3GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 4 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endoribonuclease
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3gspA00
1YVSA 7GSPA 1UCKA 1BSAA 1RN4A 2F5WA 1HZ1A 1FUSA 1MGWA 3BIRA 1RGFA 2SARA 1GOVA 3AHWA 1MGRA 1B20A 3DH2A 2RBIA 1T2IA 1YGWA 1B3SA 1BRIA 1RCLA 1RTUA 3SYUA 1BGSA 1I3FA 4BU4A 1BRJA 1RGGA 3D5GA 6RNTA 3Q3FA 3WHOA 2C4BA 1RNBA 3WR2A 1AQZA 1BNSA 2HOHA 1BRSA 5HOHA 2KF6A 1SARA 1X1UA 1LOYA 3AGNA 1ZGXA 2F56A 1T2HA 1I0XA 3GSPA 1RGAA 1IYYA 1RSNA 1G02A 1GMPA 3D5IA 1JBTA 1BSCA 3AHSA 1BIRA 1CH0A 2AAEA 1RGEA 1BRHA 2BU4A 3BU4A 5RNTA 1RDSA 3RNTA 1YNVX 1BSEA 1RN1A 6GSPA 1BANA 5BIRA 3HOHA 1I3IA 3D4AA 3KCHA 5GSPA 1BNIA 1BAOA 1RGHA 1FUTA 1GSPA 1TTOA 1RGKA 1TRQA 1I2FA 4HOHA 1I2EA 1B27A 1GOUA 9RNTA 1RMSA 1AY7A 1GMRA 7RNTA 1BNFA 1BNRA 1BNGA 1R4YA 2F5MA 1GOYA 2KF5A 3A5EA 1B2ZA 1BU4A 2KF4A 1B2SA 1LNIA 1BVIA 5BU4A 1RGCA 2RNTA 4HAAA 1JBRA 1BNJA 2BIRA 1LOWA 1B2MA 1BOXA 2F4YA 1LRAA 4RNTA 1I70A 3DGYA 1GMQA 2KAAA 1RNTA 4J5GA 1B2XA 1B2UA 1FZUA 1UCIA 2AADA 1RCKA 1BRNL 1RGLA 1B21A 1HYFA 1BRKA 1I2GA 1BNEA 1LOVA 1UCLA 1RLSA 1X1WA 4J5KA 8RNTA 1JBSA 1DE3A 2GSPA 1A2PA 1I8VA 1RHLA 1UCJA 1TRPA 1BSBA 4GSPA 1PY3A 1X1XA 1FYSA 1PYLA 2ZA4A 4BIRA 3URPA 1Q9EA 1BUJA 1C54A 1FW7A 1BSDA 2KF3A 1X1YA 1BRGA 1DETA 3AGOA 4GHOA 1I0VA
chains in the Genus database with same CATH superfamily
4AKYA 1JKGA 1OH0A 1V57A 3SOAA 3BIRA 1FA3A 4L8OA 5FGOA 3ROBA 5CLKA 4BTXA 1OACA 2W9PA 2W6JH 2RGQA 3WOFB 3LH4A 4NPBA 1NNVA 1VQM3 1NB5I 3J7Yd 1Q814 1RCLA 2W04A 4BL3A 3B7CA 1BGSA 1JB2A 1NB3I 4IT7A 1QVG2 4R1KA 2P0MA 2CK3H 2RFRA 3Q3FA 4RZMA 2YFLB 1Q40A 1W6CA 2C4BA 2KCDA 2ZHXB 3EHCA 3FCSB 3IJEB 3CC43 1O7PB 3WR2A 1RNBA 2W9QA 3X3ZA 1BRSA 4HBRA 1OHPA 1X1UA 3GWRA 3MG1A 4FMBA 2CWTA 4H3UA 4MMYB 5IF6A 1CQSA 1SIHA 1ZGXA 1EG9B 3DGOA 2WGOA 1YJN3 2IUKA 3RDEA 1RSNA 3CPOA 3FG3A 3L0RA 1IK3A 4X2HA 1T3BA 1VQP3 3MKIA 2E2UA 1BSCA 3K0ZA 4PEJA 3ZG0A 1E3RA 3BB9A 5BVBA 1YHQ3 1W6YA 2MC8A 1CH0A 1OCVA 1TFOA 1JB5A 4EXRA 1UGHI 3EC9A 5ELUA 3CXC2 3G713 1UUWB 5IW9A 3EE1A 1M9GA 3BU4A 3F9SA 2W2CA 3ZG5A 3JUMA 5FW5A 3UNLA 1V58A 2R41A 4HM3B 3MYTA 2IA7A 1BSEA 3O8YA 2ML6A 2IUJA 4BTYA 3MSOA 3EBYA 1FGMA 2SBLA 2IMJA 2W56B 1JN5A 3HOHA 3KE7A 4XM4A 3KN4A 2CX0A 2OCTA 3QRDA 1LQGC 1TP6A 1Q7HA 4R80A 5AIIA 3BNEA 4XB5A 1GYBA 4WYKA 1RGKA 1LOXA 2BO9B 1IVVA 4CJNA 1BNFA 1BNGA 2F5MA 1PFPA 1B2ZA 1MOLA 2CC3A 1RKYA 1LNIA 3WODG 5AIFA 5G1KA 1U5OA 4XDWA 3X3XA 3EX9A 1ZS7A 3CD63 2BT3A 5IG4A 1BNJA 1NDOB 1LXEA 1LOWA 4IIAA 1VQQA 3CPW2 4ILFA 2RSXA 1YIJ3 3NBJA 5STDA 3PS8A 3OV4A 1BOXA 3U97A 1QALA 2GXFA 3IMAB 3UL5A 1LRAA 1LVNA 3VGNA 1MWUA 3D79A 2YFIB 3PXMA 4O2HA 4WWUC 3FG1A 3I553 3LYGA 3B8LA 4EC6A 1K41A 2GEXA 3G16A 4ZM8A 5AEUB 1RJOA 1UCIA 3LT8A 3FF0A 4HM5B 5EVHA 3EB8A 1RGLA 1DMNA 2C11A 4GL6A 4HM2B 3CMA3 2JQ5A 3N9HA 3RNTA 1C7HA 4AKZA 5M1AA 4R9LA 3RGAA 1IQ8A 1JZDA 4HM1B 1NWWA 1G0TA 1SIIA 1RHLA 3CCM3 2QA43 1TRPA 5I97A 1PYLA 1C54A 3IPTA 1FW7A 3EF8A 8RNTA 5G2GA 1BSDA 1QJGA 2KF3A 2OWPA 4HKVB 3WOEB 1Z1SA 2E2TA 3NBRA 3UJMA 2XGNA 7GSPA 3FF2A 4KT3B 4R9KA 3FG4A 1HZ1A 1FUSA 2GEYA 3CCQ3 1RGFA 1Q40B 3GZYB 1MGRA 1UGIA 1B20A 3HK4A 3LT9A 2F99A 1GS3A 3SX1A 3DH2A 4EV2A 2Y73A 2RBIA 3F14A 3FH1A 1VQ73 1T2IA 2FGTA 1IQYA 2HMOB 4XDVA 2PNCA 3HX8A 1AR0A 1G96A 3CNXA 1GD3A 1RTUA 1K8A4 3S29A 1OF5B 2BHMA 2P09A 1I3FA 1BRJA 3D5GA 1GY5A 1SPUA 3HIGA 4ORLA 2OQEA 1Y4KA 1E3VA 3JUNA 5JPUA 3OXAA 1F8NA 4EW5A 3FZWA 4J9AA 1IVUA 5AIGA 1AQZA 2HOHA 5HOHA 1SARA 4HM0B 2CX1A 3NM7A 4U13A 4L7KA 2WO0A 2B24B 1IYYA 2XGLA 1TU5A 1RN7A 2YFJB 1VQO3 1Q7Y4 1E97A 3D5IA 4KZ1A 3N54B 5CK6A 3CCR3 2OOVC 1BIRA 3CU3A 2AAEA 2UUGC 3CME3 2CWUA 2XFSA 1A2KA 2XRXB 4WYKB 1IDPA 4K61A 5KP4A 2KRTA 5AIHA 1K9M4 1MNLA 4HM7B 1WQLB 3B4PA 1IT8A 2R4IA 4FMAA 1J2BA 2CHCA 2CWVA 1ASKA 2Z7AA 1RN1A 1BANA 2FNQA 3FGYA 1DMQA 5BIRA 4HZ9B 4RNZA 4MMZB 3KCHA 1BNIA 1BAOA 3RGRA 2GBXB 1VQN3 4HM6B 1S723 2QIYA 2M7OA 1I2FA 4HOHA 5JBSA 1N5HA 3U1WA 3GRDA 2H0GA 5DREA 1GMRA 2HMLB 4LYLB 5AYSC 1VQL3 2OQEC 2J8XB 3FLJA 5AEWB 1K734 1KQS2 1W01A 3JUOA 1B2SA 3GZRA 4DKIA 5BU4A 3CCU3 5TGNA 2RNTA 3NQZA 1K28A 1A90A 4I5QA 2BIRA 1KWIA 1UUVB 3X41A 2F4YA 5CF2A 3SOYA 3DGYA 1GMQA 2KAAA 3NHXA 2I9WA 5IG3A 1AVKA 1RNTA 4J5GA 1B2UA 1RCKA 2GU1A 3BNBA 3MPHA 3CCV3 2WGQA 2OTJ3 1Q42A 1ZO2A 1BRKA 1BNEA 4HYZA 4JF8A 1ZX2A 3F8XA 1HU9A 4K1UA 1IVWA 1US1A 1A2PA 4BL2A 1EKMA 1PY3A 2CH9A 1FYSA 3URPA 1N9EA 1X1YA 1BRGA 1W6GA 3S28A 3WDGB 2XH9A 4GHOA 4N6NB 1JNQA 2P0XA 4HVNA 1YVSA 4O8SA 1MWSA 4R4KA 4STDA 3K9MC 2UX0A 1UCKA 1HKXA 3NUVA 1RN4A 3NV0A 4NREA 4Q53A 1QAKA 5AI1A 2RCDA 1FGOA 1JRQA 1MGWA 1OGZA 4AEQA 3MG3A 1GOVA 3AHWA 1IT7A 1TUHA 2CKFB 1DYUA 4N6TA 3WA2X 1VQ63 1M904 3QK9A 1YGWA 1JKGB 1V74A 1T5YA 5D81A 2H0IA 1O7WB 3LTCA 1O7MB 1N8QA 4JRFA 3DGLA 3ER7A 1ULJB 2OOVA 1D6ZA 4LSOA 1D6UA 1JJ22 2WOHA 1I0VA 1SQWA 3WHOA 1NJI4 1SJWA 2K3DA 3DXOA 3FKAA 5IEPA 4OVMA 1BNSA 1ROAA 3HZPA 1W5ZA 2HMJB 2L4VA 3KSPA 1DVDA 3GZBA 3K63A 1ISKA 2V1LA 2F56A 1UDII 4WHAA 1T2HA 1STFI 1I0XA 1TIJA 3EN8A 1RGAA 3KIIA 4MEIA 1WMOA 5D82A 3V92A 2Z6BA 1G02A 2BMOB 1GMPA 3MG2A 3A76A 5DRVA 5CXOA 2GBWB 3AMOA 3Q1CA 5G1LA 3OWYA 3T8UA 2F98A 4GB5A 4EBGA 4FCMA 1OUNA 5KP1A 2L1SA 4CCVA 1JZOA 3LTDA 4H61A 3NQYA 2Z77A 3SLUA 4G1MB 1W00A 1STDA 3BNCA 2XSOB 3KKGA 2JDIH 1YIT3 1I3IA 1TJDA 4O02B 3KFQC 5GSPA 4KFEA 2K54A 3VSYA 1UI7A 1FUTA 1GSPA 1TTOA 2WOFA 2IY2A 1MWRA 3F7SA 2KXGA 1TRQA 3GAXA 3HIIA 1O7GB 2CFWA 1B27A 1GOUA 4J8TA 3NBBA 4N6V0 9RNTA 1IQXA 2CFKA 5IG5A 2O3OA 2OTL3 4MJDA 3GZXB 5IENA 3DGMA 1BNRA 1R4YA 1EEJA 1JN5B 1EA2A 3A5EA 3F7XA 1N9JA 3K5TA 4FR9A 1GD4A 1BU4A 1GY6A 2KF4A 4N6MA 5IEOA 2STDA 1BVIA 2ZL8A 1W2B2 3D3LA 3D9RA 1L5GB 1OHSA 1WMPA 1U8CB 3T0UA 1YGEA 4LEHA 1B2MA 1RRHA 3WA3A 3BLZA 1D6YA 1LQMB 1FGQA 4RNTA 5EEOA 3PYJA 4EV5A 1I70A 1YJ93 3EBTA 6STDA 2CFDA 3OWSA 1W2ZA 1ULIB 4IPBA 3UL6A 1FZUA 1BRNL 1A2VA 1W7CA 3DY5A 4HM8B 2HMMB 4CDLA 5IG0A 1B21A 1LOVA 1UUGB 2A15A 4J5KA 1RLSA 1BUQA 8CHOA 1YJW3 3S67A 1M1K4 1JBSA 3JUQA 3NV0B 2GSPA 1I8VA 4N6LA 1UCJA 3HI7A 4TX4A 1IU7A 1OGXA 1VQ93 3NXJA 2W0QA 4KVHA 2CG0A 2D1WA 1OHOA 1DETA 3M8CA 1CYVA 3AGOA 3LOYA 3GSPA 3X40A 3ECFA 1BSAA 2E2VA 2F5WA 1QMAA 5EQLA 3CCJ3 1OF5A 4K90B 2SARA 1RRLA 3ALAA 1KD14 3JVCA 5HGRA 2FXTA 3DZLA 2QGUA 3VF1A 2XFTA 1M1XB 3SXXA 3LXUX 1W02A 2Z76A 5ELJA 5A0OB 1B3SA 1Q824 1IV9A 1BRIA 3CCS3 1QVF2 3SYUA 3T8NA 1S5AA 3JUPA 2HMKB 4OUQA 1WMNA 4X2OA 1RGGA 3Q90A 4BU4A 7STDA 4N6OB 3EQQB 3K7CA 6RNTA 2K0MA 3G6E3 1KC84 1OPYA 2IYJA 1VZZA 2YX9A 3AMOB 1AV4A 3STDA 3KSED 3Q2PA 4MMXB 1VQK3 3DM8A 3G0KA 4HJLB 3PCSA 2ZDJA 2INXA 4RBNA 1CEWI 1IV7A 3DUKA 4XBTA 2HMNB 2KF6A 1LOYA 3AGNA 2LYXA 4WFOA 1QAFA 1AVLA 3I563 3PGBA 3CCL3 3ZFZA 1FGTA 3MWZA 4KFDA 4CPKA 2QEX3 4WP5A 1EQKA 1JBTA 3PCRA 3N8BA 3AHSA 3OWUA 1VQ43 4BTWA 1NU3A 1RGEA 2CFLA 2XR8B 2C10A 1TFKA 1BRHA 2BU4A 2MF7A 5RNTA 4K1VA 3LMLA 1N5PA 1JB4A 3WMDA 1RDSA 4O3VA 3V99A 1MWTA 1YI23 2PZVA 1YNVX 2CFGA 2GU3A 3DMCA 3LTBA 1NO3A 4FCJA 1N8R4 1WNHA 6GSPA 2ML5A 1O7NB 3OW22 1YVBI 2P38A 1W4NA 3NM2A 3D4AA 1RGHA 1WTHA 2UGIA 4LZIA 5D83A 4FMCA 3SEDA 3EN1B 3TDGA 2P05A 5IERA 1I2EA 5BXQA 3CCE3 2BMRB 3V98A 1RMSA 1A67A 1AY7A 2BNGA 7RNTA 3X42A 5M19A 2KF5A 1GOYA 4I4KA 1VQ53 2CIUA 4N3VA 1RGCA 4HAAA 2W03A 2W56A 4NHFA 4XBXA 5AYRB 3X3YA 3G4S3 5JPPA 3E99A 3UB1A 1JBRA 3BNDA 2H0HA 2O9UX 3H3HA 1DMMA 1DVCA 5LC7A 3F8HA 3CNMA 1FUWA 4QWTA 4OK0A 2D42A 1KSIA 2XF3A 3EJVA 3S27A 3CC23 1VQ83 4LGQA 3G8ZA 4N6UA 5KP3A 3CC73 2Q07A 3LTAA 1FGRA 1B2XA 4HZBB 4LMIA 4KFFA 1UW1A 2AADA 3PZWA 4EYCA 2Y74A 3SVAA 1Q864 3DGNA 1HYFA 1UI8A 3F40A 1I2GA 3H51A 1UCLA 1X1WA 4FMDA 3I0YA 3NX0A 2XEPA 2XSHB 2LQVA 4FCZA 1DE3A 1LNHA 1O7HB 1R4CA 3S5CA 1GY7A 2B1XB 3OX9A 1BSBA 4GSPA 4HM4B 1X1XA 1EUIC 2CG1A 4L8PA 2ZA4A 5LC6A 3LZAA 1Q9EA 2F86B 4BIRA 1BUJA 1CYUA 1IVXA 1JV2B 2BMQB 3FSDA 3MHEA 3B4OA 2CW9A 5M18A 4XBYA 4RNYA 5CF1A 1PU4A 1ROVA 3KZTA
chains in the Genus database with same CATH topology
1YVSA 7GSPA 1UCKA 1BSAA 1RN4A 2F5WA 1HZ1A 1FUSA 1MGWA 3BIRA 1RGFA 2SARA 1GOVA 3AHWA 1MGRA 1B20A 3DH2A 2RBIA 1T2IA 1YGWA 1B3SA 1BRIA 1RCLA 1RTUA 3SYUA 1BGSA 1I3FA 4BU4A 1BRJA 1RGGA 3D5GA 6RNTA 3Q3FA 3WHOA 2C4BA 1RNBA 3WR2A 1AQZA 1BNSA 2HOHA 1BRSA 5HOHA 2KF6A 1SARA 1X1UA 1LOYA 3AGNA 1ZGXA 2F56A 1T2HA 1I0XA 3GSPA 1RGAA 1IYYA 1RSNA 1G02A 1GMPA 3D5IA 1JBTA 1BSCA 3AHSA 1BIRA 1CH0A 2AAEA 1RGEA 1BRHA 2BU4A 3BU4A 5RNTA 1RDSA 3RNTA 1YNVX 1BSEA 1RN1A 6GSPA 1BANA 5BIRA 3HOHA 1I3IA 3D4AA 3KCHA 5GSPA 1BNIA 1BAOA 1RGHA 1FUTA 1GSPA 1TTOA 1RGKA 1TRQA 1I2FA 4HOHA 1I2EA 1B27A 1GOUA 9RNTA 1RMSA 1AY7A 1GMRA 7RNTA 1BNFA 1BNRA 1BNGA 1R4YA 2F5MA 1GOYA 2KF5A 3A5EA 1B2ZA 1BU4A 2KF4A 1B2SA 1LNIA 1BVIA 5BU4A 1RGCA 2RNTA 4HAAA 1JBRA 1BNJA 2BIRA 1LOWA 1B2MA 1BOXA 2F4YA 1LRAA 4RNTA 1I70A 3DGYA 1GMQA 2KAAA 1RNTA 4J5GA 1B2XA 1B2UA 1FZUA 1UCIA 2AADA 1RCKA 1BRNL 1RGLA 1B21A 1HYFA 1BRKA 1I2GA 1BNEA 1LOVA 1UCLA 1RLSA 1X1WA 4J5KA 8RNTA 1JBSA 1DE3A 2GSPA 1A2PA 1I8VA 1RHLA 1UCJA 1TRPA 1BSBA 4GSPA 1PY3A 1X1XA 1FYSA 1PYLA 2ZA4A 4BIRA 3URPA 1Q9EA 1BUJA 1C54A 1FW7A 1BSDA 2KF3A 1X1YA 1BRGA 1DETA 3AGOA 4GHOA 1I0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVS A;  7GSP A;  1UCK A;  1BSA A;  1RN4 A;  2F5W A;  1HZ1 A;  1FUS A;  1MGW A;  3BIR A;  1RGF A;  2SAR A;  1GOV A;  3AHW A;  1MGR A;  1B20 A;  3DH2 A;  2RBI A;  1T2I A;  1YGW A;  1B3S A;  1BRI A;  1RCL A;  1RTU A;  3SYU A;  1BGS A;  1I3F A;  4BU4 A;  1BRJ A;  1RGG A;  3D5G A;  6RNT A;  3Q3F A;  3WHO A;  2C4B A;  1RNB A;  3WR2 A;  1AQZ A;  1BNS A;  2HOH A;  1BRS A;  5HOH A;  2KF6 A;  1SAR A;  1X1U A;  1LOY A;  3AGN A;  1ZGX A;  2F56 A;  1T2H A;  1I0X A;  3GSP A;  1RGA A;  1IYY A;  1RSN A;  1G02 A;  1GMP A;  3D5I A;  1JBT A;  1BSC A;  3AHS A;  1BIR A;  1CH0 A;  2AAE A;  1RGE A;  1BRH A;  2BU4 A;  3BU4 A;  5RNT A;  1RDS A;  3RNT A;  1YNV X;  1BSE A;  1RN1 A;  6GSP A;  1BAN A;  5BIR A;  3HOH A;  1I3I A;  3D4A A;  3KCH A;  5GSP A;  1BNI A;  1BAO A;  1RGH A;  1FUT A;  1GSP A;  1TTO A;  1RGK A;  1TRQ A;  1I2F A;  4HOH A;  1I2E A;  1B27 A;  1GOU A;  9RNT A;  1RMS A;  1AY7 A;  1GMR A;  7RNT A;  1BNF A;  1BNR A;  1BNG A;  1R4Y A;  2F5M A;  1GOY A;  2KF5 A;  3A5E A;  1B2Z A;  1BU4 A;  2KF4 A;  1B2S A;  1LNI A;  1BVI A;  5BU4 A;  1RGC A;  2RNT A;  4HAA A;  1JBR A;  1BNJ A;  2BIR A;  1LOW A;  1B2M A;  1BOX A;  2F4Y A;  1LRA A;  4RNT A;  1I70 A;  3DGY A;  1GMQ A;  2KAA A;  1RNT A;  4J5G A;  1B2X A;  1B2U A;  1FZU A;  1UCI A;  2AAD A;  1RCK A;  1BRN L;  1RGL A;  1B21 A;  1HYF A;  1BRK A;  1I2G A;  1BNE A;  1LOV A;  1UCL A;  1RLS A;  1X1W A;  4J5K A;  8RNT A;  1JBS A;  1DE3 A;  2GSP A;  1A2P A;  1I8V A;  1RHL A;  1UCJ A;  1TRP A;  1BSB A;  4GSP A;  1PY3 A;  1X1X A;  1FYS A;  1PYL A;  2ZA4 A;  4BIR A;  3URP A;  1Q9E A;  1BUJ A;  1C54 A;  1FW7 A;  1BSD A;  2KF3 A;  1X1Y A;  1BRG A;  1DET A;  3AGO A;  4GHO A;  1I0V A; 
#chains in the Genus database with same CATH topology
 4AKY A;  1JKG A;  1OH0 A;  1V57 A;  3SOA A;  3BIR A;  1FA3 A;  4L8O A;  5FGO A;  3ROB A;  5CLK A;  4BTX A;  1OAC A;  2W9P A;  2W6J H;  2RGQ A;  3WOF B;  3LH4 A;  4NPB A;  1NNV A;  1VQM 3;  1NB5 I;  3J7Y d;  1Q81 4;  1RCL A;  2W04 A;  4BL3 A;  3B7C A;  1BGS A;  1JB2 A;  1NB3 I;  4IT7 A;  1QVG 2;  4R1K A;  2P0M A;  2CK3 H;  2RFR A;  3Q3F A;  4RZM A;  2YFL B;  1Q40 A;  1W6C A;  2C4B A;  2KCD A;  2ZHX B;  3EHC A;  3FCS B;  3IJE B;  3CC4 3;  1O7P B;  3WR2 A;  1RNB A;  2W9Q A;  3X3Z A;  1BRS A;  4HBR A;  1OHP A;  1X1U A;  3GWR A;  3MG1 A;  4FMB A;  2CWT A;  4H3U A;  4MMY B;  5IF6 A;  1CQS A;  1SIH A;  1ZGX A;  1EG9 B;  3DGO A;  2WGO A;  1YJN 3;  2IUK A;  3RDE A;  1RSN A;  3CPO A;  3FG3 A;  3L0R A;  1IK3 A;  4X2H A;  1T3B A;  1VQP 3;  3MKI A;  2E2U A;  1BSC A;  3K0Z A;  4PEJ A;  3ZG0 A;  1E3R A;  3BB9 A;  5BVB A;  1YHQ 3;  1W6Y A;  2MC8 A;  1CH0 A;  1OCV A;  1TFO A;  1JB5 A;  4EXR A;  1UGH I;  3EC9 A;  5ELU A;  3CXC 2;  3G71 3;  1UUW B;  5IW9 A;  3EE1 A;  1M9G A;  3BU4 A;  3F9S A;  2W2C A;  3ZG5 A;  3JUM A;  5FW5 A;  3UNL A;  1V58 A;  2R41 A;  4HM3 B;  3MYT A;  2IA7 A;  1BSE A;  3O8Y A;  2ML6 A;  2IUJ A;  4BTY A;  3MSO A;  3EBY A;  1FGM A;  2SBL A;  2IMJ A;  2W56 B;  1JN5 A;  3HOH A;  3KE7 A;  4XM4 A;  3KN4 A;  2CX0 A;  2OCT A;  3QRD A;  1LQG C;  1TP6 A;  1Q7H A;  4R80 A;  5AII A;  3BNE A;  4XB5 A;  1GYB A;  4WYK A;  1RGK A;  1LOX A;  2BO9 B;  1IVV A;  4CJN A;  1BNF A;  1BNG A;  2F5M A;  1PFP A;  1B2Z A;  1MOL A;  2CC3 A;  1RKY A;  1LNI A;  3WOD G;  5AIF A;  5G1K A;  1U5O A;  4XDW A;  3X3X A;  3EX9 A;  1ZS7 A;  3CD6 3;  2BT3 A;  5IG4 A;  1BNJ A;  1NDO B;  1LXE A;  1LOW A;  4IIA A;  1VQQ A;  3CPW 2;  4ILF A;  2RSX A;  1YIJ 3;  3NBJ A;  5STD A;  3PS8 A;  3OV4 A;  1BOX A;  3U97 A;  1QAL A;  2GXF A;  3IMA B;  3UL5 A;  1LRA A;  1LVN A;  3VGN A;  1MWU A;  3D79 A;  2YFI B;  3PXM A;  4O2H A;  4WWU C;  3FG1 A;  3I55 3;  3LYG A;  3B8L A;  4EC6 A;  1K41 A;  2GEX A;  3G16 A;  4ZM8 A;  5AEU B;  1RJO A;  1UCI A;  3LT8 A;  3FF0 A;  4HM5 B;  5EVH A;  3EB8 A;  1RGL A;  1DMN A;  2C11 A;  4GL6 A;  4HM2 B;  3CMA 3;  2JQ5 A;  3N9H A;  3RNT A;  1C7H A;  4AKZ A;  5M1A A;  4R9L A;  3RGA A;  1IQ8 A;  1JZD A;  4HM1 B;  1NWW A;  1G0T A;  1SII A;  1RHL A;  3CCM 3;  2QA4 3;  1TRP A;  5I97 A;  1PYL A;  1C54 A;  3IPT A;  1FW7 A;  3EF8 A;  8RNT A;  5G2G A;  1BSD A;  1QJG A;  2KF3 A;  2OWP A;  4HKV B;  3WOE B;  1Z1S A;  2E2T A;  3NBR A;  3UJM A;  2XGN A;  7GSP A;  3FF2 A;  4KT3 B;  4R9K A;  3FG4 A;  1HZ1 A;  1FUS A;  2GEY A;  3CCQ 3;  1RGF A;  1Q40 B;  3GZY B;  1MGR A;  1UGI A;  1B20 A;  3HK4 A;  3LT9 A;  2F99 A;  1GS3 A;  3SX1 A;  3DH2 A;  4EV2 A;  2Y73 A;  2RBI A;  3F14 A;  3FH1 A;  1VQ7 3;  1T2I A;  2FGT A;  1IQY A;  2HMO B;  4XDV A;  2PNC A;  3HX8 A;  1AR0 A;  1G96 A;  3CNX A;  1GD3 A;  1RTU A;  1K8A 4;  3S29 A;  1OF5 B;  2BHM A;  2P09 A;  1I3F A;  1BRJ A;  3D5G A;  1GY5 A;  1SPU A;  3HIG A;  4ORL A;  2OQE A;  1Y4K A;  1E3V A;  3JUN A;  5JPU A;  3OXA A;  1F8N A;  4EW5 A;  3FZW A;  4J9A A;  1IVU A;  5AIG A;  1AQZ A;  2HOH A;  5HOH A;  1SAR A;  4HM0 B;  2CX1 A;  3NM7 A;  4U13 A;  4L7K A;  2WO0 A;  2B24 B;  1IYY A;  2XGL A;  1TU5 A;  1RN7 A;  2YFJ B;  1VQO 3;  1Q7Y 4;  1E97 A;  3D5I A;  4KZ1 A;  3N54 B;  5CK6 A;  3CCR 3;  2OOV C;  1BIR A;  3CU3 A;  2AAE A;  2UUG C;  3CME 3;  2CWU A;  2XFS A;  1A2K A;  2XRX B;  4WYK B;  1IDP A;  4K61 A;  5KP4 A;  2KRT A;  5AIH A;  1K9M 4;  1MNL A;  4HM7 B;  1WQL B;  3B4P A;  1IT8 A;  2R4I A;  4FMA A;  1J2B A;  2CHC A;  2CWV A;  1ASK A;  2Z7A A;  1RN1 A;  1BAN A;  2FNQ A;  3FGY A;  1DMQ A;  5BIR A;  4HZ9 B;  4RNZ A;  4MMZ B;  3KCH A;  1BNI A;  1BAO A;  3RGR A;  2GBX B;  1VQN 3;  4HM6 B;  1S72 3;  2QIY A;  2M7O A;  1I2F A;  4HOH A;  5JBS A;  1N5H A;  3U1W A;  3GRD A;  2H0G A;  5DRE A;  1GMR A;  2HML B;  4LYL B;  5AYS C;  1VQL 3;  2OQE C;  2J8X B;  3FLJ A;  5AEW B;  1K73 4;  1KQS 2;  1W01 A;  3JUO A;  1B2S A;  3GZR A;  4DKI A;  5BU4 A;  3CCU 3;  5TGN A;  2RNT A;  3NQZ A;  1K28 A;  1A90 A;  4I5Q A;  2BIR A;  1KWI A;  1UUV B;  3X41 A;  2F4Y A;  5CF2 A;  3SOY A;  3DGY A;  1GMQ A;  2KAA A;  3NHX A;  2I9W A;  5IG3 A;  1AVK A;  1RNT A;  4J5G A;  1B2U A;  1RCK A;  2GU1 A;  3BNB A;  3MPH A;  3CCV 3;  2WGQ A;  2OTJ 3;  1Q42 A;  1ZO2 A;  1BRK A;  1BNE A;  4HYZ A;  4JF8 A;  1ZX2 A;  3F8X A;  1HU9 A;  4K1U A;  1IVW A;  1US1 A;  1A2P A;  4BL2 A;  1EKM A;  1PY3 A;  2CH9 A;  1FYS A;  3URP A;  1N9E A;  1X1Y A;  1BRG A;  1W6G A;  3S28 A;  3WDG B;  2XH9 A;  4GHO A;  4N6N B;  1JNQ A;  2P0X A;  4HVN A;  1YVS A;  4O8S A;  1MWS A;  4R4K A;  4STD A;  3K9M C;  2UX0 A;  1UCK A;  1HKX A;  3NUV A;  1RN4 A;  3NV0 A;  4NRE A;  4Q53 A;  1QAK A;  5AI1 A;  2RCD A;  1FGO A;  1JRQ A;  1MGW A;  1OGZ A;  4AEQ A;  3MG3 A;  1GOV A;  3AHW A;  1IT7 A;  1TUH A;  2CKF B;  1DYU A;  4N6T A;  3WA2 X;  1VQ6 3;  1M90 4;  3QK9 A;  1YGW A;  1JKG B;  1V74 A;  1T5Y A;  5D81 A;  2H0I A;  1O7W B;  3LTC A;  1O7M B;  1N8Q A;  4JRF A;  3DGL A;  3ER7 A;  1ULJ B;  2OOV A;  1D6Z A;  4LSO A;  1D6U A;  1JJ2 2;  2WOH A;  1I0V A;  1SQW A;  3WHO A;  1NJI 4;  1SJW A;  2K3D A;  3DXO A;  3FKA A;  5IEP A;  4OVM A;  1BNS A;  1ROA A;  3HZP A;  1W5Z A;  2HMJ B;  2L4V A;  3KSP A;  1DVD A;  3GZB A;  3K63 A;  1ISK A;  2V1L A;  2F56 A;  1UDI I;  4WHA A;  1T2H A;  1STF I;  1I0X A;  1TIJ A;  3EN8 A;  1RGA A;  3KII A;  4MEI A;  1WMO A;  5D82 A;  3V92 A;  2Z6B A;  1G02 A;  2BMO B;  1GMP A;  3MG2 A;  3A76 A;  5DRV A;  5CXO A;  2GBW B;  3AMO A;  3Q1C A;  5G1L A;  3OWY A;  3T8U A;  2F98 A;  4GB5 A;  4EBG A;  4FCM A;  1OUN A;  5KP1 A;  2L1S A;  4CCV A;  1JZO A;  3LTD A;  4H61 A;  3NQY A;  2Z77 A;  3SLU A;  4G1M B;  1W00 A;  1STD A;  3BNC A;  2XSO B;  3KKG A;  2JDI H;  1YIT 3;  1I3I A;  1TJD A;  4O02 B;  3KFQ C;  5GSP A;  4KFE A;  2K54 A;  3VSY A;  1UI7 A;  1FUT A;  1GSP A;  1TTO A;  2WOF A;  2IY2 A;  1MWR A;  3F7S A;  2KXG A;  1TRQ A;  3GAX A;  3HII A;  1O7G B;  2CFW A;  1B27 A;  1GOU A;  4J8T A;  3NBB A;  4N6V 0;  9RNT A;  1IQX A;  2CFK A;  5IG5 A;  2O3O A;  2OTL 3;  4MJD A;  3GZX B;  5IEN A;  3DGM A;  1BNR A;  1R4Y A;  1EEJ A;  1JN5 B;  1EA2 A;  3A5E A;  3F7X A;  1N9J A;  3K5T A;  4FR9 A;  1GD4 A;  1BU4 A;  1GY6 A;  2KF4 A;  4N6M A;  5IEO A;  2STD A;  1BVI A;  2ZL8 A;  1W2B 2;  3D3L A;  3D9R A;  1L5G B;  1OHS A;  1WMP A;  1U8C B;  3T0U A;  1YGE A;  4LEH A;  1B2M A;  1RRH A;  3WA3 A;  3BLZ A;  1D6Y A;  1LQM B;  1FGQ A;  4RNT A;  5EEO A;  3PYJ A;  4EV5 A;  1I70 A;  1YJ9 3;  3EBT A;  6STD A;  2CFD A;  3OWS A;  1W2Z A;  1ULI B;  4IPB A;  3UL6 A;  1FZU A;  1BRN L;  1A2V A;  1W7C A;  3DY5 A;  4HM8 B;  2HMM B;  4CDL A;  5IG0 A;  1B21 A;  1LOV A;  1UUG B;  2A15 A;  4J5K A;  1RLS A;  1BUQ A;  8CHO A;  1YJW 3;  3S67 A;  1M1K 4;  1JBS A;  3JUQ A;  3NV0 B;  2GSP A;  1I8V A;  4N6L A;  1UCJ A;  3HI7 A;  4TX4 A;  1IU7 A;  1OGX A;  1VQ9 3;  3NXJ A;  2W0Q A;  4KVH A;  2CG0 A;  2D1W A;  1OHO A;  1DET A;  3M8C A;  1CYV A;  3AGO A;  3LOY A;  3GSP A;  3X40 A;  3ECF A;  1BSA A;  2E2V A;  2F5W A;  1QMA A;  5EQL A;  3CCJ 3;  1OF5 A;  4K90 B;  2SAR A;  1RRL A;  3ALA A;  1KD1 4;  3JVC A;  5HGR A;  2FXT A;  3DZL A;  2QGU A;  3VF1 A;  2XFT A;  1M1X B;  3SXX A;  3LXU X;  1W02 A;  2Z76 A;  5ELJ A;  5A0O B;  1B3S A;  1Q82 4;  1IV9 A;  1BRI A;  3CCS 3;  1QVF 2;  3SYU A;  3T8N A;  1S5A A;  3JUP A;  2HMK B;  4OUQ A;  1WMN A;  4X2O A;  1RGG A;  3Q90 A;  4BU4 A;  7STD A;  4N6O B;  3EQQ B;  3K7C A;  6RNT A;  2K0M A;  3G6E 3;  1KC8 4;  1OPY A;  2IYJ A;  1VZZ A;  2YX9 A;  3AMO B;  1AV4 A;  3STD A;  3KSE D;  3Q2P A;  4MMX B;  1VQK 3;  3DM8 A;  3G0K A;  4HJL B;  3PCS A;  2ZDJ A;  2INX A;  4RBN A;  1CEW I;  1IV7 A;  3DUK A;  4XBT A;  2HMN B;  2KF6 A;  1LOY A;  3AGN A;  2LYX A;  4WFO A;  1QAF A;  1AVL A;  3I56 3;  3PGB A;  3CCL 3;  3ZFZ A;  1FGT A;  3MWZ A;  4KFD A;  4CPK A;  2QEX 3;  4WP5 A;  1EQK A;  1JBT A;  3PCR A;  3N8B A;  3AHS A;  3OWU A;  1VQ4 3;  4BTW A;  1NU3 A;  1RGE A;  2CFL A;  2XR8 B;  2C10 A;  1TFK A;  1BRH A;  2BU4 A;  2MF7 A;  5RNT A;  4K1V A;  3LML A;  1N5P A;  1JB4 A;  3WMD A;  1RDS A;  4O3V A;  3V99 A;  1MWT A;  1YI2 3;  2PZV A;  1YNV X;  2CFG A;  2GU3 A;  3DMC A;  3LTB A;  1NO3 A;  4FCJ A;  1N8R 4;  1WNH A;  6GSP A;  2ML5 A;  1O7N B;  3OW2 2;  1YVB I;  2P38 A;  1W4N A;  3NM2 A;  3D4A A;  1RGH A;  1WTH A;  2UGI A;  4LZI A;  5D83 A;  4FMC A;  3SED A;  3EN1 B;  3TDG A;  2P05 A;  5IER A;  1I2E A;  5BXQ A;  3CCE 3;  2BMR B;  3V98 A;  1RMS A;  1A67 A;  1AY7 A;  2BNG A;  7RNT A;  3X42 A;  5M19 A;  2KF5 A;  1GOY A;  4I4K A;  1VQ5 3;  2CIU A;  4N3V A;  1RGC A;  4HAA A;  2W03 A;  2W56 A;  4NHF A;  4XBX A;  5AYR B;  3X3Y A;  3G4S 3;  5JPP A;  3E99 A;  3UB1 A;  1JBR A;  3BND A;  2H0H A;  2O9U X;  3H3H A;  1DMM A;  1DVC A;  5LC7 A;  3F8H A;  3CNM A;  1FUW A;  4QWT A;  4OK0 A;  2D42 A;  1KSI A;  2XF3 A;  3EJV A;  3S27 A;  3CC2 3;  1VQ8 3;  4LGQ A;  3G8Z A;  4N6U A;  5KP3 A;  3CC7 3;  2Q07 A;  3LTA A;  1FGR A;  1B2X A;  4HZB B;  4LMI A;  4KFF A;  1UW1 A;  2AAD A;  3PZW A;  4EYC A;  2Y74 A;  3SVA A;  1Q86 4;  3DGN A;  1HYF A;  1UI8 A;  3F40 A;  1I2G A;  3H51 A;  1UCL A;  1X1W A;  4FMD A;  3I0Y A;  3NX0 A;  2XEP A;  2XSH B;  2LQV A;  4FCZ A;  1DE3 A;  1LNH A;  1O7H B;  1R4C A;  3S5C A;  1GY7 A;  2B1X B;  3OX9 A;  1BSB A;  4GSP A;  4HM4 B;  1X1X A;  1EUI C;  2CG1 A;  4L8P A;  2ZA4 A;  5LC6 A;  3LZA A;  1Q9E A;  2F86 B;  4BIR A;  1BUJ A;  1CYU A;  1IVX A;  1JV2 B;  2BMQ B;  3FSD A;  3MHE A;  3B4O A;  2CW9 A;  5M18 A;  4XBY A;  4RNY A;  5CF1 A;  1PU4 A;  1ROV A;  3KZT A; 
#chains in the Genus database with same CATH homology
 1YVS A;  7GSP A;  1UCK A;  1BSA A;  1RN4 A;  2F5W A;  1HZ1 A;  1FUS A;  1MGW A;  3BIR A;  1RGF A;  2SAR A;  1GOV A;  3AHW A;  1MGR A;  1B20 A;  3DH2 A;  2RBI A;  1T2I A;  1YGW A;  1B3S A;  1BRI A;  1RCL A;  1RTU A;  3SYU A;  1BGS A;  1I3F A;  4BU4 A;  1BRJ A;  1RGG A;  3D5G A;  6RNT A;  3Q3F A;  3WHO A;  2C4B A;  1RNB A;  3WR2 A;  1AQZ A;  1BNS A;  2HOH A;  1BRS A;  5HOH A;  2KF6 A;  1SAR A;  1X1U A;  1LOY A;  3AGN A;  1ZGX A;  2F56 A;  1T2H A;  1I0X A;  3GSP A;  1RGA A;  1IYY A;  1RSN A;  1G02 A;  1GMP A;  3D5I A;  1JBT A;  1BSC A;  3AHS A;  1BIR A;  1CH0 A;  2AAE A;  1RGE A;  1BRH A;  2BU4 A;  3BU4 A;  5RNT A;  1RDS A;  3RNT A;  1YNV X;  1BSE A;  1RN1 A;  6GSP A;  1BAN A;  5BIR A;  3HOH A;  1I3I A;  3D4A A;  3KCH A;  5GSP A;  1BNI A;  1BAO A;  1RGH A;  1FUT A;  1GSP A;  1TTO A;  1RGK A;  1TRQ A;  1I2F A;  4HOH A;  1I2E A;  1B27 A;  1GOU A;  9RNT A;  1RMS A;  1AY7 A;  1GMR A;  7RNT A;  1BNF A;  1BNR A;  1BNG A;  1R4Y A;  2F5M A;  1GOY A;  2KF5 A;  3A5E A;  1B2Z A;  1BU4 A;  2KF4 A;  1B2S A;  1LNI A;  1BVI A;  5BU4 A;  1RGC A;  2RNT A;  4HAA A;  1JBR A;  1BNJ A;  2BIR A;  1LOW A;  1B2M A;  1BOX A;  2F4Y A;  1LRA A;  4RNT A;  1I70 A;  3DGY A;  1GMQ A;  2KAA A;  1RNT A;  4J5G A;  1B2X A;  1B2U A;  1FZU A;  1UCI A;  2AAD A;  1RCK A;  1BRN L;  1RGL A;  1B21 A;  1HYF A;  1BRK A;  1I2G A;  1BNE A;  1LOV A;  1UCL A;  1RLS A;  1X1W A;  4J5K A;  8RNT A;  1JBS A;  1DE3 A;  2GSP A;  1A2P A;  1I8V A;  1RHL A;  1UCJ A;  1TRP A;  1BSB A;  4GSP A;  1PY3 A;  1X1X A;  1FYS A;  1PYL A;  2ZA4 A;  4BIR A;  3URP A;  1Q9E A;  1BUJ A;  1C54 A;  1FW7 A;  1BSD A;  2KF3 A;  1X1Y A;  1BRG A;  1DET A;  3AGO A;  4GHO A;  1I0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...