1PY3A

Crystal structure of ribonuclease sa2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease
publication title Crystal structure reveals two alternative conformations in the active site of ribonuclease Sa2.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 21
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1py3A00
1FUSA 1BSEA 1LOYA 2KF4A 4BU4A 1PYLA 1JBRA 1B2MA 1I8VA 1HZ1A 2F56A 4GHOA 5GSPA 2AADA 1I0XA 1B3SA 2F4YA 1BRJA 1RGFA 1BRNL 2ZA4A 1I0VA 3DGYA 1C54A 3BU4A 1B20A 1IYYA 1RCKA 1RGEA 1BNIA 1YNVX 4RNTA 3RNTA 1YGWA 1UCLA 1JBSA 1I3IA 1X1XA 3SYUA 1BU4A 1RDSA 1RSNA 2KF3A 1I2EA 1GMPA 1TRQA 1SARA 3WHOA 1BSBA 3AGNA 4HOHA 1GOYA 1RN4A 1I70A 2RNTA 2C4BA 3D5GA 3AGOA 1Q9EA 1GOUA 3DH2A 5HOHA 1A2PA 3AHSA 1FZUA 5BU4A 1GSPA 1I2GA 1BGSA 1DE3A 1BRSA 1T2HA 9RNTA 1BSCA 1BNRA 1BRIA 1R4YA 3Q3FA 1BANA 2KF6A 3GSPA 1PY3A 4J5GA 1B2UA 2BIRA 7GSPA 1UCJA 1B27A 7RNTA 1TRPA 1BSDA 4HAAA 3KCHA 1BRGA 1BRKA 2AAEA 1BAOA 8RNTA 1RGKA 3A5EA 1BNEA 1B2ZA 1I2FA 2HOHA 3URPA 1FW7A 3AHWA 1BNSA 1YVSA 1AQZA 1GOVA 1RMSA 1FYSA 1GMQA 1RLSA 4BIRA 1HYFA 1BNGA 1BOXA 1GMRA 2BU4A 1RNBA 1FUTA 1MGRA 1RHLA 2F5MA 1JBTA 1LNIA 1X1UA 1AY7A 1BNFA 6GSPA 2RBIA 1B2SA 1LRAA 1ZGXA 3HOHA 1RN1A 1G02A 1RGCA 3BIRA 1BVIA 1RGHA 1RGGA 3D4AA 1B2XA 3WR2A 2KAAA 1RNTA 1RTUA 1B21A 1BNJA 1LOWA 1RGAA 1UCKA 1BSAA 1DETA 1MGWA 4GSPA 4J5KA 2KF5A 1T2IA 1X1WA 6RNTA 1LOVA 2F5WA 1BRHA 1BUJA 1X1YA 1UCIA 1BIRA 2GSPA 1TTOA 1CH0A 1I3FA 1RCLA 1RGLA 2SARA 5RNTA 5BIRA 3D5IA
chains in the Genus database with same CATH superfamily
2W9QA 3EX9A 2E2TA 2XEPA 5IG3A 5DRVA 4I4KA 5AYRB 3ZG5A 4BU4A 3DUKA 2OOVC 1OPYA 1PYLA 4STDA 3CCM3 1ULIB 1TJDA 3OV4A 1ROVA 2OOVA 1E3RA 1HU9A 2J8XB 4DKIA 5JPUA 5EEOA 2XSHB 1CQSA 2AADA 1GD4A 4O02B 5KP1A 1B3SA 3H3HA 2WOHA 2F4YA 2QGUA 1TFKA 1UUGB 4X2OA 2ZA4A 3VF1A 5BVBA 1IVVA 2UUGC 1ULJB 1A2KA 1DMMA 3DGYA 3Q1CA 4TX4A 1D6YA 2CFLA 3S29A 3CME3 1TIJA 1B20A 1C54A 1IYYA 3SEDA 4PEJA 1BNIA 1QAKA 3CU3A 4RNTA 4HBRA 3RNTA 1UCLA 3K0ZA 4BL3A 3IJEB 4CDLA 1I3IA 2H0GA 3B7CA 1W4NA 3K5TA 4L8PA 2W9PA 4BL2A 3SYUA 1FUWA 1GD3A 2HMKB 2KF3A 1Z1SA 3NBJA 4IPBA 1R4CA 1NO3A 5CF1A 2XFSA 1EQKA 3AGNA 4HOHA 1GOYA 3HIIA 5LC6A 1VQ93 1I70A 2RSXA 1NDOB 3CPOA 1JNQA 2FXTA 2D1WA 1KWIA 1STFI 4ORLA 5D83A 3WOFB 3FZWA 1NWWA 1C7HA 1GOUA 1OHOA 1A2PA 1AR0A 1IV7A 2LQVA 3A76A 3DH2A 3AHSA 3ECFA 4HM2B 4EBGA 1JRQA 1WMNA 3F7SA 4XDWA 1ZO2A 1DE3A 3OW22 1W6GA 3JUPA 3BB9A 9RNTA 1YJW3 5RNTA 1BRIA 4CJNA 3KFQC 1FGRA 3DGLA 4LMIA 4KFFA 1B2UA 1UI8A 3TDGA 2STDA 5IG5A 7RNTA 1FGMA 2YFJB 3VGNA 4HAAA 3K7CA 3LYGA 2OTL3 1MOLA 1T3BA 2CW9A 4N6OB 3AMOA 1WMOA 1BAOA 1LQMB 3A5EA 1W2B2 2BMQB 2QA43 1UW1A 3MKIA 1BNEA 3BNBA 4HKVB 1SQWA 2HOHA 3RDEA 4CCVA 1Q40B 1TU5A 1L5GB 3AHWA 1YVSA 4EV2A 2O3OA 1G0TA 1GOVA 3U97A 1FYSA 1GMQA 1U8CB 1YIT3 1SIIA 1S5AA 1HYFA 3CCL3 1J2BA 1GMRA 3HK4A 2QEX3 4R80A 1MGRA 4R9LA 4XBTA 1CEWI 1YHQ3 3B8LA 1FGTA 6GSPA 2ML5A 2RBIA 1B2SA 3NBBA 1ZGXA 5LC7A 1RN1A 3ZG0A 5EVHA 1WNHA 4N6NB 4CPKA 4EXRA 4ZM8A 3BIRA 2CWUA 1STDA 3D4AA 1W00A 3MHEA 5EQLA 1K41A 1D6ZA 3SX1A 3JUMA 5KP4A 5AI1A 1BSAA 1EG9B 3QRDA 1DETA 1E3VA 4GL6A 3GRDA 3CCJ3 1T2IA 1PFPA 2Z77A 4L7KA 1X1WA 4N6TA 2Y74A 2F5WA 1IQXA 2MF7A 2ML6A 8CHOA 2D42A 2XH9A 5G1LA 1W7CA 4KVHA 4WFOA 1KC84 2ZL8A 1NNVA 2CWVA 3FLJA 2PZVA 1TP6A 1DVCA 2HMJB 3QK9A 1RCLA 2E2UA 2FGTA 1K734 4WYKB 3JUNA 1QAFA 2BNGA 1N9JA 3D5IA 5AYSC 3KSPA 3NM7A 1O7WB 3NX0A 1YJ93 3NM2A 1JZDA 1Q864 3D3LA 4JF8A 1N9EA 4NREA 1I8VA 3LTDA 3PYJA 1B2MA 1CYVA 1HZ1A 1Y4KA 4GHOA 1O7MB 2IMJA 3PGBA 3CC23 2HMLB 2CG1A 2Z6BA 1BRNL 1UDII 3SLUA 3UL5A 3AMOB 2IUJA 3JUQA 4ILFA 1VQP3 3FF0A 3WA2X 5IW9A 2SBLA 3B4PA 3F40A 3DGMA 4FCMA 5STDA 5AIHA 4J8TA 5M19A 4FR9A 2GEXA 3F8XA 4XM4A 2IUKA 1TRQA 5IEPA 3I553 3CMA3 3OX9A 2BMRB 2W56A 1E97A 1NJI4 1OF5A 4MMZB 3K63A 3U1WA 3I563 2B24B 2RNTA 3F9SA 1IDPA 2ZDJA 2R41A 3NUVA 3AGOA 4R9KA 3X3ZA 1V58A 3LTBA 1W6CA 3MG2A 4EW5A 5IERA 1M1K4 5BU4A 1FZUA 2KRTA 1OH0A 3X3XA 3SVAA 1BRSA 1T2HA 2KCDA 2XFTA 1BSCA 1NU3A 1BNRA 1R4YA 2C10A 1GY6A 4FCZA 2BIRA 3OWSA 4EC6A 3CCE3 1B27A 1ROAA 1BSDA 1W5ZA 3BNEA 2BHMA 5DREA 1KQS2 3RGRA 8RNTA 3CXC2 1IT8A 2GU1A 3PCRA 1S723 2I9WA 1MWTA 1LQGC 4HYZA 1I2FA 3X41A 1DMNA 1FW7A 1MWUA 3X40A 1ZX2A 5ELJA 1MNLA 1O7NB 2L1SA 1A90A 2CHCA 4N6V0 1HKXA 3WODG 3CPW2 1IVXA 3DGOA 1RNBA 3ALAA 1FUTA 5CLKA 1YI23 4HJLB 3EE1A 3N8BA 1NB5I 4K90B 1X1UA 5IG0A 1IVWA 4G1MB 3SXXA 4K1VA 1ASKA 2QIYA 1GYBA 1Q42A 2YFIB 5D82A 1OGZA 1T5YA 1W02A 1Q7Y4 1BVIA 5AIFA 3V99A 1B2XA 5JBSA 1OHSA 3SOAA 4NPBA 2KAAA 1RNTA 1LVNA 5AEUB 1JB4A 1JJ22 1EKMA 2XRXB 2OCTA 2XR8B 3I0YA 1JKGA 1O7HB 4J5KA 1V74A 5D81A 4U13A 3MWZA 5A0OB 1N8R4 2CFWA 3FF2A 4FMAA 5M1AA 6RNTA 1LOVA 2W56B 4IIAA 4HM7B 2GBXB 1DYUA 1BUJA 1OF5B 1OUNA 1O7GB 2WGOA 3FG1A 1X1YA 3PS8A 1UCIA 3OWUA 4K1UA 3UJMA 1BIRA 1OACA 1RRLA 2W2CA 3GZBA 3PCSA 2P0XA 4KZ1A 5AEWB 1TTOA 3CCS3 2SARA 1I3FA 4NHFA 3Q2PA 1JB5A 1JZOA 3NV0A 4H3UA 2CKFB 4LZIA 1BSEA 1LOYA 2KF4A 1ISKA 1JN5A 1IU7A 2CX0A 5JPPA 1M9GA 3GZYB 3EJVA 4XB5A 4I5QA 2M7OA 1VQK3 3GAXA 3X42A 5AIIA 3BNCA 7STDA 4KT3B 1I0XA 3NQZA 2A15A 3S28A 1W6YA 1QVF2 1RGFA 1WQLB 2HMOB 1I0VA 3G6E3 1F8NA 4N3VA 4OK0A 3EQQB 1Q7HA 3CNMA 3D79A 3CCR3 2HMNB 4R1KA 1JBSA 3FGYA 4HM1B 3RGAA 3V98A 1VQ63 1GY5A 1IV9A 3EF8A 2XF3A 3FKAA 1RDSA 1YVBI 2KXGA 1N8QA 5IEOA 4EV5A 4XDVA 4K61A 3EB8A 2IA7A 3PZWA 4EYCA 1SARA 2W04A 2PNCA 3H51A 4JRFA 3WHOA 1VQM3 3CCU3 4H61A 5HGRA 1G96A 4X2HA 2C4BA 3KE7A 3D5GA 4MMXB 4FMCA 2P05A 2P38A 3KN4A 2CFGA 3EBTA 3T0UA 1JB2A 5HOHA 2F86B 3KKGA 1VQ43 3JVCA 3GWRA 1LXEA 1LOXA 1YGEA 3DZLA 4O3VA 3BNDA 3GSPA 1UI7A 2OQEC 2UX0A 4J5GA 5IF6A 3G4S3 1JKGB 7GSPA 3N9HA 3FG3A 4WWUC 1D6UA 2IYJA 2RGQA 3ER7A 4L8OA 3KSED 3WDGB 3KCHA 1BUQA 2HMMB 2Q07A 2XSOB 5G2GA 2IY2A 2AAEA 2OQEA 2BO9B 2W03A 3F8HA 3DM8A 3D9RA 4MMYB 3KZTA 1K9M4 1FGQA 2K54A 1US1A 1K8A4 2L4VA 1ZS7A 1BNSA 1Q824 1JN5B 3EHCA 4MEIA 4HZ9B 1VQO3 1UUWB 3HZPA 2JDIH 1CYUA 1VQ83 1WTHA 1VQQA 2V1LA 1U5OA 3NXJA 4BIRA 6STDA 1IK3A 3E99A 1EA2A 2BU4A 3F7XA 4HM4B 4LGQA 4AEQA 1TUHA 2OTJ3 1DMQA 1JBTA 2GXFA 4OVMA 1LNIA 1KSIA 3MG3A 1BNFA 3DY5A 2Y73A 1LRAA 4J9AA 4LEHA 1RGCA 4BTWA 3GZRA 1Q814 1RGHA 2XGNA 4IT7A 3LT9A 1RKYA 1OCVA 2C11A 1B21A 1LOWA 1TFOA 2CH9A 2P0MA 2K3DA 3EN1B 3FSDA 4QWTA 3CC43 3NBRA 5G1KA 2KF5A 3G16A 3MYTA 1M904 2YX9A 2LYXA 3S5CA 3V92A 3Q90A 2OWPA 4WP5A 1AVKA 1VQ73 1VQ53 3B4OA 1QMAA 4HM0B 1CH0A 1W2ZA 2JQ5A 3STDA 3HIGA 1IVUA 2R4IA 2ZHXB 3UL6A 1FUSA 2Z7AA 1VQN3 1RRHA 3IPTA 1FA3A 1AV4A 1DVDA 2XGLA 4HVNA 1JBRA 3VSYA 3CCV3 3M8CA 2F56A 3N54B 5GSPA 2P09A 5KP3A 5IG4A 2BT3A 4RNZA 1V57A 4WYKA 1N5HA 1BRJA 3UB1A 4OUQA 3UNLA 2GU3A 3FCSB 3PXMA 3K9MC 1UUVB 3CD63 3BU4A 3LOYA 3OWYA 2F99A 1RCKA 1RGEA 1YNVX 1JV2B 2WOFA 2YFLB 1YGWA 4FCJA 5AIGA 1RN7A 4Q53A 4O2HA 1X1XA 2CC3A 1BU4A 4FMBA 4MJDA 1RSNA 1A2VA 3O8YA 4KFDA 3S27A 1I2EA 2CFDA 1M1XB 1GMPA 5CK6A 4N6MA 4HM8B 3DGNA 1UGIA 3LMLA 1BSBA 3LTCA 5ELUA 1RN4A 4GB5A 3CC73 1QJGA 3CCQ3 3X3YA 1Q9EA 2INXA 4LSOA 1A67A 2K0MA 3L0RA 1QALA 1GSPA 1I2GA 1BGSA 2BMOB 3S67A 4LYLB 2UGIA 4O8SA 3MPHA 5I97A 2WGQA 4N6LA 5FGOA 3FH1A 3Q3FA 3T8NA 1OGXA 1BANA 2KF6A 1PY3A 3LH4A 5BXQA 3HI7A 3J7Yd 1PU4A 2Z76A 3G8ZA 1UCJA 3NQYA 1TRPA 1W01A 1MWSA 2F98A 1EUIC 3WA3A 2H0IA 3DMCA 1BRGA 5CF2A 1BRKA 1EEJA 4AKYA 3DXOA 3EN8A 1MWRA 1RGKA 2CX1A 2E2VA 1AVLA 1IQYA 3ZFZA 2W6JH 1RJOA 1B2ZA 1N5PA 1UGHI 2CFKA 2CK3H 3EC9A 3SOYA 3URPA 5IENA 2CWTA 4HM5B 4KFEA 4AKZA 1QVG2 1LNHA 4HZBB 1AQZA 4R4KA 1SPUA 2B1XB 1RMSA 3FG4A 1RLSA 3CNXA 4HM6B 1BNGA 1BOXA 1WMPA 2GEYA 2FNQA 1YJN3 2GBWB 3G713 3HX8A 1IQ8A 3MG1A 1RHLA 2F5MA 1FGOA 1GS3A 1SIHA 2CIUA 3MSOA 1AY7A 4N6UA 4RBNA 4XBYA 2WO0A 4RZMA 3HOHA 3GZXB 1VZZA 1G02A 1GY7A 1OHPA 2H0HA 3LTAA 1VQL3 4HM3B 1RGGA 2CG0A 3ROBA 3WR2A 3JUOA 1NB3I 1RTUA 1UCKA 1BNJA 3WMDA 1RGAA 5TGNA 1O7PB 3KIIA 1MGWA 3F14A 4GSPA 3IMAB 3NHXA 3LZAA 3NV0B 2MC8A 1YIJ3 1IT7A 1KD14 1BRHA 4XBXA 3T8UA 3WOEB 1K28A 3G0KA 4RNYA 3LT8A 2RCDA 3BLZA 2W0QA 2GSPA 4BTYA 4BTXA 3LXUX 3OXAA 5FW5A 2RFRA 5M18A 5CXOA 4WHAA 4FMDA 1RGLA 1SJWA 2O9UX 3EBYA 5BIRA 1Q40A
chains in the Genus database with same CATH topology
1FUSA 1BSEA 1LOYA 2KF4A 4BU4A 1PYLA 1JBRA 1B2MA 1I8VA 1HZ1A 2F56A 4GHOA 5GSPA 2AADA 1I0XA 1B3SA 2F4YA 1BRJA 1RGFA 1BRNL 2ZA4A 1I0VA 3DGYA 1C54A 3BU4A 1B20A 1IYYA 1RCKA 1RGEA 1BNIA 1YNVX 4RNTA 3RNTA 1YGWA 1UCLA 1JBSA 1I3IA 1X1XA 3SYUA 1BU4A 1RDSA 1RSNA 2KF3A 1I2EA 1GMPA 1TRQA 1SARA 3WHOA 1BSBA 3AGNA 4HOHA 1GOYA 1RN4A 1I70A 2RNTA 2C4BA 3D5GA 3AGOA 1Q9EA 1GOUA 3DH2A 5HOHA 1A2PA 3AHSA 1FZUA 5BU4A 1GSPA 1I2GA 1BGSA 1DE3A 1BRSA 1T2HA 9RNTA 1BSCA 1BNRA 1BRIA 1R4YA 3Q3FA 1BANA 2KF6A 3GSPA 1PY3A 4J5GA 1B2UA 2BIRA 7GSPA 1UCJA 1B27A 7RNTA 1TRPA 1BSDA 4HAAA 3KCHA 1BRGA 1BRKA 2AAEA 1BAOA 8RNTA 1RGKA 3A5EA 1BNEA 1B2ZA 1I2FA 2HOHA 3URPA 1FW7A 3AHWA 1BNSA 1YVSA 1AQZA 1GOVA 1RMSA 1FYSA 1GMQA 1RLSA 4BIRA 1HYFA 1BNGA 1BOXA 1GMRA 2BU4A 1RNBA 1FUTA 1MGRA 1RHLA 2F5MA 1JBTA 1LNIA 1X1UA 1AY7A 1BNFA 6GSPA 2RBIA 1B2SA 1LRAA 1ZGXA 3HOHA 1RN1A 1G02A 1RGCA 3BIRA 1BVIA 1RGHA 1RGGA 3D4AA 1B2XA 3WR2A 2KAAA 1RNTA 1RTUA 1B21A 1BNJA 1LOWA 1RGAA 1UCKA 1BSAA 1DETA 1MGWA 4GSPA 4J5KA 2KF5A 1T2IA 1X1WA 6RNTA 1LOVA 2F5WA 1BRHA 1BUJA 1X1YA 1UCIA 1BIRA 2GSPA 1TTOA 1CH0A 1I3FA 1RCLA 1RGLA 2SARA 5RNTA 5BIRA 3D5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUS A;  1BSE A;  1LOY A;  2KF4 A;  4BU4 A;  1PYL A;  1JBR A;  1B2M A;  1I8V A;  1HZ1 A;  2F56 A;  4GHO A;  5GSP A;  2AAD A;  1I0X A;  1B3S A;  2F4Y A;  1BRJ A;  1RGF A;  1BRN L;  2ZA4 A;  1I0V A;  3DGY A;  1C54 A;  3BU4 A;  1B20 A;  1IYY A;  1RCK A;  1RGE A;  1BNI A;  1YNV X;  4RNT A;  3RNT A;  1YGW A;  1UCL A;  1JBS A;  1I3I A;  1X1X A;  3SYU A;  1BU4 A;  1RDS A;  1RSN A;  2KF3 A;  1I2E A;  1GMP A;  1TRQ A;  1SAR A;  3WHO A;  1BSB A;  3AGN A;  4HOH A;  1GOY A;  1RN4 A;  1I70 A;  2RNT A;  2C4B A;  3D5G A;  3AGO A;  1Q9E A;  1GOU A;  3DH2 A;  5HOH A;  1A2P A;  3AHS A;  1FZU A;  5BU4 A;  1GSP A;  1I2G A;  1BGS A;  1DE3 A;  1BRS A;  1T2H A;  9RNT A;  1BSC A;  1BNR A;  1BRI A;  1R4Y A;  3Q3F A;  1BAN A;  2KF6 A;  3GSP A;  1PY3 A;  4J5G A;  1B2U A;  2BIR A;  7GSP A;  1UCJ A;  1B27 A;  7RNT A;  1TRP A;  1BSD A;  4HAA A;  3KCH A;  1BRG A;  1BRK A;  2AAE A;  1BAO A;  8RNT A;  1RGK A;  3A5E A;  1BNE A;  1B2Z A;  1I2F A;  2HOH A;  3URP A;  1FW7 A;  3AHW A;  1BNS A;  1YVS A;  1AQZ A;  1GOV A;  1RMS A;  1FYS A;  1GMQ A;  1RLS A;  4BIR A;  1HYF A;  1BNG A;  1BOX A;  1GMR A;  2BU4 A;  1RNB A;  1FUT A;  1MGR A;  1RHL A;  2F5M A;  1JBT A;  1LNI A;  1X1U A;  1AY7 A;  1BNF A;  6GSP A;  2RBI A;  1B2S A;  1LRA A;  1ZGX A;  3HOH A;  1RN1 A;  1G02 A;  1RGC A;  3BIR A;  1BVI A;  1RGH A;  1RGG A;  3D4A A;  1B2X A;  3WR2 A;  2KAA A;  1RNT A;  1RTU A;  1B21 A;  1BNJ A;  1LOW A;  1RGA A;  1UCK A;  1BSA A;  1DET A;  1MGW A;  4GSP A;  4J5K A;  2KF5 A;  1T2I A;  1X1W A;  6RNT A;  1LOV A;  2F5W A;  1BRH A;  1BUJ A;  1X1Y A;  1UCI A;  1BIR A;  2GSP A;  1TTO A;  1CH0 A;  1I3F A;  1RCL A;  1RGL A;  2SAR A;  5RNT A;  5BIR A;  3D5I A; 
#chains in the Genus database with same CATH topology
 2W9Q A;  3EX9 A;  2E2T A;  2XEP A;  5IG3 A;  5DRV A;  4I4K A;  5AYR B;  3ZG5 A;  4BU4 A;  3DUK A;  2OOV C;  1OPY A;  1PYL A;  4STD A;  3CCM 3;  1ULI B;  1TJD A;  3OV4 A;  1ROV A;  2OOV A;  1E3R A;  1HU9 A;  2J8X B;  4DKI A;  5JPU A;  5EEO A;  2XSH B;  1CQS A;  2AAD A;  1GD4 A;  4O02 B;  5KP1 A;  1B3S A;  3H3H A;  2WOH A;  2F4Y A;  2QGU A;  1TFK A;  1UUG B;  4X2O A;  2ZA4 A;  3VF1 A;  5BVB A;  1IVV A;  2UUG C;  1ULJ B;  1A2K A;  1DMM A;  3DGY A;  3Q1C A;  4TX4 A;  1D6Y A;  2CFL A;  3S29 A;  3CME 3;  1TIJ A;  1B20 A;  1C54 A;  1IYY A;  3SED A;  4PEJ A;  1BNI A;  1QAK A;  3CU3 A;  4RNT A;  4HBR A;  3RNT A;  1UCL A;  3K0Z A;  4BL3 A;  3IJE B;  4CDL A;  1I3I A;  2H0G A;  3B7C A;  1W4N A;  3K5T A;  4L8P A;  2W9P A;  4BL2 A;  3SYU A;  1FUW A;  1GD3 A;  2HMK B;  2KF3 A;  1Z1S A;  3NBJ A;  4IPB A;  1R4C A;  1NO3 A;  5CF1 A;  2XFS A;  1EQK A;  3AGN A;  4HOH A;  1GOY A;  3HII A;  5LC6 A;  1VQ9 3;  1I70 A;  2RSX A;  1NDO B;  3CPO A;  1JNQ A;  2FXT A;  2D1W A;  1KWI A;  1STF I;  4ORL A;  5D83 A;  3WOF B;  3FZW A;  1NWW A;  1C7H A;  1GOU A;  1OHO A;  1A2P A;  1AR0 A;  1IV7 A;  2LQV A;  3A76 A;  3DH2 A;  3AHS A;  3ECF A;  4HM2 B;  4EBG A;  1JRQ A;  1WMN A;  3F7S A;  4XDW A;  1ZO2 A;  1DE3 A;  3OW2 2;  1W6G A;  3JUP A;  3BB9 A;  9RNT A;  1YJW 3;  5RNT A;  1BRI A;  4CJN A;  3KFQ C;  1FGR A;  3DGL A;  4LMI A;  4KFF A;  1B2U A;  1UI8 A;  3TDG A;  2STD A;  5IG5 A;  7RNT A;  1FGM A;  2YFJ B;  3VGN A;  4HAA A;  3K7C A;  3LYG A;  2OTL 3;  1MOL A;  1T3B A;  2CW9 A;  4N6O B;  3AMO A;  1WMO A;  1BAO A;  1LQM B;  3A5E A;  1W2B 2;  2BMQ B;  2QA4 3;  1UW1 A;  3MKI A;  1BNE A;  3BNB A;  4HKV B;  1SQW A;  2HOH A;  3RDE A;  4CCV A;  1Q40 B;  1TU5 A;  1L5G B;  3AHW A;  1YVS A;  4EV2 A;  2O3O A;  1G0T A;  1GOV A;  3U97 A;  1FYS A;  1GMQ A;  1U8C B;  1YIT 3;  1SII A;  1S5A A;  1HYF A;  3CCL 3;  1J2B A;  1GMR A;  3HK4 A;  2QEX 3;  4R80 A;  1MGR A;  4R9L A;  4XBT A;  1CEW I;  1YHQ 3;  3B8L A;  1FGT A;  6GSP A;  2ML5 A;  2RBI A;  1B2S A;  3NBB A;  1ZGX A;  5LC7 A;  1RN1 A;  3ZG0 A;  5EVH A;  1WNH A;  4N6N B;  4CPK A;  4EXR A;  4ZM8 A;  3BIR A;  2CWU A;  1STD A;  3D4A A;  1W00 A;  3MHE A;  5EQL A;  1K41 A;  1D6Z A;  3SX1 A;  3JUM A;  5KP4 A;  5AI1 A;  1BSA A;  1EG9 B;  3QRD A;  1DET A;  1E3V A;  4GL6 A;  3GRD A;  3CCJ 3;  1T2I A;  1PFP A;  2Z77 A;  4L7K A;  1X1W A;  4N6T A;  2Y74 A;  2F5W A;  1IQX A;  2MF7 A;  2ML6 A;  8CHO A;  2D42 A;  2XH9 A;  5G1L A;  1W7C A;  4KVH A;  4WFO A;  1KC8 4;  2ZL8 A;  1NNV A;  2CWV A;  3FLJ A;  2PZV A;  1TP6 A;  1DVC A;  2HMJ B;  3QK9 A;  1RCL A;  2E2U A;  2FGT A;  1K73 4;  4WYK B;  3JUN A;  1QAF A;  2BNG A;  1N9J A;  3D5I A;  5AYS C;  3KSP A;  3NM7 A;  1O7W B;  3NX0 A;  1YJ9 3;  3NM2 A;  1JZD A;  1Q86 4;  3D3L A;  4JF8 A;  1N9E A;  4NRE A;  1I8V A;  3LTD A;  3PYJ A;  1B2M A;  1CYV A;  1HZ1 A;  1Y4K A;  4GHO A;  1O7M B;  2IMJ A;  3PGB A;  3CC2 3;  2HML B;  2CG1 A;  2Z6B A;  1BRN L;  1UDI I;  3SLU A;  3UL5 A;  3AMO B;  2IUJ A;  3JUQ A;  4ILF A;  1VQP 3;  3FF0 A;  3WA2 X;  5IW9 A;  2SBL A;  3B4P A;  3F40 A;  3DGM A;  4FCM A;  5STD A;  5AIH A;  4J8T A;  5M19 A;  4FR9 A;  2GEX A;  3F8X A;  4XM4 A;  2IUK A;  1TRQ A;  5IEP A;  3I55 3;  3CMA 3;  3OX9 A;  2BMR B;  2W56 A;  1E97 A;  1NJI 4;  1OF5 A;  4MMZ B;  3K63 A;  3U1W A;  3I56 3;  2B24 B;  2RNT A;  3F9S A;  1IDP A;  2ZDJ A;  2R41 A;  3NUV A;  3AGO A;  4R9K A;  3X3Z A;  1V58 A;  3LTB A;  1W6C A;  3MG2 A;  4EW5 A;  5IER A;  1M1K 4;  5BU4 A;  1FZU A;  2KRT A;  1OH0 A;  3X3X A;  3SVA A;  1BRS A;  1T2H A;  2KCD A;  2XFT A;  1BSC A;  1NU3 A;  1BNR A;  1R4Y A;  2C10 A;  1GY6 A;  4FCZ A;  2BIR A;  3OWS A;  4EC6 A;  3CCE 3;  1B27 A;  1ROA A;  1BSD A;  1W5Z A;  3BNE A;  2BHM A;  5DRE A;  1KQS 2;  3RGR A;  8RNT A;  3CXC 2;  1IT8 A;  2GU1 A;  3PCR A;  1S72 3;  2I9W A;  1MWT A;  1LQG C;  4HYZ A;  1I2F A;  3X41 A;  1DMN A;  1FW7 A;  1MWU A;  3X40 A;  1ZX2 A;  5ELJ A;  1MNL A;  1O7N B;  2L1S A;  1A90 A;  2CHC A;  4N6V 0;  1HKX A;  3WOD G;  3CPW 2;  1IVX A;  3DGO A;  1RNB A;  3ALA A;  1FUT A;  5CLK A;  1YI2 3;  4HJL B;  3EE1 A;  3N8B A;  1NB5 I;  4K90 B;  1X1U A;  5IG0 A;  1IVW A;  4G1M B;  3SXX A;  4K1V A;  1ASK A;  2QIY A;  1GYB A;  1Q42 A;  2YFI B;  5D82 A;  1OGZ A;  1T5Y A;  1W02 A;  1Q7Y 4;  1BVI A;  5AIF A;  3V99 A;  1B2X A;  5JBS A;  1OHS A;  3SOA A;  4NPB A;  2KAA A;  1RNT A;  1LVN A;  5AEU B;  1JB4 A;  1JJ2 2;  1EKM A;  2XRX B;  2OCT A;  2XR8 B;  3I0Y A;  1JKG A;  1O7H B;  4J5K A;  1V74 A;  5D81 A;  4U13 A;  3MWZ A;  5A0O B;  1N8R 4;  2CFW A;  3FF2 A;  4FMA A;  5M1A A;  6RNT A;  1LOV A;  2W56 B;  4IIA A;  4HM7 B;  2GBX B;  1DYU A;  1BUJ A;  1OF5 B;  1OUN A;  1O7G B;  2WGO A;  3FG1 A;  1X1Y A;  3PS8 A;  1UCI A;  3OWU A;  4K1U A;  3UJM A;  1BIR A;  1OAC A;  1RRL A;  2W2C A;  3GZB A;  3PCS A;  2P0X A;  4KZ1 A;  5AEW B;  1TTO A;  3CCS 3;  2SAR A;  1I3F A;  4NHF A;  3Q2P A;  1JB5 A;  1JZO A;  3NV0 A;  4H3U A;  2CKF B;  4LZI A;  1BSE A;  1LOY A;  2KF4 A;  1ISK A;  1JN5 A;  1IU7 A;  2CX0 A;  5JPP A;  1M9G A;  3GZY B;  3EJV A;  4XB5 A;  4I5Q A;  2M7O A;  1VQK 3;  3GAX A;  3X42 A;  5AII A;  3BNC A;  7STD A;  4KT3 B;  1I0X A;  3NQZ A;  2A15 A;  3S28 A;  1W6Y A;  1QVF 2;  1RGF A;  1WQL B;  2HMO B;  1I0V A;  3G6E 3;  1F8N A;  4N3V A;  4OK0 A;  3EQQ B;  1Q7H A;  3CNM A;  3D79 A;  3CCR 3;  2HMN B;  4R1K A;  1JBS A;  3FGY A;  4HM1 B;  3RGA A;  3V98 A;  1VQ6 3;  1GY5 A;  1IV9 A;  3EF8 A;  2XF3 A;  3FKA A;  1RDS A;  1YVB I;  2KXG A;  1N8Q A;  5IEO A;  4EV5 A;  4XDV A;  4K61 A;  3EB8 A;  2IA7 A;  3PZW A;  4EYC A;  1SAR A;  2W04 A;  2PNC A;  3H51 A;  4JRF A;  3WHO A;  1VQM 3;  3CCU 3;  4H61 A;  5HGR A;  1G96 A;  4X2H A;  2C4B A;  3KE7 A;  3D5G A;  4MMX B;  4FMC A;  2P05 A;  2P38 A;  3KN4 A;  2CFG A;  3EBT A;  3T0U A;  1JB2 A;  5HOH A;  2F86 B;  3KKG A;  1VQ4 3;  3JVC A;  3GWR A;  1LXE A;  1LOX A;  1YGE A;  3DZL A;  4O3V A;  3BND A;  3GSP A;  1UI7 A;  2OQE C;  2UX0 A;  4J5G A;  5IF6 A;  3G4S 3;  1JKG B;  7GSP A;  3N9H A;  3FG3 A;  4WWU C;  1D6U A;  2IYJ A;  2RGQ A;  3ER7 A;  4L8O A;  3KSE D;  3WDG B;  3KCH A;  1BUQ A;  2HMM B;  2Q07 A;  2XSO B;  5G2G A;  2IY2 A;  2AAE A;  2OQE A;  2BO9 B;  2W03 A;  3F8H A;  3DM8 A;  3D9R A;  4MMY B;  3KZT A;  1K9M 4;  1FGQ A;  2K54 A;  1US1 A;  1K8A 4;  2L4V A;  1ZS7 A;  1BNS A;  1Q82 4;  1JN5 B;  3EHC A;  4MEI A;  4HZ9 B;  1VQO 3;  1UUW B;  3HZP A;  2JDI H;  1CYU A;  1VQ8 3;  1WTH A;  1VQQ A;  2V1L A;  1U5O A;  3NXJ A;  4BIR A;  6STD A;  1IK3 A;  3E99 A;  1EA2 A;  2BU4 A;  3F7X A;  4HM4 B;  4LGQ A;  4AEQ A;  1TUH A;  2OTJ 3;  1DMQ A;  1JBT A;  2GXF A;  4OVM A;  1LNI A;  1KSI A;  3MG3 A;  1BNF A;  3DY5 A;  2Y73 A;  1LRA A;  4J9A A;  4LEH A;  1RGC A;  4BTW A;  3GZR A;  1Q81 4;  1RGH A;  2XGN A;  4IT7 A;  3LT9 A;  1RKY A;  1OCV A;  2C11 A;  1B21 A;  1LOW A;  1TFO A;  2CH9 A;  2P0M A;  2K3D A;  3EN1 B;  3FSD A;  4QWT A;  3CC4 3;  3NBR A;  5G1K A;  2KF5 A;  3G16 A;  3MYT A;  1M90 4;  2YX9 A;  2LYX A;  3S5C A;  3V92 A;  3Q90 A;  2OWP A;  4WP5 A;  1AVK A;  1VQ7 3;  1VQ5 3;  3B4O A;  1QMA A;  4HM0 B;  1CH0 A;  1W2Z A;  2JQ5 A;  3STD A;  3HIG A;  1IVU A;  2R4I A;  2ZHX B;  3UL6 A;  1FUS A;  2Z7A A;  1VQN 3;  1RRH A;  3IPT A;  1FA3 A;  1AV4 A;  1DVD A;  2XGL A;  4HVN A;  1JBR A;  3VSY A;  3CCV 3;  3M8C A;  2F56 A;  3N54 B;  5GSP A;  2P09 A;  5KP3 A;  5IG4 A;  2BT3 A;  4RNZ A;  1V57 A;  4WYK A;  1N5H A;  1BRJ A;  3UB1 A;  4OUQ A;  3UNL A;  2GU3 A;  3FCS B;  3PXM A;  3K9M C;  1UUV B;  3CD6 3;  3BU4 A;  3LOY A;  3OWY A;  2F99 A;  1RCK A;  1RGE A;  1YNV X;  1JV2 B;  2WOF A;  2YFL B;  1YGW A;  4FCJ A;  5AIG A;  1RN7 A;  4Q53 A;  4O2H A;  1X1X A;  2CC3 A;  1BU4 A;  4FMB A;  4MJD A;  1RSN A;  1A2V A;  3O8Y A;  4KFD A;  3S27 A;  1I2E A;  2CFD A;  1M1X B;  1GMP A;  5CK6 A;  4N6M A;  4HM8 B;  3DGN A;  1UGI A;  3LML A;  1BSB A;  3LTC A;  5ELU A;  1RN4 A;  4GB5 A;  3CC7 3;  1QJG A;  3CCQ 3;  3X3Y A;  1Q9E A;  2INX A;  4LSO A;  1A67 A;  2K0M A;  3L0R A;  1QAL A;  1GSP A;  1I2G A;  1BGS A;  2BMO B;  3S67 A;  4LYL B;  2UGI A;  4O8S A;  3MPH A;  5I97 A;  2WGQ A;  4N6L A;  5FGO A;  3FH1 A;  3Q3F A;  3T8N A;  1OGX A;  1BAN A;  2KF6 A;  1PY3 A;  3LH4 A;  5BXQ A;  3HI7 A;  3J7Y d;  1PU4 A;  2Z76 A;  3G8Z A;  1UCJ A;  3NQY A;  1TRP A;  1W01 A;  1MWS A;  2F98 A;  1EUI C;  3WA3 A;  2H0I A;  3DMC A;  1BRG A;  5CF2 A;  1BRK A;  1EEJ A;  4AKY A;  3DXO A;  3EN8 A;  1MWR A;  1RGK A;  2CX1 A;  2E2V A;  1AVL A;  1IQY A;  3ZFZ A;  2W6J H;  1RJO A;  1B2Z A;  1N5P A;  1UGH I;  2CFK A;  2CK3 H;  3EC9 A;  3SOY A;  3URP A;  5IEN A;  2CWT A;  4HM5 B;  4KFE A;  4AKZ A;  1QVG 2;  1LNH A;  4HZB B;  1AQZ A;  4R4K A;  1SPU A;  2B1X B;  1RMS A;  3FG4 A;  1RLS A;  3CNX A;  4HM6 B;  1BNG A;  1BOX A;  1WMP A;  2GEY A;  2FNQ A;  1YJN 3;  2GBW B;  3G71 3;  3HX8 A;  1IQ8 A;  3MG1 A;  1RHL A;  2F5M A;  1FGO A;  1GS3 A;  1SIH A;  2CIU A;  3MSO A;  1AY7 A;  4N6U A;  4RBN A;  4XBY A;  2WO0 A;  4RZM A;  3HOH A;  3GZX B;  1VZZ A;  1G02 A;  1GY7 A;  1OHP A;  2H0H A;  3LTA A;  1VQL 3;  4HM3 B;  1RGG A;  2CG0 A;  3ROB A;  3WR2 A;  3JUO A;  1NB3 I;  1RTU A;  1UCK A;  1BNJ A;  3WMD A;  1RGA A;  5TGN A;  1O7P B;  3KII A;  1MGW A;  3F14 A;  4GSP A;  3IMA B;  3NHX A;  3LZA A;  3NV0 B;  2MC8 A;  1YIJ 3;  1IT7 A;  1KD1 4;  1BRH A;  4XBX A;  3T8U A;  3WOE B;  1K28 A;  3G0K A;  4RNY A;  3LT8 A;  2RCD A;  3BLZ A;  2W0Q A;  2GSP A;  4BTY A;  4BTX A;  3LXU X;  3OXA A;  5FW5 A;  2RFR A;  5M18 A;  5CXO A;  4WHA A;  4FMD A;  1RGL A;  1SJW A;  2O9U X;  3EBY A;  5BIR A;  1Q40 A; 
#chains in the Genus database with same CATH homology
 1FUS A;  1BSE A;  1LOY A;  2KF4 A;  4BU4 A;  1PYL A;  1JBR A;  1B2M A;  1I8V A;  1HZ1 A;  2F56 A;  4GHO A;  5GSP A;  2AAD A;  1I0X A;  1B3S A;  2F4Y A;  1BRJ A;  1RGF A;  1BRN L;  2ZA4 A;  1I0V A;  3DGY A;  1C54 A;  3BU4 A;  1B20 A;  1IYY A;  1RCK A;  1RGE A;  1BNI A;  1YNV X;  4RNT A;  3RNT A;  1YGW A;  1UCL A;  1JBS A;  1I3I A;  1X1X A;  3SYU A;  1BU4 A;  1RDS A;  1RSN A;  2KF3 A;  1I2E A;  1GMP A;  1TRQ A;  1SAR A;  3WHO A;  1BSB A;  3AGN A;  4HOH A;  1GOY A;  1RN4 A;  1I70 A;  2RNT A;  2C4B A;  3D5G A;  3AGO A;  1Q9E A;  1GOU A;  3DH2 A;  5HOH A;  1A2P A;  3AHS A;  1FZU A;  5BU4 A;  1GSP A;  1I2G A;  1BGS A;  1DE3 A;  1BRS A;  1T2H A;  9RNT A;  1BSC A;  1BNR A;  1BRI A;  1R4Y A;  3Q3F A;  1BAN A;  2KF6 A;  3GSP A;  1PY3 A;  4J5G A;  1B2U A;  2BIR A;  7GSP A;  1UCJ A;  1B27 A;  7RNT A;  1TRP A;  1BSD A;  4HAA A;  3KCH A;  1BRG A;  1BRK A;  2AAE A;  1BAO A;  8RNT A;  1RGK A;  3A5E A;  1BNE A;  1B2Z A;  1I2F A;  2HOH A;  3URP A;  1FW7 A;  3AHW A;  1BNS A;  1YVS A;  1AQZ A;  1GOV A;  1RMS A;  1FYS A;  1GMQ A;  1RLS A;  4BIR A;  1HYF A;  1BNG A;  1BOX A;  1GMR A;  2BU4 A;  1RNB A;  1FUT A;  1MGR A;  1RHL A;  2F5M A;  1JBT A;  1LNI A;  1X1U A;  1AY7 A;  1BNF A;  6GSP A;  2RBI A;  1B2S A;  1LRA A;  1ZGX A;  3HOH A;  1RN1 A;  1G02 A;  1RGC A;  3BIR A;  1BVI A;  1RGH A;  1RGG A;  3D4A A;  1B2X A;  3WR2 A;  2KAA A;  1RNT A;  1RTU A;  1B21 A;  1BNJ A;  1LOW A;  1RGA A;  1UCK A;  1BSA A;  1DET A;  1MGW A;  4GSP A;  4J5K A;  2KF5 A;  1T2I A;  1X1W A;  6RNT A;  1LOV A;  2F5W A;  1BRH A;  1BUJ A;  1X1Y A;  1UCI A;  1BIR A;  2GSP A;  1TTO A;  1CH0 A;  1I3F A;  1RCL A;  1RGL A;  2SAR A;  5RNT A;  5BIR A;  3D5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...