3VGNA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 3-fluoro-4-nitrophenol
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Quantitative dissection of hydrogen bond-mediated proton transfer in the ketosteroid isomerase active site
pubmed doi rcsb
source organism Pseudomonas putida
total genus 33
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3vgnA00
2RGQA 1JN5A 3EF8A 2OWPA 4HM6B 3B8LA 3F40A 3RGRA 5AIHA 4Q53A 3EJVA 3F7XA 2GBWB 4WP5A 1GY6A 2HMMB 3EC9A 3CNXA 3F8XA 3FH1A 3JUPA 3NM2A 4K1VA 4L7KA 3NV0B 4XM4A 1JKGA 2YFIB 3ROBA 3DZLA 2QGUA 5KP1A 1E3VA 2CKFB 4U13A 1OPYA 4WYKB 5IG0A 1HKXA 3EN8A 1GYBA 3F14A 3OV4A 5AEUB 4LGQA 4X2HA 3MKIA 3DXOA 1WQLB 3H3HA 2YFJB 3WMDA 3SOYA 3STDA 1QJGA 2GEXA 3FZWA 2BMRB 2F98A 4J8TA 2INXA 3EN1B 1DMNA 1ZX2A 4HM2B 1Z1SA 3HK4A 2GXFA 4STDA 3BLZA 3GZBA 3UNLA 5KP3A 3H51A 3G8ZA 1OGXA 2QIYA 1E97A 6STDA 3OWUA 4HM4B 3OWSA 4XDVA 2A15A 3RGAA 2XSHB 3Q90A 1QMAA 1OCVA 3NUVA 1TUHA 4H3UA 5STDA 1UUVB 3K0ZA 5JPPA 3E99A 4HM8B 1AR0A 3KSPA 5JPUA 3HZPA 3MG2A 3NBRA 2B1XB 1UUWB 5HGRA 4HZBB 5IF6A 3NHXA 3LYGA 1K41A 5CK6A 1ISKA 3FSDA 3JUMA 1W02A 5IENA 3M8CA 3DMCA 1A2KA 4XBXA 2RCDA 5G2GA 2JQ5A 1EA2A 4X2OA 3GRDA 3FLJA 4HM3B 5D83A 1OHOA 5D81A 5IERA 1S5AA 2PZVA 1VZZA 2RFRA 3GZYB 1OF5A 2W2CA 1W6YA 3HX8A 3CU3A 5IEOA 3MSOA 4K1UA 2Z7AA 2I9WA 1U5OA 5DRVA 1O7GB 1JN5B 4J9AA 2YFLB 1DMQA 4GB5A 2BMOB 4HJLB 4IIAA 1ASKA 4KVHA 5IEPA 2XR8B 2HMOB 3KKGA 2F99A 4XBYA 8CHOA 3ECFA 5AIFA 4CDLA 1EG9B 3ER7A 3EQQB 3A76A 3MG1A 5IG3A 5AIGA 5AI1A 1O7WB 5CLKA 1JKGB 5AIIA 1STDA 4RZMA 1OF5B 1O7NB 3JUOA 1NDOB 3CNMA 4FCJA 1CQSA 3BB9A 3B7CA 4R9LA 2CHCA 2F86B 1W01A 3K7CA 1GS3A 1IDPA 1ULIB 4HM5B 4LMIA 3FF2A 1JB5A 3G16A 4OVMA 2BNGA 3FKAA 2GEYA 4LEHA 1ULJB 5TGNA 3T8UA 5CXOA 4L8OA 3NV0A 2Z77A 3G0KA 4HM0B 4R9KA 5AEWB 4L8PA 3EX9A 3GZRA 3EBYA 5D82A 3LZAA 1BUQA 5DREA 1E3RA 2XRXB 4R1KA 2GBXB 3VSYA 2Z76A 5BVBA 5CF1A 3B4OA 2STDA 3SEDA 4MJDA 1OHPA 1OH0A 3T8NA 1C7HA 3JUNA 1TP6A 4HM1B 4HM7B 5BXQA 3I0YA 1GY7A 4ORLA 3JUQA 4XDWA 1W00A 3UJMA 1DMMA 1O7HB 2BMQB 4OUQA 2B24B 4XBTA 5IG5A 3DUKA 3GZXB 1ZO2A 1JB4A 3GWRA 5CF2A 3IPTA 2HMJB 2HMNB 3FF0A 1OUNA 3EHCA 1Q42A 1Q40A 2XSOB 3MG3A 1O7PB 3OX9A 1NWWA 3SOAA 3F9SA 3S5CA 2IMJA 4HZ9B 3FGYA 3DM8A 3MYTA 3F7SA 1OGZA 3KE7A 3CPOA 2UX0A 3EBTA 4HKVB 2HMLB 4N3VA 5IG4A 1OHSA 1SJWA 1GY5A 1O7MB 3KZTA 5FW5A 3D9RA 1NU3A 3VGNA 2R4IA 5KP4A 3F8HA 4HVNA 4PEJA 1Q40B 3OXAA 7STDA 1JB2A 5EVHA 3MHEA 4XB5A 4WWUC 4WYKA 3OWYA 2K54A 3NXJA 3B4PA 4FCMA 4I4KA 2HMKB
chains in the Genus database with same CATH superfamily
1UI8A 2RGQA 1JN5A 5FGOA 3EF8A 2XFSA 2OWPA 4HM6B 3B8LA 1UGHI 1BSDA 3F40A 2ZL8A 3PCRA 3ZG5A 3RGRA 3UL6A 3D5IA 2BIRA 6GSPA 5AIHA 3X42A 3N9HA 4Q53A 1BSAA 1PYLA 3EJVA 3F7XA 2CG0A 3DY5A 1Q814 4QWTA 5EEOA 2GBWB 1STFI 1VQN3 4OK0A 3NX0A 1GY6A 4WP5A 2H0GA 2P38A 2HMMB 1MWSA 3CNXA 3EC9A 3SX1A 3F8XA 3FH1A 1UCIA 1IQXA 1IYYA 3JUPA 3K9MC 3NM2A 3NQYA 2O9UX 3LH4A 2H0HA 2CFGA 2XEPA 1BSCA 4K1VA 1I2GA 4HAAA 2OTL3 1HU9A 4BL3A 3KN4A 7GSPA 4L7KA 2XFTA 3JVCA 3LXUX 3NV0B 4XM4A 1GOUA 2E2TA 3Q2PA 1JKGA 2YFIB 3ROBA 1LNHA 3NM7A 1X1UA 3DZLA 3RNTA 2QGUA 2KF3A 3X3ZA 2LQVA 2GU3A 5KP1A 1E3VA 1VQ93 2CKFB 4U13A 1OPYA 1YGEA 4WYKB 1FUWA 1M1K4 5BU4A 3KCHA 2K3DA 1GOYA 1US1A 3PYJA 4MMYB 5IG0A 3CCR3 1HKXA 3NBJA 2XGNA 3EN8A 1GYBA 3CD63 2F4YA 3G4S3 3F14A 4EBGA 3OV4A 4N6OB 1EKMA 5IW9A 1BVIA 2UUGC 3KFQC 4O02B 5AEUB 4LGQA 4X2HA 3MKIA 1SQWA 3DXOA 1B2UA 1D6YA 1WQLB 3ZG0A 4CJNA 4BTXA 3H3HA 2CWTA 2YFJB 4HBRA 3WMDA 1JV2B 4KFFA 5GSPA 3SOYA 1RGAA 2Z6BA 4O2HA 5JBSA 1X1WA 3GSPA 4R4KA 1UI7A 1GMRA 5AYRB 3STDA 1UCKA 1QJGA 1AV4A 1M904 1RCLA 1BNIA 2GEXA 1B27A 3FZWA 2CK3H 1CYUA 1RCKA 3UB1A 1QAFA 1YGWA 2BMRB 3DGNA 1V57A 2F98A 3WDGB 3WOFB 4J8TA 1D6UA 2INXA 3EN1B 3WA3A 1I2EA 2XF3A 1I8VA 1T2HA 3O8YA 1GMQA 1DMNA 4J5GA 4WFOA 1IV7A 2WGOA 1RGLA 3AMOA 1ZX2A 4FMCA 1Z1SA 4HM2B 4FMAA 1IQYA 1WMPA 2FNQA 2GXFA 3HK4A 3Q3FA 4STDA 3BLZA 3GZBA 3UNLA 2MC8A 5KP3A 1B2XA 3H51A 2P0XA 3G8ZA 1MWTA 1OACA 5ELJA 1RHLA 1I0VA 2CFWA 1OGXA 2QIYA 1UUGB 1E97A 2RBIA 3G6E3 2D1WA 1QVF2 3PCSA 1A2VA 4FMDA 4GL6A 1UCLA 6STDA 1UCJA 1WTHA 2P0MA 2CH9A 1IQ8A 1W7CA 3OWUA 2D42A 3OWSA 1FGRA 4HM4B 1BRJA 2ZA4A 1WNHA 4XDVA 2A15A 3CPW2 3ALAA 1RN4A 3HIIA 4KT3B 2CC3A 1DVCA 2XSHB 3RGAA 3SVAA 1AVLA 3Q90A 3IJEB 1QMAA 1OCVA 1AY7A 3LT9A 3NUVA 4N6UA 1TUHA 4H3UA 4IPBA 5STDA 3BNBA 1I3FA 1UUVB 1A90A 1WMOA 3U97A 1R4YA 3K0ZA 5JPPA 2AAEA 1TIJA 1TRPA 2KRTA 1I70A 3E99A 4HM8B 1IVVA 1N9EA 1YVBI 2F5WA 1AR0A 3DGLA 3KSPA 4ILFA 2KF5A 4JF8A 4RBNA 5JPUA 3HZPA 3MG2A 4MMXB 4TX4A 3LTDA 3AHWA 5LC7A 2PNCA 1F8NA 1FYSA 4RNZA 1Q7Y4 4CPKA 3NBRA 4N6TA 1DVDA 2B1XB 1UUWB 3IMAB 4HZBB 5HGRA 5IF6A 3NHXA 3LYGA 1VQ83 1K41A 2W6JH 4GSPA 2C4BA 3AMOB 5CK6A 1ISKA 1SIHA 3FSDA 2XH9A 3JUMA 2OQEA 1W02A 1TJDA 1KQS2 5IENA 3M8CA 3DMCA 1A2KA 4XBXA 1V58A 2RCDA 1ZGXA 1BAOA 2OQEC 2IYJA 1VQ63 2J8XB 5G2GA 2JQ5A 1RGEA 1EA2A 2RNTA 3NQZA 1RGGA 4X2OA 3DGOA 1VQ73 3GRDA 2R41A 1CH0A 2M7OA 3FLJA 4HM3B 4ZM8A 5D83A 1OHOA 2GU1A 1N5PA 3BIRA 3HOHA 4DKIA 1JJ22 1IV9A 1PU4A 2FGTA 1IVXA 5D81A 5IERA 1VQM3 2V1LA 3I563 1UGIA 3I553 1LXEA 4BU4A 1S5AA 1YIT3 2W9PA 3X3YA 1K28A 2K0MA 1W2ZA 3SYUA 3AGOA 2PZVA 1BNFA 4N6MA 1VZZA 5M19A 4GHOA 5I97A 2RFRA 1BRNL 3GZYB 2FXTA 4EXRA 1QAKA 1OF5A 3BNDA 3QRDA 2IA7A 2W2CA 2W56B 3N54B 1CEWI 1W6YA 3HX8A 1AQZA 5RNTA 3CU3A 4AKYA 5IEOA 4RNYA 1NJI4 1RNTA 3MSOA 1BGSA 1W4NA 2KCDA 1BUJA 2F5MA 4NREA 4K1UA 5M18A 1BIRA 2Z7AA 2I9WA 1DE3A 1U5OA 5DRVA 1O7GB 2CX1A 1JN5B 1W2B2 2CFDA 4J9AA 1YJ93 2BT3A 3MPHA 3CCE3 1EEJA 1G0TA 2YFLB 2SARA 2QA43 1DMQA 4GB5A 3KSED 3PGBA 2BMOB 3S67A 1FGMA 2CX0A 4HJLB 4IIAA 1NNVA 1ASKA 1W6CA 5EQLA 1ZS7A 1QVG2 4KVHA 5IEPA 2XR8B 3DGYA 2HMOB 3Q1CA 3WHOA 3KKGA 1IVUA 5CF2A 2F99A 2CWVA 4XBYA 3PXMA 8CHOA 3ECFA 1T3BA 4EW5A 1SPUA 2LYXA 5AIFA 4CDLA 1EG9B 1FUSA 3K5TA 1LVNA 2MF7A 3ER7A 3A76A 1N9JA 3D4AA 3EQQB 3MG1A 4LZIA 3CCL3 5IG3A 5AIGA 5AI1A 1O7WB 2Y73A 2W9QA 3FG3A 1JBTA 1RRLA 3L0RA 1RLSA 3CME3 1KD14 4KFDA 1M1XB 1JKGB 5CLKA 5AIIA 1FGOA 4K90B 2WO0A 3DH2A 1STDA 4NHFA 1K8A4 1W5ZA 1JNQA 1G02A 4RZMA 1OF5B 3PZWA 1RN1A 1O7NB 3UL5A 1NDOB 3CNMA 3JUOA 2L1SA 1GOVA 4FCJA 2IUKA 1CQSA 3BB9A 4NPBA 3U1WA 1IK3A 4O8SA 3B7CA 1NO3A 1BRHA 1M9GA 1FGQA 5LC6A 4R9LA 4KFEA 5M1AA 1N8QA 2CHCA 4N6V0 2F86B 3CC23 1W01A 1Q9EA 1NB3I 3K7CA 1JZOA 4MEIA 1RJOA 1GS3A 3SXXA 1IDPA 1GD3A 1ULIB 2IUJA 4HM5B 1YHQ3 3ZFZA 1BSBA 3QK9A 2H0IA 4I5QA 4LMIA 3EB8A 4AKZA 1RGCA 1BRGA 1ROVA 1JB5A 3FF2A 3G16A 1MOLA 2KAAA 2CFKA 3LMLA 4OVMA 1FUTA 2SBLA 2W04A 4IT7A 2BNGA 3FKAA 1IU7A 2CFLA 1GMPA 1YVSA 4FR9A 1B2ZA 5AYSC 2GEYA 4LEHA 3X3XA 1ULJB 3HI7A 1IT8A 5TGNA 3T8UA 1YIJ3 4CCVA 2KXGA 5CXOA 4BTWA 2Q07A 1VQO3 4L8OA 4J5KA 1MWUA 3TDGA 1ROAA 5BIRA 3CCM3 3CMA3 5A0OB 1BRSA 1BRKA 1RGKA 2Y74A 3S27A 3NV0A 3D3LA 3V99A 2CW9A 2Z77A 3G0KA 4EV2A 1TFOA 1B21A 2KF6A 4HM0B 3GAXA 1VQ43 3EE1A 1FW7A 1RMSA 1I2FA 1Y4KA 3J7Yd 1EQKA 4R9KA 5AEWB 1VQL3 4L8PA 2WOFA 8RNTA 3EX9A 3GZRA 1YI23 3WA2X 3PS8A 3EBYA 3CCJ3 5D82A 3LZAA 1BUQA 4FCZA 3VF1A 3D79A 1YJN3 2L4VA 1N8R4 4FMBA 5DREA 1RRHA 4MMZB 1E3RA 5G1KA 2XRXB 1SIIA 1TRQA 1BNEA 1L5GB 1UDII 1RSNA 2KF4A 4R1KA 2E2UA 4G1MB 2GBXB 1EUIC 2O3OA 1SARA 3VSYA 1HYFA 2Z76A 4KZ1A 4BL2A 5BVBA 3B4OA 3SLUA 5CF1A 2STDA 1GSPA 2P09A 3SEDA 4MJDA 1CYVA 1OHPA 1BNSA 2JDIH 1KWIA 2YX9A 1LOYA 1MGWA 1OH0A 2BU4A 3FCSB 5G1LA 3T8NA 1JBSA 3CCQ3 1LRAA 1C7HA 3N8BA 3FG4A 4LYLB 3RDEA 1VQP3 1RDSA 2E2VA 4BTYA 1KC84 1FA3A 1DETA 5HOHA 1UW1A 3JUNA 1V74A 1TP6A 3K63A 1BNJA 2CIUA 2C10A 1BSEA 4BIRA 4HM1B 4HM7B 1BANA 5BXQA 1BRIA 1BU4A 1IT7A 4WHAA 3I0YA 3CC43 1MNLA 1GY7A 4ORLA 3JUQA 4O3VA 1R4CA 2OCTA 2BHMA 4XDWA 1LQMB 1PY3A 2HOHA 3HIGA 1W00A 3LT8A 3BNEA 3UJMA 2P05A 3V98A 4H61A 3S29A 1RKYA 1DMMA 1O7HB 2BMQB 4OUQA 2B24B 4XBTA 3T0UA 5IG5A 3DUKA 3MWZA 3GZXB 2BO9B 1ZO2A 2CWUA 1JB4A 3BU4A 3GWRA 1JRQA 1LOWA 1Q7HA 3IPTA 2HMJB 1QALA 2HMNB 3FF0A 3URPA 3NBBA 1OUNA 3OW22 1Q824 1S723 3EHCA 3AHSA 1X1XA 2XGLA 4N6NB 1Q42A 3X40A 1DYUA 1YJW3 3X41A 3LOYA 1Q40A 2WOHA 2XSOB 3MG3A 1AVKA 1O7PB 3OX9A 1NWWA 4JRFA 3SOAA 1X1YA 1GD4A 3F9SA 1J2BA 2OTJ3 1U8CB 1JZDA 1LOXA 3D5GA 2F56A 1BOXA 3S5CA 3BNCA 1BNRA 3CCV3 1Q864 6RNTA 1RGFA 2IMJA 4HZ9B 2QEX3 3FGYA 3A5EA 1JBRA 3DM8A 3MYTA 1RN7A 3FG1A 3F7SA 4RNTA 1VQ53 5ELUA 1BNGA 1OGZA 3WODG 3WR2A 1A67A 2ML5A 2RSXA 4K61A 2WGQA 3KE7A 3S28A 3CPOA 1VQK3 1MGRA 1TFKA 2GSPA 3AGNA 2ML6A 1PFPA 2UX0A 4LSOA 1B2MA 3EBTA 4EYCA 3LTAA 2ZDJA 4N6LA 1KSIA 4HKVB 2HMLB 4N3VA 5IG4A 3WOEB 1WMNA 2W0QA 3DGMA 1OHSA 1RTUA 1SJWA 4HYZA 1I0XA 4AEQA 1GY5A 1O7MB 1VQQA 1LNIA 7RNTA 1A2PA 1I3IA 3KZTA 1G96A 2CG1A 5FW5A 3CXC2 2ZHXB 3D9RA 1NU3A 1TU5A 1B20A 4R80A 3LTCA 3VGNA 1N5HA 1RGHA 3CCU3 3CC73 2R4IA 5KP4A 2OOVA 3F8HA 9RNTA 2IY2A 4HVNA 3CCS3 1B3SA 1C54A 3KIIA 4PEJA 2W03A 3LTBA 1K734 1HZ1A 1Q40B 1LOVA 4EC6A 2C11A 2OOVC 3OXAA 2AADA 4HOHA 4EV5A 1IVWA 1W6GA 7STDA 3G713 1JB2A 5EVHA 1FGTA 1YNVX 1MWRA 3MHEA 4XB5A 1D6ZA 2W56A 1NB5I 4WWUC 1LQGC 4WYKA 1RNBA 1T5YA 2UGIA 1FZUA 1K9M4 1B2SA 2K54A 3OWYA 1TTOA 3NXJA 3B4PA 1T2IA 4FCMA 4I4KA 3V92A 2HMKB
chains in the Genus database with same CATH topology
1UI8A 2RGQA 1JN5A 5FGOA 3EF8A 2XFSA 2OWPA 4HM6B 3B8LA 3PCRA 3F40A 2ZL8A 3RGRA 3UL6A 5AIHA 3X42A 3N9HA 4Q53A 3EJVA 3F7XA 2CG0A 3DY5A 1Q814 4QWTA 5EEOA 2GBWB 1STFI 1VQN3 4OK0A 3NX0A 1GY6A 4WP5A 2P38A 2HMMB 3EC9A 3CNXA 3SX1A 3F8XA 3FH1A 1IQXA 3JUPA 3K9MC 3NM2A 3NQYA 2O9UX 3LH4A 2CFGA 2XEPA 4K1VA 2OTL3 1HU9A 3KN4A 4L7KA 2XFTA 3JVCA 3LXUX 3NV0B 4XM4A 3Q2PA 2E2TA 1JKGA 2YFIB 3ROBA 1LNHA 3NM7A 3DZLA 2QGUA 3X3ZA 2LQVA 2GU3A 5KP1A 1E3VA 1VQ93 2CKFB 4U13A 1OPYA 1YGEA 4WYKB 1FUWA 1M1K4 1US1A 3PYJA 4MMYB 5IG0A 3CCR3 1HKXA 3NBJA 2XGNA 3EN8A 1GYBA 3CD63 3G4S3 3F14A 4EBGA 3OV4A 4N6OB 1EKMA 5IW9A 3KFQC 4O02B 5AEUB 4LGQA 4X2HA 3MKIA 1SQWA 3DXOA 1D6YA 1WQLB 4BTXA 3H3HA 2CWTA 2YFJB 4HBRA 3WMDA 1JV2B 4KFFA 3SOYA 2Z6BA 4O2HA 5JBSA 4R4KA 1UI7A 5AYRB 3STDA 1QJGA 1AV4A 1M904 2GEXA 3FZWA 2CK3H 1CYUA 3UB1A 1QAFA 2BMRB 3DGNA 2F98A 3WOFB 3WDGB 4J8TA 1D6UA 2INXA 3EN1B 3WA3A 2XF3A 3O8YA 1DMNA 4WFOA 1IV7A 2WGOA 3AMOA 1ZX2A 4FMCA 1Z1SA 4HM2B 4FMAA 1IQYA 1WMPA 2FNQA 2GXFA 3HK4A 4STDA 3BLZA 3GZBA 3UNLA 2MC8A 5KP3A 3H51A 2P0XA 3G8ZA 1OACA 5ELJA 2CFWA 1OGXA 2QIYA 1E97A 3G6E3 2D1WA 1QVF2 3PCSA 1A2VA 4FMDA 4GL6A 6STDA 1WTHA 2P0MA 2CH9A 1IQ8A 1W7CA 3OWUA 2D42A 3OWSA 1FGRA 4HM4B 1WNHA 4XDVA 2A15A 3CPW2 3ALAA 3HIIA 3RGAA 3SVAA 2CC3A 1DVCA 2XSHB 1AVLA 3Q90A 3IJEB 1QMAA 1OCVA 3LT9A 3NUVA 4N6UA 1TUHA 4H3UA 4IPBA 5STDA 3BNBA 1A90A 1UUVB 1WMOA 3U97A 3K0ZA 5JPPA 1TIJA 2KRTA 3E99A 4HM8B 4RNYA 1IVVA 1N9EA 1YVBI 3DGLA 1AR0A 4JF8A 3KSPA 4RBNA 5JPUA 3HZPA 3MG2A 4MMXB 4TX4A 3LTDA 5LC7A 2PNCA 1F8NA 4RNZA 1Q7Y4 3NBRA 4N6TA 1DVDA 2B1XB 1UUWB 3IMAB 4HZBB 5HGRA 5IF6A 3NHXA 3LYGA 1VQ83 1K41A 2W6JH 3AMOB 5CK6A 1ISKA 1SIHA 3FSDA 2XH9A 3JUMA 2OQEA 1W02A 1KQS2 5IENA 3M8CA 3DMCA 1A2KA 4XBXA 2RCDA 2OQEC 1VQ63 5G2GA 2JQ5A 1EA2A 3NQZA 4X2OA 3DGOA 1VQ73 3GRDA 2M7OA 3FLJA 4HM3B 4ZM8A 5D83A 1OHOA 2GU1A 1N5PA 1JJ22 1IV9A 1PU4A 2FGTA 1IVXA 5D81A 5IERA 1VQM3 2V1LA 3I563 3I553 1LXEA 1S5AA 1YIT3 2W9PA 3X3YA 1K28A 2K0MA 1W2ZA 2PZVA 4N6MA 1VZZA 5I97A 2RFRA 3GZYB 2FXTA 4EXRA 1QAKA 1OF5A 3BNDA 3QRDA 2IA7A 2W2CA 2W56B 3N54B 1CEWI 1W6YA 3HX8A 3CU3A 4AKYA 5IEOA 1NJI4 3MSOA 2KCDA 1W4NA 4NREA 4K1UA 2Z7AA 2I9WA 1U5OA 5DRVA 1O7GB 1JN5B 1W2B2 2CFDA 4J9AA 1YJ93 2BT3A 3MPHA 3CCE3 2YFLB 2QA43 1DMQA 4GB5A 3KSED 3PGBA 2BMOB 3S67A 1FGMA 4HJLB 4IIAA 5EQLA 1QVG2 1ASKA 1W6CA 4KVHA 5IEPA 2XR8B 3Q1CA 2HMOB 3KKGA 1IVUA 2F99A 2CWVA 4XBYA 3PXMA 8CHOA 3ECFA 1SPUA 2LYXA 5AIFA 4CDLA 1EG9B 3K5TA 1LVNA 2MF7A 3ER7A 3A76A 1N9JA 3EQQB 3CCL3 3MG1A 4LZIA 5IG3A 5AIGA 5AI1A 1O7WB 2Y73A 2W9QA 3FG3A 1RRLA 3L0RA 3CME3 1KD14 4KFDA 1M1XB 1JKGB 5CLKA 5AIIA 1FGOA 4K90B 2WO0A 4NHFA 1STDA 1K8A4 1W5ZA 1JNQA 4RZMA 1OF5B 3PZWA 1O7NB 3UL5A 1NDOB 3CNMA 3JUOA 4FCJA 2IUKA 1CQSA 3BB9A 1IK3A 3U1WA 4O8SA 3B7CA 1NO3A 1M9GA 1FGQA 5LC6A 4R9LA 4KFEA 1N8QA 2CHCA 4N6V0 2F86B 3CC23 1W01A 1NB3I 3K7CA 4MEIA 1RJOA 1GS3A 3SXXA 1IDPA 1GD3A 1ULIB 2IUJA 4HM5B 1YHQ3 3QK9A 4LMIA 3EB8A 4AKZA 1ROVA 3FF2A 1JB5A 3LMLA 3G16A 1MOLA 2CFKA 4OVMA 2SBLA 2W04A 4IT7A 2BNGA 3FKAA 1IU7A 2CFLA 4FR9A 5AYSC 2GEYA 4LEHA 3X3XA 1ULJB 3HI7A 1IT8A 5TGNA 3T8UA 1YIJ3 4CCVA 2KXGA 5CXOA 4BTWA 2Q07A 1VQO3 4L8OA 3TDGA 1ROAA 3CCM3 3CMA3 5A0OB 3S27A 2Y74A 3V99A 3NV0A 3D3LA 2CW9A 2Z77A 3G0KA 4EV2A 1TFOA 4HM0B 3GAXA 1VQ43 3EE1A 1Y4KA 3J7Yd 1EQKA 4R9KA 5AEWB 1VQL3 4L8PA 2WOFA 3EX9A 3GZRA 1YI23 3WA2X 3PS8A 3EBYA 3CCJ3 5D82A 3LZAA 1BUQA 4FCZA 3VF1A 1YJN3 2L4VA 1N8R4 4FMBA 5DREA 1RRHA 4MMZB 1E3RA 2XRXB 1SIIA 1L5GB 4R1KA 2E2UA 4G1MB 2GBXB 2O3OA 3VSYA 2Z76A 4KZ1A 5BVBA 5CF1A 3B4OA 3SLUA 2STDA 2P09A 3SEDA 4MJDA 1CYVA 1OHPA 2JDIH 2YX9A 1KWIA 3FCSB 1OH0A 3T8NA 3CCQ3 1C7HA 3N8BA 3FG4A 3RDEA 1VQP3 2E2VA 4BTYA 1KC84 1FA3A 1UW1A 3JUNA 1V74A 1TP6A 3K63A 2CIUA 2C10A 4HM1B 4HM7B 5BXQA 1IT7A 4WHAA 3I0YA 3CC43 1MNLA 1GY7A 4ORLA 3JUQA 4O3VA 1R4CA 2OCTA 2BHMA 4XDWA 3HIGA 1W00A 3LT8A 3BNEA 3UJMA 2P05A 3V98A 4H61A 3S29A 1RKYA 1DMMA 1O7HB 2BMQB 4OUQA 2B24B 4XBTA 3T0UA 5IG5A 3DUKA 3MWZA 3GZXB 2BO9B 1ZO2A 2CWUA 1JB4A 3GWRA 1JRQA 3IPTA 5CF2A 2HMJB 1QALA 2HMNB 3FF0A 3NBBA 1OUNA 3OW22 1Q824 1S723 3EHCA 4N6NB 2XGLA 1Q42A 3X40A 1DYUA 1YJW3 3X41A 3LOYA 1Q40A 2WOHA 2XSOB 3MG3A 1AVKA 1O7PB 3OX9A 1NWWA 4JRFA 3SOAA 1J2BA 1GD4A 3F9SA 2OTJ3 1U8CB 1LOXA 3S5CA 3BNCA 3CCV3 1Q864 2IMJA 4HZ9B 2QEX3 3FGYA 3DM8A 3MYTA 1RN7A 3FG1A 3F7SA 1VQ53 5ELUA 1OGZA 3WODG 1A67A 2ML5A 2RSXA 4K61A 2WGQA 3KE7A 3S28A 3CPOA 1VQK3 1TFKA 2ML6A 1PFPA 2UX0A 4LSOA 3EBTA 4EYCA 3LTAA 2ZDJA 4N6LA 1KSIA 4HKVB 2HMLB 4N3VA 5IG4A 3WOEB 1WMNA 2W0QA 3DGMA 1OHSA 1SJWA 4HYZA 4AEQA 1GY5A 1O7MB 3KZTA 1G96A 2CG1A 5FW5A 3CXC2 3D9RA 1NU3A 1TU5A 4R80A 3VGNA 3LTCA 1N5HA 3CCU3 3CC73 2R4IA 5KP4A 2OOVA 3F8HA 4HVNA 3CCS3 3KIIA 4PEJA 2W03A 3LTBA 1K734 1Q40B 4EC6A 2C11A 2OOVC 3OXAA 4EV5A 1IVWA 1W6GA 7STDA 3G713 1JB2A 5EVHA 1FGTA 3MHEA 4XB5A 1D6ZA 2W56A 1NB5I 4WWUC 4WYKA 1T5YA 1K9M4 3OWYA 2K54A 3NXJA 3B4PA 4FCMA 4I4KA 3V92A 2HMKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGQ A;  1JN5 A;  3EF8 A;  2OWP A;  4HM6 B;  3B8L A;  3F40 A;  3RGR A;  5AIH A;  4Q53 A;  3EJV A;  3F7X A;  2GBW B;  4WP5 A;  1GY6 A;  2HMM B;  3EC9 A;  3CNX A;  3F8X A;  3FH1 A;  3JUP A;  3NM2 A;  4K1V A;  4L7K A;  3NV0 B;  4XM4 A;  1JKG A;  2YFI B;  3ROB A;  3DZL A;  2QGU A;  5KP1 A;  1E3V A;  2CKF B;  4U13 A;  1OPY A;  4WYK B;  5IG0 A;  1HKX A;  3EN8 A;  1GYB A;  3F14 A;  3OV4 A;  5AEU B;  4LGQ A;  4X2H A;  3MKI A;  3DXO A;  1WQL B;  3H3H A;  2YFJ B;  3WMD A;  3SOY A;  3STD A;  1QJG A;  2GEX A;  3FZW A;  2BMR B;  2F98 A;  4J8T A;  2INX A;  3EN1 B;  1DMN A;  1ZX2 A;  4HM2 B;  1Z1S A;  3HK4 A;  2GXF A;  4STD A;  3BLZ A;  3GZB A;  3UNL A;  5KP3 A;  3H51 A;  3G8Z A;  1OGX A;  2QIY A;  1E97 A;  6STD A;  3OWU A;  4HM4 B;  3OWS A;  4XDV A;  2A15 A;  3RGA A;  2XSH B;  3Q90 A;  1QMA A;  1OCV A;  3NUV A;  1TUH A;  4H3U A;  5STD A;  1UUV B;  3K0Z A;  5JPP A;  3E99 A;  4HM8 B;  1AR0 A;  3KSP A;  5JPU A;  3HZP A;  3MG2 A;  3NBR A;  2B1X B;  1UUW B;  5HGR A;  4HZB B;  5IF6 A;  3NHX A;  3LYG A;  1K41 A;  5CK6 A;  1ISK A;  3FSD A;  3JUM A;  1W02 A;  5IEN A;  3M8C A;  3DMC A;  1A2K A;  4XBX A;  2RCD A;  5G2G A;  2JQ5 A;  1EA2 A;  4X2O A;  3GRD A;  3FLJ A;  4HM3 B;  5D83 A;  1OHO A;  5D81 A;  5IER A;  1S5A A;  2PZV A;  1VZZ A;  2RFR A;  3GZY B;  1OF5 A;  2W2C A;  1W6Y A;  3HX8 A;  3CU3 A;  5IEO A;  3MSO A;  4K1U A;  2Z7A A;  2I9W A;  1U5O A;  5DRV A;  1O7G B;  1JN5 B;  4J9A A;  2YFL B;  1DMQ A;  4GB5 A;  2BMO B;  4HJL B;  4IIA A;  1ASK A;  4KVH A;  5IEP A;  2XR8 B;  2HMO B;  3KKG A;  2F99 A;  4XBY A;  8CHO A;  3ECF A;  5AIF A;  4CDL A;  1EG9 B;  3ER7 A;  3EQQ B;  3A76 A;  3MG1 A;  5IG3 A;  5AIG A;  5AI1 A;  1O7W B;  5CLK A;  1JKG B;  5AII A;  1STD A;  4RZM A;  1OF5 B;  1O7N B;  3JUO A;  1NDO B;  3CNM A;  4FCJ A;  1CQS A;  3BB9 A;  3B7C A;  4R9L A;  2CHC A;  2F86 B;  1W01 A;  3K7C A;  1GS3 A;  1IDP A;  1ULI B;  4HM5 B;  4LMI A;  3FF2 A;  1JB5 A;  3G16 A;  4OVM A;  2BNG A;  3FKA A;  2GEY A;  4LEH A;  1ULJ B;  5TGN A;  3T8U A;  5CXO A;  4L8O A;  3NV0 A;  2Z77 A;  3G0K A;  4HM0 B;  4R9K A;  5AEW B;  4L8P A;  3EX9 A;  3GZR A;  3EBY A;  5D82 A;  3LZA A;  1BUQ A;  5DRE A;  1E3R A;  2XRX B;  4R1K A;  2GBX B;  3VSY A;  2Z76 A;  5BVB A;  5CF1 A;  3B4O A;  2STD A;  3SED A;  4MJD A;  1OHP A;  1OH0 A;  3T8N A;  1C7H A;  3JUN A;  1TP6 A;  4HM1 B;  4HM7 B;  5BXQ A;  3I0Y A;  1GY7 A;  4ORL A;  3JUQ A;  4XDW A;  1W00 A;  3UJM A;  1DMM A;  1O7H B;  2BMQ B;  4OUQ A;  2B24 B;  4XBT A;  5IG5 A;  3DUK A;  3GZX B;  1ZO2 A;  1JB4 A;  3GWR A;  5CF2 A;  3IPT A;  2HMJ B;  2HMN B;  3FF0 A;  1OUN A;  3EHC A;  1Q42 A;  1Q40 A;  2XSO B;  3MG3 A;  1O7P B;  3OX9 A;  1NWW A;  3SOA A;  3F9S A;  3S5C A;  2IMJ A;  4HZ9 B;  3FGY A;  3DM8 A;  3MYT A;  3F7S A;  1OGZ A;  3KE7 A;  3CPO A;  2UX0 A;  3EBT A;  4HKV B;  2HML B;  4N3V A;  5IG4 A;  1OHS A;  1SJW A;  1GY5 A;  1O7M B;  3KZT A;  5FW5 A;  3D9R A;  1NU3 A;  3VGN A;  2R4I A;  5KP4 A;  3F8H A;  4HVN A;  4PEJ A;  1Q40 B;  3OXA A;  7STD A;  1JB2 A;  5EVH A;  3MHE A;  4XB5 A;  4WWU C;  4WYK A;  3OWY A;  2K54 A;  3NXJ A;  3B4P A;  4FCM A;  4I4K A;  2HMK B; 
#chains in the Genus database with same CATH topology
 1UI8 A;  2RGQ A;  1JN5 A;  5FGO A;  3EF8 A;  2XFS A;  2OWP A;  4HM6 B;  3B8L A;  1UGH I;  1BSD A;  3F40 A;  2ZL8 A;  3PCR A;  3ZG5 A;  3RGR A;  3UL6 A;  3D5I A;  2BIR A;  6GSP A;  5AIH A;  3X42 A;  3N9H A;  4Q53 A;  1BSA A;  1PYL A;  3EJV A;  3F7X A;  2CG0 A;  3DY5 A;  1Q81 4;  4QWT A;  5EEO A;  2GBW B;  1STF I;  1VQN 3;  4OK0 A;  3NX0 A;  1GY6 A;  4WP5 A;  2H0G A;  2P38 A;  2HMM B;  1MWS A;  3CNX A;  3EC9 A;  3SX1 A;  3F8X A;  3FH1 A;  1UCI A;  1IQX A;  1IYY A;  3JUP A;  3K9M C;  3NM2 A;  3NQY A;  2O9U X;  3LH4 A;  2H0H A;  2CFG A;  2XEP A;  1BSC A;  4K1V A;  1I2G A;  4HAA A;  2OTL 3;  1HU9 A;  4BL3 A;  3KN4 A;  7GSP A;  4L7K A;  2XFT A;  3JVC A;  3LXU X;  3NV0 B;  4XM4 A;  1GOU A;  2E2T A;  3Q2P A;  1JKG A;  2YFI B;  3ROB A;  1LNH A;  3NM7 A;  1X1U A;  3DZL A;  3RNT A;  2QGU A;  2KF3 A;  3X3Z A;  2LQV A;  2GU3 A;  5KP1 A;  1E3V A;  1VQ9 3;  2CKF B;  4U13 A;  1OPY A;  1YGE A;  4WYK B;  1FUW A;  1M1K 4;  5BU4 A;  3KCH A;  2K3D A;  1GOY A;  1US1 A;  3PYJ A;  4MMY B;  5IG0 A;  3CCR 3;  1HKX A;  3NBJ A;  2XGN A;  3EN8 A;  1GYB A;  3CD6 3;  2F4Y A;  3G4S 3;  3F14 A;  4EBG A;  3OV4 A;  4N6O B;  1EKM A;  5IW9 A;  1BVI A;  2UUG C;  3KFQ C;  4O02 B;  5AEU B;  4LGQ A;  4X2H A;  3MKI A;  1SQW A;  3DXO A;  1B2U A;  1D6Y A;  1WQL B;  3ZG0 A;  4CJN A;  4BTX A;  3H3H A;  2CWT A;  2YFJ B;  4HBR A;  3WMD A;  1JV2 B;  4KFF A;  5GSP A;  3SOY A;  1RGA A;  2Z6B A;  4O2H A;  5JBS A;  1X1W A;  3GSP A;  4R4K A;  1UI7 A;  1GMR A;  5AYR B;  3STD A;  1UCK A;  1QJG A;  1AV4 A;  1M90 4;  1RCL A;  1BNI A;  2GEX A;  1B27 A;  3FZW A;  2CK3 H;  1CYU A;  1RCK A;  3UB1 A;  1QAF A;  1YGW A;  2BMR B;  3DGN A;  1V57 A;  2F98 A;  3WDG B;  3WOF B;  4J8T A;  1D6U A;  2INX A;  3EN1 B;  3WA3 A;  1I2E A;  2XF3 A;  1I8V A;  1T2H A;  3O8Y A;  1GMQ A;  1DMN A;  4J5G A;  4WFO A;  1IV7 A;  2WGO A;  1RGL A;  3AMO A;  1ZX2 A;  4FMC A;  1Z1S A;  4HM2 B;  4FMA A;  1IQY A;  1WMP A;  2FNQ A;  2GXF A;  3HK4 A;  3Q3F A;  4STD A;  3BLZ A;  3GZB A;  3UNL A;  2MC8 A;  5KP3 A;  1B2X A;  3H51 A;  2P0X A;  3G8Z A;  1MWT A;  1OAC A;  5ELJ A;  1RHL A;  1I0V A;  2CFW A;  1OGX A;  2QIY A;  1UUG B;  1E97 A;  2RBI A;  3G6E 3;  2D1W A;  1QVF 2;  3PCS A;  1A2V A;  4FMD A;  4GL6 A;  1UCL A;  6STD A;  1UCJ A;  1WTH A;  2P0M A;  2CH9 A;  1IQ8 A;  1W7C A;  3OWU A;  2D42 A;  3OWS A;  1FGR A;  4HM4 B;  1BRJ A;  2ZA4 A;  1WNH A;  4XDV A;  2A15 A;  3CPW 2;  3ALA A;  1RN4 A;  3HII A;  4KT3 B;  2CC3 A;  1DVC A;  2XSH B;  3RGA A;  3SVA A;  1AVL A;  3Q90 A;  3IJE B;  1QMA A;  1OCV A;  1AY7 A;  3LT9 A;  3NUV A;  4N6U A;  1TUH A;  4H3U A;  4IPB A;  5STD A;  3BNB A;  1I3F A;  1UUV B;  1A90 A;  1WMO A;  3U97 A;  1R4Y A;  3K0Z A;  5JPP A;  2AAE A;  1TIJ A;  1TRP A;  2KRT A;  1I70 A;  3E99 A;  4HM8 B;  1IVV A;  1N9E A;  1YVB I;  2F5W A;  1AR0 A;  3DGL A;  3KSP A;  4ILF A;  2KF5 A;  4JF8 A;  4RBN A;  5JPU A;  3HZP A;  3MG2 A;  4MMX B;  4TX4 A;  3LTD A;  3AHW A;  5LC7 A;  2PNC A;  1F8N A;  1FYS A;  4RNZ A;  1Q7Y 4;  4CPK A;  3NBR A;  4N6T A;  1DVD A;  2B1X B;  1UUW B;  3IMA B;  4HZB B;  5HGR A;  5IF6 A;  3NHX A;  3LYG A;  1VQ8 3;  1K41 A;  2W6J H;  4GSP A;  2C4B A;  3AMO B;  5CK6 A;  1ISK A;  1SIH A;  3FSD A;  2XH9 A;  3JUM A;  2OQE A;  1W02 A;  1TJD A;  1KQS 2;  5IEN A;  3M8C A;  3DMC A;  1A2K A;  4XBX A;  1V58 A;  2RCD A;  1ZGX A;  1BAO A;  2OQE C;  2IYJ A;  1VQ6 3;  2J8X B;  5G2G A;  2JQ5 A;  1RGE A;  1EA2 A;  2RNT A;  3NQZ A;  1RGG A;  4X2O A;  3DGO A;  1VQ7 3;  3GRD A;  2R41 A;  1CH0 A;  2M7O A;  3FLJ A;  4HM3 B;  4ZM8 A;  5D83 A;  1OHO A;  2GU1 A;  1N5P A;  3BIR A;  3HOH A;  4DKI A;  1JJ2 2;  1IV9 A;  1PU4 A;  2FGT A;  1IVX A;  5D81 A;  5IER A;  1VQM 3;  2V1L A;  3I56 3;  1UGI A;  3I55 3;  1LXE A;  4BU4 A;  1S5A A;  1YIT 3;  2W9P A;  3X3Y A;  1K28 A;  2K0M A;  1W2Z A;  3SYU A;  3AGO A;  2PZV A;  1BNF A;  4N6M A;  1VZZ A;  5M19 A;  4GHO A;  5I97 A;  2RFR A;  1BRN L;  3GZY B;  2FXT A;  4EXR A;  1QAK A;  1OF5 A;  3BND A;  3QRD A;  2IA7 A;  2W2C A;  2W56 B;  3N54 B;  1CEW I;  1W6Y A;  3HX8 A;  1AQZ A;  5RNT A;  3CU3 A;  4AKY A;  5IEO A;  4RNY A;  1NJI 4;  1RNT A;  3MSO A;  1BGS A;  1W4N A;  2KCD A;  1BUJ A;  2F5M A;  4NRE A;  4K1U A;  5M18 A;  1BIR A;  2Z7A A;  2I9W A;  1DE3 A;  1U5O A;  5DRV A;  1O7G B;  2CX1 A;  1JN5 B;  1W2B 2;  2CFD A;  4J9A A;  1YJ9 3;  2BT3 A;  3MPH A;  3CCE 3;  1EEJ A;  1G0T A;  2YFL B;  2SAR A;  2QA4 3;  1DMQ A;  4GB5 A;  3KSE D;  3PGB A;  2BMO B;  3S67 A;  1FGM A;  2CX0 A;  4HJL B;  4IIA A;  1NNV A;  1ASK A;  1W6C A;  5EQL A;  1ZS7 A;  1QVG 2;  4KVH A;  5IEP A;  2XR8 B;  3DGY A;  2HMO B;  3Q1C A;  3WHO A;  3KKG A;  1IVU A;  5CF2 A;  2F99 A;  2CWV A;  4XBY A;  3PXM A;  8CHO A;  3ECF A;  1T3B A;  4EW5 A;  1SPU A;  2LYX A;  5AIF A;  4CDL A;  1EG9 B;  1FUS A;  3K5T A;  1LVN A;  2MF7 A;  3ER7 A;  3A76 A;  1N9J A;  3D4A A;  3EQQ B;  3MG1 A;  4LZI A;  3CCL 3;  5IG3 A;  5AIG A;  5AI1 A;  1O7W B;  2Y73 A;  2W9Q A;  3FG3 A;  1JBT A;  1RRL A;  3L0R A;  1RLS A;  3CME 3;  1KD1 4;  4KFD A;  1M1X B;  1JKG B;  5CLK A;  5AII A;  1FGO A;  4K90 B;  2WO0 A;  3DH2 A;  1STD A;  4NHF A;  1K8A 4;  1W5Z A;  1JNQ A;  1G02 A;  4RZM A;  1OF5 B;  3PZW A;  1RN1 A;  1O7N B;  3UL5 A;  1NDO B;  3CNM A;  3JUO A;  2L1S A;  1GOV A;  4FCJ A;  2IUK A;  1CQS A;  3BB9 A;  4NPB A;  3U1W A;  1IK3 A;  4O8S A;  3B7C A;  1NO3 A;  1BRH A;  1M9G A;  1FGQ A;  5LC6 A;  4R9L A;  4KFE A;  5M1A A;  1N8Q A;  2CHC A;  4N6V 0;  2F86 B;  3CC2 3;  1W01 A;  1Q9E A;  1NB3 I;  3K7C A;  1JZO A;  4MEI A;  1RJO A;  1GS3 A;  3SXX A;  1IDP A;  1GD3 A;  1ULI B;  2IUJ A;  4HM5 B;  1YHQ 3;  3ZFZ A;  1BSB A;  3QK9 A;  2H0I A;  4I5Q A;  4LMI A;  3EB8 A;  4AKZ A;  1RGC A;  1BRG A;  1ROV A;  1JB5 A;  3FF2 A;  3G16 A;  1MOL A;  2KAA A;  2CFK A;  3LML A;  4OVM A;  1FUT A;  2SBL A;  2W04 A;  4IT7 A;  2BNG A;  3FKA A;  1IU7 A;  2CFL A;  1GMP A;  1YVS A;  4FR9 A;  1B2Z A;  5AYS C;  2GEY A;  4LEH A;  3X3X A;  1ULJ B;  3HI7 A;  1IT8 A;  5TGN A;  3T8U A;  1YIJ 3;  4CCV A;  2KXG A;  5CXO A;  4BTW A;  2Q07 A;  1VQO 3;  4L8O A;  4J5K A;  1MWU A;  3TDG A;  1ROA A;  5BIR A;  3CCM 3;  3CMA 3;  5A0O B;  1BRS A;  1BRK A;  1RGK A;  2Y74 A;  3S27 A;  3NV0 A;  3D3L A;  3V99 A;  2CW9 A;  2Z77 A;  3G0K A;  4EV2 A;  1TFO A;  1B21 A;  2KF6 A;  4HM0 B;  3GAX A;  1VQ4 3;  3EE1 A;  1FW7 A;  1RMS A;  1I2F A;  1Y4K A;  3J7Y d;  1EQK A;  4R9K A;  5AEW B;  1VQL 3;  4L8P A;  2WOF A;  8RNT A;  3EX9 A;  3GZR A;  1YI2 3;  3WA2 X;  3PS8 A;  3EBY A;  3CCJ 3;  5D82 A;  3LZA A;  1BUQ A;  4FCZ A;  3VF1 A;  3D79 A;  1YJN 3;  2L4V A;  1N8R 4;  4FMB A;  5DRE A;  1RRH A;  4MMZ B;  1E3R A;  5G1K A;  2XRX B;  1SII A;  1TRQ A;  1BNE A;  1L5G B;  1UDI I;  1RSN A;  2KF4 A;  4R1K A;  2E2U A;  4G1M B;  2GBX B;  1EUI C;  2O3O A;  1SAR A;  3VSY A;  1HYF A;  2Z76 A;  4KZ1 A;  4BL2 A;  5BVB A;  3B4O A;  3SLU A;  5CF1 A;  2STD A;  1GSP A;  2P09 A;  3SED A;  4MJD A;  1CYV A;  1OHP A;  1BNS A;  2JDI H;  1KWI A;  2YX9 A;  1LOY A;  1MGW A;  1OH0 A;  2BU4 A;  3FCS B;  5G1L A;  3T8N A;  1JBS A;  3CCQ 3;  1LRA A;  1C7H A;  3N8B A;  3FG4 A;  4LYL B;  3RDE A;  1VQP 3;  1RDS A;  2E2V A;  4BTY A;  1KC8 4;  1FA3 A;  1DET A;  5HOH A;  1UW1 A;  3JUN A;  1V74 A;  1TP6 A;  3K63 A;  1BNJ A;  2CIU A;  2C10 A;  1BSE A;  4BIR A;  4HM1 B;  4HM7 B;  1BAN A;  5BXQ A;  1BRI A;  1BU4 A;  1IT7 A;  4WHA A;  3I0Y A;  3CC4 3;  1MNL A;  1GY7 A;  4ORL A;  3JUQ A;  4O3V A;  1R4C A;  2OCT A;  2BHM A;  4XDW A;  1LQM B;  1PY3 A;  2HOH A;  3HIG A;  1W00 A;  3LT8 A;  3BNE A;  3UJM A;  2P05 A;  3V98 A;  4H61 A;  3S29 A;  1RKY A;  1DMM A;  1O7H B;  2BMQ B;  4OUQ A;  2B24 B;  4XBT A;  3T0U A;  5IG5 A;  3DUK A;  3MWZ A;  3GZX B;  2BO9 B;  1ZO2 A;  2CWU A;  1JB4 A;  3BU4 A;  3GWR A;  1JRQ A;  1LOW A;  1Q7H A;  3IPT A;  2HMJ B;  1QAL A;  2HMN B;  3FF0 A;  3URP A;  3NBB A;  1OUN A;  3OW2 2;  1Q82 4;  1S72 3;  3EHC A;  3AHS A;  1X1X A;  2XGL A;  4N6N B;  1Q42 A;  3X40 A;  1DYU A;  1YJW 3;  3X41 A;  3LOY A;  1Q40 A;  2WOH A;  2XSO B;  3MG3 A;  1AVK A;  1O7P B;  3OX9 A;  1NWW A;  4JRF A;  3SOA A;  1X1Y A;  1GD4 A;  3F9S A;  1J2B A;  2OTJ 3;  1U8C B;  1JZD A;  1LOX A;  3D5G A;  2F56 A;  1BOX A;  3S5C A;  3BNC A;  1BNR A;  3CCV 3;  1Q86 4;  6RNT A;  1RGF A;  2IMJ A;  4HZ9 B;  2QEX 3;  3FGY A;  3A5E A;  1JBR A;  3DM8 A;  3MYT A;  1RN7 A;  3FG1 A;  3F7S A;  4RNT A;  1VQ5 3;  5ELU A;  1BNG A;  1OGZ A;  3WOD G;  3WR2 A;  1A67 A;  2ML5 A;  2RSX A;  4K61 A;  2WGQ A;  3KE7 A;  3S28 A;  3CPO A;  1VQK 3;  1MGR A;  1TFK A;  2GSP A;  3AGN A;  2ML6 A;  1PFP A;  2UX0 A;  4LSO A;  1B2M A;  3EBT A;  4EYC A;  3LTA A;  2ZDJ A;  4N6L A;  1KSI A;  4HKV B;  2HML B;  4N3V A;  5IG4 A;  3WOE B;  1WMN A;  2W0Q A;  3DGM A;  1OHS A;  1RTU A;  1SJW A;  4HYZ A;  1I0X A;  4AEQ A;  1GY5 A;  1O7M B;  1VQQ A;  1LNI A;  7RNT A;  1A2P A;  1I3I A;  3KZT A;  1G96 A;  2CG1 A;  5FW5 A;  3CXC 2;  2ZHX B;  3D9R A;  1NU3 A;  1TU5 A;  1B20 A;  4R80 A;  3LTC A;  3VGN A;  1N5H A;  1RGH A;  3CCU 3;  3CC7 3;  2R4I A;  5KP4 A;  2OOV A;  3F8H A;  9RNT A;  2IY2 A;  4HVN A;  3CCS 3;  1B3S A;  1C54 A;  3KII A;  4PEJ A;  2W03 A;  3LTB A;  1K73 4;  1HZ1 A;  1Q40 B;  1LOV A;  4EC6 A;  2C11 A;  2OOV C;  3OXA A;  2AAD A;  4HOH A;  4EV5 A;  1IVW A;  1W6G A;  7STD A;  3G71 3;  1JB2 A;  5EVH A;  1FGT A;  1YNV X;  1MWR A;  3MHE A;  4XB5 A;  1D6Z A;  2W56 A;  1NB5 I;  4WWU C;  1LQG C;  4WYK A;  1RNB A;  1T5Y A;  2UGI A;  1FZU A;  1K9M 4;  1B2S A;  2K54 A;  3OWY A;  1TTO A;  3NXJ A;  3B4P A;  1T2I A;  4FCM A;  4I4K A;  3V92 A;  2HMK B; 
#chains in the Genus database with same CATH homology
 1UI8 A;  2RGQ A;  1JN5 A;  5FGO A;  3EF8 A;  2XFS A;  2OWP A;  4HM6 B;  3B8L A;  3PCR A;  3F40 A;  2ZL8 A;  3RGR A;  3UL6 A;  5AIH A;  3X42 A;  3N9H A;  4Q53 A;  3EJV A;  3F7X A;  2CG0 A;  3DY5 A;  1Q81 4;  4QWT A;  5EEO A;  2GBW B;  1STF I;  1VQN 3;  4OK0 A;  3NX0 A;  1GY6 A;  4WP5 A;  2P38 A;  2HMM B;  3EC9 A;  3CNX A;  3SX1 A;  3F8X A;  3FH1 A;  1IQX A;  3JUP A;  3K9M C;  3NM2 A;  3NQY A;  2O9U X;  3LH4 A;  2CFG A;  2XEP A;  4K1V A;  2OTL 3;  1HU9 A;  3KN4 A;  4L7K A;  2XFT A;  3JVC A;  3LXU X;  3NV0 B;  4XM4 A;  3Q2P A;  2E2T A;  1JKG A;  2YFI B;  3ROB A;  1LNH A;  3NM7 A;  3DZL A;  2QGU A;  3X3Z A;  2LQV A;  2GU3 A;  5KP1 A;  1E3V A;  1VQ9 3;  2CKF B;  4U13 A;  1OPY A;  1YGE A;  4WYK B;  1FUW A;  1M1K 4;  1US1 A;  3PYJ A;  4MMY B;  5IG0 A;  3CCR 3;  1HKX A;  3NBJ A;  2XGN A;  3EN8 A;  1GYB A;  3CD6 3;  3G4S 3;  3F14 A;  4EBG A;  3OV4 A;  4N6O B;  1EKM A;  5IW9 A;  3KFQ C;  4O02 B;  5AEU B;  4LGQ A;  4X2H A;  3MKI A;  1SQW A;  3DXO A;  1D6Y A;  1WQL B;  4BTX A;  3H3H A;  2CWT A;  2YFJ B;  4HBR A;  3WMD A;  1JV2 B;  4KFF A;  3SOY A;  2Z6B A;  4O2H A;  5JBS A;  4R4K A;  1UI7 A;  5AYR B;  3STD A;  1QJG A;  1AV4 A;  1M90 4;  2GEX A;  3FZW A;  2CK3 H;  1CYU A;  3UB1 A;  1QAF A;  2BMR B;  3DGN A;  2F98 A;  3WOF B;  3WDG B;  4J8T A;  1D6U A;  2INX A;  3EN1 B;  3WA3 A;  2XF3 A;  3O8Y A;  1DMN A;  4WFO A;  1IV7 A;  2WGO A;  3AMO A;  1ZX2 A;  4FMC A;  1Z1S A;  4HM2 B;  4FMA A;  1IQY A;  1WMP A;  2FNQ A;  2GXF A;  3HK4 A;  4STD A;  3BLZ A;  3GZB A;  3UNL A;  2MC8 A;  5KP3 A;  3H51 A;  2P0X A;  3G8Z A;  1OAC A;  5ELJ A;  2CFW A;  1OGX A;  2QIY A;  1E97 A;  3G6E 3;  2D1W A;  1QVF 2;  3PCS A;  1A2V A;  4FMD A;  4GL6 A;  6STD A;  1WTH A;  2P0M A;  2CH9 A;  1IQ8 A;  1W7C A;  3OWU A;  2D42 A;  3OWS A;  1FGR A;  4HM4 B;  1WNH A;  4XDV A;  2A15 A;  3CPW 2;  3ALA A;  3HII A;  3RGA A;  3SVA A;  2CC3 A;  1DVC A;  2XSH B;  1AVL A;  3Q90 A;  3IJE B;  1QMA A;  1OCV A;  3LT9 A;  3NUV A;  4N6U A;  1TUH A;  4H3U A;  4IPB A;  5STD A;  3BNB A;  1A90 A;  1UUV B;  1WMO A;  3U97 A;  3K0Z A;  5JPP A;  1TIJ A;  2KRT A;  3E99 A;  4HM8 B;  4RNY A;  1IVV A;  1N9E A;  1YVB I;  3DGL A;  1AR0 A;  4JF8 A;  3KSP A;  4RBN A;  5JPU A;  3HZP A;  3MG2 A;  4MMX B;  4TX4 A;  3LTD A;  5LC7 A;  2PNC A;  1F8N A;  4RNZ A;  1Q7Y 4;  3NBR A;  4N6T A;  1DVD A;  2B1X B;  1UUW B;  3IMA B;  4HZB B;  5HGR A;  5IF6 A;  3NHX A;  3LYG A;  1VQ8 3;  1K41 A;  2W6J H;  3AMO B;  5CK6 A;  1ISK A;  1SIH A;  3FSD A;  2XH9 A;  3JUM A;  2OQE A;  1W02 A;  1KQS 2;  5IEN A;  3M8C A;  3DMC A;  1A2K A;  4XBX A;  2RCD A;  2OQE C;  1VQ6 3;  5G2G A;  2JQ5 A;  1EA2 A;  3NQZ A;  4X2O A;  3DGO A;  1VQ7 3;  3GRD A;  2M7O A;  3FLJ A;  4HM3 B;  4ZM8 A;  5D83 A;  1OHO A;  2GU1 A;  1N5P A;  1JJ2 2;  1IV9 A;  1PU4 A;  2FGT A;  1IVX A;  5D81 A;  5IER A;  1VQM 3;  2V1L A;  3I56 3;  3I55 3;  1LXE A;  1S5A A;  1YIT 3;  2W9P A;  3X3Y A;  1K28 A;  2K0M A;  1W2Z A;  2PZV A;  4N6M A;  1VZZ A;  5I97 A;  2RFR A;  3GZY B;  2FXT A;  4EXR A;  1QAK A;  1OF5 A;  3BND A;  3QRD A;  2IA7 A;  2W2C A;  2W56 B;  3N54 B;  1CEW I;  1W6Y A;  3HX8 A;  3CU3 A;  4AKY A;  5IEO A;  1NJI 4;  3MSO A;  2KCD A;  1W4N A;  4NRE A;  4K1U A;  2Z7A A;  2I9W A;  1U5O A;  5DRV A;  1O7G B;  1JN5 B;  1W2B 2;  2CFD A;  4J9A A;  1YJ9 3;  2BT3 A;  3MPH A;  3CCE 3;  2YFL B;  2QA4 3;  1DMQ A;  4GB5 A;  3KSE D;  3PGB A;  2BMO B;  3S67 A;  1FGM A;  4HJL B;  4IIA A;  5EQL A;  1QVG 2;  1ASK A;  1W6C A;  4KVH A;  5IEP A;  2XR8 B;  3Q1C A;  2HMO B;  3KKG A;  1IVU A;  2F99 A;  2CWV A;  4XBY A;  3PXM A;  8CHO A;  3ECF A;  1SPU A;  2LYX A;  5AIF A;  4CDL A;  1EG9 B;  3K5T A;  1LVN A;  2MF7 A;  3ER7 A;  3A76 A;  1N9J A;  3EQQ B;  3CCL 3;  3MG1 A;  4LZI A;  5IG3 A;  5AIG A;  5AI1 A;  1O7W B;  2Y73 A;  2W9Q A;  3FG3 A;  1RRL A;  3L0R A;  3CME 3;  1KD1 4;  4KFD A;  1M1X B;  1JKG B;  5CLK A;  5AII A;  1FGO A;  4K90 B;  2WO0 A;  4NHF A;  1STD A;  1K8A 4;  1W5Z A;  1JNQ A;  4RZM A;  1OF5 B;  3PZW A;  1O7N B;  3UL5 A;  1NDO B;  3CNM A;  3JUO A;  4FCJ A;  2IUK A;  1CQS A;  3BB9 A;  1IK3 A;  3U1W A;  4O8S A;  3B7C A;  1NO3 A;  1M9G A;  1FGQ A;  5LC6 A;  4R9L A;  4KFE A;  1N8Q A;  2CHC A;  4N6V 0;  2F86 B;  3CC2 3;  1W01 A;  1NB3 I;  3K7C A;  4MEI A;  1RJO A;  1GS3 A;  3SXX A;  1IDP A;  1GD3 A;  1ULI B;  2IUJ A;  4HM5 B;  1YHQ 3;  3QK9 A;  4LMI A;  3EB8 A;  4AKZ A;  1ROV A;  3FF2 A;  1JB5 A;  3LML A;  3G16 A;  1MOL A;  2CFK A;  4OVM A;  2SBL A;  2W04 A;  4IT7 A;  2BNG A;  3FKA A;  1IU7 A;  2CFL A;  4FR9 A;  5AYS C;  2GEY A;  4LEH A;  3X3X A;  1ULJ B;  3HI7 A;  1IT8 A;  5TGN A;  3T8U A;  1YIJ 3;  4CCV A;  2KXG A;  5CXO A;  4BTW A;  2Q07 A;  1VQO 3;  4L8O A;  3TDG A;  1ROA A;  3CCM 3;  3CMA 3;  5A0O B;  3S27 A;  2Y74 A;  3V99 A;  3NV0 A;  3D3L A;  2CW9 A;  2Z77 A;  3G0K A;  4EV2 A;  1TFO A;  4HM0 B;  3GAX A;  1VQ4 3;  3EE1 A;  1Y4K A;  3J7Y d;  1EQK A;  4R9K A;  5AEW B;  1VQL 3;  4L8P A;  2WOF A;  3EX9 A;  3GZR A;  1YI2 3;  3WA2 X;  3PS8 A;  3EBY A;  3CCJ 3;  5D82 A;  3LZA A;  1BUQ A;  4FCZ A;  3VF1 A;  1YJN 3;  2L4V A;  1N8R 4;  4FMB A;  5DRE A;  1RRH A;  4MMZ B;  1E3R A;  2XRX B;  1SII A;  1L5G B;  4R1K A;  2E2U A;  4G1M B;  2GBX B;  2O3O A;  3VSY A;  2Z76 A;  4KZ1 A;  5BVB A;  5CF1 A;  3B4O A;  3SLU A;  2STD A;  2P09 A;  3SED A;  4MJD A;  1CYV A;  1OHP A;  2JDI H;  2YX9 A;  1KWI A;  3FCS B;  1OH0 A;  3T8N A;  3CCQ 3;  1C7H A;  3N8B A;  3FG4 A;  3RDE A;  1VQP 3;  2E2V A;  4BTY A;  1KC8 4;  1FA3 A;  1UW1 A;  3JUN A;  1V74 A;  1TP6 A;  3K63 A;  2CIU A;  2C10 A;  4HM1 B;  4HM7 B;  5BXQ A;  1IT7 A;  4WHA A;  3I0Y A;  3CC4 3;  1MNL A;  1GY7 A;  4ORL A;  3JUQ A;  4O3V A;  1R4C A;  2OCT A;  2BHM A;  4XDW A;  3HIG A;  1W00 A;  3LT8 A;  3BNE A;  3UJM A;  2P05 A;  3V98 A;  4H61 A;  3S29 A;  1RKY A;  1DMM A;  1O7H B;  2BMQ B;  4OUQ A;  2B24 B;  4XBT A;  3T0U A;  5IG5 A;  3DUK A;  3MWZ A;  3GZX B;  2BO9 B;  1ZO2 A;  2CWU A;  1JB4 A;  3GWR A;  1JRQ A;  3IPT A;  5CF2 A;  2HMJ B;  1QAL A;  2HMN B;  3FF0 A;  3NBB A;  1OUN A;  3OW2 2;  1Q82 4;  1S72 3;  3EHC A;  4N6N B;  2XGL A;  1Q42 A;  3X40 A;  1DYU A;  1YJW 3;  3X41 A;  3LOY A;  1Q40 A;  2WOH A;  2XSO B;  3MG3 A;  1AVK A;  1O7P B;  3OX9 A;  1NWW A;  4JRF A;  3SOA A;  1J2B A;  1GD4 A;  3F9S A;  2OTJ 3;  1U8C B;  1LOX A;  3S5C A;  3BNC A;  3CCV 3;  1Q86 4;  2IMJ A;  4HZ9 B;  2QEX 3;  3FGY A;  3DM8 A;  3MYT A;  1RN7 A;  3FG1 A;  3F7S A;  1VQ5 3;  5ELU A;  1OGZ A;  3WOD G;  1A67 A;  2ML5 A;  2RSX A;  4K61 A;  2WGQ A;  3KE7 A;  3S28 A;  3CPO A;  1VQK 3;  1TFK A;  2ML6 A;  1PFP A;  2UX0 A;  4LSO A;  3EBT A;  4EYC A;  3LTA A;  2ZDJ A;  4N6L A;  1KSI A;  4HKV B;  2HML B;  4N3V A;  5IG4 A;  3WOE B;  1WMN A;  2W0Q A;  3DGM A;  1OHS A;  1SJW A;  4HYZ A;  4AEQ A;  1GY5 A;  1O7M B;  3KZT A;  1G96 A;  2CG1 A;  5FW5 A;  3CXC 2;  3D9R A;  1NU3 A;  1TU5 A;  4R80 A;  3VGN A;  3LTC A;  1N5H A;  3CCU 3;  3CC7 3;  2R4I A;  5KP4 A;  2OOV A;  3F8H A;  4HVN A;  3CCS 3;  3KII A;  4PEJ A;  2W03 A;  3LTB A;  1K73 4;  1Q40 B;  4EC6 A;  2C11 A;  2OOV C;  3OXA A;  4EV5 A;  1IVW A;  1W6G A;  7STD A;  3G71 3;  1JB2 A;  5EVH A;  1FGT A;  3MHE A;  4XB5 A;  1D6Z A;  2W56 A;  1NB5 I;  4WWU C;  4WYK A;  1T5Y A;  1K9M 4;  3OWY A;  2K54 A;  3NXJ A;  3B4P A;  4FCM A;  4I4K A;  3V92 A;  2HMK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...