2BIRA

Additivity of substrate binding in ribonuclease t1 (y42a mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKANNYEGFAFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Additivity of protein-guanine interactions in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Ribonuclease
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1996-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2birA00
1IYYA 1GMPA 1X1XA 1Q9EA 1BRHA 3BU4A 1BVIA 1ZGXA 3AGOA 3WHOA 3D5IA 1CH0A 1RTUA 1C54A 2F5MA 1BNJA 2HOHA 3DH2A 1I3IA 1I2GA 1RMSA 1YGWA 1BSEA 2F4YA 8RNTA 2KF6A 1JBSA 1BUJA 1BOXA 1I3FA 2F5WA 3AHSA 1DETA 1MGWA 7RNTA 1BNRA 1RGKA 1YVSA 3BIRA 1RLSA 1AY7A 1B2UA 2KF5A 1GOUA 1I2FA 1BNGA 1B2XA 1I70A 3GSPA 4GSPA 2KF3A 1G02A 1RHLA 1HZ1A 1R4YA 5GSPA 1FYSA 1UCJA 1RCKA 1RN1A 4J5GA 1I8VA 1BRIA 1AQZA 1GOYA 1RGGA 1JBRA 1B21A 1RNTA 5RNTA 3AGNA 1DE3A 1GOVA 1BRGA 1RDSA 1UCIA 1FUSA 3HOHA 1JBTA 5HOHA 1BRSA 1BNFA 1LNIA 3A5EA 2BU4A 1BNIA 1LRAA 1B20A 1PY3A 5BIRA 3D4AA 1BNEA 2AADA 3KCHA 4GHOA 1GMQA 1A2PA 1HYFA 1UCKA 1I2EA 1BU4A 1I0VA 4RNTA 2AAEA 1BSBA 1UCLA 1LOVA 1BSAA 2KAAA 1BGSA 4BU4A 2BIRA 1RCLA 1X1UA 1I0XA 4J5KA 3D5GA 6RNTA 3RNTA 4HAAA 1PYLA 1B2ZA 1RGHA 1GMRA 1RSNA 1T2HA 2SARA 1RGEA 1TTOA 1B2SA 1YNVX 1GSPA 9RNTA 1BANA 1BSCA 1RN4A 1BAOA 5BU4A 2RNTA 4BIRA 1MGRA 1RNBA 3WR2A 7GSPA 2ZA4A 3URPA 1LOYA 1BSDA 2C4BA 2F56A 3AHWA 1BRNL 2KF4A 1TRPA 1X1WA 1LOWA 1X1YA 2RBIA 1B27A 2GSPA 3DGYA 4HOHA 1B2MA 1TRQA 1SARA 1RGAA 1RGLA 1FW7A 1FZUA 1B3SA 1T2IA 3Q3FA 1FUTA 1BNSA 1RGFA 1RGCA 6GSPA 1BIRA 3SYUA 1BRKA 1BRJA
chains in the Genus database with same CATH superfamily
2GBWB 1GMPA 4CJNA 2LYXA 1V74A 3X3XA 4BL2A 3EN1B 5FGOA 4NREA 1BRHA 3SVAA 1NNVA 3D5IA 2E2UA 3CCL3 1VQO3 4STDA 5D82A 1NDOB 3A76A 4WYKA 2BMRB 3NBRA 1SQWA 4BTWA 2JQ5A 1I2GA 2XSHB 3QK9A 1U5OA 2KXGA 3I553 1Q7Y4 3MG3A 1VQQA 4HYZA 2F5WA 1OF5B 3EF8A 3GWRA 1EQKA 1W5ZA 1FGTA 3BIRA 1W6GA 3FZWA 4RBNA 1W4NA 2KF5A 3UB1A 3S28A 1I2FA 1G96A 1TUHA 1W7CA 3GSPA 2KF3A 1G02A 1OF5A 2ZHXB 4EW5A 3CCJ3 3FH1A 2C11A 1DMNA 4WP5A 5DRVA 3LT8A 5TGNA 5CK6A 3LXUX 4Q53A 1RN1A 1KC84 1I8VA 1BRIA 1RGGA 1TJDA 3KIIA 4ZM8A 4HVNA 1JBRA 4NHFA 1GD4A 2UGIA 1RNTA 1GOVA 1W00A 3HIIA 4FMDA 2D1WA 1FUSA 2WO0A 3DM8A 1RRHA 2RFRA 3MWZA 3V92A 1B20A 1PY3A 1UGHI 4XDVA 2CG1A 3D4AA 3U97A 1K41A 1JB4A 1O7MB 2AADA 2RSXA 2W04A 2H0GA 3K0ZA 1Y4KA 1I2EA 1IDPA 3D3LA 3S27A 2AAEA 1BSBA 3EC9A 1STFI 5G1KA 1L5GB 3NV0A 2P05A 3JVCA 3S67A 1AVKA 2LQVA 3G713 2HMMB 4HM8B 3DY5A 2XR8B 1FGQA 5CF2A 1KQS2 3D5GA 3MSOA 3G16A 3RNTA 1WMOA 2CWVA 3GZBA 1IV7A 1PYLA 2CFGA 4HZ9B 4HJLB 5AYRB 2QGUA 1UUVB 3Q2PA 1N8R4 4K1UA 1RN7A 4O8SA 2OTJ3 4JRFA 3D79A 1WQLB 2P38A 1BANA 3NX0A 2WOHA 3MKIA 3KSED 3PS8A 3NXJA 1W2ZA 3PCRA 4H61A 4HM3B 2FXTA 4DKIA 1ULJB 1OACA 1LVNA 4BIRA 3RDEA 5KP4A 4HM5B 4XBXA 3EE1A 1IQ8A 2ZA4A 4BL3A 1TFOA 1LOYA 2F56A 3URPA 4HBRA 4QWTA 5BXQA 1YJ93 3BB9A 2KF4A 1TRPA 2CFKA 3OWUA 1X1WA 1LOWA 1BUQA 1X1YA 2RBIA 1B27A 3DGYA 5AYSC 1B2MA 5CXOA 5M1AA 1Q40A 2SBLA 5IF6A 3FF0A 2OTL3 1A90A 1TU5A 1B3SA 4EV2A 3CC73 1YVBI 3GZRA 4CPKA 1RGCA 6GSPA 1GS3A 2W56B 3K63A 1O7NB 1O7WB 1QJGA 2WOFA 2XFTA 3DUKA 5STDA 4PEJA 1EUIC 3G6E3 1X1XA 4I4KA 1Q9EA 5A0OB 2M7OA 2K54A 3KZTA 3LTCA 3Q1CA 2W56A 3EBTA 2F5MA 1BNJA 2Q07A 3DH2A 1ROAA 1N5PA 4LGQA 4XDWA 3WOFB 3CCU3 1YGWA 1BSEA 3DXOA 4K61A 8RNTA 1A2KA 4IPBA 1W01A 4EXRA 1A67A 3JUOA 2IUKA 1IT8A 1QMAA 2CK3H 4HM1B 2W9PA 3F8XA 1DETA 2BNGA 1SIIA 1K734 1SPUA 3FG3A 3D9RA 1YVSA 3NM2A 4CDLA 3LZAA 1EKMA 1CEWI 1AY7A 1B2UA 1OHSA 1RLSA 2YFJB 3EB8A 1GY6A 3OWYA 1Q814 2Z76A 1BNGA 1YIJ3 2Z77A 2ML6A 3EQQB 2IMJA 4HM2B 3BNBA 3STDA 4N6TA 3LMLA 4N6LA 3OX9A 2E2TA 1RHLA 1TIJA 2V1LA 4O2HA 1AV4A 1OGZA 1HZ1A 1R4YA 2IUJA 3CPW2 1UUWB 3B4OA 1FYSA 4L8OA 4FCMA 4HM6B 1RCKA 2ZDJA 1QALA 4GL6A 4J5GA 3CCM3 1AQZA 3WOEB 5KP3A 3UNLA 1VQL3 1GY7A 3K5TA 5AI1A 1B21A 5IG5A 1VQM3 4ORLA 2CKFB 4OVMA 1W6CA 1BRGA 3HOHA 3CME3 5HOHA 4EV5A 1BRSA 1OUNA 1TFKA 3BNDA 3CPOA 1M1K4 3CCV3 1FGRA 1LRAA 5BIRA 3EHCA 1NB3I 2FGTA 7STDA 1CYVA 5D83A 4WWUC 3X42A 5JPUA 3CCS3 3CC43 1GY5A 1VZZA 2Y73A 3JUQA 3VF1A 5JPPA 2UUGC 3X3YA 2HMKB 2IA7A 3LOYA 1UCLA 2Z6BA 1MOLA 1BGSA 4BU4A 2XH9A 1RCLA 1MWSA 1X1UA 1VQ53 3X3ZA 1GD3A 1SIHA 1JZOA 3JUPA 1IV9A 4J8TA 1NJI4 4LZIA 2E2VA 2B24B 4MMXB 2CWUA 4EBGA 4NPBA 1LQGC 2SARA 3SEDA 2R4IA 2GEXA 1YIT3 1YNVX 4I5QA 5I97A 1GSPA 3NV0B 2MC8A 9RNTA 1NU3A 2W03A 1ZO2A 5IW9A 3BNEA 2O3OA 3ALAA 3V99A 3DZLA 5AIHA 1WMNA 5IERA 4JF8A 1NO3A 2J8XB 3FKAA 3UL5A 5IENA 3WR2A 1NB5I 1IQXA 2CFDA 2INXA 2C4BA 3AHWA 3F14A 2WGQA 1JKGA 2BO9B 2CFWA 2L4VA 3CNXA 3PZWA 4J9AA 5DREA 3SLUA 3WODG 4RNYA 1JJ22 4MJDA 6STDA 4G1MB 1C7HA 3DGLA 1VQN3 4MMYB 2CH9A 2XGNA 1FW7A 5EEOA 3Q3FA 1JB5A 3NM7A 1Q42A 3CU3A 4N6MA 4LSOA 1BIRA 4BTYA 1N5HA 4L7KA 5FW5A 3SYUA 5JBSA 1RJOA 5EVHA 1VQ83 1D6UA 1M1XB 1HKXA 3OWSA 1W02A 3BNCA 5HGRA 3WMDA 4KVHA 2XEPA 2GXFA 2IYJA 1W6YA 3VGNA 4R80A 2WGOA 5M18A 2FNQA 1Q40B 1BVIA 3BU4A 2D42A 3AGOA 4HKVB 5ELJA 3WHOA 1K9M4 1DMQA 1CH0A 1O7HB 1JRQA 1RTUA 2MF7A 1C54A 2HOHA 2K3DA 4R9LA 3CD63 4LEHA 2F4YA 4FMAA 3T8UA 3U1WA 1JBSA 1PFPA 2RCDA 1BOXA 1TP6A 2IY2A 3BLZA 3TDGA 2PNCA 7RNTA 8CHOA 3FG1A 4FMCA 3HX8A 4X2HA 1RGKA 2GU1A 2QIYA 5CF1A 3OW22 2XSOB 5IG0A 3V98A 3S29A 3LT9A 1GOUA 4AKYA 1Q824 1I70A 1IVVA 1YHQ3 5EQLA 3SXXA 1U8CB 1WTHA 3MYTA 4GSPA 3M8CA 1W2B2 4AKZA 2OCTA 3KSPA 3MG1A 2Y74A 1ZX2A 5LC7A 1UUGB 3DGOA 2HMNB 1UCJA 1O7PB 1GOYA 2R41A 3B8LA 2XF3A 3PCSA 1ISKA 1EA2A 5RNTA 3AGNA 1DE3A 1RDSA 1UCIA 2BMQB 1JBTA 1BNFA 2RGQA 3B4PA 2HMOB 5LC6A 4RNZA 5IEOA 4FR9A 5KP1A 5IEPA 5AIGA 1G0TA 3KCHA 4GHOA 2H0HA 1ROVA 2HMJB 4HM4B 3WA3A 2KRTA 1MWRA 1HYFA 4CCVA 1UCKA 1N8QA 3T8NA 3GZXB 3S5CA 2I9WA 1BU4A 1I0VA 4RNTA 5IG3A 3CCQ3 3FG4A 1BSAA 1M904 3J7Yd 3IJEB 3PXMA 4AEQA 3ZG5A 1HU9A 2YFLB 3CC23 1ASKA 1A2VA 4J5KA 4N6V0 2CX1A 3F7XA 3I0YA 3I563 1R4CA 1B2ZA 1IVUA 1RSNA 1N9EA 1T2HA 1QVF2 1OHOA 2H0IA 3MPHA 1Q7HA 1RGEA 1T3BA 1B2SA 2P0MA 3F7SA 5AEUB 3LH4A 2CFLA 2O9UX 1IVXA 3AMOB 3T0UA 3G4S3 1BSCA 1RN4A 3N8BA 3KE7A 3RGAA 2GEYA 1LNHA 4EYCA 1LOXA 3LYGA 4RZMA 1QAKA 1MGRA 2CIUA 1RNBA 3CCE3 1AVLA 3G8ZA 4R4KA 2GBXB 1MWTA 1N9JA 1YJN3 7GSPA 2F99A 1YJW3 3FLJA 4N6UA 1BSDA 1STDA 1IQYA 1FGOA 3AMOA 3EBYA 3MG2A 1BRNL 1VQ63 1JB2A 1AR0A 3CMA3 2GSPA 1S5AA 1M9GA 1Z1SA 1UI8A 3UJMA 3WDGB 2QA43 2BT3A 1DVCA 1VQP3 1TRQA 1SARA 1IT7A 1RGLA 1JN5B 2BMOB 1FZUA 4IIAA 5AIFA 1QVG2 5ELUA 1BNSA 2QEX3 3GZYB 2F86B 1V58A 2YFIB 1S723 1JNQA 3E99A 1KWIA 3UL6A 5IG4A 1BRKA 2CWTA 4K1VA 5CLKA 1JKGB 4X2OA 1IYYA 1ULIB 1EG9B 1JN5A 2HMLB 4H3UA 4WHAA 2P0XA 3LTBA 2JDIH 3O8YA 1ZGXA 4BTXA 2OQEC 1UI7A 2W6JH 4ILFA 2OWPA 3NBJA 1GYBA 3NBBA 1E3VA 4N6OB 5D81A 1Q864 3EJVA 2ML5A 5G2GA 3F8HA 1F8NA 3MHEA 2OQEA 1I3IA 1RMSA 1UGIA 3N54B 5M19A 1ZS7A 1SJWA 2KF6A 2STDA 1BUJA 2CG0A 3H3HA 1I3FA 1NWWA 2W0QA 2XFSA 3AHSA 4GB5A 1MGWA 1BNRA 1DMMA 1OH0A 3GRDA 3CNMA 3KKGA 5G1LA 3X40A 1VQ43 3DGNA 1CQSA 2XRXB 3SX1A 1OCVA 3FSDA 3FCSB 1B2XA 3PGBA 1K28A 1RKYA 2F98A 3NUVA 3HZPA 2C10A 4XBTA 3ZG0A 2B1XB 1D6ZA 3NQYA 1DYUA 1YI23 2GU3A 4KFDA 3K9MC 4MMZB 4N3VA 5GSPA 3B7CA 2L1SA 3DMCA 4FCJA 3L0RA 4KFEA 4XBYA 3K7CA 4XM4A 1LQMB 4FCZA 2A15A 1D6YA 4TX4A 1J2BA 4KT3B 1KD14 3G0KA 1RRLA 4R1KA 3A5EA 1IU7A 1LNIA 2BU4A 1VQ73 1BNIA 4KZ1A 3DGMA 3F40A 3OXAA 4WFOA 2OOVC 2KCDA 1IVWA 1OHPA 1FGMA 1OGXA 1BNEA 3EX9A 3LTDA 4K90B 3KN4A 3VSYA 3WA2X 1GMQA 3IMAB 4U13A 1VQ93 3CCR3 2OOVA 1A2PA 1LXEA 3X41A 3IPTA 4FMBA 4MEIA 4N6NB 3FF2A 1IK3A 3CXC2 1JV2B 1KSIA 1LOVA 3ROBA 2KAAA 1UDII 3ZFZA 2BIRA 1WNHA 2CHCA 4KFFA 4HM7B 4O02B 4IT7A 3HK4A 1I0XA 1UW1A 3GAXA 1EEJA 4LYLB 1YGEA 3H51A 3N9HA 3NQZA 3SOAA 6RNTA 2UX0A 4L8PA 4LMIA 4HAAA 2W2CA 3NHXA 1RGHA 1GMRA 5AIIA 4OK0A 1TTOA 1DVDA 1FUWA 3JUNA 3LTAA 2K0MA 1OPYA 2W9QA 1BAOA 1K8A4 3ECFA 3F9SA 5BU4A 1MWUA 1PU4A 2RNTA 1T5YA 1FA3A 2Z7AA 3ER7A 5BVBA 2YX9A 2PZVA 3PYJA 2ZL8A 3OV4A 2CC3A 3RGRA 1E3RA 1VQK3 4HZBB 3HI7A 1V57A 2CW9A 4HM0B 3JUMA 4HOHA 1MNLA 3EN8A 1QAFA 2BHMA 2CX0A 4O3VA 4R9KA 1E97A 2P09A 1O7GB 1RGAA 4EC6A 5AEWB 1T2IA 4OUQA 2XGLA 3Q90A 1FUTA 1US1A 3FGYA 3HIGA 1RGFA 3KFQC 1JZDA 1CYUA 4WYKB 1WMPA 3SOYA 4XB5A 3QRDA 1BRJA
chains in the Genus database with same CATH topology
1IYYA 1GMPA 1X1XA 1Q9EA 1BRHA 3BU4A 1BVIA 1ZGXA 3AGOA 3WHOA 3D5IA 1CH0A 1RTUA 1C54A 2F5MA 1BNJA 2HOHA 3DH2A 1I3IA 1I2GA 1RMSA 1YGWA 1BSEA 2F4YA 8RNTA 2KF6A 1JBSA 1BUJA 1BOXA 1I3FA 2F5WA 3AHSA 1DETA 1MGWA 7RNTA 1BNRA 1RGKA 1YVSA 3BIRA 1RLSA 1AY7A 1B2UA 2KF5A 1GOUA 1I2FA 1BNGA 1B2XA 1I70A 3GSPA 4GSPA 2KF3A 1G02A 1RHLA 1HZ1A 1R4YA 5GSPA 1FYSA 1UCJA 1RCKA 1RN1A 4J5GA 1I8VA 1BRIA 1AQZA 1GOYA 1RGGA 1JBRA 1B21A 1RNTA 5RNTA 3AGNA 1DE3A 1GOVA 1BRGA 1RDSA 1UCIA 1FUSA 3HOHA 1JBTA 5HOHA 1BRSA 1BNFA 1LNIA 3A5EA 2BU4A 1BNIA 1LRAA 1B20A 1PY3A 5BIRA 3D4AA 1BNEA 2AADA 3KCHA 4GHOA 1GMQA 1A2PA 1HYFA 1UCKA 1I2EA 1BU4A 1I0VA 4RNTA 2AAEA 1BSBA 1UCLA 1LOVA 1BSAA 2KAAA 1BGSA 4BU4A 2BIRA 1RCLA 1X1UA 1I0XA 4J5KA 3D5GA 6RNTA 3RNTA 4HAAA 1PYLA 1B2ZA 1RGHA 1GMRA 1RSNA 1T2HA 2SARA 1RGEA 1TTOA 1B2SA 1YNVX 1GSPA 9RNTA 1BANA 1BSCA 1RN4A 1BAOA 5BU4A 2RNTA 4BIRA 1MGRA 1RNBA 3WR2A 7GSPA 2ZA4A 3URPA 1LOYA 1BSDA 2C4BA 2F56A 3AHWA 1BRNL 2KF4A 1TRPA 1X1WA 1LOWA 1X1YA 2RBIA 1B27A 2GSPA 3DGYA 4HOHA 1B2MA 1TRQA 1SARA 1RGAA 1RGLA 1FW7A 1FZUA 1B3SA 1T2IA 3Q3FA 1FUTA 1BNSA 1RGFA 1RGCA 6GSPA 1BIRA 3SYUA 1BRKA 1BRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYY A;  1GMP A;  1X1X A;  1Q9E A;  1BRH A;  3BU4 A;  1BVI A;  1ZGX A;  3AGO A;  3WHO A;  3D5I A;  1CH0 A;  1RTU A;  1C54 A;  2F5M A;  1BNJ A;  2HOH A;  3DH2 A;  1I3I A;  1I2G A;  1RMS A;  1YGW A;  1BSE A;  2F4Y A;  8RNT A;  2KF6 A;  1JBS A;  1BUJ A;  1BOX A;  1I3F A;  2F5W A;  3AHS A;  1DET A;  1MGW A;  7RNT A;  1BNR A;  1RGK A;  1YVS A;  3BIR A;  1RLS A;  1AY7 A;  1B2U A;  2KF5 A;  1GOU A;  1I2F A;  1BNG A;  1B2X A;  1I70 A;  3GSP A;  4GSP A;  2KF3 A;  1G02 A;  1RHL A;  1HZ1 A;  1R4Y A;  5GSP A;  1FYS A;  1UCJ A;  1RCK A;  1RN1 A;  4J5G A;  1I8V A;  1BRI A;  1AQZ A;  1GOY A;  1RGG A;  1JBR A;  1B21 A;  1RNT A;  5RNT A;  3AGN A;  1DE3 A;  1GOV A;  1BRG A;  1RDS A;  1UCI A;  1FUS A;  3HOH A;  1JBT A;  5HOH A;  1BRS A;  1BNF A;  1LNI A;  3A5E A;  2BU4 A;  1BNI A;  1LRA A;  1B20 A;  1PY3 A;  5BIR A;  3D4A A;  1BNE A;  2AAD A;  3KCH A;  4GHO A;  1GMQ A;  1A2P A;  1HYF A;  1UCK A;  1I2E A;  1BU4 A;  1I0V A;  4RNT A;  2AAE A;  1BSB A;  1UCL A;  1LOV A;  1BSA A;  2KAA A;  1BGS A;  4BU4 A;  2BIR A;  1RCL A;  1X1U A;  1I0X A;  4J5K A;  3D5G A;  6RNT A;  3RNT A;  4HAA A;  1PYL A;  1B2Z A;  1RGH A;  1GMR A;  1RSN A;  1T2H A;  2SAR A;  1RGE A;  1TTO A;  1B2S A;  1YNV X;  1GSP A;  9RNT A;  1BAN A;  1BSC A;  1RN4 A;  1BAO A;  5BU4 A;  2RNT A;  4BIR A;  1MGR A;  1RNB A;  3WR2 A;  7GSP A;  2ZA4 A;  3URP A;  1LOY A;  1BSD A;  2C4B A;  2F56 A;  3AHW A;  1BRN L;  2KF4 A;  1TRP A;  1X1W A;  1LOW A;  1X1Y A;  2RBI A;  1B27 A;  2GSP A;  3DGY A;  4HOH A;  1B2M A;  1TRQ A;  1SAR A;  1RGA A;  1RGL A;  1FW7 A;  1FZU A;  1B3S A;  1T2I A;  3Q3F A;  1FUT A;  1BNS A;  1RGF A;  1RGC A;  6GSP A;  1BIR A;  3SYU A;  1BRK A;  1BRJ A; 
#chains in the Genus database with same CATH topology
 2GBW B;  1GMP A;  4CJN A;  2LYX A;  1V74 A;  3X3X A;  4BL2 A;  3EN1 B;  5FGO A;  4NRE A;  1BRH A;  3SVA A;  1NNV A;  3D5I A;  2E2U A;  3CCL 3;  1VQO 3;  4STD A;  5D82 A;  1NDO B;  3A76 A;  4WYK A;  2BMR B;  3NBR A;  1SQW A;  4BTW A;  2JQ5 A;  1I2G A;  2XSH B;  3QK9 A;  1U5O A;  2KXG A;  3I55 3;  1Q7Y 4;  3MG3 A;  1VQQ A;  4HYZ A;  2F5W A;  1OF5 B;  3EF8 A;  3GWR A;  1EQK A;  1W5Z A;  1FGT A;  3BIR A;  1W6G A;  3FZW A;  4RBN A;  1W4N A;  2KF5 A;  3UB1 A;  3S28 A;  1I2F A;  1G96 A;  1TUH A;  1W7C A;  3GSP A;  2KF3 A;  1G02 A;  1OF5 A;  2ZHX B;  4EW5 A;  3CCJ 3;  3FH1 A;  2C11 A;  1DMN A;  4WP5 A;  5DRV A;  3LT8 A;  5TGN A;  5CK6 A;  3LXU X;  4Q53 A;  1RN1 A;  1KC8 4;  1I8V A;  1BRI A;  1RGG A;  1TJD A;  3KII A;  4ZM8 A;  4HVN A;  1JBR A;  4NHF A;  1GD4 A;  2UGI A;  1RNT A;  1GOV A;  1W00 A;  3HII A;  4FMD A;  2D1W A;  1FUS A;  2WO0 A;  3DM8 A;  1RRH A;  2RFR A;  3MWZ A;  3V92 A;  1B20 A;  1PY3 A;  1UGH I;  4XDV A;  2CG1 A;  3D4A A;  3U97 A;  1K41 A;  1JB4 A;  1O7M B;  2AAD A;  2RSX A;  2W04 A;  2H0G A;  3K0Z A;  1Y4K A;  1I2E A;  1IDP A;  3D3L A;  3S27 A;  2AAE A;  1BSB A;  3EC9 A;  1STF I;  5G1K A;  1L5G B;  3NV0 A;  2P05 A;  3JVC A;  3S67 A;  1AVK A;  2LQV A;  3G71 3;  2HMM B;  4HM8 B;  3DY5 A;  2XR8 B;  1FGQ A;  5CF2 A;  1KQS 2;  3D5G A;  3MSO A;  3G16 A;  3RNT A;  1WMO A;  2CWV A;  3GZB A;  1IV7 A;  1PYL A;  2CFG A;  4HZ9 B;  4HJL B;  5AYR B;  2QGU A;  1UUV B;  3Q2P A;  1N8R 4;  4K1U A;  1RN7 A;  4O8S A;  2OTJ 3;  4JRF A;  3D79 A;  1WQL B;  2P38 A;  1BAN A;  3NX0 A;  2WOH A;  3MKI A;  3KSE D;  3PS8 A;  3NXJ A;  1W2Z A;  3PCR A;  4H61 A;  4HM3 B;  2FXT A;  4DKI A;  1ULJ B;  1OAC A;  1LVN A;  4BIR A;  3RDE A;  5KP4 A;  4HM5 B;  4XBX A;  3EE1 A;  1IQ8 A;  2ZA4 A;  4BL3 A;  1TFO A;  1LOY A;  2F56 A;  3URP A;  4HBR A;  4QWT A;  5BXQ A;  1YJ9 3;  3BB9 A;  2KF4 A;  1TRP A;  2CFK A;  3OWU A;  1X1W A;  1LOW A;  1BUQ A;  1X1Y A;  2RBI A;  1B27 A;  3DGY A;  5AYS C;  1B2M A;  5CXO A;  5M1A A;  1Q40 A;  2SBL A;  5IF6 A;  3FF0 A;  2OTL 3;  1A90 A;  1TU5 A;  1B3S A;  4EV2 A;  3CC7 3;  1YVB I;  3GZR A;  4CPK A;  1RGC A;  6GSP A;  1GS3 A;  2W56 B;  3K63 A;  1O7N B;  1O7W B;  1QJG A;  2WOF A;  2XFT A;  3DUK A;  5STD A;  4PEJ A;  1EUI C;  3G6E 3;  1X1X A;  4I4K A;  1Q9E A;  5A0O B;  2M7O A;  2K54 A;  3KZT A;  3LTC A;  3Q1C A;  2W56 A;  3EBT A;  2F5M A;  1BNJ A;  2Q07 A;  3DH2 A;  1ROA A;  1N5P A;  4LGQ A;  4XDW A;  3WOF B;  3CCU 3;  1YGW A;  1BSE A;  3DXO A;  4K61 A;  8RNT A;  1A2K A;  4IPB A;  1W01 A;  4EXR A;  1A67 A;  3JUO A;  2IUK A;  1IT8 A;  1QMA A;  2CK3 H;  4HM1 B;  2W9P A;  3F8X A;  1DET A;  2BNG A;  1SII A;  1K73 4;  1SPU A;  3FG3 A;  3D9R A;  1YVS A;  3NM2 A;  4CDL A;  3LZA A;  1EKM A;  1CEW I;  1AY7 A;  1B2U A;  1OHS A;  1RLS A;  2YFJ B;  3EB8 A;  1GY6 A;  3OWY A;  1Q81 4;  2Z76 A;  1BNG A;  1YIJ 3;  2Z77 A;  2ML6 A;  3EQQ B;  2IMJ A;  4HM2 B;  3BNB A;  3STD A;  4N6T A;  3LML A;  4N6L A;  3OX9 A;  2E2T A;  1RHL A;  1TIJ A;  2V1L A;  4O2H A;  1AV4 A;  1OGZ A;  1HZ1 A;  1R4Y A;  2IUJ A;  3CPW 2;  1UUW B;  3B4O A;  1FYS A;  4L8O A;  4FCM A;  4HM6 B;  1RCK A;  2ZDJ A;  1QAL A;  4GL6 A;  4J5G A;  3CCM 3;  1AQZ A;  3WOE B;  5KP3 A;  3UNL A;  1VQL 3;  1GY7 A;  3K5T A;  5AI1 A;  1B21 A;  5IG5 A;  1VQM 3;  4ORL A;  2CKF B;  4OVM A;  1W6C A;  1BRG A;  3HOH A;  3CME 3;  5HOH A;  4EV5 A;  1BRS A;  1OUN A;  1TFK A;  3BND A;  3CPO A;  1M1K 4;  3CCV 3;  1FGR A;  1LRA A;  5BIR A;  3EHC A;  1NB3 I;  2FGT A;  7STD A;  1CYV A;  5D83 A;  4WWU C;  3X42 A;  5JPU A;  3CCS 3;  3CC4 3;  1GY5 A;  1VZZ A;  2Y73 A;  3JUQ A;  3VF1 A;  5JPP A;  2UUG C;  3X3Y A;  2HMK B;  2IA7 A;  3LOY A;  1UCL A;  2Z6B A;  1MOL A;  1BGS A;  4BU4 A;  2XH9 A;  1RCL A;  1MWS A;  1X1U A;  1VQ5 3;  3X3Z A;  1GD3 A;  1SIH A;  1JZO A;  3JUP A;  1IV9 A;  4J8T A;  1NJI 4;  4LZI A;  2E2V A;  2B24 B;  4MMX B;  2CWU A;  4EBG A;  4NPB A;  1LQG C;  2SAR A;  3SED A;  2R4I A;  2GEX A;  1YIT 3;  1YNV X;  4I5Q A;  5I97 A;  1GSP A;  3NV0 B;  2MC8 A;  9RNT A;  1NU3 A;  2W03 A;  1ZO2 A;  5IW9 A;  3BNE A;  2O3O A;  3ALA A;  3V99 A;  3DZL A;  5AIH A;  1WMN A;  5IER A;  4JF8 A;  1NO3 A;  2J8X B;  3FKA A;  3UL5 A;  5IEN A;  3WR2 A;  1NB5 I;  1IQX A;  2CFD A;  2INX A;  2C4B A;  3AHW A;  3F14 A;  2WGQ A;  1JKG A;  2BO9 B;  2CFW A;  2L4V A;  3CNX A;  3PZW A;  4J9A A;  5DRE A;  3SLU A;  3WOD G;  4RNY A;  1JJ2 2;  4MJD A;  6STD A;  4G1M B;  1C7H A;  3DGL A;  1VQN 3;  4MMY B;  2CH9 A;  2XGN A;  1FW7 A;  5EEO A;  3Q3F A;  1JB5 A;  3NM7 A;  1Q42 A;  3CU3 A;  4N6M A;  4LSO A;  1BIR A;  4BTY A;  1N5H A;  4L7K A;  5FW5 A;  3SYU A;  5JBS A;  1RJO A;  5EVH A;  1VQ8 3;  1D6U A;  1M1X B;  1HKX A;  3OWS A;  1W02 A;  3BNC A;  5HGR A;  3WMD A;  4KVH A;  2XEP A;  2GXF A;  2IYJ A;  1W6Y A;  3VGN A;  4R80 A;  2WGO A;  5M18 A;  2FNQ A;  1Q40 B;  1BVI A;  3BU4 A;  2D42 A;  3AGO A;  4HKV B;  5ELJ A;  3WHO A;  1K9M 4;  1DMQ A;  1CH0 A;  1O7H B;  1JRQ A;  1RTU A;  2MF7 A;  1C54 A;  2HOH A;  2K3D A;  4R9L A;  3CD6 3;  4LEH A;  2F4Y A;  4FMA A;  3T8U A;  3U1W A;  1JBS A;  1PFP A;  2RCD A;  1BOX A;  1TP6 A;  2IY2 A;  3BLZ A;  3TDG A;  2PNC A;  7RNT A;  8CHO A;  3FG1 A;  4FMC A;  3HX8 A;  4X2H A;  1RGK A;  2GU1 A;  2QIY A;  5CF1 A;  3OW2 2;  2XSO B;  5IG0 A;  3V98 A;  3S29 A;  3LT9 A;  1GOU A;  4AKY A;  1Q82 4;  1I70 A;  1IVV A;  1YHQ 3;  5EQL A;  3SXX A;  1U8C B;  1WTH A;  3MYT A;  4GSP A;  3M8C A;  1W2B 2;  4AKZ A;  2OCT A;  3KSP A;  3MG1 A;  2Y74 A;  1ZX2 A;  5LC7 A;  1UUG B;  3DGO A;  2HMN B;  1UCJ A;  1O7P B;  1GOY A;  2R41 A;  3B8L A;  2XF3 A;  3PCS A;  1ISK A;  1EA2 A;  5RNT A;  3AGN A;  1DE3 A;  1RDS A;  1UCI A;  2BMQ B;  1JBT A;  1BNF A;  2RGQ A;  3B4P A;  2HMO B;  5LC6 A;  4RNZ A;  5IEO A;  4FR9 A;  5KP1 A;  5IEP A;  5AIG A;  1G0T A;  3KCH A;  4GHO A;  2H0H A;  1ROV A;  2HMJ B;  4HM4 B;  3WA3 A;  2KRT A;  1MWR A;  1HYF A;  4CCV A;  1UCK A;  1N8Q A;  3T8N A;  3GZX B;  3S5C A;  2I9W A;  1BU4 A;  1I0V A;  4RNT A;  5IG3 A;  3CCQ 3;  3FG4 A;  1BSA A;  1M90 4;  3J7Y d;  3IJE B;  3PXM A;  4AEQ A;  3ZG5 A;  1HU9 A;  2YFL B;  3CC2 3;  1ASK A;  1A2V A;  4J5K A;  4N6V 0;  2CX1 A;  3F7X A;  3I0Y A;  3I56 3;  1R4C A;  1B2Z A;  1IVU A;  1RSN A;  1N9E A;  1T2H A;  1QVF 2;  1OHO A;  2H0I A;  3MPH A;  1Q7H A;  1RGE A;  1T3B A;  1B2S A;  2P0M A;  3F7S A;  5AEU B;  3LH4 A;  2CFL A;  2O9U X;  1IVX A;  3AMO B;  3T0U A;  3G4S 3;  1BSC A;  1RN4 A;  3N8B A;  3KE7 A;  3RGA A;  2GEY A;  1LNH A;  4EYC A;  1LOX A;  3LYG A;  4RZM A;  1QAK A;  1MGR A;  2CIU A;  1RNB A;  3CCE 3;  1AVL A;  3G8Z A;  4R4K A;  2GBX B;  1MWT A;  1N9J A;  1YJN 3;  7GSP A;  2F99 A;  1YJW 3;  3FLJ A;  4N6U A;  1BSD A;  1STD A;  1IQY A;  1FGO A;  3AMO A;  3EBY A;  3MG2 A;  1BRN L;  1VQ6 3;  1JB2 A;  1AR0 A;  3CMA 3;  2GSP A;  1S5A A;  1M9G A;  1Z1S A;  1UI8 A;  3UJM A;  3WDG B;  2QA4 3;  2BT3 A;  1DVC A;  1VQP 3;  1TRQ A;  1SAR A;  1IT7 A;  1RGL A;  1JN5 B;  2BMO B;  1FZU A;  4IIA A;  5AIF A;  1QVG 2;  5ELU A;  1BNS A;  2QEX 3;  3GZY B;  2F86 B;  1V58 A;  2YFI B;  1S72 3;  1JNQ A;  3E99 A;  1KWI A;  3UL6 A;  5IG4 A;  1BRK A;  2CWT A;  4K1V A;  5CLK A;  1JKG B;  4X2O A;  1IYY A;  1ULI B;  1EG9 B;  1JN5 A;  2HML B;  4H3U A;  4WHA A;  2P0X A;  3LTB A;  2JDI H;  3O8Y A;  1ZGX A;  4BTX A;  2OQE C;  1UI7 A;  2W6J H;  4ILF A;  2OWP A;  3NBJ A;  1GYB A;  3NBB A;  1E3V A;  4N6O B;  5D81 A;  1Q86 4;  3EJV A;  2ML5 A;  5G2G A;  3F8H A;  1F8N A;  3MHE A;  2OQE A;  1I3I A;  1RMS A;  1UGI A;  3N54 B;  5M19 A;  1ZS7 A;  1SJW A;  2KF6 A;  2STD A;  1BUJ A;  2CG0 A;  3H3H A;  1I3F A;  1NWW A;  2W0Q A;  2XFS A;  3AHS A;  4GB5 A;  1MGW A;  1BNR A;  1DMM A;  1OH0 A;  3GRD A;  3CNM A;  3KKG A;  5G1L A;  3X40 A;  1VQ4 3;  3DGN A;  1CQS A;  2XRX B;  3SX1 A;  1OCV A;  3FSD A;  3FCS B;  1B2X A;  3PGB A;  1K28 A;  1RKY A;  2F98 A;  3NUV A;  3HZP A;  2C10 A;  4XBT A;  3ZG0 A;  2B1X B;  1D6Z A;  3NQY A;  1DYU A;  1YI2 3;  2GU3 A;  4KFD A;  3K9M C;  4MMZ B;  4N3V A;  5GSP A;  3B7C A;  2L1S A;  3DMC A;  4FCJ A;  3L0R A;  4KFE A;  4XBY A;  3K7C A;  4XM4 A;  1LQM B;  4FCZ A;  2A15 A;  1D6Y A;  4TX4 A;  1J2B A;  4KT3 B;  1KD1 4;  3G0K A;  1RRL A;  4R1K A;  3A5E A;  1IU7 A;  1LNI A;  2BU4 A;  1VQ7 3;  1BNI A;  4KZ1 A;  3DGM A;  3F40 A;  3OXA A;  4WFO A;  2OOV C;  2KCD A;  1IVW A;  1OHP A;  1FGM A;  1OGX A;  1BNE A;  3EX9 A;  3LTD A;  4K90 B;  3KN4 A;  3VSY A;  3WA2 X;  1GMQ A;  3IMA B;  4U13 A;  1VQ9 3;  3CCR 3;  2OOV A;  1A2P A;  1LXE A;  3X41 A;  3IPT A;  4FMB A;  4MEI A;  4N6N B;  3FF2 A;  1IK3 A;  3CXC 2;  1JV2 B;  1KSI A;  1LOV A;  3ROB A;  2KAA A;  1UDI I;  3ZFZ A;  2BIR A;  1WNH A;  2CHC A;  4KFF A;  4HM7 B;  4O02 B;  4IT7 A;  3HK4 A;  1I0X A;  1UW1 A;  3GAX A;  1EEJ A;  4LYL B;  1YGE A;  3H51 A;  3N9H A;  3NQZ A;  3SOA A;  6RNT A;  2UX0 A;  4L8P A;  4LMI A;  4HAA A;  2W2C A;  3NHX A;  1RGH A;  1GMR A;  5AII A;  4OK0 A;  1TTO A;  1DVD A;  1FUW A;  3JUN A;  3LTA A;  2K0M A;  1OPY A;  2W9Q A;  1BAO A;  1K8A 4;  3ECF A;  3F9S A;  5BU4 A;  1MWU A;  1PU4 A;  2RNT A;  1T5Y A;  1FA3 A;  2Z7A A;  3ER7 A;  5BVB A;  2YX9 A;  2PZV A;  3PYJ A;  2ZL8 A;  3OV4 A;  2CC3 A;  3RGR A;  1E3R A;  1VQK 3;  4HZB B;  3HI7 A;  1V57 A;  2CW9 A;  4HM0 B;  3JUM A;  4HOH A;  1MNL A;  3EN8 A;  1QAF A;  2BHM A;  2CX0 A;  4O3V A;  4R9K A;  1E97 A;  2P09 A;  1O7G B;  1RGA A;  4EC6 A;  5AEW B;  1T2I A;  4OUQ A;  2XGL A;  3Q90 A;  1FUT A;  1US1 A;  3FGY A;  3HIG A;  1RGF A;  3KFQ C;  1JZD A;  1CYU A;  4WYK B;  1WMP A;  3SOY A;  4XB5 A;  3QRD A;  1BRJ A; 
#chains in the Genus database with same CATH homology
 1IYY A;  1GMP A;  1X1X A;  1Q9E A;  1BRH A;  3BU4 A;  1BVI A;  1ZGX A;  3AGO A;  3WHO A;  3D5I A;  1CH0 A;  1RTU A;  1C54 A;  2F5M A;  1BNJ A;  2HOH A;  3DH2 A;  1I3I A;  1I2G A;  1RMS A;  1YGW A;  1BSE A;  2F4Y A;  8RNT A;  2KF6 A;  1JBS A;  1BUJ A;  1BOX A;  1I3F A;  2F5W A;  3AHS A;  1DET A;  1MGW A;  7RNT A;  1BNR A;  1RGK A;  1YVS A;  3BIR A;  1RLS A;  1AY7 A;  1B2U A;  2KF5 A;  1GOU A;  1I2F A;  1BNG A;  1B2X A;  1I70 A;  3GSP A;  4GSP A;  2KF3 A;  1G02 A;  1RHL A;  1HZ1 A;  1R4Y A;  5GSP A;  1FYS A;  1UCJ A;  1RCK A;  1RN1 A;  4J5G A;  1I8V A;  1BRI A;  1AQZ A;  1GOY A;  1RGG A;  1JBR A;  1B21 A;  1RNT A;  5RNT A;  3AGN A;  1DE3 A;  1GOV A;  1BRG A;  1RDS A;  1UCI A;  1FUS A;  3HOH A;  1JBT A;  5HOH A;  1BRS A;  1BNF A;  1LNI A;  3A5E A;  2BU4 A;  1BNI A;  1LRA A;  1B20 A;  1PY3 A;  5BIR A;  3D4A A;  1BNE A;  2AAD A;  3KCH A;  4GHO A;  1GMQ A;  1A2P A;  1HYF A;  1UCK A;  1I2E A;  1BU4 A;  1I0V A;  4RNT A;  2AAE A;  1BSB A;  1UCL A;  1LOV A;  1BSA A;  2KAA A;  1BGS A;  4BU4 A;  2BIR A;  1RCL A;  1X1U A;  1I0X A;  4J5K A;  3D5G A;  6RNT A;  3RNT A;  4HAA A;  1PYL A;  1B2Z A;  1RGH A;  1GMR A;  1RSN A;  1T2H A;  2SAR A;  1RGE A;  1TTO A;  1B2S A;  1YNV X;  1GSP A;  9RNT A;  1BAN A;  1BSC A;  1RN4 A;  1BAO A;  5BU4 A;  2RNT A;  4BIR A;  1MGR A;  1RNB A;  3WR2 A;  7GSP A;  2ZA4 A;  3URP A;  1LOY A;  1BSD A;  2C4B A;  2F56 A;  3AHW A;  1BRN L;  2KF4 A;  1TRP A;  1X1W A;  1LOW A;  1X1Y A;  2RBI A;  1B27 A;  2GSP A;  3DGY A;  4HOH A;  1B2M A;  1TRQ A;  1SAR A;  1RGA A;  1RGL A;  1FW7 A;  1FZU A;  1B3S A;  1T2I A;  3Q3F A;  1FUT A;  1BNS A;  1RGF A;  1RGC A;  6GSP A;  1BIR A;  3SYU A;  1BRK A;  1BRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...