3GSPA

Ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 4 days
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 3gspA00
4J5GA 1I70A 1I2FA 1B27A 3D5IA 1I8VA 1X1UA 1RGCA 2F5WA 5BIRA 1DETA 2RBIA 5RNTA 1RGLA 2AADA 1GOUA 1BANA 1MGRA 1MGWA 2F56A 1BGSA 1X1XA 3WR2A 4GHOA 1HZ1A 1FZUA 1FUSA 1PY3A 1SARA 1B21A 2ZA4A 1C54A 1RGEA 1GMRA 1JBRA 1I2GA 2C4BA 3DH2A 3GSPA 1BRKA 4BIRA 1DE3A 1GMPA 1GMQA 2KF4A 1B2XA 1BVIA 2KF3A 1B2ZA 1BRIA 1YGWA 3AHSA 1BRSA 1LOVA 1PYLA 1TTOA 1YNVX 3BIRA 1BNRA 5HOHA 1TRQA 1GOYA 1B2MA 1LOYA 1RGKA 1BU4A 3D5GA 1JBTA 1YVSA 3KCHA 1RTUA 1BRNL 1X1YA 1LRAA 1AY7A 1RGHA 8RNTA 1RGFA 1T2HA 1RGGA 4J5KA 1IYYA 1UCIA 4RNTA 4HAAA 1BNFA 1LOWA 3RNTA 1I2EA 2KF5A 1UCJA 1B2SA 3HOHA 2KF6A 3A5EA 3DGYA 4HOHA 2F4YA 2SARA 1BNGA 1BNJA 1G02A 7GSPA 1BRGA 1RLSA 1BNEA 2BU4A 3D4AA 4GSPA 2GSPA 1UCKA 1LNIA 1BIRA 3AGOA 1ZGXA 1T2IA 1RSNA 1FYSA 1RCLA 1RMSA 1CH0A 1BSEA 1I0VA 1BOXA 9RNTA 3AHWA 1UCLA 2BIRA 7RNTA 1JBSA 1BSBA 3Q3FA 5GSPA 1BNSA 1BRJA 1HYFA 1BNIA 1I0XA 3AGNA 1BSAA 3SYUA 1I3FA 1FUTA 3WHOA 2AAEA 1R4YA 1TRPA 1BAOA 1BUJA 2RNTA 1BSDA 1A2PA 3URPA 2KAAA 1RCKA 1B2UA 1GSPA 1RGAA 1BRHA 1X1WA 3BU4A 1RN4A 2HOHA 1RHLA 1FW7A 1RN1A 2F5MA 6RNTA 5BU4A 1B3SA 1RNTA 1B20A 1AQZA 4BU4A 1GOVA 1RDSA 6GSPA 1I3IA 1RNBA 1Q9EA 1BSCA
chains in the Genus database with same CATH superfamily
2H0HA 5IEOA 1AVLA 1W02A 2IA7A 1DETA 2ZDJA 1JN5A 1KSIA 2IMJA 2RBIA 4HM8B 4O8SA 3DM8A 2AADA 1GOUA 3F8XA 1PFPA 2M7OA 1BANA 2XR8B 3NHXA 4R9KA 3TDGA 1YI23 3HIIA 1D6ZA 1MGWA 1O7PB 1IV9A 2Z76A 5TGNA 2GEXA 3D9RA 3AMOB 3DUKA 4I4KA 1C54A 4STDA 3LXUX 1K9M4 2L4VA 2UX0A 2IYJA 1I2GA 1O7GB 4K90B 2C4BA 1Q7HA 3OWSA 1DE3A 4BIRA 2E2UA 1GMPA 1JZDA 2KF4A 4FCMA 2Y73A 4MMYB 1A90A 3CMA3 3LTCA 1VQQA 1BRIA 3H3HA 2YFJB 3ZG0A 5IEPA 1RN7A 2I9WA 1BRSA 1LOVA 1PYLA 1TTOA 3JUOA 3BNDA 4R9LA 3LMLA 5LC6A 5HOHA 1VQ63 2CK3H 3NQYA 3LOYA 1N8R4 1NU3A 5IF6A 2W0QA 3UJMA 1X1YA 1M9GA 4LGQA 3ZFZA 2GU1A 1EG9B 1RNBA 4RNTA 2RSXA 3Q90A 3CME3 3SOYA 2OQEC 1GY5A 1ZO2A 1LOWA 3PZWA 2BHMA 4N6MA 4KFDA 3G4S3 2WOHA 4WWUC 5D81A 3F40A 3GZYB 3STDA 5IENA 3CNMA 1WTHA 1BNGA 2D1WA 4RNYA 3T8NA 1LOXA 7GSPA 1BRGA 1IVUA 1DMQA 1BNEA 2ZHXB 4FCJA 4OK0A 4CDLA 1ROVA 5IG4A 4LMIA 5D83A 3CXC2 8CHOA 3EJVA 1LNIA 1L5GB 4EBGA 3AGOA 3DMCA 3FH1A 1VQ53 3S27A 1RSNA 4KVHA 5M18A 4WYKA 1JB4A 4CPKA 2F98A 3EHCA 1CH0A 3T8UA 1GS3A 2CW9A 2O3OA 1O7NB 3AHWA 3NBBA 1UCLA 2BIRA 3OW22 4L7KA 1M1XB 1BSBA 4HM0B 4Q53A 3UNLA 2A15A 2JQ5A 1GD3A 3EB8A 4NREA 2BMQB 3AGNA 1N8QA 3JVCA 4CCVA 1CEWI 2XSOB 2RGQA 4HM2B 1JZOA 1Q40A 1KWIA 1VQP3 3MG2A 1TRPA 1OF5B 1LVNA 2CWUA 1BSDA 1A2PA 2K54A 2OOVC 3SX1A 3CD63 1SJWA 4XDWA 4LZIA 1YIJ3 1RCKA 3I563 1BRHA 1DVCA 1Q42A 2LQVA 1IVWA 4BL3A 3B4OA 4FMAA 1RN4A 2HOHA 2FNQA 1RN1A 3VGNA 1C7HA 2F5MA 3CCE3 3FG4A 1V57A 1SPUA 3KN4A 3WOFB 2GU3A 3MKIA 1TJDA 1W2ZA 1RDSA 1IQXA 2WGQA 2P09A 3KKGA 1VQK3 3OX9A 1OHSA 3MSOA 3V99A 1VQ83 5JBSA 1K734 3CCJ3 1GD4A 1N5HA 1SIIA 1TFOA 1UUGB 4J5GA 4CJNA 2CX1A 4JRFA 1US1A 3ROBA 3BNCA 3VF1A 3EQQB 1JKGB 1RRHA 1MNLA 2F5WA 3DGOA 4O02B 5BIRA 1W2B2 1UW1A 2XFSA 3IMAB 5EVHA 1KC84 1IU7A 1V58A 3AMOA 3FSDA 4N6V0 1MGRA 5AIIA 1STDA 5STDA 2OQEA 3PCRA 1YHQ3 2F56A 2W2CA 2W9PA 3GRDA 1LNHA 1IQ8A 2YX9A 3D79A 2XRXB 3F14A 1HZ1A 1PY3A 2XFTA 3GZBA 2XGNA 2MC8A 1ZS7A 2MF7A 3D3LA 3PGBA 4IIAA 1W7CA 4N6TA 1JBRA 1ISKA 3N9HA 3DH2A 3JUQA 2ML6A 1WMOA 3NUVA 3S29A 3EBTA 1NWWA 3MG3A 4ILFA 4IPBA 4L8PA 5AEWB 5JPUA 1LQMB 1YGWA 3AHSA 3KE7A 3HZPA 3LH4A 4HM3B 1D6UA 4ZM8A 3BIRA 4N6NB 1WQLB 4LSOA 1QJGA 2R41A 1YGEA 3WA2X 1MWTA 5AIHA 5G1KA 1LOYA 3ZG5A 3CC43 3MYTA 1NO3A 2HMNB 4HJLB 3CU3A 2KXGA 1YVSA 2F99A 3KCHA 2W6JH 1LRAA 1AY7A 3E99A 1T2HA 1RGGA 3FCSB 1OGXA 1IT7A 4J5KA 4J9AA 3GAXA 3H51A 3LZAA 4KFFA 1IDPA 6STDA 1UUVB 2OTL3 1DMNA 4KFEA 5FGOA 3HIGA 5IG0A 5CLKA 5G2GA 1GY7A 3N8BA 3CC23 3A5EA 3NX0A 1UUWB 4FMBA 3I0YA 4HOHA 1TUHA 2CG1A 3U97A 2BO9B 5AYRB 1BNJA 1YVBI 2OOVA 5CF1A 3DXOA 3BNBA 1G02A 1A2KA 2XF3A 4FMDA 2SBLA 3LTAA 2BU4A 1VQL3 3PYJA 2CFWA 3X3YA 4HZBB 2WO0A 3RGAA 3LYGA 3DGMA 4EXRA 1GYBA 1OGZA 2BMRB 4G1MB 2QIYA 1CYUA 2JDIH 1RCLA 4LYLB 1RRLA 1BSEA 2F86B 2STDA 3HK4A 1I0VA 3Q1CA 3WOEB 4N6UA 1JRQA 3I553 3Q2PA 3FG3A 4L8OA 7RNTA 2BT3A 4O2HA 3LT9A 3F9SA 3Q3FA 2Z77A 1BNSA 4BL2A 1HYFA 1BNIA 4TX4A 1OF5A 1VZZA 3LTBA 1FUTA 2H0GA 3VSYA 4HYZA 2FGTA 4HM7B 3JUNA 4HKVB 1UGHI 1HU9A 1BAOA 4H3UA 5G1LA 1QVG2 1K41A 4EV5A 1B2UA 1GSPA 2RFRA 3EX9A 3KFQC 2ML5A 2W04A 2CG0A 2W56B 1U8CB 3K7CA 5JPPA 3LT8A 1FW7A 1RHLA 4HM1B 3CCQ3 4O3VA 2RCDA 5IG3A 6RNTA 3G6E3 1RNTA 1B20A 2YFLB 3NQZA 3EBYA 4NHFA 3EN8A 2J8XB 1FGQA 1E3RA 1O7WB 3B4PA 2GBXB 4K1UA 1JKGA 1E97A 3D5IA 4MMXB 2P0MA 3LTDA 3X3XA 1I70A 3FZWA 3U1WA 3CCL3 1VQ73 2P05A 1B27A 2E2TA 2HMLB 4N3VA 1A2VA 2O9UX 4NPBA 2CC3A 1ULIB 2IUJA 1KQS2 3EF8A 1X1UA 1RGCA 4RZMA 4HVNA 5CK6A 5EEOA 1ZX2A 4U13A 2KCDA 5RNTA 2HMMB 3OXAA 5BVBA 3BLZA 1TU5A 2XH9A 4MMZB 3F7SA 7STDA 3HI7A 1BGSA 1IT8A 1N9JA 1S5AA 2FXTA 3PXMA 2IY2A 4HM4B 3RGRA 1Q824 2ZA4A 1EUIC 1GMRA 1M1K4 1NB5I 5EQLA 1ASKA 2Z6BA 1NJI4 1BRKA 3BB9A 5KP1A 3FF2A 3CCS3 1K8A4 1J2BA 5DREA 1GMQA 1Q814 4BTWA 1B2XA 1IVVA 1NDOB 2Q07A 5BXQA 3QRDA 1FUWA 2KF3A 3CC73 2UGIA 4EV2A 1AR0A 2LYXA 2V1LA 3MHEA 2CIUA 1BNRA 3NBRA 4FR9A 4HZ9B 1TRQA 1OHOA 3F7XA 5D82A 1RGKA 1V74A 1BU4A 3D5GA 1JBTA 1JJ22 1BRNL 2W9QA 4XDVA 2ZL8A 1RGHA 1F8NA 1RGFA 1E3VA 1UCIA 2CX0A 1BNFA 5IERA 2KF5A 1EKMA 3MG1A 2CFKA 1B2SA 2HMKB 3M8CA 3DGYA 3L0RA 1OUNA 2B1XB 2F4YA 3UB1A 3ER7A 2SARA 1M904 3NV0A 1BUQA 4RNZA 2C10A 3B7CA 5M1AA 4EW5A 4H61A 4FCZA 5FW5A 1HKXA 3EE1A 1MWUA 3D4AA 1Y4KA 2OTJ3 2GSPA 1UCKA 4I5QA 3DGNA 3JUPA 4IT7A 3K0ZA 3SEDA 4RBNA 5AIGA 3WMDA 4X2HA 2PZVA 1EQKA 1ZGXA 3T0UA 1JV2B 1UI7A 1IK3A 1ROAA 3CCV3 1YIT3 1RMSA 3PS8A 4HM6B 5ELUA 4DKIA 3OWUA 3G16A 4EC6A 1YJ93 1BOXA 1MWSA 9RNTA 3G8ZA 4N6LA 1WMNA 2CHCA 2XSHB 3V92A 5GSPA 1VQ43 1QVF2 1BRJA 3NBJA 5M19A 5DRVA 1I0XA 1MOLA 2XEPA 3CPW2 3X41A 1ULJB 3OV4A 1LXEA 1AV4A 4GL6A 1AVKA 3WHOA 2BNGA 2AAEA 4J8TA 2HMOB 3MPHA 1BUJA 2RNTA 3URPA 1NB3I 1QAKA 2HMJB 2W56A 2GXFA 3NV0B 1LQGC 3CCM3 3SVAA 1RGAA 4BTYA 1O7MB 3CCU3 4R80A 3KIIA 1EEJA 1X1WA 3BU4A 5AIFA 1R4CA 2BMOB 3RDEA 1O7HB 5ELJA 2Y74A 3WODG 4AEQA 2R4IA 3JUMA 1B3SA 1JNQA 5AI1A 3SOAA 1AQZA 3FG1A 4K1VA 4QWTA 1GOVA 1N5PA 2CWTA 1TP6A 2XGLA 3HX8A 1I3IA 1T5YA 1S723 1BSCA 3KSPA 1QAFA 1I2FA 1MWRA 4XBYA 3K63A 3N54B 4WP5A 1VQ93 1W00A 1I8VA 1W6YA 4MJDA 4R1KA 4JF8A 4R4KA 1DMMA 2P0XA 1RGLA 1W5ZA 1IVXA 1OPYA 1OCVA 1QMAA 3ALAA 4PEJA 2CFDA 2QA43 1JN5B 1X1XA 3WR2A 2Z7AA 4GHOA 3PCSA 1FZUA 1FUSA 2D42A 1SARA 3GZRA 1B21A 3MWZA 3S67A 3S5CA 1YJN3 1UDII 1RGEA 3EC9A 4ORLA 3IPTA 3UL6A 4MEIA 3GSPA 3QK9A 5I97A 5IW9A 2CFGA 5HGRA 2K3DA 1K28A 3X3ZA 1TIJA 1BVIA 2C11A 1B2ZA 2WOFA 3WDGB 5CXOA 3K5TA 2PNCA 3FGYA 3FKAA 1YNVX 3ECFA 2L1SA 1W6CA 3GZXB 1SQWA 1GOYA 1FGTA 1B2MA 4AKYA 1SIHA 1UI8A 1W4NA 4XBTA 3UL5A 2W03A 4KZ1A 3CNXA 1FGOA 1RTUA 2QGUA 3CCR3 8RNTA 5KP3A 1IYYA 1CYVA 3WA3A 1FGMA 4HAAA 2OWPA 4AKZA 1RKYA 3B8LA 3RNTA 1I2EA 1NNVA 1U5OA 1UCJA 2INXA 1OACA 3HOHA 1STFI 1OH0A 4OVMA 2KF6A 3GWRA 1VQO3 2IUKA 2CH9A 1G0TA 3BNEA 3OWYA 1VQN3 2QEX3 1IV7A 1WMPA 3DGLA 1W6GA 1EA2A 3A76A 2CFLA 3CPOA 1RLSA 4LEHA 5KP4A 1KD14 1PU4A 4GSPA 5AYSC 1JB5A 2UUGC 1DYUA 3SXXA 1FA3A 1IQYA 1BIRA 2GEYA 1T2IA 1A67A 1FYSA 1UGIA 2K0MA 4WFOA 4GB5A 4N6OB 3FLJA 3NXJA 5IG5A 3X40A 5AEUB 3X42A 1Q864 1JBSA 3G0KA 3F8HA 4WYKB 2CKFB 1D6YA 3IJEB 3DY5A 2GBWB 2CWVA 3KZTA 3NM2A 3G713 1BSAA 4XB5A 3SYUA 1I3FA 1TFKA 1CQSA 1FGRA 4HM5B 5LC7A 2YFIB 1R4YA 1GY6A 1Q7Y4 4XBXA 3O8YA 4X2OA 5CF2A 3S28A 4HBRA 2KRTA 2KAAA 3SLUA 1OHPA 2B24B 1W01A 2E2VA 3K9MC 4FMCA 1RJOA 4KT3B 1Q40B 1JB2A 3FF0A 3J7Yd 3V98A 1T3BA 1DVDA 3DZLA 4BTXA 4EYCA 2H0IA 1VQM3 1QALA 3NM7A 3EN1B 1YJW3 5BU4A 1Z1SA 1WNHA 1N9EA 5A0OB 4XM4A 4BU4A 2WGOA 4K61A 4OUQA 6GSPA 1G96A 3KSED 4WHAA 2P38A 1Q9EA 2OCTA
chains in the Genus database with same CATH topology
4J5GA 1I70A 1I2FA 1B27A 3D5IA 1I8VA 1X1UA 1RGCA 2F5WA 5BIRA 1DETA 2RBIA 5RNTA 1RGLA 2AADA 1GOUA 1BANA 1MGRA 1MGWA 2F56A 1BGSA 1X1XA 3WR2A 4GHOA 1HZ1A 1FZUA 1FUSA 1PY3A 1SARA 1B21A 2ZA4A 1C54A 1RGEA 1GMRA 1JBRA 1I2GA 2C4BA 3DH2A 3GSPA 1BRKA 4BIRA 1DE3A 1GMPA 1GMQA 2KF4A 1B2XA 1BVIA 2KF3A 1B2ZA 1BRIA 1YGWA 3AHSA 1BRSA 1LOVA 1PYLA 1TTOA 1YNVX 3BIRA 1BNRA 5HOHA 1TRQA 1GOYA 1B2MA 1LOYA 1RGKA 1BU4A 3D5GA 1JBTA 1YVSA 3KCHA 1RTUA 1BRNL 1X1YA 1LRAA 1AY7A 1RGHA 8RNTA 1RGFA 1T2HA 1RGGA 4J5KA 1IYYA 1UCIA 4RNTA 4HAAA 1BNFA 1LOWA 3RNTA 1I2EA 2KF5A 1UCJA 1B2SA 3HOHA 2KF6A 3A5EA 3DGYA 4HOHA 2F4YA 2SARA 1BNGA 1BNJA 1G02A 7GSPA 1BRGA 1RLSA 1BNEA 2BU4A 3D4AA 4GSPA 2GSPA 1UCKA 1LNIA 1BIRA 3AGOA 1ZGXA 1T2IA 1RSNA 1FYSA 1RCLA 1RMSA 1CH0A 1BSEA 1I0VA 1BOXA 9RNTA 3AHWA 1UCLA 2BIRA 7RNTA 1JBSA 1BSBA 3Q3FA 5GSPA 1BNSA 1BRJA 1HYFA 1BNIA 1I0XA 3AGNA 1BSAA 3SYUA 1I3FA 1FUTA 3WHOA 2AAEA 1R4YA 1TRPA 1BAOA 1BUJA 2RNTA 1BSDA 1A2PA 3URPA 2KAAA 1RCKA 1B2UA 1GSPA 1RGAA 1BRHA 1X1WA 3BU4A 1RN4A 2HOHA 1RHLA 1FW7A 1RN1A 2F5MA 6RNTA 5BU4A 1B3SA 1RNTA 1B20A 1AQZA 4BU4A 1GOVA 1RDSA 6GSPA 1I3IA 1RNBA 1Q9EA 1BSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5G A;  1I70 A;  1I2F A;  1B27 A;  3D5I A;  1I8V A;  1X1U A;  1RGC A;  2F5W A;  5BIR A;  1DET A;  2RBI A;  5RNT A;  1RGL A;  2AAD A;  1GOU A;  1BAN A;  1MGR A;  1MGW A;  2F56 A;  1BGS A;  1X1X A;  3WR2 A;  4GHO A;  1HZ1 A;  1FZU A;  1FUS A;  1PY3 A;  1SAR A;  1B21 A;  2ZA4 A;  1C54 A;  1RGE A;  1GMR A;  1JBR A;  1I2G A;  2C4B A;  3DH2 A;  3GSP A;  1BRK A;  4BIR A;  1DE3 A;  1GMP A;  1GMQ A;  2KF4 A;  1B2X A;  1BVI A;  2KF3 A;  1B2Z A;  1BRI A;  1YGW A;  3AHS A;  1BRS A;  1LOV A;  1PYL A;  1TTO A;  1YNV X;  3BIR A;  1BNR A;  5HOH A;  1TRQ A;  1GOY A;  1B2M A;  1LOY A;  1RGK A;  1BU4 A;  3D5G A;  1JBT A;  1YVS A;  3KCH A;  1RTU A;  1BRN L;  1X1Y A;  1LRA A;  1AY7 A;  1RGH A;  8RNT A;  1RGF A;  1T2H A;  1RGG A;  4J5K A;  1IYY A;  1UCI A;  4RNT A;  4HAA A;  1BNF A;  1LOW A;  3RNT A;  1I2E A;  2KF5 A;  1UCJ A;  1B2S A;  3HOH A;  2KF6 A;  3A5E A;  3DGY A;  4HOH A;  2F4Y A;  2SAR A;  1BNG A;  1BNJ A;  1G02 A;  7GSP A;  1BRG A;  1RLS A;  1BNE A;  2BU4 A;  3D4A A;  4GSP A;  2GSP A;  1UCK A;  1LNI A;  1BIR A;  3AGO A;  1ZGX A;  1T2I A;  1RSN A;  1FYS A;  1RCL A;  1RMS A;  1CH0 A;  1BSE A;  1I0V A;  1BOX A;  9RNT A;  3AHW A;  1UCL A;  2BIR A;  7RNT A;  1JBS A;  1BSB A;  3Q3F A;  5GSP A;  1BNS A;  1BRJ A;  1HYF A;  1BNI A;  1I0X A;  3AGN A;  1BSA A;  3SYU A;  1I3F A;  1FUT A;  3WHO A;  2AAE A;  1R4Y A;  1TRP A;  1BAO A;  1BUJ A;  2RNT A;  1BSD A;  1A2P A;  3URP A;  2KAA A;  1RCK A;  1B2U A;  1GSP A;  1RGA A;  1BRH A;  1X1W A;  3BU4 A;  1RN4 A;  2HOH A;  1RHL A;  1FW7 A;  1RN1 A;  2F5M A;  6RNT A;  5BU4 A;  1B3S A;  1RNT A;  1B20 A;  1AQZ A;  4BU4 A;  1GOV A;  1RDS A;  6GSP A;  1I3I A;  1RNB A;  1Q9E A;  1BSC A; 
#chains in the Genus database with same CATH topology
 2H0H A;  5IEO A;  1AVL A;  1W02 A;  2IA7 A;  1DET A;  2ZDJ A;  1JN5 A;  1KSI A;  2IMJ A;  2RBI A;  4HM8 B;  4O8S A;  3DM8 A;  2AAD A;  1GOU A;  3F8X A;  1PFP A;  2M7O A;  1BAN A;  2XR8 B;  3NHX A;  4R9K A;  3TDG A;  1YI2 3;  3HII A;  1D6Z A;  1MGW A;  1O7P B;  1IV9 A;  2Z76 A;  5TGN A;  2GEX A;  3D9R A;  3AMO B;  3DUK A;  4I4K A;  1C54 A;  4STD A;  3LXU X;  1K9M 4;  2L4V A;  2UX0 A;  2IYJ A;  1I2G A;  1O7G B;  4K90 B;  2C4B A;  1Q7H A;  3OWS A;  1DE3 A;  4BIR A;  2E2U A;  1GMP A;  1JZD A;  2KF4 A;  4FCM A;  2Y73 A;  4MMY B;  1A90 A;  3CMA 3;  3LTC A;  1VQQ A;  1BRI A;  3H3H A;  2YFJ B;  3ZG0 A;  5IEP A;  1RN7 A;  2I9W A;  1BRS A;  1LOV A;  1PYL A;  1TTO A;  3JUO A;  3BND A;  4R9L A;  3LML A;  5LC6 A;  5HOH A;  1VQ6 3;  2CK3 H;  3NQY A;  3LOY A;  1N8R 4;  1NU3 A;  5IF6 A;  2W0Q A;  3UJM A;  1X1Y A;  1M9G A;  4LGQ A;  3ZFZ A;  2GU1 A;  1EG9 B;  1RNB A;  4RNT A;  2RSX A;  3Q90 A;  3CME 3;  3SOY A;  2OQE C;  1GY5 A;  1ZO2 A;  1LOW A;  3PZW A;  2BHM A;  4N6M A;  4KFD A;  3G4S 3;  2WOH A;  4WWU C;  5D81 A;  3F40 A;  3GZY B;  3STD A;  5IEN A;  3CNM A;  1WTH A;  1BNG A;  2D1W A;  4RNY A;  3T8N A;  1LOX A;  7GSP A;  1BRG A;  1IVU A;  1DMQ A;  1BNE A;  2ZHX B;  4FCJ A;  4OK0 A;  4CDL A;  1ROV A;  5IG4 A;  4LMI A;  5D83 A;  3CXC 2;  8CHO A;  3EJV A;  1LNI A;  1L5G B;  4EBG A;  3AGO A;  3DMC A;  3FH1 A;  1VQ5 3;  3S27 A;  1RSN A;  4KVH A;  5M18 A;  4WYK A;  1JB4 A;  4CPK A;  2F98 A;  3EHC A;  1CH0 A;  3T8U A;  1GS3 A;  2CW9 A;  2O3O A;  1O7N B;  3AHW A;  3NBB A;  1UCL A;  2BIR A;  3OW2 2;  4L7K A;  1M1X B;  1BSB A;  4HM0 B;  4Q53 A;  3UNL A;  2A15 A;  2JQ5 A;  1GD3 A;  3EB8 A;  4NRE A;  2BMQ B;  3AGN A;  1N8Q A;  3JVC A;  4CCV A;  1CEW I;  2XSO B;  2RGQ A;  4HM2 B;  1JZO A;  1Q40 A;  1KWI A;  1VQP 3;  3MG2 A;  1TRP A;  1OF5 B;  1LVN A;  2CWU A;  1BSD A;  1A2P A;  2K54 A;  2OOV C;  3SX1 A;  3CD6 3;  1SJW A;  4XDW A;  4LZI A;  1YIJ 3;  1RCK A;  3I56 3;  1BRH A;  1DVC A;  1Q42 A;  2LQV A;  1IVW A;  4BL3 A;  3B4O A;  4FMA A;  1RN4 A;  2HOH A;  2FNQ A;  1RN1 A;  3VGN A;  1C7H A;  2F5M A;  3CCE 3;  3FG4 A;  1V57 A;  1SPU A;  3KN4 A;  3WOF B;  2GU3 A;  3MKI A;  1TJD A;  1W2Z A;  1RDS A;  1IQX A;  2WGQ A;  2P09 A;  3KKG A;  1VQK 3;  3OX9 A;  1OHS A;  3MSO A;  3V99 A;  1VQ8 3;  5JBS A;  1K73 4;  3CCJ 3;  1GD4 A;  1N5H A;  1SII A;  1TFO A;  1UUG B;  4J5G A;  4CJN A;  2CX1 A;  4JRF A;  1US1 A;  3ROB A;  3BNC A;  3VF1 A;  3EQQ B;  1JKG B;  1RRH A;  1MNL A;  2F5W A;  3DGO A;  4O02 B;  5BIR A;  1W2B 2;  1UW1 A;  2XFS A;  3IMA B;  5EVH A;  1KC8 4;  1IU7 A;  1V58 A;  3AMO A;  3FSD A;  4N6V 0;  1MGR A;  5AII A;  1STD A;  5STD A;  2OQE A;  3PCR A;  1YHQ 3;  2F56 A;  2W2C A;  2W9P A;  3GRD A;  1LNH A;  1IQ8 A;  2YX9 A;  3D79 A;  2XRX B;  3F14 A;  1HZ1 A;  1PY3 A;  2XFT A;  3GZB A;  2XGN A;  2MC8 A;  1ZS7 A;  2MF7 A;  3D3L A;  3PGB A;  4IIA A;  1W7C A;  4N6T A;  1JBR A;  1ISK A;  3N9H A;  3DH2 A;  3JUQ A;  2ML6 A;  1WMO A;  3NUV A;  3S29 A;  3EBT A;  1NWW A;  3MG3 A;  4ILF A;  4IPB A;  4L8P A;  5AEW B;  5JPU A;  1LQM B;  1YGW A;  3AHS A;  3KE7 A;  3HZP A;  3LH4 A;  4HM3 B;  1D6U A;  4ZM8 A;  3BIR A;  4N6N B;  1WQL B;  4LSO A;  1QJG A;  2R41 A;  1YGE A;  3WA2 X;  1MWT A;  5AIH A;  5G1K A;  1LOY A;  3ZG5 A;  3CC4 3;  3MYT A;  1NO3 A;  2HMN B;  4HJL B;  3CU3 A;  2KXG A;  1YVS A;  2F99 A;  3KCH A;  2W6J H;  1LRA A;  1AY7 A;  3E99 A;  1T2H A;  1RGG A;  3FCS B;  1OGX A;  1IT7 A;  4J5K A;  4J9A A;  3GAX A;  3H51 A;  3LZA A;  4KFF A;  1IDP A;  6STD A;  1UUV B;  2OTL 3;  1DMN A;  4KFE A;  5FGO A;  3HIG A;  5IG0 A;  5CLK A;  5G2G A;  1GY7 A;  3N8B A;  3CC2 3;  3A5E A;  3NX0 A;  1UUW B;  4FMB A;  3I0Y A;  4HOH A;  1TUH A;  2CG1 A;  3U97 A;  2BO9 B;  5AYR B;  1BNJ A;  1YVB I;  2OOV A;  5CF1 A;  3DXO A;  3BNB A;  1G02 A;  1A2K A;  2XF3 A;  4FMD A;  2SBL A;  3LTA A;  2BU4 A;  1VQL 3;  3PYJ A;  2CFW A;  3X3Y A;  4HZB B;  2WO0 A;  3RGA A;  3LYG A;  3DGM A;  4EXR A;  1GYB A;  1OGZ A;  2BMR B;  4G1M B;  2QIY A;  1CYU A;  2JDI H;  1RCL A;  4LYL B;  1RRL A;  1BSE A;  2F86 B;  2STD A;  3HK4 A;  1I0V A;  3Q1C A;  3WOE B;  4N6U A;  1JRQ A;  3I55 3;  3Q2P A;  3FG3 A;  4L8O A;  7RNT A;  2BT3 A;  4O2H A;  3LT9 A;  3F9S A;  3Q3F A;  2Z77 A;  1BNS A;  4BL2 A;  1HYF A;  1BNI A;  4TX4 A;  1OF5 A;  1VZZ A;  3LTB A;  1FUT A;  2H0G A;  3VSY A;  4HYZ A;  2FGT A;  4HM7 B;  3JUN A;  4HKV B;  1UGH I;  1HU9 A;  1BAO A;  4H3U A;  5G1L A;  1QVG 2;  1K41 A;  4EV5 A;  1B2U A;  1GSP A;  2RFR A;  3EX9 A;  3KFQ C;  2ML5 A;  2W04 A;  2CG0 A;  2W56 B;  1U8C B;  3K7C A;  5JPP A;  3LT8 A;  1FW7 A;  1RHL A;  4HM1 B;  3CCQ 3;  4O3V A;  2RCD A;  5IG3 A;  6RNT A;  3G6E 3;  1RNT A;  1B20 A;  2YFL B;  3NQZ A;  3EBY A;  4NHF A;  3EN8 A;  2J8X B;  1FGQ A;  1E3R A;  1O7W B;  3B4P A;  2GBX B;  4K1U A;  1JKG A;  1E97 A;  3D5I A;  4MMX B;  2P0M A;  3LTD A;  3X3X A;  1I70 A;  3FZW A;  3U1W A;  3CCL 3;  1VQ7 3;  2P05 A;  1B27 A;  2E2T A;  2HML B;  4N3V A;  1A2V A;  2O9U X;  4NPB A;  2CC3 A;  1ULI B;  2IUJ A;  1KQS 2;  3EF8 A;  1X1U A;  1RGC A;  4RZM A;  4HVN A;  5CK6 A;  5EEO A;  1ZX2 A;  4U13 A;  2KCD A;  5RNT A;  2HMM B;  3OXA A;  5BVB A;  3BLZ A;  1TU5 A;  2XH9 A;  4MMZ B;  3F7S A;  7STD A;  3HI7 A;  1BGS A;  1IT8 A;  1N9J A;  1S5A A;  2FXT A;  3PXM A;  2IY2 A;  4HM4 B;  3RGR A;  1Q82 4;  2ZA4 A;  1EUI C;  1GMR A;  1M1K 4;  1NB5 I;  5EQL A;  1ASK A;  2Z6B A;  1NJI 4;  1BRK A;  3BB9 A;  5KP1 A;  3FF2 A;  3CCS 3;  1K8A 4;  1J2B A;  5DRE A;  1GMQ A;  1Q81 4;  4BTW A;  1B2X A;  1IVV A;  1NDO B;  2Q07 A;  5BXQ A;  3QRD A;  1FUW A;  2KF3 A;  3CC7 3;  2UGI A;  4EV2 A;  1AR0 A;  2LYX A;  2V1L A;  3MHE A;  2CIU A;  1BNR A;  3NBR A;  4FR9 A;  4HZ9 B;  1TRQ A;  1OHO A;  3F7X A;  5D82 A;  1RGK A;  1V74 A;  1BU4 A;  3D5G A;  1JBT A;  1JJ2 2;  1BRN L;  2W9Q A;  4XDV A;  2ZL8 A;  1RGH A;  1F8N A;  1RGF A;  1E3V A;  1UCI A;  2CX0 A;  1BNF A;  5IER A;  2KF5 A;  1EKM A;  3MG1 A;  2CFK A;  1B2S A;  2HMK B;  3M8C A;  3DGY A;  3L0R A;  1OUN A;  2B1X B;  2F4Y A;  3UB1 A;  3ER7 A;  2SAR A;  1M90 4;  3NV0 A;  1BUQ A;  4RNZ A;  2C10 A;  3B7C A;  5M1A A;  4EW5 A;  4H61 A;  4FCZ A;  5FW5 A;  1HKX A;  3EE1 A;  1MWU A;  3D4A A;  1Y4K A;  2OTJ 3;  2GSP A;  1UCK A;  4I5Q A;  3DGN A;  3JUP A;  4IT7 A;  3K0Z A;  3SED A;  4RBN A;  5AIG A;  3WMD A;  4X2H A;  2PZV A;  1EQK A;  1ZGX A;  3T0U A;  1JV2 B;  1UI7 A;  1IK3 A;  1ROA A;  3CCV 3;  1YIT 3;  1RMS A;  3PS8 A;  4HM6 B;  5ELU A;  4DKI A;  3OWU A;  3G16 A;  4EC6 A;  1YJ9 3;  1BOX A;  1MWS A;  9RNT A;  3G8Z A;  4N6L A;  1WMN A;  2CHC A;  2XSH B;  3V92 A;  5GSP A;  1VQ4 3;  1QVF 2;  1BRJ A;  3NBJ A;  5M19 A;  5DRV A;  1I0X A;  1MOL A;  2XEP A;  3CPW 2;  3X41 A;  1ULJ B;  3OV4 A;  1LXE A;  1AV4 A;  4GL6 A;  1AVK A;  3WHO A;  2BNG A;  2AAE A;  4J8T A;  2HMO B;  3MPH A;  1BUJ A;  2RNT A;  3URP A;  1NB3 I;  1QAK A;  2HMJ B;  2W56 A;  2GXF A;  3NV0 B;  1LQG C;  3CCM 3;  3SVA A;  1RGA A;  4BTY A;  1O7M B;  3CCU 3;  4R80 A;  3KII A;  1EEJ A;  1X1W A;  3BU4 A;  5AIF A;  1R4C A;  2BMO B;  3RDE A;  1O7H B;  5ELJ A;  2Y74 A;  3WOD G;  4AEQ A;  2R4I A;  3JUM A;  1B3S A;  1JNQ A;  5AI1 A;  3SOA A;  1AQZ A;  3FG1 A;  4K1V A;  4QWT A;  1GOV A;  1N5P A;  2CWT A;  1TP6 A;  2XGL A;  3HX8 A;  1I3I A;  1T5Y A;  1S72 3;  1BSC A;  3KSP A;  1QAF A;  1I2F A;  1MWR A;  4XBY A;  3K63 A;  3N54 B;  4WP5 A;  1VQ9 3;  1W00 A;  1I8V A;  1W6Y A;  4MJD A;  4R1K A;  4JF8 A;  4R4K A;  1DMM A;  2P0X A;  1RGL A;  1W5Z A;  1IVX A;  1OPY A;  1OCV A;  1QMA A;  3ALA A;  4PEJ A;  2CFD A;  2QA4 3;  1JN5 B;  1X1X A;  3WR2 A;  2Z7A A;  4GHO A;  3PCS A;  1FZU A;  1FUS A;  2D42 A;  1SAR A;  3GZR A;  1B21 A;  3MWZ A;  3S67 A;  3S5C A;  1YJN 3;  1UDI I;  1RGE A;  3EC9 A;  4ORL A;  3IPT A;  3UL6 A;  4MEI A;  3GSP A;  3QK9 A;  5I97 A;  5IW9 A;  2CFG A;  5HGR A;  2K3D A;  1K28 A;  3X3Z A;  1TIJ A;  1BVI A;  2C11 A;  1B2Z A;  2WOF A;  3WDG B;  5CXO A;  3K5T A;  2PNC A;  3FGY A;  3FKA A;  1YNV X;  3ECF A;  2L1S A;  1W6C A;  3GZX B;  1SQW A;  1GOY A;  1FGT A;  1B2M A;  4AKY A;  1SIH A;  1UI8 A;  1W4N A;  4XBT A;  3UL5 A;  2W03 A;  4KZ1 A;  3CNX A;  1FGO A;  1RTU A;  2QGU A;  3CCR 3;  8RNT A;  5KP3 A;  1IYY A;  1CYV A;  3WA3 A;  1FGM A;  4HAA A;  2OWP A;  4AKZ A;  1RKY A;  3B8L A;  3RNT A;  1I2E A;  1NNV A;  1U5O A;  1UCJ A;  2INX A;  1OAC A;  3HOH A;  1STF I;  1OH0 A;  4OVM A;  2KF6 A;  3GWR A;  1VQO 3;  2IUK A;  2CH9 A;  1G0T A;  3BNE A;  3OWY A;  1VQN 3;  2QEX 3;  1IV7 A;  1WMP A;  3DGL A;  1W6G A;  1EA2 A;  3A76 A;  2CFL A;  3CPO A;  1RLS A;  4LEH A;  5KP4 A;  1KD1 4;  1PU4 A;  4GSP A;  5AYS C;  1JB5 A;  2UUG C;  1DYU A;  3SXX A;  1FA3 A;  1IQY A;  1BIR A;  2GEY A;  1T2I A;  1A67 A;  1FYS A;  1UGI A;  2K0M A;  4WFO A;  4GB5 A;  4N6O B;  3FLJ A;  3NXJ A;  5IG5 A;  3X40 A;  5AEU B;  3X42 A;  1Q86 4;  1JBS A;  3G0K A;  3F8H A;  4WYK B;  2CKF B;  1D6Y A;  3IJE B;  3DY5 A;  2GBW B;  2CWV A;  3KZT A;  3NM2 A;  3G71 3;  1BSA A;  4XB5 A;  3SYU A;  1I3F A;  1TFK A;  1CQS A;  1FGR A;  4HM5 B;  5LC7 A;  2YFI B;  1R4Y A;  1GY6 A;  1Q7Y 4;  4XBX A;  3O8Y A;  4X2O A;  5CF2 A;  3S28 A;  4HBR A;  2KRT A;  2KAA A;  3SLU A;  1OHP A;  2B24 B;  1W01 A;  2E2V A;  3K9M C;  4FMC A;  1RJO A;  4KT3 B;  1Q40 B;  1JB2 A;  3FF0 A;  3J7Y d;  3V98 A;  1T3B A;  1DVD A;  3DZL A;  4BTX A;  4EYC A;  2H0I A;  1VQM 3;  1QAL A;  3NM7 A;  3EN1 B;  1YJW 3;  5BU4 A;  1Z1S A;  1WNH A;  1N9E A;  5A0O B;  4XM4 A;  4BU4 A;  2WGO A;  4K61 A;  4OUQ A;  6GSP A;  1G96 A;  3KSE D;  4WHA A;  2P38 A;  1Q9E A;  2OCT A; 
#chains in the Genus database with same CATH homology
 4J5G A;  1I70 A;  1I2F A;  1B27 A;  3D5I A;  1I8V A;  1X1U A;  1RGC A;  2F5W A;  5BIR A;  1DET A;  2RBI A;  5RNT A;  1RGL A;  2AAD A;  1GOU A;  1BAN A;  1MGR A;  1MGW A;  2F56 A;  1BGS A;  1X1X A;  3WR2 A;  4GHO A;  1HZ1 A;  1FZU A;  1FUS A;  1PY3 A;  1SAR A;  1B21 A;  2ZA4 A;  1C54 A;  1RGE A;  1GMR A;  1JBR A;  1I2G A;  2C4B A;  3DH2 A;  3GSP A;  1BRK A;  4BIR A;  1DE3 A;  1GMP A;  1GMQ A;  2KF4 A;  1B2X A;  1BVI A;  2KF3 A;  1B2Z A;  1BRI A;  1YGW A;  3AHS A;  1BRS A;  1LOV A;  1PYL A;  1TTO A;  1YNV X;  3BIR A;  1BNR A;  5HOH A;  1TRQ A;  1GOY A;  1B2M A;  1LOY A;  1RGK A;  1BU4 A;  3D5G A;  1JBT A;  1YVS A;  3KCH A;  1RTU A;  1BRN L;  1X1Y A;  1LRA A;  1AY7 A;  1RGH A;  8RNT A;  1RGF A;  1T2H A;  1RGG A;  4J5K A;  1IYY A;  1UCI A;  4RNT A;  4HAA A;  1BNF A;  1LOW A;  3RNT A;  1I2E A;  2KF5 A;  1UCJ A;  1B2S A;  3HOH A;  2KF6 A;  3A5E A;  3DGY A;  4HOH A;  2F4Y A;  2SAR A;  1BNG A;  1BNJ A;  1G02 A;  7GSP A;  1BRG A;  1RLS A;  1BNE A;  2BU4 A;  3D4A A;  4GSP A;  2GSP A;  1UCK A;  1LNI A;  1BIR A;  3AGO A;  1ZGX A;  1T2I A;  1RSN A;  1FYS A;  1RCL A;  1RMS A;  1CH0 A;  1BSE A;  1I0V A;  1BOX A;  9RNT A;  3AHW A;  1UCL A;  2BIR A;  7RNT A;  1JBS A;  1BSB A;  3Q3F A;  5GSP A;  1BNS A;  1BRJ A;  1HYF A;  1BNI A;  1I0X A;  3AGN A;  1BSA A;  3SYU A;  1I3F A;  1FUT A;  3WHO A;  2AAE A;  1R4Y A;  1TRP A;  1BAO A;  1BUJ A;  2RNT A;  1BSD A;  1A2P A;  3URP A;  2KAA A;  1RCK A;  1B2U A;  1GSP A;  1RGA A;  1BRH A;  1X1W A;  3BU4 A;  1RN4 A;  2HOH A;  1RHL A;  1FW7 A;  1RN1 A;  2F5M A;  6RNT A;  5BU4 A;  1B3S A;  1RNT A;  1B20 A;  1AQZ A;  4BU4 A;  1GOV A;  1RDS A;  6GSP A;  1I3I A;  1RNB A;  1Q9E A;  1BSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...