3VGNA

Crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 3-fluoro-4-nitrophenol
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Quantitative dissection of hydrogen bond-mediated proton transfer in the ketosteroid isomerase active site
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3vgnA00
5G2GA 1JB5A 4HM2B 4PEJA 4HJLB 3DM8A 3NM2A 5FW5A 3DMCA 2JQ5A 1O7NB 3S5CA 4HVNA 2HMMB 5IG0A 2HMKB 3HZPA 3VGNA 4LGQA 2STDA 3F14A 3ROBA 3DUKA 3OV4A 3F40A 1JB4A 2XSOB 1GY7A 5AIGA 4KVHA 5CLKA 4HM1B 2HMOB 1GY5A 4CDLA 4HM0B 1Z1SA 3FLJA 1O7WB 3B4OA 3T8UA 4R9LA 3KKGA 3BLZA 4I4KA 3EJVA 4HKVB 3NV0B 3MKIA 2BMOB 3I0YA 4U13A 1OF5B 3EN8A 4L8PA 4R9KA 1W01A 1K41A 3BB9A 3FGYA 1E3RA 4WYKB 3UNLA 2B24B 1ISKA 5AIIA 1EG9B 1O7HB 3B8LA 3EX9A 3T8NA 2BMQB 3JUQA 3EQQB 3GZYB 4Q53A 4OUQA 1QJGA 5IERA 1TP6A 3GZXB 2RCDA 1OGXA 3KE7A 3EHCA 1UUVB 1U5OA 1ULIB 5IEPA 1OGZA 3G0KA 2GBXB 5EVHA 3K7CA 1W02A 4FCMA 2Z76A 1OHSA 5AI1A 4HM3B 2GEXA 2YFLB 3OWSA 3WMDA 1VZZA 3OWUA 4XB5A 4HM8B 3NHXA 1GYBA 1Q42A 7STDA 1UUWB 3IPTA 3MG1A 4LEHA 5KP3A 4HM6B 2CKFB 2GEYA 4IIAA 4H3UA 5DREA 1W6YA 3E99A 3F7XA 3NXJA 1OCVA 1OH0A 2HMLB 4J9AA 5IENA 3CPOA 5AIFA 1JB2A 1NWWA 3H3HA 2HMNB 3MHEA 1Q40B 1S5AA 2XSHB 3DZLA 2XR8B 1JN5B 2CHCA 2RGQA 2B1XB 4L8OA 3FF0A 4FCJA 1GS3A 5CK6A 4LMIA 3SEDA 2YFJB 4HZ9B 1C7HA 6STDA 5CF1A 3FSDA 3EBYA 2A15A 4XDVA 3DXOA 5AEUB 3RGAA 1ASKA 3VSYA 1ULJB 2Z77A 5D81A 2Z7AA 3KSPA 5TGNA 5JPUA 1BUQA 5IG3A 4HM7B 2F98A 2W2CA 3ER7A 3KZTA 1OUNA 2F86B 3MSOA 1ZO2A 1EA2A 1SJWA 4X2HA 3HX8A 3FF2A 4MJDA 3A76A 3HK4A 5IEOA 4XBXA 4WWUC 3EC9A 3LZAA 3GZRA 3G8ZA 1STDA 4XBTA 3F8HA 1DMMA 5AEWB 2INXA 5KP4A 1AR0A 4K1UA 2QIYA 4WP5A 2GBWB 1QMAA 3Q90A 1O7MB 2YFIB 3K0ZA 2BMRB 1E3VA 1NU3A 4HM4B 1JKGA 4RZMA 3GWRA 2HMJB 3JUPA 3STDA 3GZBA 5IG5A 3GRDA 3CNMA 1CQSA 3NV0A 3F7SA 4R1KA 3JUMA 2PZVA 4N3VA 5AIHA 1O7GB 1OF5A 3EF8A 2K54A 2OWPA 5CF2A 4WYKA 3NUVA 3ECFA 3MG2A 4HZBB 3EBTA 4HM5B 1GY6A 1DMQA 3EN1B 1WQLB 3JUOA 2I9WA 2BNGA 4XBYA 3CNXA 4XDWA 2R4IA 3LYGA 1IDPA 5HGRA 3RGRA 2UX0A 1JKGB 3FH1A 5JPPA 1E97A 3JUNA 1OPYA 1OHOA 3SOYA 1HKXA 3G16A 3OWYA 1W00A 3FZWA 1ZX2A 4XM4A 4J8TA 3CU3A 4STDA 3OXAA 3B7CA 4K1VA 5STDA 8CHOA 5D82A 3D9RA 4L7KA 4ORLA 1O7PB 3SOAA 1TUHA 5IG4A 5KP1A 3F8XA 3OX9A 2XRXB 5BVBA 3M8CA 4X2OA 2QGUA 5BXQA 1Q40A 3UJMA 3MG3A 3F9SA 5DRVA 2RFRA 3NBRA 4GB5A 1JN5A 1A2KA 1DMNA 3H51A 3MYTA 1NDOB 5IF6A 2IMJA 4OVMA 3FKAA 5D83A 2GXFA 3B4PA 1OHPA 5CXOA 2F99A
chains in the Genus database with same CATH superfamily
5G2GA 3SYUA 3K63A 2CC3A 2FNQA 4GSPA 1JB5A 5GSPA 4HM2B 3S29A 4PEJA 3CCQ3 1YIJ3 1RN1A 2F56A 4HJLB 3UL6A 3DM8A 1JV2B 3NM2A 5FW5A 5FGOA 3CPW2 1I8VA 1X1YA 1RLSA 3DMCA 4NREA 1YIT3 2JQ5A 5BIRA 1O7NB 3S5CA 1W7CA 4HVNA 2HMMB 4EYCA 5IG0A 1VQO3 1FGQA 2HMKB 1BNGA 3HZPA 3VGNA 1YGWA 3NQZA 4LGQA 2STDA 3F14A 3ROBA 2OTJ3 3DUKA 3OV4A 3F40A 1QVF2 4R80A 1JB4A 2XSOB 1RCKA 4EC6A 2RNTA 1GY7A 1GMRA 3ZFZA 1W4NA 5AIGA 1IU7A 4KVHA 1RRHA 3MWZA 5CLKA 3U97A 2ML6A 4HM1B 3NM7A 4ILFA 4H61A 1BNSA 4O02B 2H0HA 2HMOB 1U8CB 1QVG2 1UI7A 1GY5A 3AHWA 2D1WA 2FGTA 3V98A 2JDIH 2OCTA 3WHOA 1RGEA 3CCL3 1M9GA 1FZUA 3CXC2 1A67A 3LOYA 1YJ93 1VQ93 4MEIA 4CDLA 4HM0B 3PS8A 1EKMA 1UI8A 4CPKA 1Z1SA 3FLJA 2XEPA 1VQM3 4FMCA 1O7WB 3B4OA 3NQYA 1BRIA 3T8UA 1B2MA 1SIIA 4R9LA 2E2TA 2W03A 4N6V0 1QAFA 2OQEA 3DH2A 1UCLA 4HOHA 2CW9A 3BU4A 3KKGA 1N9EA 6RNTA 3BLZA 3AGNA 4I4KA 3RNTA 3CCJ3 3EJVA 1DVDA 4HKVB 5RNTA 3NV0B 2IA7A 1LNHA 3LT9A 3X41A 3MKIA 2Z6BA 1JBTA 1I2FA 2L1SA 1R4YA 2BU4A 1UW1A 1MNLA 2E2VA 2BMOB 1N5HA 3I0YA 1RJOA 1BNRA 4U13A 1K9M4 2KF4A 2ZL8A 4CCVA 4BTYA 2E2UA 1OF5B 2YX9A 1SIHA 2H0GA 1BSBA 3EN8A 4N6LA 1BIRA 4L8PA 1CYVA 3D3LA 4R9KA 1K734 1PU4A 1W01A 1K41A 3BB9A 3FGYA 3CC73 1EUIC 3CD63 1E3RA 2ML5A 1RTUA 4WYKB 1VQL3 3UNLA 4AKZA 4MMYB 3WOFB 2B24B 3WDGB 5AIIA 3SVAA 1ISKA 1W5ZA 3V99A 1HYFA 1EG9B 1WTHA 1O7HB 3PZWA 1KC84 1BGSA 5AYSC 3OW22 5BU4A 2P38A 3MPHA 3B8LA 1JNQA 3LXUX 3S27A 3I553 2C11A 3EX9A 3T8NA 3SXXA 2BMQB 1V74A 3AMOA 5G1KA 3WODG 1IVVA 3JUQA 1A2PA 1WNHA 3EQQB 3X42A 1RN4A 2CFDA 3GZYB 4Q53A 1BSEA 3X3XA 4OUQA 2CK3H 3CCV3 1QJGA 5IERA 1RCLA 1TP6A 2Y74A 3GZXB 2RCDA 4LZIA 4O2HA 2WOFA 1OGXA 3KE7A 3U1WA 5AYRB 3EHCA 1UUVB 1IVUA 1T2HA 4HAAA 2W56A 1I0VA 3CME3 4IPBA 1U5OA 3LH4A 1ULIB 5IEPA 2KCDA 2KXGA 1OGZA 3KN4A 3QRDA 3RDEA 3G0KA 1BNEA 5ELJA 3WA2X 2ZDJA 1MWTA 2GBXB 3V92A 4G1MB 2CX1A 3K7CA 5EVHA 1VQ73 2QEX3 3BNBA 1W02A 2M7OA 1FUSA 2Z76A 1OHSA 4FCMA 5AI1A 4HM3B 2O9UX 2GEXA 1CH0A 1RGLA 1I0XA 2YFLB 3OWSA 2CIUA 3KCHA 3WMDA 3HIGA 1RGGA 3G713 2F4YA 1VZZA 3OWUA 1VQ53 1BANA 1LOYA 4XB5A 4HM8B 3D4AA 3NHXA 4LSOA 5A0OB 1D6UA 2XFSA 1IYYA 1GYBA 1Q42A 1KSIA 1N5PA 1FYSA 3IJEB 2F5MA 4K61A 1VQP3 4EW5A 1BSCA 1TRPA 3Q1CA 1FGMA 7STDA 1UUWB 2KF3A 3IPTA 3K9MC 3MG1A 4KT3B 4LEHA 3KFQC 4IT7A 4RNYA 5KP3A 1BNIA 3UB1A 3KIIA 2XF3A 7GSPA 4HM6B 2CKFB 1RNBA 1LOVA 2GEYA 4IIAA 3CMA3 2Q07A 3EB8A 2XGLA 4H3UA 5DREA 1FGTA 1W6YA 1UDII 1BRJA 3E99A 3FCSB 3F7XA 1SARA 3DGNA 3SLUA 1LNIA 2BHMA 4CJNA 3HOHA 3NXJA 1OCVA 2IUJA 3CC23 4R4KA 1I3FA 1OH0A 2GU3A 2HMLB 2SARA 2Y73A 3HI7A 4J9AA 5IENA 3CPOA 2CX0A 5ELUA 2H0IA 5AIFA 2GSPA 1JB2A 1GSPA 1HZ1A 1NWWA 3BNDA 3VF1A 2CFKA 2CFLA 1Q7HA 3H3HA 4I5QA 2HMNB 1BRKA 3MHEA 1YVBI 3Q3FA 4EXRA 3G4S3 1Q40B 1S5AA 4DKIA 1LQGC 1TFOA 2XSHB 1UCKA 1GOYA 2W56B 3DZLA 4FMDA 1GMQA 1X1XA 3KSED 1RNTA 2XR8B 3D5IA 2KF6A 3UL5A 3X40A 1BRNL 1JN5B 2CHCA 2RGQA 4HBRA 2B1XB 3LMLA 1EQKA 4L8OA 1RGFA 3FF0A 4FCJA 1HU9A 1GS3A 5CK6A 2BO9B 2KAAA 4LMIA 3SEDA 1FGRA 2KF5A 1Y4KA 2YFJB 1BUJA 1UUGB 4HZ9B 1C7HA 1W2ZA 6STDA 5CF1A 4JF8A 4BL2A 5LC7A 3FSDA 1B2ZA 3EBYA 2A15A 2P0XA 4XDVA 3DXOA 5AEUB 3ZG0A 1B2XA 2LYXA 1G02A 2UUGC 4N6UA 3RGAA 1ASKA 3VSYA 1ULJB 2Z77A 3DGYA 5D81A 1IK3A 1Q824 2OQEC 1TJDA 2Z7AA 3KSPA 5TGNA 2W04A 5JPUA 1B20A 1BUQA 2W0QA 1RSNA 1PFPA 1V58A 2WGOA 4WHAA 5IG3A 1ZS7A 1TU5A 2ZA4A 1B21A 2W6JH 4HM7B 1LQMB 3CCR3 2BT3A 2F98A 1IQXA 1V57A 4N6NB 2CG0A 5M19A 1Q7Y4 3N9HA 2W2CA 3ER7A 3KZTA 1DVCA 4NHFA 1LVNA 1OUNA 1SQWA 3BNEA 2F86B 1I70A 3MSOA 1T5YA 3S28A 1PYLA 3S67A 3X3YA 1NB3I 1UGHI 3X3ZA 2XH9A 1ZO2A 1X1UA 1RMSA 2W9QA 4BTWA 1EA2A 1GD3A 1BSAA 2IY2A 1SJWA 1N9JA 4X2HA 1FA3A 2C10A 2R41A 3FG1A 3HX8A 2UGIA 3FF2A 3PYJA 5JBSA 1BU4A 4MJDA 3A76A 4N6MA 3BNCA 2XFTA 4GL6A 3HK4A 4FCZA 1BNFA 5IEOA 4XBXA 4WWUC 2P09A 3EC9A 1M904 1FW7A 1FUWA 1FGOA 2K0MA 1JZOA 1BOXA 3LZAA 2FXTA 3NBBA 2MC8A 1YI23 1M1XB 4KZ1A 2MF7A 1VQ83 3FG4A 1J2BA 1JRQA 1JBRA 1DETA 1BNJA 3GZRA 3LTCA 3G8ZA 1PY3A 4RBNA 1CEWI 1JZDA 1STDA 1GOUA 2CH9A 3F8HA 1LRAA 3HIIA 1UGIA 4XBTA 4AEQA 6GSPA 1DMMA 5AEWB 1EEJA 2INXA 1YVSA 4KFFA 5KP4A 3DGLA 2OOVA 1AR0A 1RHLA 4WFOA 4K1UA 2QIYA 4WP5A 2GBWB 1ROAA 1QMAA 3Q90A 1WMOA 1O7MB 1BRGA 1UCIA 1TIJA 2YFIB 3AHSA 3IMAB 1LOWA 3K0ZA 1WMPA 3LT8A 4RNZA 5HOHA 2XGNA 2BMRB 2P05A 3G6E3 1E3VA 1NU3A 4O8SA 1QAKA 4HM4B 2GU1A 3EE1A 1KQS2 1VQK3 1JKGA 1JJ22 4RZMA 1Q814 3GWRA 1RGKA 2HMJB 1IQYA 3JUPA 1K28A 4NPBA 3STDA 3GZBA 3SX1A 5IG5A 3GRDA 1ROVA 3CNMA 9RNTA 1CQSA 1I2EA 1MOLA 1B27A 2HOHA 3F7SA 3NV0A 4K90B 4O3VA 1A90A 4KFDA 1GOVA 4HYZA 5G1LA 4AKYA 4R1KA 3JUMA 1MGWA 1RRLA 1A2VA 2PZVA 4N3VA 4QWTA 5AIHA 2L4VA 5I97A 1O7GB 1OF5A 4FR9A 1ZGXA 3D79A 3CCE3 1W2B2 4BTXA 4EV2A 2CWUA 1IV7A 3EF8A 3TDGA 1BVIA 1D6YA 2K54A 2OWPA 3K5TA 3ALAA 5CF2A 5M18A 4OK0A 1X1WA 4WYKA 3AMOB 3NUVA 1L5GB 1NO3A 4N6OB 1N8R4 3CC43 1AV4A 1TRQA 3ECFA 4N6TA 1IVWA 3GAXA 3FG3A 1R4CA 2K3DA 2LQVA 3MG2A 4BIRA 1S723 3PCSA 1FUTA 1AVKA 4GHOA 1RGHA 1VQQA 1MWUA 1B2SA 3LTDA 4BU4A 4HZBB 2CFWA 2RSXA 3EBTA 2BIRA 1BSDA 1KD14 1C54A 4HM5B 1GY6A 1DMQA 3NX0A 1BRHA 8RNTA 1IT8A 3NBJA 3BIRA 2IYJA 1KWIA 3LTAA 3I563 1NB5I 3EN1B 1WQLB 3JUOA 1Q9EA 2V1LA 2I9WA 1VQ43 2BNGA 2RBIA 4XBYA 1GMPA 4MMXB 3J7Yd 1BAOA 1DYUA 3CNXA 1AY7A 4ZM8A 4XDWA 2R4IA 3CCU3 4JRFA 3LYGA 2AAEA 1IDPA 2IUKA 3JVCA 5HGRA 4FMAA 2CG1A 3RGRA 2F5WA 1IV9A 1YNVX 2UX0A 1JKGB 1MGRA 1TTOA 2J8XB 1WMNA 2WGQA 3FH1A 1B2UA 3LTBA 1NNVA 5JPPA 1TFKA 1SPUA 1E97A 2ZHXB 1RKYA 3JUNA 4KFEA 1OPYA 3WOEB 1MWSA 1OHOA 2O3OA 1YJW3 1F8NA 1YGEA 3SOYA 1HKXA 2P0MA 4TX4A 3G16A 3OWYA 1W00A 3L0RA 3PGBA 1W6GA 3FZWA 1ZX2A 4XM4A 1CYUA 2WOHA 4J8TA 1IVXA 3ZG5A 3DGMA 5EEOA 1B3SA 1RGCA 3CU3A 4STDA 1GD4A 1K8A4 3OXAA 1G0TA 3CCS3 2C4BA 3B7CA 1RN7A 1W6CA 4K1VA 5STDA 3GSPA 2W9PA 8CHOA 2OTL3 2CFGA 2WO0A 5D82A 1AVLA 5LC6A 1I3IA 3D9RA 4BL3A 4L7KA 2KRTA 4MMZB 4ORLA 3WA3A 2QA43 1G96A 1M1K4 1VQN3 1O7PB 5IW9A 1T2IA 1IT7A 2D42A 3SOAA 1TUHA 3AGOA 5IG4A 5KP1A 2CWTA 2SBLA 1D6ZA 5EQLA 7RNTA 1NJI4 4EV5A 3DGOA 1STFI 3F8XA 4RNTA 3OX9A 4LYLB 1YHQ3 1OACA 1RDSA 3PCRA 1IQ8A 2XRXB 2CWVA 5BVBA 1JBSA 3M8CA 2AADA 4X2OA 1LOXA 1MWRA 1QALA 3O8YA 3D5GA 2QGUA 5BXQA 1Q40A 1UCJA 3QK9A 3UJMA 5M1AA 3MG3A 3F9SA 5DRVA 2RFRA 3NBRA 4EBGA 4GB5A 1JN5A 3A5EA 1T3BA 1A2KA 1DMNA 3PXMA 4FMBA 3URPA 3H51A 2OOVC 3MYTA 4J5GA 1LXEA 1AQZA 1NDOB 5IF6A 2IMJA 4OVMA 1US1A 3FKAA 5D83A 2GXFA 1Q864 1BRSA 1DE3A 4J5KA 1YJN3 1RGAA 3B4PA 3WR2A 1OHPA 1N8QA 3DY5A 3CCM3 3N54B 3N8BA 5CXOA 3Q2PA 2PNCA 1VQ63 2F99A 3T0UA 1I2GA
chains in the Genus database with same CATH topology
5G2GA 3K63A 2CC3A 2FNQA 1JB5A 4HM2B 3S29A 4PEJA 3CCQ3 1YIJ3 4HJLB 3UL6A 3DM8A 1JV2B 3NM2A 5FW5A 5FGOA 3CPW2 3DMCA 4NREA 1YIT3 2JQ5A 1O7NB 3S5CA 1W7CA 4HVNA 2HMMB 4EYCA 5IG0A 1VQO3 1FGQA 2HMKB 3HZPA 3VGNA 3NQZA 4LGQA 2STDA 3F14A 3ROBA 3DUKA 3OV4A 3F40A 1QVF2 4R80A 1JB4A 2XSOB 4EC6A 1GY7A 1W4NA 5AIGA 1IU7A 4KVHA 1RRHA 3MWZA 5CLKA 3U97A 2ML6A 4HM1B 3NM7A 4O02B 4H61A 2HMOB 1U8CB 1QVG2 1UI7A 1GY5A 2D1WA 2FGTA 3V98A 2JDIH 2OCTA 3CCL3 1M9GA 3CXC2 1A67A 3LOYA 1YJ93 1VQ93 4MEIA 4CDLA 4HM0B 3PS8A 1EKMA 1UI8A 1Z1SA 3FLJA 2XEPA 1VQM3 4FMCA 1O7WB 3B4OA 3NQYA 3T8UA 1SIIA 4R9LA 2E2TA 2W03A 4N6V0 1QAFA 2OQEA 2OTJ3 2CW9A 3KKGA 3CCJ3 1N9EA 3BLZA 4I4KA 3EJVA 1DVDA 4HKVB 3NV0B 2IA7A 1LNHA 3LT9A 3X41A 3MKIA 2Z6BA 1UW1A 1MNLA 2E2VA 2BMOB 1N5HA 3I0YA 1RJOA 4U13A 1K9M4 2ZL8A 4CCVA 4BTYA 2E2UA 1OF5B 2YX9A 1SIHA 4N6LA 3EN8A 4L8PA 1CYVA 3D3LA 4R9KA 1K734 1PU4A 1W01A 1K41A 3BB9A 3FGYA 3CC73 3CD63 1E3RA 2ML5A 4WYKB 1VQL3 3UNLA 4AKZA 4MMYB 3WOFB 2B24B 3WDGB 5AIIA 3SVAA 1ISKA 1W5ZA 3V99A 1EG9B 1WTHA 1O7HB 3PZWA 1KC84 5AYSC 3OW22 2P38A 3MPHA 3B8LA 1JNQA 3LXUX 3S27A 3I553 2C11A 3EX9A 3T8NA 3SXXA 2BMQB 1V74A 3AMOA 3WODG 1IVVA 3JUQA 1WNHA 3EQQB 3X42A 2CFDA 3GZYB 3X3XA 4Q53A 4OUQA 2CK3H 3CCV3 1QJGA 5IERA 1TP6A 2Y74A 3GZXB 2RCDA 4LZIA 4O2HA 2WOFA 1OGXA 3KE7A 3U1WA 5AYRB 3EHCA 1UUVB 1IVUA 2W56A 3CME3 4IPBA 1U5OA 3LH4A 1ULIB 5IEPA 2KCDA 2KXGA 1OGZA 3KN4A 3QRDA 3RDEA 3G0KA 5ELJA 3WA2X 2ZDJA 2GBXB 3V92A 4G1MB 5EVHA 3K7CA 1VQ73 2QEX3 3BNBA 1W02A 2M7OA 2Z76A 4FCMA 1OHSA 5AI1A 4HM3B 2O9UX 2GEXA 2YFLB 3OWSA 2CIUA 3WMDA 3HIGA 3G713 1VZZA 3OWUA 1VQ53 4XB5A 4HM8B 3NHXA 4LSOA 5A0OB 1D6UA 2XFSA 1GYBA 1Q42A 1KSIA 1N5PA 3IJEB 4K61A 1VQP3 3Q1CA 1FGMA 7STDA 1UUWB 3IPTA 3K9MC 3MG1A 4LEHA 4RNYA 3KFQC 4IT7A 5KP3A 3UB1A 3KIIA 2XF3A 4HM6B 2CKFB 2GEYA 4IIAA 3CMA3 2Q07A 3EB8A 2XGLA 4H3UA 5DREA 1FGTA 1W6YA 3E99A 3FCSB 3F7XA 3DGNA 3SLUA 2BHMA 3NXJA 1OCVA 2IUJA 3CC23 4R4KA 1OH0A 2GU3A 2HMLB 2Y73A 4J9AA 3HI7A 5IENA 3CPOA 5ELUA 5AIFA 3VF1A 1JB2A 1NWWA 3BNDA 2CFKA 2CFLA 3H3HA 2HMNB 3MHEA 1YVBI 4EXRA 3G4S3 1Q40B 1S5AA 4FMDA 1TFOA 2XSHB 1N8R4 2W56B 3DZLA 3KSED 2XR8B 3UL5A 3X40A 1JN5B 2CHCA 2RGQA 4HBRA 2B1XB 3LMLA 1EQKA 4L8OA 3FF0A 4FCJA 1HU9A 1GS3A 5CK6A 2BO9B 4LMIA 3SEDA 1FGRA 1Y4KA 2YFJB 4HZ9B 1C7HA 1W2ZA 6STDA 5CF1A 4JF8A 5LC7A 3FSDA 3EBYA 2A15A 2P0XA 4XDVA 3DXOA 5AEUB 2LYXA 4N6UA 3RGAA 1ASKA 3VSYA 1ULJB 2Z77A 5D81A 1IK3A 1Q824 2OQEC 2Z7AA 3KSPA 5TGNA 2W04A 5JPUA 1BUQA 2W0QA 1PFPA 2WGOA 4WHAA 5IG3A 1TU5A 2W6JH 4HM7B 3CCR3 2BT3A 2F98A 1IQXA 4N6NB 1Q7Y4 2CG0A 3N9HA 2W2CA 3ER7A 3KZTA 1DVCA 4NHFA 1LVNA 1OUNA 1SQWA 3BNEA 2F86B 3MSOA 1T5YA 3S28A 3S67A 3X3YA 1NB3I 3X3ZA 2XH9A 1ZO2A 2W9QA 4BTWA 1EA2A 1GD3A 1SJWA 1N9JA 4X2HA 1FA3A 2C10A 3FG1A 3HX8A 3FF2A 3PYJA 5JBSA 4MJDA 3A76A 4N6MA 3BNCA 2XFTA 4GL6A 3HK4A 4FCZA 5IEOA 4XBXA 4WWUC 2P09A 3EC9A 1M904 1FUWA 1FGOA 2K0MA 3LZAA 2FXTA 3NBBA 2MC8A 1YI23 1M1XB 4KZ1A 2MF7A 1VQ83 3FG4A 1J2BA 1JRQA 3GZRA 3LTCA 3G8ZA 4RBNA 1CEWI 2CH9A 1STDA 3HIIA 3F8HA 4XBTA 4AEQA 1DMMA 5AEWB 2INXA 4KFFA 5KP4A 3DGLA 2OOVA 1AR0A 4WFOA 4K1UA 2QIYA 4WP5A 2GBWB 1ROAA 1QMAA 3Q90A 1WMOA 1O7MB 2YFIB 1TIJA 3IMAB 3K0ZA 3LT8A 4RNZA 1WMPA 2XGNA 2BMRB 2P05A 3G6E3 1E3VA 1NU3A 4O8SA 1QAKA 4HM4B 2GU1A 3EE1A 1KQS2 1VQK3 1JKGA 1JJ22 4RZMA 1Q814 3GWRA 2HMJB 1IQYA 3JUPA 1K28A 3STDA 3SX1A 3GZBA 5IG5A 3GRDA 1ROVA 3CNMA 1CQSA 1MOLA 3NV0A 4K90B 3F7SA 4O3VA 1A90A 4KFDA 4HYZA 4AKYA 4R1KA 3JUMA 1RRLA 4QWTA 1A2VA 2PZVA 4N3VA 5AIHA 5I97A 2L4VA 1O7GB 1OF5A 4FR9A 3CCE3 1W2B2 4BTXA 4EV2A 2CWUA 1IV7A 3EF8A 3TDGA 1D6YA 2K54A 2OWPA 3K5TA 3ALAA 5CF2A 4OK0A 4WYKA 3AMOB 3NUVA 1L5GB 1NO3A 4N6OB 3CC43 1AV4A 3ECFA 4N6TA 1IVWA 3GAXA 3FG3A 1R4CA 2LQVA 3MG2A 1S723 3PCSA 1AVKA 3LTDA 4HZBB 2CFWA 2RSXA 3EBTA 1KD14 4HM5B 1GY6A 1DMQA 3NX0A 1IT8A 3NBJA 3LTAA 1KWIA 3I563 1NB5I 3EN1B 1WQLB 3JUOA 2V1LA 2I9WA 1VQ43 2BNGA 4XBYA 4MMXB 3J7Yd 1DYUA 3CNXA 4ZM8A 4XDWA 2R4IA 3CCU3 4JRFA 3LYGA 1IDPA 2IUKA 3JVCA 5HGRA 4FMAA 2CG1A 3RGRA 1IV9A 2UX0A 1JKGB 1WMNA 2WGQA 3FH1A 3LTBA 5JPPA 1TFKA 1SPUA 1E97A 1RKYA 3JUNA 4KFEA 1OPYA 3WOEB 1OHOA 2O3OA 1YJW3 1F8NA 1YGEA 3SOYA 1HKXA 2P0MA 4TX4A 3G16A 3OWYA 1W00A 3L0RA 3PGBA 1W6GA 3FZWA 1ZX2A 4XM4A 1CYUA 2WOHA 4J8TA 1IVXA 3DGMA 5EEOA 3CU3A 4STDA 1K8A4 1GD4A 3OXAA 3CCS3 3B7CA 1RN7A 1W6CA 4K1VA 5STDA 2W9PA 8CHOA 2OTL3 2CFGA 2WO0A 5D82A 1AVLA 5LC6A 3D9RA 4L7KA 2KRTA 4MMZB 4ORLA 3WA3A 2QA43 1G96A 1M1K4 1VQN3 1O7PB 5IW9A 1IT7A 2D42A 3SOAA 1TUHA 5IG4A 5KP1A 1NJI4 2CWTA 2SBLA 1D6ZA 5EQLA 4EV5A 3DGOA 1STFI 3F8XA 3OX9A 1YHQ3 1OACA 3PCRA 1IQ8A 2XRXB 2CWVA 5BVBA 3M8CA 4X2OA 1LOXA 1QALA 3O8YA 2QGUA 5BXQA 1Q40A 3QK9A 3UJMA 3MG3A 3F9SA 5DRVA 2RFRA 3NBRA 4EBGA 4GB5A 1JN5A 1A2KA 1DMNA 3PXMA 4FMBA 3H51A 2OOVC 3MYTA 1LXEA 1NDOB 5IF6A 2IMJA 4OVMA 1US1A 3FKAA 5D83A 2GXFA 1Q864 1YJN3 3B4PA 1OHPA 1N8QA 3DY5A 3CCM3 3N54B 3N8BA 5CXOA 3Q2PA 2PNCA 1VQ63 2F99A 3T0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2G A;  1JB5 A;  4HM2 B;  4PEJ A;  4HJL B;  3DM8 A;  3NM2 A;  5FW5 A;  3DMC A;  2JQ5 A;  1O7N B;  3S5C A;  4HVN A;  2HMM B;  5IG0 A;  2HMK B;  3HZP A;  3VGN A;  4LGQ A;  2STD A;  3F14 A;  3ROB A;  3DUK A;  3OV4 A;  3F40 A;  1JB4 A;  2XSO B;  1GY7 A;  5AIG A;  4KVH A;  5CLK A;  4HM1 B;  2HMO B;  1GY5 A;  4CDL A;  4HM0 B;  1Z1S A;  3FLJ A;  1O7W B;  3B4O A;  3T8U A;  4R9L A;  3KKG A;  3BLZ A;  4I4K A;  3EJV A;  4HKV B;  3NV0 B;  3MKI A;  2BMO B;  3I0Y A;  4U13 A;  1OF5 B;  3EN8 A;  4L8P A;  4R9K A;  1W01 A;  1K41 A;  3BB9 A;  3FGY A;  1E3R A;  4WYK B;  3UNL A;  2B24 B;  1ISK A;  5AII A;  1EG9 B;  1O7H B;  3B8L A;  3EX9 A;  3T8N A;  2BMQ B;  3JUQ A;  3EQQ B;  3GZY B;  4Q53 A;  4OUQ A;  1QJG A;  5IER A;  1TP6 A;  3GZX B;  2RCD A;  1OGX A;  3KE7 A;  3EHC A;  1UUV B;  1U5O A;  1ULI B;  5IEP A;  1OGZ A;  3G0K A;  2GBX B;  5EVH A;  3K7C A;  1W02 A;  4FCM A;  2Z76 A;  1OHS A;  5AI1 A;  4HM3 B;  2GEX A;  2YFL B;  3OWS A;  3WMD A;  1VZZ A;  3OWU A;  4XB5 A;  4HM8 B;  3NHX A;  1GYB A;  1Q42 A;  7STD A;  1UUW B;  3IPT A;  3MG1 A;  4LEH A;  5KP3 A;  4HM6 B;  2CKF B;  2GEY A;  4IIA A;  4H3U A;  5DRE A;  1W6Y A;  3E99 A;  3F7X A;  3NXJ A;  1OCV A;  1OH0 A;  2HML B;  4J9A A;  5IEN A;  3CPO A;  5AIF A;  1JB2 A;  1NWW A;  3H3H A;  2HMN B;  3MHE A;  1Q40 B;  1S5A A;  2XSH B;  3DZL A;  2XR8 B;  1JN5 B;  2CHC A;  2RGQ A;  2B1X B;  4L8O A;  3FF0 A;  4FCJ A;  1GS3 A;  5CK6 A;  4LMI A;  3SED A;  2YFJ B;  4HZ9 B;  1C7H A;  6STD A;  5CF1 A;  3FSD A;  3EBY A;  2A15 A;  4XDV A;  3DXO A;  5AEU B;  3RGA A;  1ASK A;  3VSY A;  1ULJ B;  2Z77 A;  5D81 A;  2Z7A A;  3KSP A;  5TGN A;  5JPU A;  1BUQ A;  5IG3 A;  4HM7 B;  2F98 A;  2W2C A;  3ER7 A;  3KZT A;  1OUN A;  2F86 B;  3MSO A;  1ZO2 A;  1EA2 A;  1SJW A;  4X2H A;  3HX8 A;  3FF2 A;  4MJD A;  3A76 A;  3HK4 A;  5IEO A;  4XBX A;  4WWU C;  3EC9 A;  3LZA A;  3GZR A;  3G8Z A;  1STD A;  4XBT A;  3F8H A;  1DMM A;  5AEW B;  2INX A;  5KP4 A;  1AR0 A;  4K1U A;  2QIY A;  4WP5 A;  2GBW B;  1QMA A;  3Q90 A;  1O7M B;  2YFI B;  3K0Z A;  2BMR B;  1E3V A;  1NU3 A;  4HM4 B;  1JKG A;  4RZM A;  3GWR A;  2HMJ B;  3JUP A;  3STD A;  3GZB A;  5IG5 A;  3GRD A;  3CNM A;  1CQS A;  3NV0 A;  3F7S A;  4R1K A;  3JUM A;  2PZV A;  4N3V A;  5AIH A;  1O7G B;  1OF5 A;  3EF8 A;  2K54 A;  2OWP A;  5CF2 A;  4WYK A;  3NUV A;  3ECF A;  3MG2 A;  4HZB B;  3EBT A;  4HM5 B;  1GY6 A;  1DMQ A;  3EN1 B;  1WQL B;  3JUO A;  2I9W A;  2BNG A;  4XBY A;  3CNX A;  4XDW A;  2R4I A;  3LYG A;  1IDP A;  5HGR A;  3RGR A;  2UX0 A;  1JKG B;  3FH1 A;  5JPP A;  1E97 A;  3JUN A;  1OPY A;  1OHO A;  3SOY A;  1HKX A;  3G16 A;  3OWY A;  1W00 A;  3FZW A;  1ZX2 A;  4XM4 A;  4J8T A;  3CU3 A;  4STD A;  3OXA A;  3B7C A;  4K1V A;  5STD A;  8CHO A;  5D82 A;  3D9R A;  4L7K A;  4ORL A;  1O7P B;  3SOA A;  1TUH A;  5IG4 A;  5KP1 A;  3F8X A;  3OX9 A;  2XRX B;  5BVB A;  3M8C A;  4X2O A;  2QGU A;  5BXQ A;  1Q40 A;  3UJM A;  3MG3 A;  3F9S A;  5DRV A;  2RFR A;  3NBR A;  4GB5 A;  1JN5 A;  1A2K A;  1DMN A;  3H51 A;  3MYT A;  1NDO B;  5IF6 A;  2IMJ A;  4OVM A;  3FKA A;  5D83 A;  2GXF A;  3B4P A;  1OHP A;  5CXO A;  2F99 A; 
#chains in the Genus database with same CATH topology
 5G2G A;  3SYU A;  3K63 A;  2CC3 A;  2FNQ A;  4GSP A;  1JB5 A;  5GSP A;  4HM2 B;  3S29 A;  4PEJ A;  3CCQ 3;  1YIJ 3;  1RN1 A;  2F56 A;  4HJL B;  3UL6 A;  3DM8 A;  1JV2 B;  3NM2 A;  5FW5 A;  5FGO A;  3CPW 2;  1I8V A;  1X1Y A;  1RLS A;  3DMC A;  4NRE A;  1YIT 3;  2JQ5 A;  5BIR A;  1O7N B;  3S5C A;  1W7C A;  4HVN A;  2HMM B;  4EYC A;  5IG0 A;  1VQO 3;  1FGQ A;  2HMK B;  1BNG A;  3HZP A;  3VGN A;  1YGW A;  3NQZ A;  4LGQ A;  2STD A;  3F14 A;  3ROB A;  2OTJ 3;  3DUK A;  3OV4 A;  3F40 A;  1QVF 2;  4R80 A;  1JB4 A;  2XSO B;  1RCK A;  4EC6 A;  2RNT A;  1GY7 A;  1GMR A;  3ZFZ A;  1W4N A;  5AIG A;  1IU7 A;  4KVH A;  1RRH A;  3MWZ A;  5CLK A;  3U97 A;  2ML6 A;  4HM1 B;  3NM7 A;  4ILF A;  4H61 A;  1BNS A;  4O02 B;  2H0H A;  2HMO B;  1U8C B;  1QVG 2;  1UI7 A;  1GY5 A;  3AHW A;  2D1W A;  2FGT A;  3V98 A;  2JDI H;  2OCT A;  3WHO A;  1RGE A;  3CCL 3;  1M9G A;  1FZU A;  3CXC 2;  1A67 A;  3LOY A;  1YJ9 3;  1VQ9 3;  4MEI A;  4CDL A;  4HM0 B;  3PS8 A;  1EKM A;  1UI8 A;  4CPK A;  1Z1S A;  3FLJ A;  2XEP A;  1VQM 3;  4FMC A;  1O7W B;  3B4O A;  3NQY A;  1BRI A;  3T8U A;  1B2M A;  1SII A;  4R9L A;  2E2T A;  2W03 A;  4N6V 0;  1QAF A;  2OQE A;  3DH2 A;  1UCL A;  4HOH A;  2CW9 A;  3BU4 A;  3KKG A;  1N9E A;  6RNT A;  3BLZ A;  3AGN A;  4I4K A;  3RNT A;  3CCJ 3;  3EJV A;  1DVD A;  4HKV B;  5RNT A;  3NV0 B;  2IA7 A;  1LNH A;  3LT9 A;  3X41 A;  3MKI A;  2Z6B A;  1JBT A;  1I2F A;  2L1S A;  1R4Y A;  2BU4 A;  1UW1 A;  1MNL A;  2E2V A;  2BMO B;  1N5H A;  3I0Y A;  1RJO A;  1BNR A;  4U13 A;  1K9M 4;  2KF4 A;  2ZL8 A;  4CCV A;  4BTY A;  2E2U A;  1OF5 B;  2YX9 A;  1SIH A;  2H0G A;  1BSB A;  3EN8 A;  4N6L A;  1BIR A;  4L8P A;  1CYV A;  3D3L A;  4R9K A;  1K73 4;  1PU4 A;  1W01 A;  1K41 A;  3BB9 A;  3FGY A;  3CC7 3;  1EUI C;  3CD6 3;  1E3R A;  2ML5 A;  1RTU A;  4WYK B;  1VQL 3;  3UNL A;  4AKZ A;  4MMY B;  3WOF B;  2B24 B;  3WDG B;  5AII A;  3SVA A;  1ISK A;  1W5Z A;  3V99 A;  1HYF A;  1EG9 B;  1WTH A;  1O7H B;  3PZW A;  1KC8 4;  1BGS A;  5AYS C;  3OW2 2;  5BU4 A;  2P38 A;  3MPH A;  3B8L A;  1JNQ A;  3LXU X;  3S27 A;  3I55 3;  2C11 A;  3EX9 A;  3T8N A;  3SXX A;  2BMQ B;  1V74 A;  3AMO A;  5G1K A;  3WOD G;  1IVV A;  3JUQ A;  1A2P A;  1WNH A;  3EQQ B;  3X42 A;  1RN4 A;  2CFD A;  3GZY B;  4Q53 A;  1BSE A;  3X3X A;  4OUQ A;  2CK3 H;  3CCV 3;  1QJG A;  5IER A;  1RCL A;  1TP6 A;  2Y74 A;  3GZX B;  2RCD A;  4LZI A;  4O2H A;  2WOF A;  1OGX A;  3KE7 A;  3U1W A;  5AYR B;  3EHC A;  1UUV B;  1IVU A;  1T2H A;  4HAA A;  2W56 A;  1I0V A;  3CME 3;  4IPB A;  1U5O A;  3LH4 A;  1ULI B;  5IEP A;  2KCD A;  2KXG A;  1OGZ A;  3KN4 A;  3QRD A;  3RDE A;  3G0K A;  1BNE A;  5ELJ A;  3WA2 X;  2ZDJ A;  1MWT A;  2GBX B;  3V92 A;  4G1M B;  2CX1 A;  3K7C A;  5EVH A;  1VQ7 3;  2QEX 3;  3BNB A;  1W02 A;  2M7O A;  1FUS A;  2Z76 A;  1OHS A;  4FCM A;  5AI1 A;  4HM3 B;  2O9U X;  2GEX A;  1CH0 A;  1RGL A;  1I0X A;  2YFL B;  3OWS A;  2CIU A;  3KCH A;  3WMD A;  3HIG A;  1RGG A;  3G71 3;  2F4Y A;  1VZZ A;  3OWU A;  1VQ5 3;  1BAN A;  1LOY A;  4XB5 A;  4HM8 B;  3D4A A;  3NHX A;  4LSO A;  5A0O B;  1D6U A;  2XFS A;  1IYY A;  1GYB A;  1Q42 A;  1KSI A;  1N5P A;  1FYS A;  3IJE B;  2F5M A;  4K61 A;  1VQP 3;  4EW5 A;  1BSC A;  1TRP A;  3Q1C A;  1FGM A;  7STD A;  1UUW B;  2KF3 A;  3IPT A;  3K9M C;  3MG1 A;  4KT3 B;  4LEH A;  3KFQ C;  4IT7 A;  4RNY A;  5KP3 A;  1BNI A;  3UB1 A;  3KII A;  2XF3 A;  7GSP A;  4HM6 B;  2CKF B;  1RNB A;  1LOV A;  2GEY A;  4IIA A;  3CMA 3;  2Q07 A;  3EB8 A;  2XGL A;  4H3U A;  5DRE A;  1FGT A;  1W6Y A;  1UDI I;  1BRJ A;  3E99 A;  3FCS B;  3F7X A;  1SAR A;  3DGN A;  3SLU A;  1LNI A;  2BHM A;  4CJN A;  3HOH A;  3NXJ A;  1OCV A;  2IUJ A;  3CC2 3;  4R4K A;  1I3F A;  1OH0 A;  2GU3 A;  2HML B;  2SAR A;  2Y73 A;  3HI7 A;  4J9A A;  5IEN A;  3CPO A;  2CX0 A;  5ELU A;  2H0I A;  5AIF A;  2GSP A;  1JB2 A;  1GSP A;  1HZ1 A;  1NWW A;  3BND A;  3VF1 A;  2CFK A;  2CFL A;  1Q7H A;  3H3H A;  4I5Q A;  2HMN B;  1BRK A;  3MHE A;  1YVB I;  3Q3F A;  4EXR A;  3G4S 3;  1Q40 B;  1S5A A;  4DKI A;  1LQG C;  1TFO A;  2XSH B;  1UCK A;  1GOY A;  2W56 B;  3DZL A;  4FMD A;  1GMQ A;  1X1X A;  3KSE D;  1RNT A;  2XR8 B;  3D5I A;  2KF6 A;  3UL5 A;  3X40 A;  1BRN L;  1JN5 B;  2CHC A;  2RGQ A;  4HBR A;  2B1X B;  3LML A;  1EQK A;  4L8O A;  1RGF A;  3FF0 A;  4FCJ A;  1HU9 A;  1GS3 A;  5CK6 A;  2BO9 B;  2KAA A;  4LMI A;  3SED A;  1FGR A;  2KF5 A;  1Y4K A;  2YFJ B;  1BUJ A;  1UUG B;  4HZ9 B;  1C7H A;  1W2Z A;  6STD A;  5CF1 A;  4JF8 A;  4BL2 A;  5LC7 A;  3FSD A;  1B2Z A;  3EBY A;  2A15 A;  2P0X A;  4XDV A;  3DXO A;  5AEU B;  3ZG0 A;  1B2X A;  2LYX A;  1G02 A;  2UUG C;  4N6U A;  3RGA A;  1ASK A;  3VSY A;  1ULJ B;  2Z77 A;  3DGY A;  5D81 A;  1IK3 A;  1Q82 4;  2OQE C;  1TJD A;  2Z7A A;  3KSP A;  5TGN A;  2W04 A;  5JPU A;  1B20 A;  1BUQ A;  2W0Q A;  1RSN A;  1PFP A;  1V58 A;  2WGO A;  4WHA A;  5IG3 A;  1ZS7 A;  1TU5 A;  2ZA4 A;  1B21 A;  2W6J H;  4HM7 B;  1LQM B;  3CCR 3;  2BT3 A;  2F98 A;  1IQX A;  1V57 A;  4N6N B;  2CG0 A;  5M19 A;  1Q7Y 4;  3N9H A;  2W2C A;  3ER7 A;  3KZT A;  1DVC A;  4NHF A;  1LVN A;  1OUN A;  1SQW A;  3BNE A;  2F86 B;  1I70 A;  3MSO A;  1T5Y A;  3S28 A;  1PYL A;  3S67 A;  3X3Y A;  1NB3 I;  1UGH I;  3X3Z A;  2XH9 A;  1ZO2 A;  1X1U A;  1RMS A;  2W9Q A;  4BTW A;  1EA2 A;  1GD3 A;  1BSA A;  2IY2 A;  1SJW A;  1N9J A;  4X2H A;  1FA3 A;  2C10 A;  2R41 A;  3FG1 A;  3HX8 A;  2UGI A;  3FF2 A;  3PYJ A;  5JBS A;  1BU4 A;  4MJD A;  3A76 A;  4N6M A;  3BNC A;  2XFT A;  4GL6 A;  3HK4 A;  4FCZ A;  1BNF A;  5IEO A;  4XBX A;  4WWU C;  2P09 A;  3EC9 A;  1M90 4;  1FW7 A;  1FUW A;  1FGO A;  2K0M A;  1JZO A;  1BOX A;  3LZA A;  2FXT A;  3NBB A;  2MC8 A;  1YI2 3;  1M1X B;  4KZ1 A;  2MF7 A;  1VQ8 3;  3FG4 A;  1J2B A;  1JRQ A;  1JBR A;  1DET A;  1BNJ A;  3GZR A;  3LTC A;  3G8Z A;  1PY3 A;  4RBN A;  1CEW I;  1JZD A;  1STD A;  1GOU A;  2CH9 A;  3F8H A;  1LRA A;  3HII A;  1UGI A;  4XBT A;  4AEQ A;  6GSP A;  1DMM A;  5AEW B;  1EEJ A;  2INX A;  1YVS A;  4KFF A;  5KP4 A;  3DGL A;  2OOV A;  1AR0 A;  1RHL A;  4WFO A;  4K1U A;  2QIY A;  4WP5 A;  2GBW B;  1ROA A;  1QMA A;  3Q90 A;  1WMO A;  1O7M B;  1BRG A;  1UCI A;  1TIJ A;  2YFI B;  3AHS A;  3IMA B;  1LOW A;  3K0Z A;  1WMP A;  3LT8 A;  4RNZ A;  5HOH A;  2XGN A;  2BMR B;  2P05 A;  3G6E 3;  1E3V A;  1NU3 A;  4O8S A;  1QAK A;  4HM4 B;  2GU1 A;  3EE1 A;  1KQS 2;  1VQK 3;  1JKG A;  1JJ2 2;  4RZM A;  1Q81 4;  3GWR A;  1RGK A;  2HMJ B;  1IQY A;  3JUP A;  1K28 A;  4NPB A;  3STD A;  3GZB A;  3SX1 A;  5IG5 A;  3GRD A;  1ROV A;  3CNM A;  9RNT A;  1CQS A;  1I2E A;  1MOL A;  1B27 A;  2HOH A;  3F7S A;  3NV0 A;  4K90 B;  4O3V A;  1A90 A;  4KFD A;  1GOV A;  4HYZ A;  5G1L A;  4AKY A;  4R1K A;  3JUM A;  1MGW A;  1RRL A;  1A2V A;  2PZV A;  4N3V A;  4QWT A;  5AIH A;  2L4V A;  5I97 A;  1O7G B;  1OF5 A;  4FR9 A;  1ZGX A;  3D79 A;  3CCE 3;  1W2B 2;  4BTX A;  4EV2 A;  2CWU A;  1IV7 A;  3EF8 A;  3TDG A;  1BVI A;  1D6Y A;  2K54 A;  2OWP A;  3K5T A;  3ALA A;  5CF2 A;  5M18 A;  4OK0 A;  1X1W A;  4WYK A;  3AMO B;  3NUV A;  1L5G B;  1NO3 A;  4N6O B;  1N8R 4;  3CC4 3;  1AV4 A;  1TRQ A;  3ECF A;  4N6T A;  1IVW A;  3GAX A;  3FG3 A;  1R4C A;  2K3D A;  2LQV A;  3MG2 A;  4BIR A;  1S72 3;  3PCS A;  1FUT A;  1AVK A;  4GHO A;  1RGH A;  1VQQ A;  1MWU A;  1B2S A;  3LTD A;  4BU4 A;  4HZB B;  2CFW A;  2RSX A;  3EBT A;  2BIR A;  1BSD A;  1KD1 4;  1C54 A;  4HM5 B;  1GY6 A;  1DMQ A;  3NX0 A;  1BRH A;  8RNT A;  1IT8 A;  3NBJ A;  3BIR A;  2IYJ A;  1KWI A;  3LTA A;  3I56 3;  1NB5 I;  3EN1 B;  1WQL B;  3JUO A;  1Q9E A;  2V1L A;  2I9W A;  1VQ4 3;  2BNG A;  2RBI A;  4XBY A;  1GMP A;  4MMX B;  3J7Y d;  1BAO A;  1DYU A;  3CNX A;  1AY7 A;  4ZM8 A;  4XDW A;  2R4I A;  3CCU 3;  4JRF A;  3LYG A;  2AAE A;  1IDP A;  2IUK A;  3JVC A;  5HGR A;  4FMA A;  2CG1 A;  3RGR A;  2F5W A;  1IV9 A;  1YNV X;  2UX0 A;  1JKG B;  1MGR A;  1TTO A;  2J8X B;  1WMN A;  2WGQ A;  3FH1 A;  1B2U A;  3LTB A;  1NNV A;  5JPP A;  1TFK A;  1SPU A;  1E97 A;  2ZHX B;  1RKY A;  3JUN A;  4KFE A;  1OPY A;  3WOE B;  1MWS A;  1OHO A;  2O3O A;  1YJW 3;  1F8N A;  1YGE A;  3SOY A;  1HKX A;  2P0M A;  4TX4 A;  3G16 A;  3OWY A;  1W00 A;  3L0R A;  3PGB A;  1W6G A;  3FZW A;  1ZX2 A;  4XM4 A;  1CYU A;  2WOH A;  4J8T A;  1IVX A;  3ZG5 A;  3DGM A;  5EEO A;  1B3S A;  1RGC A;  3CU3 A;  4STD A;  1GD4 A;  1K8A 4;  3OXA A;  1G0T A;  3CCS 3;  2C4B A;  3B7C A;  1RN7 A;  1W6C A;  4K1V A;  5STD A;  3GSP A;  2W9P A;  8CHO A;  2OTL 3;  2CFG A;  2WO0 A;  5D82 A;  1AVL A;  5LC6 A;  1I3I A;  3D9R A;  4BL3 A;  4L7K A;  2KRT A;  4MMZ B;  4ORL A;  3WA3 A;  2QA4 3;  1G96 A;  1M1K 4;  1VQN 3;  1O7P B;  5IW9 A;  1T2I A;  1IT7 A;  2D42 A;  3SOA A;  1TUH A;  3AGO A;  5IG4 A;  5KP1 A;  2CWT A;  2SBL A;  1D6Z A;  5EQL A;  7RNT A;  1NJI 4;  4EV5 A;  3DGO A;  1STF I;  3F8X A;  4RNT A;  3OX9 A;  4LYL B;  1YHQ 3;  1OAC A;  1RDS A;  3PCR A;  1IQ8 A;  2XRX B;  2CWV A;  5BVB A;  1JBS A;  3M8C A;  2AAD A;  4X2O A;  1LOX A;  1MWR A;  1QAL A;  3O8Y A;  3D5G A;  2QGU A;  5BXQ A;  1Q40 A;  1UCJ A;  3QK9 A;  3UJM A;  5M1A A;  3MG3 A;  3F9S A;  5DRV A;  2RFR A;  3NBR A;  4EBG A;  4GB5 A;  1JN5 A;  3A5E A;  1T3B A;  1A2K A;  1DMN A;  3PXM A;  4FMB A;  3URP A;  3H51 A;  2OOV C;  3MYT A;  4J5G A;  1LXE A;  1AQZ A;  1NDO B;  5IF6 A;  2IMJ A;  4OVM A;  1US1 A;  3FKA A;  5D83 A;  2GXF A;  1Q86 4;  1BRS A;  1DE3 A;  4J5K A;  1YJN 3;  1RGA A;  3B4P A;  3WR2 A;  1OHP A;  1N8Q A;  3DY5 A;  3CCM 3;  3N54 B;  3N8B A;  5CXO A;  3Q2P A;  2PNC A;  1VQ6 3;  2F99 A;  3T0U A;  1I2G A; 
#chains in the Genus database with same CATH homology
 5G2G A;  3K63 A;  2CC3 A;  2FNQ A;  1JB5 A;  4HM2 B;  3S29 A;  4PEJ A;  3CCQ 3;  1YIJ 3;  4HJL B;  3UL6 A;  3DM8 A;  1JV2 B;  3NM2 A;  5FW5 A;  5FGO A;  3CPW 2;  3DMC A;  4NRE A;  1YIT 3;  2JQ5 A;  1O7N B;  3S5C A;  1W7C A;  4HVN A;  2HMM B;  4EYC A;  5IG0 A;  1VQO 3;  1FGQ A;  2HMK B;  3HZP A;  3VGN A;  3NQZ A;  4LGQ A;  2STD A;  3F14 A;  3ROB A;  3DUK A;  3OV4 A;  3F40 A;  1QVF 2;  4R80 A;  1JB4 A;  2XSO B;  4EC6 A;  1GY7 A;  1W4N A;  5AIG A;  1IU7 A;  4KVH A;  1RRH A;  3MWZ A;  5CLK A;  3U97 A;  2ML6 A;  4HM1 B;  3NM7 A;  4O02 B;  4H61 A;  2HMO B;  1U8C B;  1QVG 2;  1UI7 A;  1GY5 A;  2D1W A;  2FGT A;  3V98 A;  2JDI H;  2OCT A;  3CCL 3;  1M9G A;  3CXC 2;  1A67 A;  3LOY A;  1YJ9 3;  1VQ9 3;  4MEI A;  4CDL A;  4HM0 B;  3PS8 A;  1EKM A;  1UI8 A;  1Z1S A;  3FLJ A;  2XEP A;  1VQM 3;  4FMC A;  1O7W B;  3B4O A;  3NQY A;  3T8U A;  1SII A;  4R9L A;  2E2T A;  2W03 A;  4N6V 0;  1QAF A;  2OQE A;  2OTJ 3;  2CW9 A;  3KKG A;  3CCJ 3;  1N9E A;  3BLZ A;  4I4K A;  3EJV A;  1DVD A;  4HKV B;  3NV0 B;  2IA7 A;  1LNH A;  3LT9 A;  3X41 A;  3MKI A;  2Z6B A;  1UW1 A;  1MNL A;  2E2V A;  2BMO B;  1N5H A;  3I0Y A;  1RJO A;  4U13 A;  1K9M 4;  2ZL8 A;  4CCV A;  4BTY A;  2E2U A;  1OF5 B;  2YX9 A;  1SIH A;  4N6L A;  3EN8 A;  4L8P A;  1CYV A;  3D3L A;  4R9K A;  1K73 4;  1PU4 A;  1W01 A;  1K41 A;  3BB9 A;  3FGY A;  3CC7 3;  3CD6 3;  1E3R A;  2ML5 A;  4WYK B;  1VQL 3;  3UNL A;  4AKZ A;  4MMY B;  3WOF B;  2B24 B;  3WDG B;  5AII A;  3SVA A;  1ISK A;  1W5Z A;  3V99 A;  1EG9 B;  1WTH A;  1O7H B;  3PZW A;  1KC8 4;  5AYS C;  3OW2 2;  2P38 A;  3MPH A;  3B8L A;  1JNQ A;  3LXU X;  3S27 A;  3I55 3;  2C11 A;  3EX9 A;  3T8N A;  3SXX A;  2BMQ B;  1V74 A;  3AMO A;  3WOD G;  1IVV A;  3JUQ A;  1WNH A;  3EQQ B;  3X42 A;  2CFD A;  3GZY B;  3X3X A;  4Q53 A;  4OUQ A;  2CK3 H;  3CCV 3;  1QJG A;  5IER A;  1TP6 A;  2Y74 A;  3GZX B;  2RCD A;  4LZI A;  4O2H A;  2WOF A;  1OGX A;  3KE7 A;  3U1W A;  5AYR B;  3EHC A;  1UUV B;  1IVU A;  2W56 A;  3CME 3;  4IPB A;  1U5O A;  3LH4 A;  1ULI B;  5IEP A;  2KCD A;  2KXG A;  1OGZ A;  3KN4 A;  3QRD A;  3RDE A;  3G0K A;  5ELJ A;  3WA2 X;  2ZDJ A;  2GBX B;  3V92 A;  4G1M B;  5EVH A;  3K7C A;  1VQ7 3;  2QEX 3;  3BNB A;  1W02 A;  2M7O A;  2Z76 A;  4FCM A;  1OHS A;  5AI1 A;  4HM3 B;  2O9U X;  2GEX A;  2YFL B;  3OWS A;  2CIU A;  3WMD A;  3HIG A;  3G71 3;  1VZZ A;  3OWU A;  1VQ5 3;  4XB5 A;  4HM8 B;  3NHX A;  4LSO A;  5A0O B;  1D6U A;  2XFS A;  1GYB A;  1Q42 A;  1KSI A;  1N5P A;  3IJE B;  4K61 A;  1VQP 3;  3Q1C A;  1FGM A;  7STD A;  1UUW B;  3IPT A;  3K9M C;  3MG1 A;  4LEH A;  4RNY A;  3KFQ C;  4IT7 A;  5KP3 A;  3UB1 A;  3KII A;  2XF3 A;  4HM6 B;  2CKF B;  2GEY A;  4IIA A;  3CMA 3;  2Q07 A;  3EB8 A;  2XGL A;  4H3U A;  5DRE A;  1FGT A;  1W6Y A;  3E99 A;  3FCS B;  3F7X A;  3DGN A;  3SLU A;  2BHM A;  3NXJ A;  1OCV A;  2IUJ A;  3CC2 3;  4R4K A;  1OH0 A;  2GU3 A;  2HML B;  2Y73 A;  4J9A A;  3HI7 A;  5IEN A;  3CPO A;  5ELU A;  5AIF A;  3VF1 A;  1JB2 A;  1NWW A;  3BND A;  2CFK A;  2CFL A;  3H3H A;  2HMN B;  3MHE A;  1YVB I;  4EXR A;  3G4S 3;  1Q40 B;  1S5A A;  4FMD A;  1TFO A;  2XSH B;  1N8R 4;  2W56 B;  3DZL A;  3KSE D;  2XR8 B;  3UL5 A;  3X40 A;  1JN5 B;  2CHC A;  2RGQ A;  4HBR A;  2B1X B;  3LML A;  1EQK A;  4L8O A;  3FF0 A;  4FCJ A;  1HU9 A;  1GS3 A;  5CK6 A;  2BO9 B;  4LMI A;  3SED A;  1FGR A;  1Y4K A;  2YFJ B;  4HZ9 B;  1C7H A;  1W2Z A;  6STD A;  5CF1 A;  4JF8 A;  5LC7 A;  3FSD A;  3EBY A;  2A15 A;  2P0X A;  4XDV A;  3DXO A;  5AEU B;  2LYX A;  4N6U A;  3RGA A;  1ASK A;  3VSY A;  1ULJ B;  2Z77 A;  5D81 A;  1IK3 A;  1Q82 4;  2OQE C;  2Z7A A;  3KSP A;  5TGN A;  2W04 A;  5JPU A;  1BUQ A;  2W0Q A;  1PFP A;  2WGO A;  4WHA A;  5IG3 A;  1TU5 A;  2W6J H;  4HM7 B;  3CCR 3;  2BT3 A;  2F98 A;  1IQX A;  4N6N B;  1Q7Y 4;  2CG0 A;  3N9H A;  2W2C A;  3ER7 A;  3KZT A;  1DVC A;  4NHF A;  1LVN A;  1OUN A;  1SQW A;  3BNE A;  2F86 B;  3MSO A;  1T5Y A;  3S28 A;  3S67 A;  3X3Y A;  1NB3 I;  3X3Z A;  2XH9 A;  1ZO2 A;  2W9Q A;  4BTW A;  1EA2 A;  1GD3 A;  1SJW A;  1N9J A;  4X2H A;  1FA3 A;  2C10 A;  3FG1 A;  3HX8 A;  3FF2 A;  3PYJ A;  5JBS A;  4MJD A;  3A76 A;  4N6M A;  3BNC A;  2XFT A;  4GL6 A;  3HK4 A;  4FCZ A;  5IEO A;  4XBX A;  4WWU C;  2P09 A;  3EC9 A;  1M90 4;  1FUW A;  1FGO A;  2K0M A;  3LZA A;  2FXT A;  3NBB A;  2MC8 A;  1YI2 3;  1M1X B;  4KZ1 A;  2MF7 A;  1VQ8 3;  3FG4 A;  1J2B A;  1JRQ A;  3GZR A;  3LTC A;  3G8Z A;  4RBN A;  1CEW I;  2CH9 A;  1STD A;  3HII A;  3F8H A;  4XBT A;  4AEQ A;  1DMM A;  5AEW B;  2INX A;  4KFF A;  5KP4 A;  3DGL A;  2OOV A;  1AR0 A;  4WFO A;  4K1U A;  2QIY A;  4WP5 A;  2GBW B;  1ROA A;  1QMA A;  3Q90 A;  1WMO A;  1O7M B;  2YFI B;  1TIJ A;  3IMA B;  3K0Z A;  3LT8 A;  4RNZ A;  1WMP A;  2XGN A;  2BMR B;  2P05 A;  3G6E 3;  1E3V A;  1NU3 A;  4O8S A;  1QAK A;  4HM4 B;  2GU1 A;  3EE1 A;  1KQS 2;  1VQK 3;  1JKG A;  1JJ2 2;  4RZM A;  1Q81 4;  3GWR A;  2HMJ B;  1IQY A;  3JUP A;  1K28 A;  3STD A;  3SX1 A;  3GZB A;  5IG5 A;  3GRD A;  1ROV A;  3CNM A;  1CQS A;  1MOL A;  3NV0 A;  4K90 B;  3F7S A;  4O3V A;  1A90 A;  4KFD A;  4HYZ A;  4AKY A;  4R1K A;  3JUM A;  1RRL A;  4QWT A;  1A2V A;  2PZV A;  4N3V A;  5AIH A;  5I97 A;  2L4V A;  1O7G B;  1OF5 A;  4FR9 A;  3CCE 3;  1W2B 2;  4BTX A;  4EV2 A;  2CWU A;  1IV7 A;  3EF8 A;  3TDG A;  1D6Y A;  2K54 A;  2OWP A;  3K5T A;  3ALA A;  5CF2 A;  4OK0 A;  4WYK A;  3AMO B;  3NUV A;  1L5G B;  1NO3 A;  4N6O B;  3CC4 3;  1AV4 A;  3ECF A;  4N6T A;  1IVW A;  3GAX A;  3FG3 A;  1R4C A;  2LQV A;  3MG2 A;  1S72 3;  3PCS A;  1AVK A;  3LTD A;  4HZB B;  2CFW A;  2RSX A;  3EBT A;  1KD1 4;  4HM5 B;  1GY6 A;  1DMQ A;  3NX0 A;  1IT8 A;  3NBJ A;  3LTA A;  1KWI A;  3I56 3;  1NB5 I;  3EN1 B;  1WQL B;  3JUO A;  2V1L A;  2I9W A;  1VQ4 3;  2BNG A;  4XBY A;  4MMX B;  3J7Y d;  1DYU A;  3CNX A;  4ZM8 A;  4XDW A;  2R4I A;  3CCU 3;  4JRF A;  3LYG A;  1IDP A;  2IUK A;  3JVC A;  5HGR A;  4FMA A;  2CG1 A;  3RGR A;  1IV9 A;  2UX0 A;  1JKG B;  1WMN A;  2WGQ A;  3FH1 A;  3LTB A;  5JPP A;  1TFK A;  1SPU A;  1E97 A;  1RKY A;  3JUN A;  4KFE A;  1OPY A;  3WOE B;  1OHO A;  2O3O A;  1YJW 3;  1F8N A;  1YGE A;  3SOY A;  1HKX A;  2P0M A;  4TX4 A;  3G16 A;  3OWY A;  1W00 A;  3L0R A;  3PGB A;  1W6G A;  3FZW A;  1ZX2 A;  4XM4 A;  1CYU A;  2WOH A;  4J8T A;  1IVX A;  3DGM A;  5EEO A;  3CU3 A;  4STD A;  1K8A 4;  1GD4 A;  3OXA A;  3CCS 3;  3B7C A;  1RN7 A;  1W6C A;  4K1V A;  5STD A;  2W9P A;  8CHO A;  2OTL 3;  2CFG A;  2WO0 A;  5D82 A;  1AVL A;  5LC6 A;  3D9R A;  4L7K A;  2KRT A;  4MMZ B;  4ORL A;  3WA3 A;  2QA4 3;  1G96 A;  1M1K 4;  1VQN 3;  1O7P B;  5IW9 A;  1IT7 A;  2D42 A;  3SOA A;  1TUH A;  5IG4 A;  5KP1 A;  1NJI 4;  2CWT A;  2SBL A;  1D6Z A;  5EQL A;  4EV5 A;  3DGO A;  1STF I;  3F8X A;  3OX9 A;  1YHQ 3;  1OAC A;  3PCR A;  1IQ8 A;  2XRX B;  2CWV A;  5BVB A;  3M8C A;  4X2O A;  1LOX A;  1QAL A;  3O8Y A;  2QGU A;  5BXQ A;  1Q40 A;  3QK9 A;  3UJM A;  3MG3 A;  3F9S A;  5DRV A;  2RFR A;  3NBR A;  4EBG A;  4GB5 A;  1JN5 A;  1A2K A;  1DMN A;  3PXM A;  4FMB A;  3H51 A;  2OOV C;  3MYT A;  1LXE A;  1NDO B;  5IF6 A;  2IMJ A;  4OVM A;  1US1 A;  3FKA A;  5D83 A;  2GXF A;  1Q86 4;  1YJN 3;  3B4P A;  1OHP A;  1N8Q A;  3DY5 A;  3CCM 3;  3N54 B;  3N8B A;  5CXO A;  3Q2P A;  2PNC A;  1VQ6 3;  2F99 A;  3T0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...