 2YFIB 4OK0A 1OACA 1X1YA 4QWTA 4LZIA 3WODG 2KRTA 5BXQA 3PS8A 3F7SA 3AHSA 4R80A 2V1LA 1QAFA 4RNZA 3V98A 1IT8A 4CCVA 5LC7A 3WA2X 3WOEB 2CWUA 1Z1SA 2QIYA 3EHCA 3UB1A 2F98A 5CK6A 1FGRA 1MWSA 1RHLA 2KF4A 1BIRA 3BNEA 2XH9A 4XBYA 4RNTA 4XB5A 1BRNL 6GSPA 1YVSA 1K28A 1R4CA 3LH4A 3AMOA 2QEX3 1FGTA 3D79A 3MHEA 1VQ93 1IYYA 3KZTA 1Q40A 2PNCA 5AIGA 2H0IA 3F40A 5IW9A 3KKGA 4WYKA 4MMXB 4RBNA 4O8SA 1RMSA 4AKYA 4FMBA 3CD63 1BAOA 1JV2B 1NDOB 4R9KA 1RKYA 4AKZA 4HM1B 4FMCA 3L0RA 4BU4A 1UW1A 2CW9A 4LYLB 2UGIA 1SQWA 1C54A 1CH0A 2CWTA 1MNLA 1BNJA 1LXEA 3NXJA 1RGEA 3NBBA 3EBYA 1LRAA 3KSPA 3CCQ3 3K5TA 1W6GA 1B2SA 1O7NB 1GS3A 5BVBA 2D42A 4ILFA 3D5GA 1KD14 3K7CA 4MJDA 2OOVA 1B2MA 3GZYB 1I3FA 1Y4KA 4FR9A 4ZM8A 4HM5B 2CFDA 2CC3A 3VF1A 3CCR3 1RRLA 3QK9A 3S29A 3FKAA 2HOHA 3NV0B 1M9GA 1M904 4EW5A 1LOWA 4HAAA 2UX0A 5FGOA 2B24B 3EX9A 3UL5A 1K41A 3WHOA 1JBRA 1BRJA 2OQEA 1AVLA 5AIFA 2YFJB 4KT3B 2CX1A 3WOFB 1WMPA 3CME3 2F56A 3KFQC 4O3VA 5DRVA 1DE3A 4FMDA 7STDA 1BNIA 1BSAA 1W4NA 3NQZA 1TFOA 2RGQA 3CCM3 3CCL3 2BU4A 3B4OA 3K0ZA 2CIUA 1Q814 1VQL3 3PCSA 1VZZA 3SXXA 1DVCA 2BIRA 3OWSA 3S27A 2XGNA 4WHAA 1KC84 3SVAA 3D4AA 1GSPA 1VQO3 2IUKA 5BU4A 3A5EA 2KF5A 5IG0A 2RNTA 1BGSA 1D6ZA 5FW5A 1O7WB 2W04A 1N8R4 3X42A 4EYCA 1TU5A 1MWUA 2HMLB 1TJDA 5M1AA 5A0OB 4WYKB 3MG1A 3NX0A 1IVXA 3RDEA 4NPBA 2XGLA 3DZLA 1LQGC 3F8XA 3IMAB 4FCMA 3VSYA 3CC73 2W9PA 4GB5A 2F99A 4BTWA 1AR0A 1T5YA 2GBWB 3LMLA 1VQK3 4GL6A 3WDGB 2HMNB 1IV7A 1YVBI 4OVMA 3X40A 1OCVA 1FGMA 1IVVA 1YNVX 3HIIA 3CCS3 2XSOB 1JZDA 1BU4A 1SIIA 2WGQA 1B2ZA 3E99A 3GSPA 1JB2A 4HM8B 1STFI 1BSCA 3JUMA 1T2IA 3LTCA 1QMAA 3MPHA 4LGQA 1UUVB 2LYXA 3BLZA 2Z76A 3CC43 2CG1A 1PYLA 2BMOB 3N8BA 2RFRA 3FG3A 1Q824 3ER7A 3FG1A 4BTYA 1HYFA 1V58A 1FZUA 4JRFA 5IG3A 1YJN3 2J8XB 3KIIA 2ML5A 1IQYA 1B3SA 1ASKA 2IA7A 2IYJA 2W6JH 8RNTA 1R4YA 1OHOA 2HMKB 5AIIA 1TUHA 1O7PB 1A67A 2BMQB 5KP1A 1BRSA 1SARA 1A90A 1BSBA 1LOXA 1YI23 1GYBA 3NBJA 2IUJA 1WMNA 4XDWA 1I2EA 4HVNA 5AYRB 3AGOA 1A2KA 2K54A 4WWUC 1JKGB 1RGKA 1M1K4 1TIJA 4HM7B 1FGOA 3CXC2 1VQ63 2CWVA 3S5CA 4HKVB 4R4KA 3X3YA 4DKIA 1A2VA 2C11A 1IVUA 1GOUA 2XRXB 3D3LA 3EJVA 5HGRA 1EG9B 3EN8A 1Q9EA 1CEWI 2I9WA 3U1WA 1BSDA 4STDA 2QA43 2GEXA 4EC6A 3G713 1RLSA 1ULIB 1UI8A 4KZ1A 1UGIA 2W03A 3SLUA 2K3DA 4PEJA 5IERA 3DGYA 1Q7Y4 2BT3A 1JBTA 1UCJA 1YGEA 2O3OA 3CC23 1NNVA 3DUKA 1SIHA 1I70A 3SX1A 1RGLA 2MC8A 5M18A 1JB4A 4H61A 3CCE3 5AEUB 1J2BA 1OGZA 3DXOA 3MWZA 2GBXB 1JN5A 2XSHB 2ZDJA 3MG3A 3ZFZA 4N6LA 5IF6A 1I2FA 1O7GB 1JZOA 1O7MB 1IQXA 2WGOA 4MEIA 3WA3A 3UNLA 1VQ83 1X1WA 3ZG0A 1W6YA 3JUPA 6RNTA 2AAEA 1AY7A 3K9MC 1UGHI 3MG2A 1FUSA 1NO3A 3Q1CA 3LOYA 2L1SA 1A2PA 1S723 4RNYA 4TX4A 1RGFA 4KVHA 1LNHA 3F7XA 1B21A 2YFLB 1GD3A 1K8A4 1PFPA 1WMOA 2P38A 3KN4A 1BNRA 3PGBA 1FUWA 1CYUA 1W7CA 2P0XA 3NHXA 2OTJ3 3AHWA 1W2B2 3I553 1BNGA 2E2TA 4IPBA 1N8QA 4EV2A 1N5HA 5I97A 2STDA 1DMMA 1C7HA 5LC6A 1IQ8A 1W01A 2IY2A 1U8CB 3EN1B 4N6NB 5AIHA 1RGGA 2FNQA 2MF7A 3EB8A 1RJOA 1W6CA 5BIRA 2BO9B 5JPUA 1QAKA 1TRPA 2W56B 4ORLA 2CH9A 4XBXA 4J5KA 1EQKA 4N6V0 2A15A
chains in the Genus database with same CATH topology
5BU4A 3A5EA 2KF5A 2RNTA 1BGSA 1TTOA 1G02A 1BNSA 1X1UA 1GMQA 7RNTA 1B20A 4GHOA 1BANA 1RDSA 2GSPA 1YNVX 1AQZA 1I2GA 2C4BA 1LOVA 1PY3A 1I0XA 1GOVA 1LNIA 3BIRA 3HOHA 4GSPA 1HZ1A 2KF3A 1BU4A 1UCLA 9RNTA 1UCKA 1B2ZA 1I3IA 3GSPA 1TRQA 1I0VA 1BSCA 1T2IA 1PYLA 1BNFA 1X1YA 3Q3FA 3RNTA 1GOYA 3AHSA 1UCIA 1GMRA 2SARA 1RN4A 1HYFA 1B2UA 1BRKA 1FZUA 1RCKA 1FUTA 3AGNA 1BOXA 1B3SA 1YGWA 1RHLA 2KF4A 1BIRA 8RNTA 1R4YA 3SYUA 2F5MA 5GSPA 4RNTA 1BRSA 1GMPA 1SARA 1YVSA 6GSPA 1BRNL 1BSBA 1IYYA 1I2EA 2ZA4A 3AGOA 1ZGXA 1RGKA 1RMSA 1BAOA 1I8VA 3KCHA 3URPA 1GOUA 2RBIA 3D5IA 1Q9EA 4J5GA 4BU4A 1BSDA 1JBSA 1FW7A 1RNBA 1C54A 1CH0A 1RLSA 1BNJA 2F4YA 1T2HA 3DGYA 2AADA 1RGEA 1JBTA 1UCJA 1LRAA 1B27A 1BRHA 1I70A 1RGAA 1RGLA 1RN1A 3WR2A 1B2SA 3D5GA 1RGHA 1I2FA 2F5WA 1DETA 1B2MA 1X1WA 1I3FA 6RNTA 1X1XA 1AY7A 2AAEA 4BIRA 1FUSA 1B2XA 4HOHA 1A2PA 1FYSA 2HOHA 3DH2A 1RGFA 1LOWA 4HAAA 1JBRA 1MGWA 1B21A 1MGRA 1RTUA 3WHOA 5HOHA 1BRJA 1BNRA 5RNTA 1LOYA 1RGCA 2KAAA 1BRGA 2F56A 1RSNA 7GSPA 3AHWA 1DE3A 1BUJA 1BNIA 1BSAA 1BNGA 3BU4A 2BU4A 1BSEA 1BVIA 1BNEA 1RGGA 1BRIA 1RCLA 5BIRA 2BIRA 1RNTA 1TRPA 3D4AA 1GSPA 2KF6A 4J5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BU4 A;  3A5E A;  2KF5 A;  2RNT A;  1BGS A;  1TTO A;  1G02 A;  1BNS A;  1X1U A;  1GMQ A;  7RNT A;  1B20 A;  4GHO A;  1BAN A;  1RDS A;  2GSP A;  1YNV X;  1AQZ A;  1I2G A;  2C4B A;  1LOV A;  1PY3 A;  1I0X A;  1GOV A;  1LNI A;  3BIR A;  3HOH A;  4GSP A;  1HZ1 A;  2KF3 A;  1BU4 A;  1UCL A;  9RNT A;  1UCK A;  1B2Z A;  1I3I A;  3GSP A;  1TRQ A;  1I0V A;  1BSC A;  1T2I A;  1PYL A;  1BNF A;  1X1Y A;  3Q3F A;  3RNT A;  1GOY A;  3AHS A;  1UCI A;  1GMR A;  2SAR A;  1RN4 A;  1HYF A;  1B2U A;  1BRK A;  1FZU A;  1RCK A;  1FUT A;  3AGN A;  1BOX A;  1B3S A;  1YGW A;  1RHL A;  2KF4 A;  1BIR A;  8RNT A;  1R4Y A;  3SYU A;  2F5M A;  5GSP A;  4RNT A;  1BRS A;  1GMP A;  1SAR A;  1YVS A;  6GSP A;  1BRN L;  1BSB A;  1IYY A;  1I2E A;  2ZA4 A;  3AGO A;  1ZGX A;  1RGK A;  1RMS A;  1BAO A;  1I8V A;  3KCH A;  3URP A;  1GOU A;  2RBI A;  3D5I A;  1Q9E A;  4J5G A;  4BU4 A;  1BSD A;  1JBS A;  1FW7 A;  1RNB A;  1C54 A;  1CH0 A;  1RLS A;  1BNJ A;  2F4Y A;  1T2H A;  3DGY A;  2AAD A;  1RGE A;  1JBT A;  1UCJ A;  1LRA A;  1B27 A;  1BRH A;  1I70 A;  1RGA A;  1RGL A;  1RN1 A;  3WR2 A;  1B2S A;  3D5G A;  1RGH A;  1I2F A;  2F5W A;  1DET A;  1B2M A;  1X1W A;  1I3F A;  6RNT A;  1X1X A;  1AY7 A;  2AAE A;  4BIR A;  1FUS A;  1B2X A;  4HOH A;  1A2P A;  1FYS A;  2HOH A;  3DH2 A;  1RGF A;  1LOW A;  4HAA A;  1JBR A;  1MGW A;  1B21 A;  1MGR A;  1RTU A;  3WHO A;  5HOH A;  1BRJ A;  1BNR A;  5RNT A;  1LOY A;  1RGC A;  2KAA A;  1BRG A;  2F56 A;  1RSN A;  7GSP A;  3AHW A;  1DE3 A;  1BUJ A;  1BNI A;  1BSA A;  1BNG A;  3BU4 A;  2BU4 A;  1BSE A;  1BVI A;  1BNE A;  1RGG A;  1BRI A;  1RCL A;  5BIR A;  2BIR A;  1RNT A;  1TRP A;  3D4A A;  1GSP A;  2KF6 A;  4J5K A; 
#chains in the Genus database with same CATH topology
 5EQL A;  1Q86 4;  2OTL 3;  3B4P A;  4CJN A;  3CNX A;  1TTO A;  1SPU A;  1RRH A;  2Z6B A;  1V57 A;  3GZB A;  2CFW A;  3ALA A;  1BAN A;  4XDV A;  2XFS A;  5JBS A;  3G8Z A;  3O8Y A;  2Q07 A;  1TP6 A;  2CX0 A;  2GSP A;  3BNB A;  2CKF B;  1IVW A;  2GU1 A;  1K73 4;  1PY3 A;  1IU7 A;  1GOV A;  2OOV C;  2H0H A;  2P09 A;  3HI7 A;  2KF3 A;  1UCL A;  5G2G A;  1ZX2 A;  3WMD A;  1TRQ A;  4Q53 A;  5IG4 A;  3NBR A;  2F86 B;  4L8P A;  3SOY A;  1E3R A;  3RNT A;  4K90 B;  3AMO B;  4BL2 A;  3SOA A;  2OQE C;  1GOY A;  1OGX A;  2XF3 A;  3M8C A;  2CHC A;  2SAR A;  1ROA A;  3FLJ A;  1Q40 B;  3DGM A;  3I0Y A;  1FA3 A;  2KCD A;  1DYU A;  3OV4 A;  2C10 A;  2L4V A;  3AGN A;  3BNC A;  5G1K A;  2F5M A;  2FGT A;  5GSP A;  1VQM 3;  1GMP A;  1W00 A;  4CPK A;  3CCV 3;  3IPT A;  3LT9 A;  5CF2 A;  2CK3 H;  2HMM B;  5D82 A;  3DM8 A;  4KFF A;  2ZA4 A;  1Q42 A;  2R41 A;  1ZGX A;  1QVG 2;  5IEP A;  4EBG A;  1DMN A;  3NUV A;  1I8V A;  2BMR B;  2ML6 A;  4HM6 B;  3URP A;  3ZG5 A;  4HM4 B;  2ZL8 A;  2RBI A;  4WFO A;  1M1X B;  2D1W A;  4BL3 A;  4I5Q A;  4I4K A;  3DY5 A;  1EA2 A;  3U97 A;  1FW7 A;  1RNB A;  2HMO B;  2ZHX B;  2UUG C;  2F4Y A;  2CFL A;  2CG0 A;  3MKI A;  2AAD A;  3BND A;  3I56 3;  1OUN A;  1SJW A;  3G6E 3;  1BRH A;  1MWR A;  3BB9 A;  1RGA A;  2WOH A;  5KP4 A;  4LMI A;  4X2H A;  3GWR A;  3CNM A;  3GZX B;  1RGH A;  5CF1 A;  1OH0 A;  1DET A;  1HU9 A;  1X1X A;  3DGO A;  1W5Z A;  3CPW 2;  8CHO A;  4J8T A;  1B2X A;  1HKX A;  3IJE B;  4HOH A;  3H3H A;  1JJ2 2;  4O02 B;  2PZV A;  3DMC A;  3DH2 A;  3KE7 A;  1CYV A;  3MYT A;  1RTU A;  3EE1 A;  4MMY B;  4WP5 A;  3N54 B;  1UI7 A;  5JPP A;  5HOH A;  3DGN A;  5IEO A;  3RGR A;  2XEP A;  3PYJ A;  1QJG A;  4FMA A;  1YJ9 3;  1VQN 3;  1VQ5 3;  1QAL A;  2FXT A;  3G0K A;  1MWT A;  2Y74 A;  3PCR A;  4J9A A;  3BU4 A;  4MMZ B;  3STD A;  1QVF 2;  3OXA A;  4AEQ A;  1BUQ A;  3NV0 A;  1BSE A;  1BVI A;  1JB5 A;  1BNE A;  2SBL A;  1VQ4 3;  3RGA A;  3OX9 A;  5ELU A;  1D6U A;  1RNT A;  5CLK A;  3B7C A;  1JNQ A;  4LSO A;  3T8U A;  1UUG B;  2KF6 A;  4BTX A;  5KP3 A;  2E2U A;  1DMQ A;  3LTA A;  3Q2P A;  2IMJ A;  2CFG A;  3G16 A;  3HZP A;  3OWU A;  2W9Q A;  2Y73 A;  1BNS A;  2O9U X;  4HM0 B;  4EXR A;  2HMJ B;  2RCD A;  1N5P A;  4L7K A;  1STD A;  2CFK A;  7RNT A;  1NJI 4;  1B20 A;  1KQS 2;  3LT8 A;  3GAX A;  1ISK A;  4K1V A;  1ZO2 A;  2W2C A;  4JF8 A;  4X2O A;  5IEN A;  1K9M 4;  3MSO A;  2C4B A;  4HJL B;  1YHQ 3;  1DVD A;  3FG4 A;  3HOH A;  4GSP A;  3OWY A;  1US1 A;  1PU4 A;  2GU3 A;  1GY7 A;  3CU3 A;  1UDI I;  4KFE A;  1YIJ 3;  1I0V A;  1LQM B;  2XR8 B;  1IT7 A;  3S28 A;  3JUO A;  5EEO A;  1MOL A;  3ROB A;  3A76 A;  2P05 A;  1WTH A;  4EV5 A;  2LQV A;  1BNF A;  3Q3F A;  1EUI C;  2E2V A;  1VQQ A;  3UJM A;  1UCI A;  2GXF A;  2WO0 A;  3FF2 A;  1GMR A;  3KSE D;  1RN4 A;  3HX8 A;  1B2U A;  1BRK A;  1W2Z A;  1NU3 A;  4N6U A;  1RCK A;  5D83 A;  3T0U A;  3X3Z A;  1FUT A;  1BOX A;  1EKM A;  2OWP A;  1YGW A;  3QRD A;  3N9H A;  3SYU A;  3J7Y d;  1TFK A;  4IT7 A;  3T8N A;  3FH1 A;  1ROV A;  1UUW B;  3B8L A;  3Q90 A;  4K61 A;  1AVK A;  3HK4 A;  3OW2 2;  1RN7 A;  2BNG A;  4IIA A;  1OPY A;  4HM3 B;  4XM4 A;  1YJW 3;  1NB5 I;  4R1K A;  2BHM A;  1OF5 A;  1WNH A;  1OHP A;  3KCH A;  4KFD A;  1N9J A;  1JN5 B;  3D5I A;  4G1M B;  3CCU 3;  5AYS C;  4J5G A;  4N6O B;  3CPO A;  1GY6 A;  2M7O A;  1IV9 A;  3FF0 A;  4LEH A;  3G4S 3;  1JBS A;  1G0T A;  3S67 A;  4XBT A;  1L5G B;  2B1X B;  1T2H A;  1JKG A;  1E97 A;  5CXO A;  1IK3 A;  2JQ5 A;  3CCJ 3;  2YX9 A;  1VQP 3;  3F14 A;  1B27 A;  4HBR A;  1RN1 A;  1D6Y A;  3WR2 A;  3DGL A;  1NB3 I;  1CQS A;  2F5W A;  1KWI A;  3CMA 3;  1V74 A;  3VGN A;  3ECF A;  4BIR A;  1E3V A;  1F8N A;  5IG5 A;  1ZS7 A;  3PZW A;  1FYS A;  3JVC A;  3LTD A;  4OUQ A;  3EQQ B;  1FGQ A;  1YIT 3;  5AI1 A;  1MGW A;  1MGR A;  1NWW A;  1ULJ B;  5ELJ A;  2KXG A;  5G1L A;  3FGY A;  3GRD A;  5RNT A;  1LOY A;  2RSX A;  1RGC A;  1KSI A;  1BRG A;  2KAA A;  2WOF A;  1RSN A;  1W02 A;  3F8H A;  3X41 A;  2OCT A;  7GSP A;  2P0M A;  1T3B A;  3LTB A;  1BUJ A;  1OHS A;  4N6M A;  4U13 A;  3SED A;  2GEY A;  5EVH A;  2XFT A;  4L8O A;  2Z77 A;  6STD A;  3K63 A;  4HZB B;  1BRI A;  3F9S A;  2H0G A;  1RCL A;  1VQ7 3;  3HIG A;  4N3V A;  2W0Q A;  1GD4 A;  4R9L A;  2QGU A;  3NM7 A;  5M19 A;  3LYG A;  1GY5 A;  1U5O A;  4NHF A;  3EBT A;  3UL6 A;  1WQL B;  3EF8 A;  1G96 A;  3TDG A;  1JRQ A;  1G02 A;  3NQY A;  4NRE A;  4HYZ A;  1X1U A;  4CDL A;  1EEJ A;  2JDI H;  1N9E A;  1GMQ A;  1LVN A;  1Q7H A;  3JUQ A;  3FZW A;  1OF5 B;  4N6T A;  4RZM A;  2Z7A A;  5D81 A;  1AV4 A;  4GHO A;  1RDS A;  2K0M A;  2W56 A;  4FCZ A;  5STD A;  2INX A;  1S5A A;  3V92 A;  3X3X A;  5TGN A;  4O2H A;  3D9R A;  3PXM A;  1AQZ A;  1I2G A;  3LXU X;  1LOV A;  4HM2 B;  1I0X A;  1LNI A;  3BIR A;  1HZ1 A;  5AEW B;  3LZA A;  4H3U A;  3GZR A;  5DRE A;  1UCK A;  9RNT A;  1I3I A;  1IDP A;  3NM2 A;  3FCS B;  3H51 A;  3V99 A;  4K1U A;  2R4I A;  3EC9 A;  3JUN A;  4FCJ A;  3FSD A;  4HZ9 B;  1O7H B;  2YFI B;  4OK0 A;  1OAC A;  1X1Y A;  4QWT A;  4LZI A;  3WOD G;  2KRT A;  5BXQ A;  3PS8 A;  3F7S A;  3AHS A;  4R80 A;  2V1L A;  1QAF A;  4RNZ A;  3V98 A;  1IT8 A;  4CCV A;  5LC7 A;  3WA2 X;  3WOE B;  2CWU A;  1Z1S A;  2QIY A;  3EHC A;  3UB1 A;  2F98 A;  5CK6 A;  1FGR A;  1MWS A;  1RHL A;  2KF4 A;  1BIR A;  3BNE A;  2XH9 A;  4XBY A;  4RNT A;  4XB5 A;  1BRN L;  6GSP A;  1YVS A;  1K28 A;  1R4C A;  3LH4 A;  3AMO A;  2QEX 3;  1FGT A;  3D79 A;  3MHE A;  1VQ9 3;  1IYY A;  3KZT A;  1Q40 A;  2PNC A;  5AIG A;  2H0I A;  3F40 A;  5IW9 A;  3KKG A;  4WYK A;  4MMX B;  4RBN A;  4O8S A;  1RMS A;  4AKY A;  4FMB A;  3CD6 3;  1BAO A;  1JV2 B;  1NDO B;  4R9K A;  1RKY A;  4AKZ A;  4HM1 B;  4FMC A;  3L0R A;  4BU4 A;  1UW1 A;  2CW9 A;  4LYL B;  2UGI A;  1SQW A;  1C54 A;  1CH0 A;  2CWT A;  1MNL A;  1BNJ A;  1LXE A;  3NXJ A;  1RGE A;  3NBB A;  3EBY A;  1LRA A;  3KSP A;  3CCQ 3;  3K5T A;  1W6G A;  1B2S A;  1O7N B;  1GS3 A;  5BVB A;  2D42 A;  4ILF A;  3D5G A;  1KD1 4;  3K7C A;  4MJD A;  2OOV A;  1B2M A;  3GZY B;  1I3F A;  1Y4K A;  4FR9 A;  4ZM8 A;  4HM5 B;  2CFD A;  2CC3 A;  3VF1 A;  3CCR 3;  1RRL A;  3QK9 A;  3S29 A;  3FKA A;  2HOH A;  3NV0 B;  1M9G A;  1M90 4;  4EW5 A;  1LOW A;  4HAA A;  2UX0 A;  5FGO A;  2B24 B;  3EX9 A;  3UL5 A;  1K41 A;  3WHO A;  1JBR A;  1BRJ A;  2OQE A;  1AVL A;  5AIF A;  2YFJ B;  4KT3 B;  2CX1 A;  3WOF B;  1WMP A;  3CME 3;  2F56 A;  3KFQ C;  4O3V A;  5DRV A;  1DE3 A;  4FMD A;  7STD A;  1BNI A;  1BSA A;  1W4N A;  3NQZ A;  1TFO A;  2RGQ A;  3CCM 3;  3CCL 3;  2BU4 A;  3B4O A;  3K0Z A;  2CIU A;  1Q81 4;  1VQL 3;  3PCS A;  1VZZ A;  3SXX A;  1DVC A;  2BIR A;  3OWS A;  3S27 A;  2XGN A;  4WHA A;  1KC8 4;  3SVA A;  3D4A A;  1GSP A;  1VQO 3;  2IUK A;  5BU4 A;  3A5E A;  2KF5 A;  5IG0 A;  2RNT A;  1BGS A;  1D6Z A;  5FW5 A;  1O7W B;  2W04 A;  1N8R 4;  3X42 A;  4EYC A;  1TU5 A;  1MWU A;  2HML B;  1TJD A;  5M1A A;  5A0O B;  4WYK B;  3MG1 A;  3NX0 A;  1IVX A;  3RDE A;  4NPB A;  2XGL A;  3DZL A;  1LQG C;  3F8X A;  3IMA B;  4FCM A;  3VSY A;  3CC7 3;  2W9P A;  4GB5 A;  2F99 A;  4BTW A;  1AR0 A;  1T5Y A;  2GBW B;  3LML A;  1VQK 3;  4GL6 A;  3WDG B;  2HMN B;  1IV7 A;  1YVB I;  4OVM A;  3X40 A;  1OCV A;  1FGM A;  1IVV A;  1YNV X;  3HII A;  3CCS 3;  2XSO B;  1JZD A;  1BU4 A;  1SII A;  2WGQ A;  1B2Z A;  3E99 A;  3GSP A;  1JB2 A;  4HM8 B;  1STF I;  1BSC A;  3JUM A;  1T2I A;  3LTC A;  1QMA A;  3MPH A;  4LGQ A;  1UUV B;  2LYX A;  3BLZ A;  2Z76 A;  3CC4 3;  2CG1 A;  1PYL A;  2BMO B;  3N8B A;  2RFR A;  3FG3 A;  1Q82 4;  3ER7 A;  3FG1 A;  4BTY A;  1HYF A;  1V58 A;  1FZU A;  4JRF A;  5IG3 A;  1YJN 3;  2J8X B;  3KII A;  2ML5 A;  1IQY A;  1B3S A;  1ASK A;  2IA7 A;  2IYJ A;  2W6J H;  8RNT A;  1R4Y A;  1OHO A;  2HMK B;  5AII A;  1TUH A;  1O7P B;  1A67 A;  2BMQ B;  5KP1 A;  1BRS A;  1SAR A;  1A90 A;  1BSB A;  1LOX A;  1YI2 3;  1GYB A;  3NBJ A;  2IUJ A;  1WMN A;  4XDW A;  1I2E A;  4HVN A;  5AYR B;  3AGO A;  1A2K A;  2K54 A;  4WWU C;  1JKG B;  1RGK A;  1M1K 4;  1TIJ A;  4HM7 B;  1FGO A;  3CXC 2;  1VQ6 3;  2CWV A;  3S5C A;  4HKV B;  4R4K A;  3X3Y A;  4DKI A;  1A2V A;  2C11 A;  1IVU A;  1GOU A;  2XRX B;  3D3L A;  3EJV A;  5HGR A;  1EG9 B;  3EN8 A;  1Q9E A;  1CEW I;  2I9W A;  3U1W A;  1BSD A;  4STD A;  2QA4 3;  2GEX A;  4EC6 A;  3G71 3;  1RLS A;  1ULI B;  1UI8 A;  4KZ1 A;  1UGI A;  2W03 A;  3SLU A;  2K3D A;  4PEJ A;  5IER A;  3DGY A;  1Q7Y 4;  2BT3 A;  1JBT A;  1UCJ A;  1YGE A;  2O3O A;  3CC2 3;  1NNV A;  3DUK A;  1SIH A;  1I70 A;  3SX1 A;  1RGL A;  2MC8 A;  5M18 A;  1JB4 A;  4H61 A;  3CCE 3;  5AEU B;  1J2B A;  1OGZ A;  3DXO A;  3MWZ A;  2GBX B;  1JN5 A;  2XSH B;  2ZDJ A;  3MG3 A;  3ZFZ A;  4N6L A;  5IF6 A;  1I2F A;  1O7G B;  1JZO A;  1O7M B;  1IQX A;  2WGO A;  4MEI A;  3WA3 A;  3UNL A;  1VQ8 3;  1X1W A;  3ZG0 A;  1W6Y A;  3JUP A;  6RNT A;  2AAE A;  1AY7 A;  3K9M C;  1UGH I;  3MG2 A;  1FUS A;  1NO3 A;  3Q1C A;  3LOY A;  2L1S A;  1A2P A;  1S72 3;  4RNY A;  4TX4 A;  1RGF A;  4KVH A;  1LNH A;  3F7X A;  1B21 A;  2YFL B;  1GD3 A;  1K8A 4;  1PFP A;  1WMO A;  2P38 A;  3KN4 A;  1BNR A;  3PGB A;  1FUW A;  1CYU A;  1W7C A;  2P0X A;  3NHX A;  2OTJ 3;  3AHW A;  1W2B 2;  3I55 3;  1BNG A;  2E2T A;  4IPB A;  1N8Q A;  4EV2 A;  1N5H A;  5I97 A;  2STD A;  1DMM A;  1C7H A;  5LC6 A;  1IQ8 A;  1W01 A;  2IY2 A;  1U8C B;  3EN1 B;  4N6N B;  5AIH A;  1RGG A;  2FNQ A;  2MF7 A;  3EB8 A;  1RJO A;  1W6C A;  5BIR A;  2BO9 B;  5JPU A;  1QAK A;  1TRP A;  2W56 B;  4ORL A;  2CH9 A;  4XBX A;  4J5K A;  1EQK A;  4N6V 0;  2A15 A; 
#chains in the Genus database with same CATH homology
 5BU4 A;  3A5E A;  2KF5 A;  2RNT A;  1BGS A;  1TTO A;  1G02 A;  1BNS A;  1X1U A;  1GMQ A;  7RNT A;  1B20 A;  4GHO A;  1BAN A;  1RDS A;  2GSP A;  1YNV X;  1AQZ A;  1I2G A;  2C4B A;  1LOV A;  1PY3 A;  1I0X A;  1GOV A;  1LNI A;  3BIR A;  3HOH A;  4GSP A;  1HZ1 A;  2KF3 A;  1BU4 A;  1UCL A;  9RNT A;  1UCK A;  1B2Z A;  1I3I A;  3GSP A;  1TRQ A;  1I0V A;  1BSC A;  1T2I A;  1PYL A;  1BNF A;  1X1Y A;  3Q3F A;  3RNT A;  1GOY A;  3AHS A;  1UCI A;  1GMR A;  2SAR A;  1RN4 A;  1HYF A;  1B2U A;  1BRK A;  1FZU A;  1RCK A;  1FUT A;  3AGN A;  1BOX A;  1B3S A;  1YGW A;  1RHL A;  2KF4 A;  1BIR A;  8RNT A;  1R4Y A;  3SYU A;  2F5M A;  5GSP A;  4RNT A;  1BRS A;  1GMP A;  1SAR A;  1YVS A;  6GSP A;  1BRN L;  1BSB A;  1IYY A;  1I2E A;  2ZA4 A;  3AGO A;  1ZGX A;  1RGK A;  1RMS A;  1BAO A;  1I8V A;  3KCH A;  3URP A;  1GOU A;  2RBI A;  3D5I A;  1Q9E A;  4J5G A;  4BU4 A;  1BSD A;  1JBS A;  1FW7 A;  1RNB A;  1C54 A;  1CH0 A;  1RLS A;  1BNJ A;  2F4Y A;  1T2H A;  3DGY A;  2AAD A;  1RGE A;  1JBT A;  1UCJ A;  1LRA A;  1B27 A;  1BRH A;  1I70 A;  1RGA A;  1RGL A;  1RN1 A;  3WR2 A;  1B2S A;  3D5G A;  1RGH A;  1I2F A;  2F5W A;  1DET A;  1B2M A;  1X1W A;  1I3F A;  6RNT A;  1X1X A;  1AY7 A;  2AAE A;  4BIR A;  1FUS A;  1B2X A;  4HOH A;  1A2P A;  1FYS A;  2HOH A;  3DH2 A;  1RGF A;  1LOW A;  4HAA A;  1JBR A;  1MGW A;  1B21 A;  1MGR A;  1RTU A;  3WHO A;  5HOH A;  1BRJ A;  1BNR A;  5RNT A;  1LOY A;  1RGC A;  2KAA A;  1BRG A;  2F56 A;  1RSN A;  7GSP A;  3AHW A;  1DE3 A;  1BUJ A;  1BNI A;  1BSA A;  1BNG A;  3BU4 A;  2BU4 A;  1BSE A;  1BVI A;  1BNE A;  1RGG A;  1BRI A;  1RCL A;  5BIR A;  2BIR A;  1RNT A;  1TRP A;  3D4A A;  1GSP A;  2KF6 A;  4J5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...