1PY3A

Crystal structure of ribonuclease sa2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
b'ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease
publication title Crystal structure reveals two alternative conformations in the active site of ribonuclease Sa2.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 21
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1py3A00
1Q9EA 2C4BA 3A5EA 1BGSA 1FUSA 1I0XA 1GMPA 1BNRA 1RTUA 1RMSA 1BRHA 1BNIA 3KCHA 1AY7A 1G02A 1BRGA 1BVIA 2KF3A 2ZA4A 1B27A 1PYLA 1RGKA 2F5WA 1B2SA 1YVSA 4RNTA 3D5GA 7GSPA 1TRQA 1BSCA 1PY3A 1BU4A 1FZUA 1RGFA 2F56A 2KF4A 5GSPA 1UCLA 2F5MA 2KF6A 1BSEA 3Q3FA 1JBTA 2SARA 1IYYA 4J5KA 1RGLA 5BU4A 1BSBA 4BIRA 1HZ1A 1BAOA 1I2GA 3URPA 3WR2A 1RGGA 1RN1A 1RGAA 1X1UA 3BIRA 2GSPA 1BANA 6GSPA 1HYFA 1RHLA 1JBRA 1BNFA 1B21A 2RBIA 1T2IA 2RNTA 1FUTA 1AQZA 1A2PA 1R4YA 3AHWA 3DH2A 1JBSA 1BRNL 1I8VA 4GHOA 1BNSA 1BNEA 1RGHA 1LOWA 1RSNA 1DE3A 1BUJA 1B2MA 1X1YA 1X1WA 1GMRA 3AGNA 3RNTA 7RNTA 1UCIA 2AADA 1BIRA 3BU4A 1MGRA 3WHOA 1RN4A 1RLSA 1BNGA 1B2XA 1RGEA 3D4AA 4HAAA 1I70A 1TRPA 5RNTA 5BIRA 1UCJA 2KF5A 1TTOA 3AGOA 3SYUA 1I3FA 1LOVA 3GSPA 1GOYA 1T2HA 6RNTA 5HOHA 3DGYA 1C54A 1BRSA 8RNTA 1BRJA 1BNJA 1BOXA 1YGWA 9RNTA 1BSAA 4BU4A 1LNIA 3D5IA 1B2ZA 1RNBA 2AAEA 1BRKA 2BU4A 1LOYA 1GMQA 1FW7A 1MGWA 2HOHA 3HOHA 4J5GA 1FYSA 1RDSA 1ZGXA 1YNVX 2KAAA 1GSPA 1RCLA 1I0VA 1GOVA 1X1XA 2BIRA 2F4YA 1SARA 1B2UA 1BSDA 1CH0A 1I2FA 1I2EA 1BRIA 1UCKA 3AHSA 4GSPA 1B20A 1RCKA 1I3IA 4HOHA 1GOUA 1RGCA 1DETA 1B3SA 1LRAA 1RNTA
chains in the Genus database with same CATH superfamily
3DMCA 3V99A 3RGAA 3EBYA 3FG4A 3EF8A 2XSOB 1YJ93 1VQ73 2CFGA 2P05A 2GEXA 3EQQB 4O8SA 4CJNA 3NBRA 1EG9B 1AY7A 3FLJA 3SX1A 1TP6A 1T3BA 3LT9A 3RGRA 3DGMA 3PGBA 2E2UA 2SBLA 2Z76A 4FMDA 1PYLA 1RGKA 1W6YA 2F5WA 2QIYA 3MPHA 1B2SA 1UGHI 5JPUA 1AVKA 1OACA 1RN7A 4IT7A 2V1LA 4WYKA 2XH9A 1PY3A 4ILFA 1FZUA 1RGFA 2M7OA 2STDA 3F7XA 3NQYA 5DRVA 1GD4A 5GSPA 4DKIA 3Q1CA 5M19A 1YVBI 3F7SA 5D83A 1YGEA 3CC43 1RGLA 1W7CA 3I563 2A15A 3BNBA 3LT8A 1BSBA 1W2B2 4XM4A 1HZ1A 1S5AA 3WR2A 1AV4A 4K61A 2H0GA 5STDA 2D42A 2K3DA 2MF7A 4AEQA 3B4PA 2OCTA 3B4OA 5AIIA 1CYUA 2WGQA 3CU3A 1UW1A 1O7WB 1T2IA 1JB4A 3MHEA 3PYJA 4XDWA 2UGIA 3FSDA 5M18A 1VQ53 1AQZA 3AMOB 4H61A 1JBSA 1O7NB 3B7CA 4G1MB 1W2ZA 1JB5A 1I8VA 1RSNA 1TFKA 1RGHA 1LOWA 3HIIA 1VQO3 1EEJA 1EUIC 2QGUA 3HK4A 1V74A 1UCIA 3MWZA 3BU4A 1BIRA 4HM3B 1FGOA 4XDVA 1RLSA 1MWUA 1BNGA 1RGEA 1ZO2A 3D4AA 4BTWA 5IENA 1UUVB 1EA2A 1VQ63 5BIRA 2WOHA 1UCJA 2I9WA 4FCMA 3NXJA 1D6YA 1LNHA 1I3FA 2B1XB 3F14A 1UI8A 3HI7A 4N6V0 6RNTA 3FG1A 1VQQA 1IT7A 8RNTA 3GZYB 2K54A 1N8R4 2O3OA 3VSYA 3MSOA 1TFOA 2CFLA 2WO0A 4K1UA 4J8TA 1CEWI 2HMJB 2CKFB 3D5IA 3VGNA 1W6GA 2XSHB 4MMYB 5IF6A 1TU5A 1S723 1SPUA 3G16A 2JQ5A 3CD63 1LOYA 2W9PA 3MYTA 1FW7A 1WTHA 2INXA 4EV5A 3DGOA 1FYSA 4N6MA 3F8HA 2IYJA 3AMOA 4AKZA 2C10A 2KAAA 1X1XA 1I0VA 1UGIA 1JB2A 4HM4B 1YJN3 3DGNA 1B2UA 1BSDA 1ZX2A 1E97A 3DXOA 3LOYA 1U8CB 4HM1B 4X2HA 4GSPA 1B20A 1RCKA 3ALAA 5KP4A 5G1LA 4LEHA 2XRXB 4HM6B 4ZM8A 1LRAA 1RNTA 4KZ1A 1HU9A 3A5EA 1EKMA 1FUSA 1I0XA 1STDA 5IG3A 1GMPA 1BNRA 1RTUA 4WWUC 2QA43 1GY6A 1BRHA 1BNIA 5AYSC 3WMDA 4CCVA 3NUVA 1W01A 1BVIA 1DMQA 3LMLA 5AIFA 2KF3A 5TGNA 3STDA 3BLZA 3SEDA 3D3LA 1TIJA 5AYRB 1B27A 4EXRA 1YHQ3 2RFRA 1Q864 1EQKA 3I0YA 3X42A 1YVSA 4EC6A 2E2VA 4MMZB 7GSPA 4WHAA 4EYCA 3GZBA 1NU3A 2YFJB 4N6NB 1BU4A 2W04A 4HVNA 3CCV3 4TX4A 2KF6A 3B8LA 3DY5A 1IVXA 1W4NA 2W0QA 3LYGA 2SARA 3IJEB 4NHFA 5AI1A 3IPTA 1ISKA 4J5KA 2YX9A 4LZIA 1K9M4 5CF2A 1RKYA 1UUGB 5EQLA 3M8CA 1E3RA 1OH0A 2CC3A 3CCL3 3KFQC 5CXOA 3NX0A 4ORLA 3S29A 4FCJA 4O02B 5ELJA 1WNHA 1RGAA 4LSOA 2GSPA 1LQGC 3FF0A 6GSPA 1RHLA 1ULIB 3HZPA 4O2HA 3CCR3 3CCS3 1B21A 2RNTA 2QEX3 1FGTA 1Z1SA 1U5OA 1D6ZA 4HBRA 1NJI4 1R4YA 2BMOB 1BRNL 2CHCA 1G0TA 2OWPA 2PZVA 4GHOA 3S5CA 1BNEA 2XFTA 1WMPA 3K5TA 4R80A 4BTYA 4I4KA 2J8XB 3N54B 4IPBA 4NREA 5BVBA 4CPKA 1JJ22 3T8UA 2OTJ3 1X1YA 2OOVA 4EW5A 1X1WA 1OHSA 2XGNA 1GS3A 3UB1A 3AGNA 3RNTA 5KP3A 2W6JH 2XF3A 1CQSA 1ZS7A 4HKVB 3O8YA 1MGRA 1KD14 2F99A 1RN4A 4MJDA 3DUKA 1GD3A 3CME3 1JKGA 4X2OA 2GXFA 3KE7A 3SOYA 4CDLA 1FUWA 2RGQA 1VQL3 3AGOA 1YJW3 1G96A 3GSPA 2ML6A 4L8OA 5ELUA 3DZLA 5HOHA 3CNXA 1IQXA 4OVMA 1BRJA 3J7Yd 3I553 1BNJA 2UUGC 1ULJB 2HMNB 5DREA 9RNTA 4BU4A 3F40A 2XR8B 1LXEA 1WMOA 4N6LA 1VQ83 3LH4A 1F8NA 2GU3A 2RCDA 1B2ZA 2WOFA 1RNBA 2BO9B 4I5QA 3Q2PA 1VQ93 4HM5B 2BU4A 1RRHA 3JUNA 1Q7Y4 2H0IA 2IMJA 3HOHA 1E3VA 4HZBB 3GRDA 3NBBA 4K1VA 3K63A 1OF5B 4LYLB 2Y74A 2CWTA 1GOVA 3LTBA 3JUPA 1WQLB 3ROBA 2LQVA 4U13A 5AIHA 1DVDA 2W9QA 3EC9A 2JDIH 1SJWA 4BTXA 1NO3A 2C11A 3JUOA 1I3IA 1IQ8A 4HM0B 2IUKA 3MKIA 1JNQA 1DVCA 2F86B 5IW9A 1RGCA 2XEPA 1B2MA 1Q9EA 1NNVA 2OQEA 3NBJA 1BGSA 2ZHXB 1R4CA 4N6UA 8CHOA 4OK0A 1KSIA 1JN5B 3GZRA 4FR9A 4JF8A 2BHMA 3KCHA 3EBTA 3ECFA 1G02A 3H3HA 1QAKA 2BMRB 2IUJA 4N6OB 2HMLB 3SXXA 3H51A 2PNCA 1IQYA 1RJOA 1T5YA 3EN1B 3X41A 2CG1A 3K9MC 5LC6A 1OPYA 2Y73A 1QALA 1C7HA 2E2TA 2HMMB 4RNTA 3WOFB 3KKGA 3NV0B 3CC73 3FG3A 2RSXA 3NHXA 1BSCA 2BMQB 2L4VA 3FH1A 3FGYA 2F56A 1DYUA 4LGQA 1V58A 3ER7A 3G8ZA 1BSEA 3Q3FA 4FMBA 5JBSA 1QVF2 3WODG 1J2BA 2XFSA 1JBTA 1UI7A 4BL3A 1K8A4 4N3VA 3LXUX 1SIIA 1VQK3 1KC84 5G2GA 3S28A 1OF5A 4L7KA 4NPBA 5FW5A 1PU4A 1OGXA 4J9AA 1KQS2 1A2KA 1Q814 3UNLA 1NDOB 1K734 1RGGA 3SOAA 5IERA 1MNLA 1X1UA 3CNMA 1YIT3 3BIRA 3FZWA 4WP5A 1Q42A 5G1KA 4HZ9B 3DGLA 1BNFA 1JBRA 3RDEA 2RBIA 2UX0A 1FUTA 1JKGB 4HYZA 2GBXB 1N5HA 3DH2A 3AHWA 1IVVA 2K0MA 1UDII 2KXGA 2R4IA 2YFLB 5EEOA 1O7HB 1ASKA 2Z6BA 2GU1A 1HKXA 2BNGA 3FKAA 1JN5A 3X3YA 1BUQA 3PXMA 2CX1A 3DM8A 2P0MA 3BNCA 2KRTA 3KIIA 3L0RA 2AADA 3NM2A 1MOLA 2FXTA 3T8NA 3OWUA 5RNTA 4R1KA 4WFOA 3EX9A 2FNQA 4RNYA 3NV0A 2KF5A 5HGRA 1TTOA 3SYUA 5CK6A 2YFIB 5AEWB 5AIGA 1DMNA 1VQP3 3JUQA 1NWWA 1IVUA 1D6UA 2KCDA 1JZDA 1BRSA 5IEOA 5LC7A 1C54A 3SVAA 4HM2B 4EBGA 3KZTA 3LTAA 3OWYA 3WOEB 3CCJ3 2WGOA 3X40A 3GAXA 4KT3B 2IA7A 1LNIA 1ROVA 1YI23 1A90A 2AAEA 4L8PA 1BRKA 2HMOB 3CMA3 3QK9A 3UL6A 1RRLA 4QWTA 1GMQA 2CH9A 1SIHA 1MGWA 1N9EA 2HOHA 4O3VA 4R4KA 3X3ZA 1W6CA 3JVCA 1N8QA 1YNVX 1N5PA 3D9RA 1RCLA 3JUMA 3IMAB 3ZFZA 1LOXA 1QAFA 2F4YA 2R41A 3TDGA 5AEUB 1AVLA 3S27A 1IDPA 3WA2X 3F8XA 1BRIA 3UL5A 3CPOA 3AHSA 4XBTA 6STDA 3KSED 1MWSA 3D79A 1IV9A 1W00A 2B24B 5EVHA 2CX0A 1Q40B 1DETA 3GWRA 5BU4A 2D1WA 4GB5A 2C4BA 3PZWA 1GY7A 2P09A 2P38A 1OUNA 1QVG2 2CG0A 5IG4A 2ZL8A 2CFDA 1O7PB 3HIGA 3G4S3 1JZOA 5IG5A 4R9KA 4RBNA 1TUHA 1RMSA 2ZDJA 4HM8B 3PCRA 4R9LA 2MC8A 1QJGA 3CCQ3 1BRGA 2OOVC 5D81A 3CCE3 2BT3A 3MG1A 2LYXA 4FMAA 2ZA4A 3ZG0A 1A2VA 4HM7B 3F9SA 3G6E3 3K7CA 4HJLB 4IIAA 5D82A 1Q824 1VZZA 1KWIA 1OCVA 3D5GA 1Y4KA 3PS8A 4BL2A 1TRQA 1NB5I 3FCSB 2CFWA 2KF4A 4KVHA 1UCLA 2F5MA 4XB5A 3K0ZA 2L1SA 1IYYA 1YIJ3 4STDA 3LTCA 3LTDA 1L5GB 5CF1A 3CCM3 3EHCA 4MMXB 4EV2A 1FGQA 1Q7HA 4BIRA 1K41A 1BAOA 1I2GA 4MEIA 3URPA 4FCZA 7STDA 2CWVA 3MG2A 3SLUA 2ML5A 1RN1A 2Q07A 3OX9A 4AKYA 1BANA 2W56B 1HYFA 1FGMA 1IV7A 3BNDA 3U97A 5I97A 4KFFA 3G0KA 4Q53A 1K28A 3E99A 1Q40A 1A2PA 2FGTA 2GBWB 1IK3A 1FGRA 1N9JA 4OUQA 2CW9A 1O7MB 1BNSA 1DE3A 5FGOA 1A67A 1W5ZA 1BUJA 3QRDA 3T0UA 3EE1A 4N6TA 1GMRA 2F98A 5CLKA 7RNTA 1IT8A 2Z77A 3N8BA 3G713 2CFKA 3EN8A 3OV4A 4RZMA 4H3UA 1SQWA 3KSPA 4PEJA 3WHOA 1B2XA 2O9UX 2W03A 2CK3H 1I70A 1TRPA 3HX8A 4HAAA 1M1XB 2OQEC 3BNEA 2GEYA 5KP1A 1QMAA 3Q90A 4JRFA 3A76A 4RNZA 3V98A 5M1AA 1LOVA 2HMKB 1GOYA 1T2HA 4XBYA 2OTL3 1JRQA 1O7GB 3WDGB 5JPPA 3FF2A 3DGYA 3UJMA 3MG3A 5IG0A 1BOXA 1IVWA 1YGWA 3LZAA 3N9HA 1LQMB 1BSAA 1OHOA 1UUWB 1STFI 3X3XA 3VF1A 4WYKB 3OXAA 1M1K4 3PCSA 3CC23 1IU7A 2W2CA 5A0OB 1FA3A 1JV2B 3KN4A 2XGLA 1VQN3 4KFDA 1VQM3 1GY5A 1AR0A 3GZXB 3V92A 1ROAA 4LMIA 1TJDA 1V57A 1PFPA 2W56A 4K90B 4J5GA 3WA3A 3CPW2 1GYBA 1RDSA 4GL6A 1WMNA 3CXC2 1M904 1ZGXA 1US1A 2H0HA 1OGZA 2CIUA 3OWSA 1W02A 1GSPA 3U1WA 3NQZA 1MWTA 5IEPA 1CYVA 2BIRA 3EJVA 3ZG5A 1M9GA 2CWUA 2IY2A 4FMCA 1SARA 3EB8A 4XBXA 2P0XA 3BB9A 1VQ43 1DMMA 1CH0A 1I2FA 1I2EA 1UCKA 5BXQA 1MWRA 3S67A 3NM7A 2Z7AA 4HOHA 3CCU3 1GOUA 1NB3I 1OHPA 1B3SA 4KFEA 3OW22 1LVNA
chains in the Genus database with same CATH topology
1Q9EA 2C4BA 3A5EA 1BGSA 1FUSA 1I0XA 1GMPA 1BNRA 1RTUA 1RMSA 1BRHA 1BNIA 3KCHA 1AY7A 1G02A 1BRGA 1BVIA 2KF3A 2ZA4A 1B27A 1PYLA 1RGKA 2F5WA 1B2SA 1YVSA 4RNTA 3D5GA 7GSPA 1TRQA 1BSCA 1PY3A 1BU4A 1FZUA 1RGFA 2F56A 2KF4A 5GSPA 1UCLA 2F5MA 2KF6A 1BSEA 3Q3FA 1JBTA 2SARA 1IYYA 4J5KA 1RGLA 5BU4A 1BSBA 4BIRA 1HZ1A 1BAOA 1I2GA 3URPA 3WR2A 1RGGA 1RN1A 1RGAA 1X1UA 3BIRA 2GSPA 1BANA 6GSPA 1HYFA 1RHLA 1JBRA 1BNFA 1B21A 2RBIA 1T2IA 2RNTA 1FUTA 1AQZA 1A2PA 1R4YA 3AHWA 3DH2A 1JBSA 1BRNL 1I8VA 4GHOA 1BNSA 1BNEA 1RGHA 1LOWA 1RSNA 1DE3A 1BUJA 1B2MA 1X1YA 1X1WA 1GMRA 3AGNA 3RNTA 7RNTA 1UCIA 2AADA 1BIRA 3BU4A 1MGRA 3WHOA 1RN4A 1RLSA 1BNGA 1B2XA 1RGEA 3D4AA 4HAAA 1I70A 1TRPA 5RNTA 5BIRA 1UCJA 2KF5A 1TTOA 3AGOA 3SYUA 1I3FA 1LOVA 3GSPA 1GOYA 1T2HA 6RNTA 5HOHA 3DGYA 1C54A 1BRSA 8RNTA 1BRJA 1BNJA 1BOXA 1YGWA 9RNTA 1BSAA 4BU4A 1LNIA 3D5IA 1B2ZA 1RNBA 2AAEA 1BRKA 2BU4A 1LOYA 1GMQA 1FW7A 1MGWA 2HOHA 3HOHA 4J5GA 1FYSA 1RDSA 1ZGXA 1YNVX 2KAAA 1GSPA 1RCLA 1I0VA 1GOVA 1X1XA 2BIRA 2F4YA 1SARA 1B2UA 1BSDA 1CH0A 1I2FA 1I2EA 1BRIA 1UCKA 3AHSA 4GSPA 1B20A 1RCKA 1I3IA 4HOHA 1GOUA 1RGCA 1DETA 1B3SA 1LRAA 1RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9E A;  2C4B A;  3A5E A;  1BGS A;  1FUS A;  1I0X A;  1GMP A;  1BNR A;  1RTU A;  1RMS A;  1BRH A;  1BNI A;  3KCH A;  1AY7 A;  1G02 A;  1BRG A;  1BVI A;  2KF3 A;  2ZA4 A;  1B27 A;  1PYL A;  1RGK A;  2F5W A;  1B2S A;  1YVS A;  4RNT A;  3D5G A;  7GSP A;  1TRQ A;  1BSC A;  1PY3 A;  1BU4 A;  1FZU A;  1RGF A;  2F56 A;  2KF4 A;  5GSP A;  1UCL A;  2F5M A;  2KF6 A;  1BSE A;  3Q3F A;  1JBT A;  2SAR A;  1IYY A;  4J5K A;  1RGL A;  5BU4 A;  1BSB A;  4BIR A;  1HZ1 A;  1BAO A;  1I2G A;  3URP A;  3WR2 A;  1RGG A;  1RN1 A;  1RGA A;  1X1U A;  3BIR A;  2GSP A;  1BAN A;  6GSP A;  1HYF A;  1RHL A;  1JBR A;  1BNF A;  1B21 A;  2RBI A;  1T2I A;  2RNT A;  1FUT A;  1AQZ A;  1A2P A;  1R4Y A;  3AHW A;  3DH2 A;  1JBS A;  1BRN L;  1I8V A;  4GHO A;  1BNS A;  1BNE A;  1RGH A;  1LOW A;  1RSN A;  1DE3 A;  1BUJ A;  1B2M A;  1X1Y A;  1X1W A;  1GMR A;  3AGN A;  3RNT A;  7RNT A;  1UCI A;  2AAD A;  1BIR A;  3BU4 A;  1MGR A;  3WHO A;  1RN4 A;  1RLS A;  1BNG A;  1B2X A;  1RGE A;  3D4A A;  4HAA A;  1I70 A;  1TRP A;  5RNT A;  5BIR A;  1UCJ A;  2KF5 A;  1TTO A;  3AGO A;  3SYU A;  1I3F A;  1LOV A;  3GSP A;  1GOY A;  1T2H A;  6RNT A;  5HOH A;  3DGY A;  1C54 A;  1BRS A;  8RNT A;  1BRJ A;  1BNJ A;  1BOX A;  1YGW A;  9RNT A;  1BSA A;  4BU4 A;  1LNI A;  3D5I A;  1B2Z A;  1RNB A;  2AAE A;  1BRK A;  2BU4 A;  1LOY A;  1GMQ A;  1FW7 A;  1MGW A;  2HOH A;  3HOH A;  4J5G A;  1FYS A;  1RDS A;  1ZGX A;  1YNV X;  2KAA A;  1GSP A;  1RCL A;  1I0V A;  1GOV A;  1X1X A;  2BIR A;  2F4Y A;  1SAR A;  1B2U A;  1BSD A;  1CH0 A;  1I2F A;  1I2E A;  1BRI A;  1UCK A;  3AHS A;  4GSP A;  1B20 A;  1RCK A;  1I3I A;  4HOH A;  1GOU A;  1RGC A;  1DET A;  1B3S A;  1LRA A;  1RNT A; 
#chains in the Genus database with same CATH topology
 3DMC A;  3V99 A;  3RGA A;  3EBY A;  3FG4 A;  3EF8 A;  2XSO B;  1YJ9 3;  1VQ7 3;  2CFG A;  2P05 A;  2GEX A;  3EQQ B;  4O8S A;  4CJN A;  3NBR A;  1EG9 B;  1AY7 A;  3FLJ A;  3SX1 A;  1TP6 A;  1T3B A;  3LT9 A;  3RGR A;  3DGM A;  3PGB A;  2E2U A;  2SBL A;  2Z76 A;  4FMD A;  1PYL A;  1RGK A;  1W6Y A;  2F5W A;  2QIY A;  3MPH A;  1B2S A;  1UGH I;  5JPU A;  1AVK A;  1OAC A;  1RN7 A;  4IT7 A;  2V1L A;  4WYK A;  2XH9 A;  1PY3 A;  4ILF A;  1FZU A;  1RGF A;  2M7O A;  2STD A;  3F7X A;  3NQY A;  5DRV A;  1GD4 A;  5GSP A;  4DKI A;  3Q1C A;  5M19 A;  1YVB I;  3F7S A;  5D83 A;  1YGE A;  3CC4 3;  1RGL A;  1W7C A;  3I56 3;  2A15 A;  3BNB A;  3LT8 A;  1BSB A;  1W2B 2;  4XM4 A;  1HZ1 A;  1S5A A;  3WR2 A;  1AV4 A;  4K61 A;  2H0G A;  5STD A;  2D42 A;  2K3D A;  2MF7 A;  4AEQ A;  3B4P A;  2OCT A;  3B4O A;  5AII A;  1CYU A;  2WGQ A;  3CU3 A;  1UW1 A;  1O7W B;  1T2I A;  1JB4 A;  3MHE A;  3PYJ A;  4XDW A;  2UGI A;  3FSD A;  5M18 A;  1VQ5 3;  1AQZ A;  3AMO B;  4H61 A;  1JBS A;  1O7N B;  3B7C A;  4G1M B;  1W2Z A;  1JB5 A;  1I8V A;  1RSN A;  1TFK A;  1RGH A;  1LOW A;  3HII A;  1VQO 3;  1EEJ A;  1EUI C;  2QGU A;  3HK4 A;  1V74 A;  1UCI A;  3MWZ A;  3BU4 A;  1BIR A;  4HM3 B;  1FGO A;  4XDV A;  1RLS A;  1MWU A;  1BNG A;  1RGE A;  1ZO2 A;  3D4A A;  4BTW A;  5IEN A;  1UUV B;  1EA2 A;  1VQ6 3;  5BIR A;  2WOH A;  1UCJ A;  2I9W A;  4FCM A;  3NXJ A;  1D6Y A;  1LNH A;  1I3F A;  2B1X B;  3F14 A;  1UI8 A;  3HI7 A;  4N6V 0;  6RNT A;  3FG1 A;  1VQQ A;  1IT7 A;  8RNT A;  3GZY B;  2K54 A;  1N8R 4;  2O3O A;  3VSY A;  3MSO A;  1TFO A;  2CFL A;  2WO0 A;  4K1U A;  4J8T A;  1CEW I;  2HMJ B;  2CKF B;  3D5I A;  3VGN A;  1W6G A;  2XSH B;  4MMY B;  5IF6 A;  1TU5 A;  1S72 3;  1SPU A;  3G16 A;  2JQ5 A;  3CD6 3;  1LOY A;  2W9P A;  3MYT A;  1FW7 A;  1WTH A;  2INX A;  4EV5 A;  3DGO A;  1FYS A;  4N6M A;  3F8H A;  2IYJ A;  3AMO A;  4AKZ A;  2C10 A;  2KAA A;  1X1X A;  1I0V A;  1UGI A;  1JB2 A;  4HM4 B;  1YJN 3;  3DGN A;  1B2U A;  1BSD A;  1ZX2 A;  1E97 A;  3DXO A;  3LOY A;  1U8C B;  4HM1 B;  4X2H A;  4GSP A;  1B20 A;  1RCK A;  3ALA A;  5KP4 A;  5G1L A;  4LEH A;  2XRX B;  4HM6 B;  4ZM8 A;  1LRA A;  1RNT A;  4KZ1 A;  1HU9 A;  3A5E A;  1EKM A;  1FUS A;  1I0X A;  1STD A;  5IG3 A;  1GMP A;  1BNR A;  1RTU A;  4WWU C;  2QA4 3;  1GY6 A;  1BRH A;  1BNI A;  5AYS C;  3WMD A;  4CCV A;  3NUV A;  1W01 A;  1BVI A;  1DMQ A;  3LML A;  5AIF A;  2KF3 A;  5TGN A;  3STD A;  3BLZ A;  3SED A;  3D3L A;  1TIJ A;  5AYR B;  1B27 A;  4EXR A;  1YHQ 3;  2RFR A;  1Q86 4;  1EQK A;  3I0Y A;  3X42 A;  1YVS A;  4EC6 A;  2E2V A;  4MMZ B;  7GSP A;  4WHA A;  4EYC A;  3GZB A;  1NU3 A;  2YFJ B;  4N6N B;  1BU4 A;  2W04 A;  4HVN A;  3CCV 3;  4TX4 A;  2KF6 A;  3B8L A;  3DY5 A;  1IVX A;  1W4N A;  2W0Q A;  3LYG A;  2SAR A;  3IJE B;  4NHF A;  5AI1 A;  3IPT A;  1ISK A;  4J5K A;  2YX9 A;  4LZI A;  1K9M 4;  5CF2 A;  1RKY A;  1UUG B;  5EQL A;  3M8C A;  1E3R A;  1OH0 A;  2CC3 A;  3CCL 3;  3KFQ C;  5CXO A;  3NX0 A;  4ORL A;  3S29 A;  4FCJ A;  4O02 B;  5ELJ A;  1WNH A;  1RGA A;  4LSO A;  2GSP A;  1LQG C;  3FF0 A;  6GSP A;  1RHL A;  1ULI B;  3HZP A;  4O2H A;  3CCR 3;  3CCS 3;  1B21 A;  2RNT A;  2QEX 3;  1FGT A;  1Z1S A;  1U5O A;  1D6Z A;  4HBR A;  1NJI 4;  1R4Y A;  2BMO B;  1BRN L;  2CHC A;  1G0T A;  2OWP A;  2PZV A;  4GHO A;  3S5C A;  1BNE A;  2XFT A;  1WMP A;  3K5T A;  4R80 A;  4BTY A;  4I4K A;  2J8X B;  3N54 B;  4IPB A;  4NRE A;  5BVB A;  4CPK A;  1JJ2 2;  3T8U A;  2OTJ 3;  1X1Y A;  2OOV A;  4EW5 A;  1X1W A;  1OHS A;  2XGN A;  1GS3 A;  3UB1 A;  3AGN A;  3RNT A;  5KP3 A;  2W6J H;  2XF3 A;  1CQS A;  1ZS7 A;  4HKV B;  3O8Y A;  1MGR A;  1KD1 4;  2F99 A;  1RN4 A;  4MJD A;  3DUK A;  1GD3 A;  3CME 3;  1JKG A;  4X2O A;  2GXF A;  3KE7 A;  3SOY A;  4CDL A;  1FUW A;  2RGQ A;  1VQL 3;  3AGO A;  1YJW 3;  1G96 A;  3GSP A;  2ML6 A;  4L8O A;  5ELU A;  3DZL A;  5HOH A;  3CNX A;  1IQX A;  4OVM A;  1BRJ A;  3J7Y d;  3I55 3;  1BNJ A;  2UUG C;  1ULJ B;  2HMN B;  5DRE A;  9RNT A;  4BU4 A;  3F40 A;  2XR8 B;  1LXE A;  1WMO A;  4N6L A;  1VQ8 3;  3LH4 A;  1F8N A;  2GU3 A;  2RCD A;  1B2Z A;  2WOF A;  1RNB A;  2BO9 B;  4I5Q A;  3Q2P A;  1VQ9 3;  4HM5 B;  2BU4 A;  1RRH A;  3JUN A;  1Q7Y 4;  2H0I A;  2IMJ A;  3HOH A;  1E3V A;  4HZB B;  3GRD A;  3NBB A;  4K1V A;  3K63 A;  1OF5 B;  4LYL B;  2Y74 A;  2CWT A;  1GOV A;  3LTB A;  3JUP A;  1WQL B;  3ROB A;  2LQV A;  4U13 A;  5AIH A;  1DVD A;  2W9Q A;  3EC9 A;  2JDI H;  1SJW A;  4BTX A;  1NO3 A;  2C11 A;  3JUO A;  1I3I A;  1IQ8 A;  4HM0 B;  2IUK A;  3MKI A;  1JNQ A;  1DVC A;  2F86 B;  5IW9 A;  1RGC A;  2XEP A;  1B2M A;  1Q9E A;  1NNV A;  2OQE A;  3NBJ A;  1BGS A;  2ZHX B;  1R4C A;  4N6U A;  8CHO A;  4OK0 A;  1KSI A;  1JN5 B;  3GZR A;  4FR9 A;  4JF8 A;  2BHM A;  3KCH A;  3EBT A;  3ECF A;  1G02 A;  3H3H A;  1QAK A;  2BMR B;  2IUJ A;  4N6O B;  2HML B;  3SXX A;  3H51 A;  2PNC A;  1IQY A;  1RJO A;  1T5Y A;  3EN1 B;  3X41 A;  2CG1 A;  3K9M C;  5LC6 A;  1OPY A;  2Y73 A;  1QAL A;  1C7H A;  2E2T A;  2HMM B;  4RNT A;  3WOF B;  3KKG A;  3NV0 B;  3CC7 3;  3FG3 A;  2RSX A;  3NHX A;  1BSC A;  2BMQ B;  2L4V A;  3FH1 A;  3FGY A;  2F56 A;  1DYU A;  4LGQ A;  1V58 A;  3ER7 A;  3G8Z A;  1BSE A;  3Q3F A;  4FMB A;  5JBS A;  1QVF 2;  3WOD G;  1J2B A;  2XFS A;  1JBT A;  1UI7 A;  4BL3 A;  1K8A 4;  4N3V A;  3LXU X;  1SII A;  1VQK 3;  1KC8 4;  5G2G A;  3S28 A;  1OF5 A;  4L7K A;  4NPB A;  5FW5 A;  1PU4 A;  1OGX A;  4J9A A;  1KQS 2;  1A2K A;  1Q81 4;  3UNL A;  1NDO B;  1K73 4;  1RGG A;  3SOA A;  5IER A;  1MNL A;  1X1U A;  3CNM A;  1YIT 3;  3BIR A;  3FZW A;  4WP5 A;  1Q42 A;  5G1K A;  4HZ9 B;  3DGL A;  1BNF A;  1JBR A;  3RDE A;  2RBI A;  2UX0 A;  1FUT A;  1JKG B;  4HYZ A;  2GBX B;  1N5H A;  3DH2 A;  3AHW A;  1IVV A;  2K0M A;  1UDI I;  2KXG A;  2R4I A;  2YFL B;  5EEO A;  1O7H B;  1ASK A;  2Z6B A;  2GU1 A;  1HKX A;  2BNG A;  3FKA A;  1JN5 A;  3X3Y A;  1BUQ A;  3PXM A;  2CX1 A;  3DM8 A;  2P0M A;  3BNC A;  2KRT A;  3KII A;  3L0R A;  2AAD A;  3NM2 A;  1MOL A;  2FXT A;  3T8N A;  3OWU A;  5RNT A;  4R1K A;  4WFO A;  3EX9 A;  2FNQ A;  4RNY A;  3NV0 A;  2KF5 A;  5HGR A;  1TTO A;  3SYU A;  5CK6 A;  2YFI B;  5AEW B;  5AIG A;  1DMN A;  1VQP 3;  3JUQ A;  1NWW A;  1IVU A;  1D6U A;  2KCD A;  1JZD A;  1BRS A;  5IEO A;  5LC7 A;  1C54 A;  3SVA A;  4HM2 B;  4EBG A;  3KZT A;  3LTA A;  3OWY A;  3WOE B;  3CCJ 3;  2WGO A;  3X40 A;  3GAX A;  4KT3 B;  2IA7 A;  1LNI A;  1ROV A;  1YI2 3;  1A90 A;  2AAE A;  4L8P A;  1BRK A;  2HMO B;  3CMA 3;  3QK9 A;  3UL6 A;  1RRL A;  4QWT A;  1GMQ A;  2CH9 A;  1SIH A;  1MGW A;  1N9E A;  2HOH A;  4O3V A;  4R4K A;  3X3Z A;  1W6C A;  3JVC A;  1N8Q A;  1YNV X;  1N5P A;  3D9R A;  1RCL A;  3JUM A;  3IMA B;  3ZFZ A;  1LOX A;  1QAF A;  2F4Y A;  2R41 A;  3TDG A;  5AEU B;  1AVL A;  3S27 A;  1IDP A;  3WA2 X;  3F8X A;  1BRI A;  3UL5 A;  3CPO A;  3AHS A;  4XBT A;  6STD A;  3KSE D;  1MWS A;  3D79 A;  1IV9 A;  1W00 A;  2B24 B;  5EVH A;  2CX0 A;  1Q40 B;  1DET A;  3GWR A;  5BU4 A;  2D1W A;  4GB5 A;  2C4B A;  3PZW A;  1GY7 A;  2P09 A;  2P38 A;  1OUN A;  1QVG 2;  2CG0 A;  5IG4 A;  2ZL8 A;  2CFD A;  1O7P B;  3HIG A;  3G4S 3;  1JZO A;  5IG5 A;  4R9K A;  4RBN A;  1TUH A;  1RMS A;  2ZDJ A;  4HM8 B;  3PCR A;  4R9L A;  2MC8 A;  1QJG A;  3CCQ 3;  1BRG A;  2OOV C;  5D81 A;  3CCE 3;  2BT3 A;  3MG1 A;  2LYX A;  4FMA A;  2ZA4 A;  3ZG0 A;  1A2V A;  4HM7 B;  3F9S A;  3G6E 3;  3K7C A;  4HJL B;  4IIA A;  5D82 A;  1Q82 4;  1VZZ A;  1KWI A;  1OCV A;  3D5G A;  1Y4K A;  3PS8 A;  4BL2 A;  1TRQ A;  1NB5 I;  3FCS B;  2CFW A;  2KF4 A;  4KVH A;  1UCL A;  2F5M A;  4XB5 A;  3K0Z A;  2L1S A;  1IYY A;  1YIJ 3;  4STD A;  3LTC A;  3LTD A;  1L5G B;  5CF1 A;  3CCM 3;  3EHC A;  4MMX B;  4EV2 A;  1FGQ A;  1Q7H A;  4BIR A;  1K41 A;  1BAO A;  1I2G A;  4MEI A;  3URP A;  4FCZ A;  7STD A;  2CWV A;  3MG2 A;  3SLU A;  2ML5 A;  1RN1 A;  2Q07 A;  3OX9 A;  4AKY A;  1BAN A;  2W56 B;  1HYF A;  1FGM A;  1IV7 A;  3BND A;  3U97 A;  5I97 A;  4KFF A;  3G0K A;  4Q53 A;  1K28 A;  3E99 A;  1Q40 A;  1A2P A;  2FGT A;  2GBW B;  1IK3 A;  1FGR A;  1N9J A;  4OUQ A;  2CW9 A;  1O7M B;  1BNS A;  1DE3 A;  5FGO A;  1A67 A;  1W5Z A;  1BUJ A;  3QRD A;  3T0U A;  3EE1 A;  4N6T A;  1GMR A;  2F98 A;  5CLK A;  7RNT A;  1IT8 A;  2Z77 A;  3N8B A;  3G71 3;  2CFK A;  3EN8 A;  3OV4 A;  4RZM A;  4H3U A;  1SQW A;  3KSP A;  4PEJ A;  3WHO A;  1B2X A;  2O9U X;  2W03 A;  2CK3 H;  1I70 A;  1TRP A;  3HX8 A;  4HAA A;  1M1X B;  2OQE C;  3BNE A;  2GEY A;  5KP1 A;  1QMA A;  3Q90 A;  4JRF A;  3A76 A;  4RNZ A;  3V98 A;  5M1A A;  1LOV A;  2HMK B;  1GOY A;  1T2H A;  4XBY A;  2OTL 3;  1JRQ A;  1O7G B;  3WDG B;  5JPP A;  3FF2 A;  3DGY A;  3UJM A;  3MG3 A;  5IG0 A;  1BOX A;  1IVW A;  1YGW A;  3LZA A;  3N9H A;  1LQM B;  1BSA A;  1OHO A;  1UUW B;  1STF I;  3X3X A;  3VF1 A;  4WYK B;  3OXA A;  1M1K 4;  3PCS A;  3CC2 3;  1IU7 A;  2W2C A;  5A0O B;  1FA3 A;  1JV2 B;  3KN4 A;  2XGL A;  1VQN 3;  4KFD A;  1VQM 3;  1GY5 A;  1AR0 A;  3GZX B;  3V92 A;  1ROA A;  4LMI A;  1TJD A;  1V57 A;  1PFP A;  2W56 A;  4K90 B;  4J5G A;  3WA3 A;  3CPW 2;  1GYB A;  1RDS A;  4GL6 A;  1WMN A;  3CXC 2;  1M90 4;  1ZGX A;  1US1 A;  2H0H A;  1OGZ A;  2CIU A;  3OWS A;  1W02 A;  1GSP A;  3U1W A;  3NQZ A;  1MWT A;  5IEP A;  1CYV A;  2BIR A;  3EJV A;  3ZG5 A;  1M9G A;  2CWU A;  2IY2 A;  4FMC A;  1SAR A;  3EB8 A;  4XBX A;  2P0X A;  3BB9 A;  1VQ4 3;  1DMM A;  1CH0 A;  1I2F A;  1I2E A;  1UCK A;  5BXQ A;  1MWR A;  3S67 A;  3NM7 A;  2Z7A A;  4HOH A;  3CCU 3;  1GOU A;  1NB3 I;  1OHP A;  1B3S A;  4KFE A;  3OW2 2;  1LVN A; 
#chains in the Genus database with same CATH homology
 1Q9E A;  2C4B A;  3A5E A;  1BGS A;  1FUS A;  1I0X A;  1GMP A;  1BNR A;  1RTU A;  1RMS A;  1BRH A;  1BNI A;  3KCH A;  1AY7 A;  1G02 A;  1BRG A;  1BVI A;  2KF3 A;  2ZA4 A;  1B27 A;  1PYL A;  1RGK A;  2F5W A;  1B2S A;  1YVS A;  4RNT A;  3D5G A;  7GSP A;  1TRQ A;  1BSC A;  1PY3 A;  1BU4 A;  1FZU A;  1RGF A;  2F56 A;  2KF4 A;  5GSP A;  1UCL A;  2F5M A;  2KF6 A;  1BSE A;  3Q3F A;  1JBT A;  2SAR A;  1IYY A;  4J5K A;  1RGL A;  5BU4 A;  1BSB A;  4BIR A;  1HZ1 A;  1BAO A;  1I2G A;  3URP A;  3WR2 A;  1RGG A;  1RN1 A;  1RGA A;  1X1U A;  3BIR A;  2GSP A;  1BAN A;  6GSP A;  1HYF A;  1RHL A;  1JBR A;  1BNF A;  1B21 A;  2RBI A;  1T2I A;  2RNT A;  1FUT A;  1AQZ A;  1A2P A;  1R4Y A;  3AHW A;  3DH2 A;  1JBS A;  1BRN L;  1I8V A;  4GHO A;  1BNS A;  1BNE A;  1RGH A;  1LOW A;  1RSN A;  1DE3 A;  1BUJ A;  1B2M A;  1X1Y A;  1X1W A;  1GMR A;  3AGN A;  3RNT A;  7RNT A;  1UCI A;  2AAD A;  1BIR A;  3BU4 A;  1MGR A;  3WHO A;  1RN4 A;  1RLS A;  1BNG A;  1B2X A;  1RGE A;  3D4A A;  4HAA A;  1I70 A;  1TRP A;  5RNT A;  5BIR A;  1UCJ A;  2KF5 A;  1TTO A;  3AGO A;  3SYU A;  1I3F A;  1LOV A;  3GSP A;  1GOY A;  1T2H A;  6RNT A;  5HOH A;  3DGY A;  1C54 A;  1BRS A;  8RNT A;  1BRJ A;  1BNJ A;  1BOX A;  1YGW A;  9RNT A;  1BSA A;  4BU4 A;  1LNI A;  3D5I A;  1B2Z A;  1RNB A;  2AAE A;  1BRK A;  2BU4 A;  1LOY A;  1GMQ A;  1FW7 A;  1MGW A;  2HOH A;  3HOH A;  4J5G A;  1FYS A;  1RDS A;  1ZGX A;  1YNV X;  2KAA A;  1GSP A;  1RCL A;  1I0V A;  1GOV A;  1X1X A;  2BIR A;  2F4Y A;  1SAR A;  1B2U A;  1BSD A;  1CH0 A;  1I2F A;  1I2E A;  1BRI A;  1UCK A;  3AHS A;  4GSP A;  1B20 A;  1RCK A;  1I3I A;  4HOH A;  1GOU A;  1RGC A;  1DET A;  1B3S A;  1LRA A;  1RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...