1PY3A

Crystal structure of ribonuclease sa2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
94
structure length
94
Chain Sequence
b'ALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQYWSPDHYATFQEIDPRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ribonuclease
publication title Crystal structure reveals two alternative conformations in the active site of ribonuclease Sa2.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 21
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature ec 3.1.4.8: Transferred entry: 3.1.27.3.
pdb deposition date 2003-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1py3A00
1B2SA 2ZA4A 1PYLA 5HOHA 3D5IA 1RNTA 1RMSA 4BU4A 1BNFA 1I3FA 1DETA 1MGRA 1BRJA 3DH2A 2BU4A 5GSPA 1I0XA 1TRQA 3AHWA 1JBSA 1RGGA 4GHOA 1C54A 1BSCA 5BIRA 3RNTA 1FZUA 1RDSA 3AHSA 1BNSA 1BRSA 4RNTA 1B2ZA 4J5GA 1I2EA 1B3SA 1SARA 2F5MA 1RCKA 3URPA 1I0VA 2BIRA 1HYFA 1IYYA 1BRHA 1RLSA 3AGNA 1A2PA 1I3IA 1YNVX 1JBRA 1BANA 1BNJA 1BNEA 1B2UA 1GOYA 1UCLA 2SARA 3Q3FA 7GSPA 1BSEA 2GSPA 1RTUA 4J5KA 1X1YA 1RGEA 1TTOA 3A5EA 3DGYA 1DE3A 1LOVA 1YVSA 3GSPA 1HZ1A 2RNTA 1X1UA 2F4YA 1BGSA 2KAAA 6RNTA 1I8VA 1RGLA 1BRIA 1B27A 1LOYA 1LNIA 1BRNL 7RNTA 1B21A 1BU4A 1B20A 1CH0A 2KF5A 3WR2A 1GSPA 3AGOA 1RNBA 5RNTA 1UCKA 1MGWA 2KF4A 1ZGXA 1BRGA 1B2XA 1FYSA 1RGHA 1RSNA 1AY7A 3HOHA 1BNRA 2AAEA 4HOHA 1B2MA 1JBTA 1RGKA 1R4YA 1AQZA 1FUTA 1GMRA 1GOUA 2HOHA 1BUJA 1GMQA 3KCHA 1LRAA 1I2FA 1FUSA 2AADA 1LOWA 3SYUA 1FW7A 2F5WA 1RN1A 1BAOA 1BSDA 1RN4A 1G02A 1UCIA 1X1XA 1PY3A 6GSPA 1RGAA 1T2IA 2C4BA 1BNGA 2KF6A 1BOXA 1RGCA 1BSAA 1RGFA 1X1WA 5BU4A 1BSBA 2KF3A 8RNTA 1GMPA 1I70A 1TRPA 1UCJA 3BU4A 1BIRA 1BRKA 2F56A 1I2GA 3BIRA 1BVIA 4GSPA 1RCLA 9RNTA 1YGWA 3D5GA 1T2HA 1Q9EA 4BIRA 4HAAA 1RHLA 1GOVA 2RBIA 1BNIA 3WHOA 3D4AA
chains in the Genus database with same CATH superfamily
2GBWB 3V98A 1JN5B 5D82A 2W9QA 1NU3A 1DMQA 1V58A 3LTCA 2R4IA 5KP4A 1DETA 4XBYA 1O7NB 2FGTA 1JN5A 1OPYA 2V1LA 4FCJA 4WYKB 1STDA 1JZOA 3NXJA 3B4PA 4K1VA 1Q40B 2OQEA 3SVAA 1C54A 4XB5A 3RNTA 5DRVA 1FZUA 1HU9A 4MMYB 1IT7A 2XFSA 5EQLA 1Q40A 8RNTA 1SJWA 1BRSA 2CWVA 3X3YA 2CW9A 2Y73A 2CX0A 5HGRA 1B2ZA 1M904 1JJ22 4I4KA 1EQKA 4NREA 4O8SA 5JBSA 1I2EA 4OVMA 3G0KA 5I97A 5M18A 1A90A 2XF3A 1O7PB 2CG1A 1KWIA 2WO0A 4WP5A 2IA7A 1NWWA 3QK9A 3URPA 1N8R4 1HKXA 1S5AA 2GEXA 2CFDA 3SLUA 2XGLA 3EQQB 3FG1A 1V57A 1YNVX 3T8UA 1BNJA 3I0YA 1B2UA 4N6OB 4TX4A 4FMBA 1VQK3 4R9LA 1TIJA 3FG3A 1RGEA 3A5EA 1VQM3 5JPUA 3KSPA 4L8OA 1YVSA 1YJ93 3PCRA 3BNEA 3DY5A 1AVKA 1UUWB 2L4VA 4KFFA 4LEHA 1HZ1A 1ASKA 1ZX2A 1BGSA 3K63A 3N8BA 2CH9A 1UGHI 3UL5A 1B27A 2XGNA 7RNTA 1IVXA 1ROVA 3Q2PA 3CC73 4O3VA 3WOEB 4BL3A 2B24B 3X40A 3GZYB 1LXEA 2XFTA 1UCKA 1UUVB 3LZAA 4RBNA 3LYGA 1JB4A 3CNXA 3EB8A 4HM1B 3FGYA 3F8HA 4BTWA 4BTXA 1RGHA 5D81A 5AEUB 2B1XB 2LYXA 5AYRB 1BNRA 4HOHA 4FR9A 1JBTA 5EVHA 1CYVA 3X3ZA 1R4YA 1Q7HA 3F14A 5IENA 1FUTA 5CXOA 1GMRA 1GYBA 1JKGA 1LOXA 1GMQA 1QAFA 3OWSA 4HM7B 1V74A 4L8PA 5IEOA 1JNQA 1I2FA 1NDOB 1W5ZA 1NB5I 2M7OA 1RN7A 2OWPA 2CFWA 4ZM8A 4PEJA 3PCSA 1RN1A 1BAOA 1RN4A 2OCTA 3BNCA 1EUIC 1UCIA 1FGQA 3E99A 1W01A 3LOYA 1T2IA 3G6E3 4KFEA 3AMOB 1BOXA 3OWUA 1RGCA 1BSAA 1IV7A 1IQXA 1X1WA 3OW22 1MWSA 1U5OA 2BT3A 5EEOA 2W04A 4IT7A 3MPHA 3JUPA 1PFPA 5FW5A 1I70A 3OX9A 1TRPA 2IUKA 2MF7A 1RJOA 2XRXB 3F7SA 3N54B 1BRKA 4HM8B 3DM8A 2F56A 4H3UA 4HM3B 3SEDA 3K5TA 1O7WB 3MG3A 1UI8A 5IEPA 1MWTA 4HJLB 3D5GA 1VQ43 4BTYA 4HAAA 1OH0A 1WMNA 1ZO2A 1GS3A 3GAXA 3SXXA 2ZHXB 2ZA4A 2PZVA 2RSXA 3MYTA 3Q1CA 1IVUA 3CU3A 2ZL8A 2RCDA 1AR0A 4HKVB 4LYLB 1YJN3 1YJW3 4FMCA 5GSPA 1Q864 1I0XA 3PGBA 4R4KA 2GU1A 3AHWA 3K7CA 5TGNA 1IQYA 3DZLA 3KN4A 3VSYA 4OUQA 4EC6A 1G96A 3AHSA 3WODG 1YHQ3 1LQGC 4LSOA 2QIYA 3M8CA 3X42A 3CME3 3EX9A 2IMJA 4J5GA 3V92A 1F8NA 3BB9A 2JQ5A 3S67A 2Z7AA 1B3SA 1YIJ3 4J9AA 2F5MA 1IU7A 3KIIA 3FCSB 1FA3A 1RRHA 3LT9A 1D6UA 4NHFA 3WA2X 3FH1A 2F99A 4HZ9B 1RLSA 1UI7A 5STDA 3AGNA 1S723 1WTHA 1VQQA 1JBRA 1BANA 1GOYA 1UGIA 2RFRA 3DGNA 4AKYA 1IVWA 4J5KA 1TTOA 2KCDA 3NM2A 4KFDA 1GD4A 1LOVA 1W00A 3X41A 3GSPA 2W03A 2OTL3 1AVLA 3KSED 1DVDA 5IG5A 1UDII 8CHOA 2WOFA 1M1XB 2BO9B 1CQSA 2F4YA 1Q814 2KAAA 3EJVA 6RNTA 1RGLA 2ML6A 1BRNL 5M1AA 2WOHA 6STDA 1GY6A 1BU4A 2KRTA 3GZXB 3CCM3 3AGOA 1JB2A 2H0GA 3HI7A 5RNTA 1WQLB 1OGXA 1CEWI 2HMJB 4FMDA 4DKIA 3CC23 4XBXA 1MGWA 5A0OB 3LH4A 3ROBA 1KQS2 3U1WA 2CFLA 4HM6B 4HZBB 1VQN3 4CJNA 1B2XA 2FNQA 1RSNA 4J8TA 1AV4A 1N5PA 3D9RA 3SX1A 1M9GA 1O7GB 2P38A 3EHCA 1O7HB 2JDIH 3LT8A 4JF8A 1VQ93 5ELJA 2W6JH 2CC3A 4BL2A 3S27A 4HM4B 2INXA 1FUSA 1Q7Y4 1LOWA 1NB3I 4HM0B 4MJDA 2ZDJA 1BSDA 1Z1SA 5CLKA 5CF2A 1W02A 6GSPA 3RGAA 1T3BA 1OACA 3S28A 1MOLA 2KF6A 2GBXB 4ILFA 3I553 2XEPA 4N6MA 1Q824 4IPBA 2QA43 3LTDA 3WMDA 1E97A 1N8QA 1IT8A 3PS8A 3UJMA 5AIIA 1JKGB 1BIRA 4WHAA 3K0ZA 1J2BA 1OCVA 4MEIA 2BMOB 4GSPA 3WOFB 5IG0A 3IPTA 1QAKA 1RCLA 3GWRA 4EYCA 3F40A 3T0UA 3EN8A 3LXUX 1BNIA 2Y74A 2GXFA 3NUVA 1RRLA 1A67A 3IMAB 1B2SA 3LMLA 1PYLA 5KP3A 2CHCA 1EEJA 3D5IA 2BHMA 1RMSA 2K0MA 3HIIA 4BU4A 5HOHA 1W7CA 3KE7A 4STDA 3GRDA 1MGRA 2MC8A 2WGQA 4EV5A 1ROAA 2Z76A 3CCR3 3RDEA 4RZMA 1GY7A 2GU3A 4Q53A 3DH2A 1BUQA 1GY5A 3EC9A 3CCU3 4LZIA 3NBBA 1JBSA 2KXGA 3SOYA 2ML5A 3G713 4U13A 5BIRA 1RDSA 3FLJA 2XSOB 3LTBA 2YFLB 2OOVA 3CCV3 1BNSA 3UNLA 3CC43 2CG0A 4QWTA 4O02B 1IV9A 5D83A 4RNTA 3NQZA 3ZG5A 4N6LA 1L5GB 1Q42A 2LQVA 4XBTA 5IW9A 4N6NB 4WFOA 3JVCA 3DMCA 3KFQC 3S29A 4H61A 3HZPA 2W9PA 1SARA 3CNMA 1RCKA 1FGMA 5AIGA 1JB5A 1I0VA 5LC7A 1ULJB 2BIRA 2WGOA 3CCS3 4CPKA 1FGOA 3NBRA 2BMRB 3DXOA 1VQ83 1ULIB 3CXC2 3D3LA 3Q90A 3HIGA 4KVHA 1A2VA 2HMNB 4K61A 3CPW2 1UCLA 1BNEA 4HM2B 1W2B2 2CX1A 3GZBA 3Q3FA 1G0TA 1UUGB 4RNZA 1BSEA 3IJEB 1LNHA 1RTUA 2GSPA 4N3VA 3I563 1KD14 7STDA 1X1YA 4I5QA 4ORLA 1N5HA 2O9UX 1QVF2 1DE3A 2FXTA 4AKZA 2RGQA 3FZWA 3SOAA 2C11A 2CFKA 5G2GA 5KP1A 2RNTA 4AEQA 3GZRA 4HM5B 5M19A 1STFI 5G1LA 3PZWA 2F86B 3NHXA 1LNIA 1K28A 1VQL3 1VZZA 3S5CA 4RNYA 3H3HA 1B20A 2KF5A 1E3RA 4NPBA 3WR2A 2OOVC 1RNBA 3FF2A 3EBTA 3F7XA 3U97A 3PYJA 1GD3A 4EBGA 5AIFA 1FUWA 1O7MB 2KF4A 4CCVA 3KKGA 2QGUA 1FGTA 1ZGXA 3J7Yd 1VQ53 3G8ZA 1OUNA 2HMKB 5IG4A 2H0IA 2AAEA 2BMQB 1B2MA 2IYJA 1MWRA 1RGKA 1YGEA 3JUQA 1TFKA 3NQYA 2C10A 5AYSC 2QEX3 3VGNA 3KCHA 3NM7A 4GB5A 1LRAA 1ZS7A 3MHEA 3NBJA 2O3OA 1IVVA 2I9WA 3B8LA 2SBLA 1DYUA 1FW7A 2XR8B 4IIAA 2YFIB 3N9HA 5ELUA 4GL6A 1X1XA 1E3VA 1UW1A 2E2TA 2UX0A 3X3XA 1TU5A 2C4BA 2STDA 3JUMA 4N6TA 3CMA3 4N6V0 3MG1A 2IUJA 1Y4KA 1W6GA 3STDA 2W0QA 3MSOA 5AEWB 3B4OA 1FGRA 1BSBA 3G4S3 4N6UA 4WYKA 1QMAA 1GMPA 2E2UA 3TDGA 1YIT3 3HK4A 1UCJA 1OHOA 2D42A 1QVG2 3EBYA 1I2GA 4L7KA 3A76A 1US1A 2YFJB 1DVCA 5IF6A 3DUKA 5LC6A 4BIRA 2OTJ3 1TJDA 2RBIA 3ZG0A 3CCE3 1SIHA 1WNHA 3DGMA 1SPUA 3B7CA 4O2HA 1QJGA 2GEYA 3MG2A 1EKMA 1OHSA 1RNTA 2YX9A 3CCQ3 1QALA 1BNFA 1K41A 5AI1A 2L1SA 1I3FA 1ISKA 2UUGC 1LVNA 3CCL3 1VQP3 3CD63 2BNGA 2PNCA 2Z77A 3CPOA 1BRJA 1JZDA 2CKFB 3JUNA 2BU4A 1TRQA 3ALAA 3VF1A 1W2ZA 1A2KA 1RGGA 2P09A 2W2CA 4FMAA 4GHOA 2H0HA 3O8YA 1BSCA 4HYZA 1NJI4 1JRQA 3BNDA 2F98A 3H51A 1D6ZA 5BXQA 4LGQA 2J8XB 1D6YA 3OXAA 1YI23 5BVBA 3DGOA 5AIHA 1R4CA 4HVNA 1IDPA 1KSIA 3ECFA 2OQEC 1TP6A 3BLZA 4R80A 3UL6A 4EV2A 1M1K4 2A15A 3K9MC 1HYFA 2D1WA 1BRHA 2Q07A 4MMZB 1IYYA 2CWTA 3EN1B 3MKIA 1W6CA 1A2PA 1I3IA 2P05A 3FF0A 5IG3A 2SARA 3EE1A 1OGZA 5DREA 1TFOA 3V99A 3NX0A 2UGIA 1MNLA 2CK3H 2XSHB 7GSPA 1CYUA 3L0RA 3DGYA 2HMLB 1EA2A 3HX8A 1SQWA 3EF8A 4X2HA 5G1KA 3FSDA 4FCZA 3D79A 4K90B 1WMPA 2E2VA 2W56B 3T8NA 1W4NA 1X1UA 3WDGB 3KZTA 4OK0A 1DMNA 4KZ1A 3ER7A 1I8VA 1BRIA 4K1UA 2K3DA 1LOYA 1NO3A 1K734 1EG9B 1B21A 1CH0A 1LQMB 2W56A 3DGLA 3F9SA 5IERA 4FCMA 3UB1A 1GSPA 4HBRA 1VQ63 4CDLA 4EW5A 3AMOA 1OHPA 1BRGA 1W6YA 1FYSA 3HOHA 3OV4A 3WA3A 1AY7A 1K8A4 4MMXB 4EXRA 1YVBI 1DMMA 2IY2A 3MWZA 2CWUA 2HMOB 3OWYA 4XDVA 1AQZA 1BUJA 1GOUA 2HOHA 3G16A 1N9EA 1U8CB 5CK6A 3BNBA 1WMOA 5CF1A 2AADA 4KT3B 3SYUA 1OF5B 1VQ73 2F5WA 1IK3A 1TUHA 3LTAA 3FKAA 1G02A 1JV2B 2CFGA 1VQO3 1MWUA 1PY3A 1PU4A 1RGAA 1OF5A 1BNGA 4LMIA 2R41A 4XM4A 4R1KA 4XDWA 5JPPA 1RGFA 1SIIA 5BU4A 2P0XA 2Z6BA 4X2OA 3ZFZA 1IQ8A 3RGRA 2KF3A 4WWUC 1N9JA 3BU4A 3PXMA 1RKYA 5FGOA 1C7HA 2P0MA 1T5YA 1BVIA 2XH9A 3BIRA 4G1MB 2HMMB 3JUOA 3NV0B 3CCJ3 3FG4A 1K9M4 4JRFA 9RNTA 3QRDA 1YGWA 1T2HA 1Q9EA 2CIUA 1RHLA 2K54A 1GOVA 1KC84 3WHOA 1NNVA 4R9KA 3NV0A 3F8XA 3D4AA
chains in the Genus database with same CATH topology
1B2SA 2ZA4A 1PYLA 5HOHA 3D5IA 1RNTA 1RMSA 4BU4A 1BNFA 1I3FA 1DETA 1MGRA 1BRJA 3DH2A 2BU4A 5GSPA 1I0XA 1TRQA 3AHWA 1JBSA 1RGGA 4GHOA 1C54A 1BSCA 5BIRA 3RNTA 1FZUA 1RDSA 3AHSA 1BNSA 1BRSA 4RNTA 1B2ZA 4J5GA 1I2EA 1B3SA 1SARA 2F5MA 1RCKA 3URPA 1I0VA 2BIRA 1HYFA 1IYYA 1BRHA 1RLSA 3AGNA 1A2PA 1I3IA 1YNVX 1JBRA 1BANA 1BNJA 1BNEA 1B2UA 1GOYA 1UCLA 2SARA 3Q3FA 7GSPA 1BSEA 2GSPA 1RTUA 4J5KA 1X1YA 1RGEA 1TTOA 3A5EA 3DGYA 1DE3A 1LOVA 1YVSA 3GSPA 1HZ1A 2RNTA 1X1UA 2F4YA 1BGSA 2KAAA 6RNTA 1I8VA 1RGLA 1BRIA 1B27A 1LOYA 1LNIA 1BRNL 7RNTA 1B21A 1BU4A 1B20A 1CH0A 2KF5A 3WR2A 1GSPA 3AGOA 1RNBA 5RNTA 1UCKA 1MGWA 2KF4A 1ZGXA 1BRGA 1B2XA 1FYSA 1RGHA 1RSNA 1AY7A 3HOHA 1BNRA 2AAEA 4HOHA 1B2MA 1JBTA 1RGKA 1R4YA 1AQZA 1FUTA 1GMRA 1GOUA 2HOHA 1BUJA 1GMQA 3KCHA 1LRAA 1I2FA 1FUSA 2AADA 1LOWA 3SYUA 1FW7A 2F5WA 1RN1A 1BAOA 1BSDA 1RN4A 1G02A 1UCIA 1X1XA 1PY3A 6GSPA 1RGAA 1T2IA 2C4BA 1BNGA 2KF6A 1BOXA 1RGCA 1BSAA 1RGFA 1X1WA 5BU4A 1BSBA 2KF3A 8RNTA 1GMPA 1I70A 1TRPA 1UCJA 3BU4A 1BIRA 1BRKA 2F56A 1I2GA 3BIRA 1BVIA 4GSPA 1RCLA 9RNTA 1YGWA 3D5GA 1T2HA 1Q9EA 4BIRA 4HAAA 1RHLA 1GOVA 2RBIA 1BNIA 3WHOA 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2S A;  2ZA4 A;  1PYL A;  5HOH A;  3D5I A;  1RNT A;  1RMS A;  4BU4 A;  1BNF A;  1I3F A;  1DET A;  1MGR A;  1BRJ A;  3DH2 A;  2BU4 A;  5GSP A;  1I0X A;  1TRQ A;  3AHW A;  1JBS A;  1RGG A;  4GHO A;  1C54 A;  1BSC A;  5BIR A;  3RNT A;  1FZU A;  1RDS A;  3AHS A;  1BNS A;  1BRS A;  4RNT A;  1B2Z A;  4J5G A;  1I2E A;  1B3S A;  1SAR A;  2F5M A;  1RCK A;  3URP A;  1I0V A;  2BIR A;  1HYF A;  1IYY A;  1BRH A;  1RLS A;  3AGN A;  1A2P A;  1I3I A;  1YNV X;  1JBR A;  1BAN A;  1BNJ A;  1BNE A;  1B2U A;  1GOY A;  1UCL A;  2SAR A;  3Q3F A;  7GSP A;  1BSE A;  2GSP A;  1RTU A;  4J5K A;  1X1Y A;  1RGE A;  1TTO A;  3A5E A;  3DGY A;  1DE3 A;  1LOV A;  1YVS A;  3GSP A;  1HZ1 A;  2RNT A;  1X1U A;  2F4Y A;  1BGS A;  2KAA A;  6RNT A;  1I8V A;  1RGL A;  1BRI A;  1B27 A;  1LOY A;  1LNI A;  1BRN L;  7RNT A;  1B21 A;  1BU4 A;  1B20 A;  1CH0 A;  2KF5 A;  3WR2 A;  1GSP A;  3AGO A;  1RNB A;  5RNT A;  1UCK A;  1MGW A;  2KF4 A;  1ZGX A;  1BRG A;  1B2X A;  1FYS A;  1RGH A;  1RSN A;  1AY7 A;  3HOH A;  1BNR A;  2AAE A;  4HOH A;  1B2M A;  1JBT A;  1RGK A;  1R4Y A;  1AQZ A;  1FUT A;  1GMR A;  1GOU A;  2HOH A;  1BUJ A;  1GMQ A;  3KCH A;  1LRA A;  1I2F A;  1FUS A;  2AAD A;  1LOW A;  3SYU A;  1FW7 A;  2F5W A;  1RN1 A;  1BAO A;  1BSD A;  1RN4 A;  1G02 A;  1UCI A;  1X1X A;  1PY3 A;  6GSP A;  1RGA A;  1T2I A;  2C4B A;  1BNG A;  2KF6 A;  1BOX A;  1RGC A;  1BSA A;  1RGF A;  1X1W A;  5BU4 A;  1BSB A;  2KF3 A;  8RNT A;  1GMP A;  1I70 A;  1TRP A;  1UCJ A;  3BU4 A;  1BIR A;  1BRK A;  2F56 A;  1I2G A;  3BIR A;  1BVI A;  4GSP A;  1RCL A;  9RNT A;  1YGW A;  3D5G A;  1T2H A;  1Q9E A;  4BIR A;  4HAA A;  1RHL A;  1GOV A;  2RBI A;  1BNI A;  3WHO A;  3D4A A; 
#chains in the Genus database with same CATH topology
 2GBW B;  3V98 A;  1JN5 B;  5D82 A;  2W9Q A;  1NU3 A;  1DMQ A;  1V58 A;  3LTC A;  2R4I A;  5KP4 A;  1DET A;  4XBY A;  1O7N B;  2FGT A;  1JN5 A;  1OPY A;  2V1L A;  4FCJ A;  4WYK B;  1STD A;  1JZO A;  3NXJ A;  3B4P A;  4K1V A;  1Q40 B;  2OQE A;  3SVA A;  1C54 A;  4XB5 A;  3RNT A;  5DRV A;  1FZU A;  1HU9 A;  4MMY B;  1IT7 A;  2XFS A;  5EQL A;  1Q40 A;  8RNT A;  1SJW A;  1BRS A;  2CWV A;  3X3Y A;  2CW9 A;  2Y73 A;  2CX0 A;  5HGR A;  1B2Z A;  1M90 4;  1JJ2 2;  4I4K A;  1EQK A;  4NRE A;  4O8S A;  5JBS A;  1I2E A;  4OVM A;  3G0K A;  5I97 A;  5M18 A;  1A90 A;  2XF3 A;  1O7P B;  2CG1 A;  1KWI A;  2WO0 A;  4WP5 A;  2IA7 A;  1NWW A;  3QK9 A;  3URP A;  1N8R 4;  1HKX A;  1S5A A;  2GEX A;  2CFD A;  3SLU A;  2XGL A;  3EQQ B;  3FG1 A;  1V57 A;  1YNV X;  3T8U A;  1BNJ A;  3I0Y A;  1B2U A;  4N6O B;  4TX4 A;  4FMB A;  1VQK 3;  4R9L A;  1TIJ A;  3FG3 A;  1RGE A;  3A5E A;  1VQM 3;  5JPU A;  3KSP A;  4L8O A;  1YVS A;  1YJ9 3;  3PCR A;  3BNE A;  3DY5 A;  1AVK A;  1UUW B;  2L4V A;  4KFF A;  4LEH A;  1HZ1 A;  1ASK A;  1ZX2 A;  1BGS A;  3K63 A;  3N8B A;  2CH9 A;  1UGH I;  3UL5 A;  1B27 A;  2XGN A;  7RNT A;  1IVX A;  1ROV A;  3Q2P A;  3CC7 3;  4O3V A;  3WOE B;  4BL3 A;  2B24 B;  3X40 A;  3GZY B;  1LXE A;  2XFT A;  1UCK A;  1UUV B;  3LZA A;  4RBN A;  3LYG A;  1JB4 A;  3CNX A;  3EB8 A;  4HM1 B;  3FGY A;  3F8H A;  4BTW A;  4BTX A;  1RGH A;  5D81 A;  5AEU B;  2B1X B;  2LYX A;  5AYR B;  1BNR A;  4HOH A;  4FR9 A;  1JBT A;  5EVH A;  1CYV A;  3X3Z A;  1R4Y A;  1Q7H A;  3F14 A;  5IEN A;  1FUT A;  5CXO A;  1GMR A;  1GYB A;  1JKG A;  1LOX A;  1GMQ A;  1QAF A;  3OWS A;  4HM7 B;  1V74 A;  4L8P A;  5IEO A;  1JNQ A;  1I2F A;  1NDO B;  1W5Z A;  1NB5 I;  2M7O A;  1RN7 A;  2OWP A;  2CFW A;  4ZM8 A;  4PEJ A;  3PCS A;  1RN1 A;  1BAO A;  1RN4 A;  2OCT A;  3BNC A;  1EUI C;  1UCI A;  1FGQ A;  3E99 A;  1W01 A;  3LOY A;  1T2I A;  3G6E 3;  4KFE A;  3AMO B;  1BOX A;  3OWU A;  1RGC A;  1BSA A;  1IV7 A;  1IQX A;  1X1W A;  3OW2 2;  1MWS A;  1U5O A;  2BT3 A;  5EEO A;  2W04 A;  4IT7 A;  3MPH A;  3JUP A;  1PFP A;  5FW5 A;  1I70 A;  3OX9 A;  1TRP A;  2IUK A;  2MF7 A;  1RJO A;  2XRX B;  3F7S A;  3N54 B;  1BRK A;  4HM8 B;  3DM8 A;  2F56 A;  4H3U A;  4HM3 B;  3SED A;  3K5T A;  1O7W B;  3MG3 A;  1UI8 A;  5IEP A;  1MWT A;  4HJL B;  3D5G A;  1VQ4 3;  4BTY A;  4HAA A;  1OH0 A;  1WMN A;  1ZO2 A;  1GS3 A;  3GAX A;  3SXX A;  2ZHX B;  2ZA4 A;  2PZV A;  2RSX A;  3MYT A;  3Q1C A;  1IVU A;  3CU3 A;  2ZL8 A;  2RCD A;  1AR0 A;  4HKV B;  4LYL B;  1YJN 3;  1YJW 3;  4FMC A;  5GSP A;  1Q86 4;  1I0X A;  3PGB A;  4R4K A;  2GU1 A;  3AHW A;  3K7C A;  5TGN A;  1IQY A;  3DZL A;  3KN4 A;  3VSY A;  4OUQ A;  4EC6 A;  1G96 A;  3AHS A;  3WOD G;  1YHQ 3;  1LQG C;  4LSO A;  2QIY A;  3M8C A;  3X42 A;  3CME 3;  3EX9 A;  2IMJ A;  4J5G A;  3V92 A;  1F8N A;  3BB9 A;  2JQ5 A;  3S67 A;  2Z7A A;  1B3S A;  1YIJ 3;  4J9A A;  2F5M A;  1IU7 A;  3KII A;  3FCS B;  1FA3 A;  1RRH A;  3LT9 A;  1D6U A;  4NHF A;  3WA2 X;  3FH1 A;  2F99 A;  4HZ9 B;  1RLS A;  1UI7 A;  5STD A;  3AGN A;  1S72 3;  1WTH A;  1VQQ A;  1JBR A;  1BAN A;  1GOY A;  1UGI A;  2RFR A;  3DGN A;  4AKY A;  1IVW A;  4J5K A;  1TTO A;  2KCD A;  3NM2 A;  4KFD A;  1GD4 A;  1LOV A;  1W00 A;  3X41 A;  3GSP A;  2W03 A;  2OTL 3;  1AVL A;  3KSE D;  1DVD A;  5IG5 A;  1UDI I;  8CHO A;  2WOF A;  1M1X B;  2BO9 B;  1CQS A;  2F4Y A;  1Q81 4;  2KAA A;  3EJV A;  6RNT A;  1RGL A;  2ML6 A;  1BRN L;  5M1A A;  2WOH A;  6STD A;  1GY6 A;  1BU4 A;  2KRT A;  3GZX B;  3CCM 3;  3AGO A;  1JB2 A;  2H0G A;  3HI7 A;  5RNT A;  1WQL B;  1OGX A;  1CEW I;  2HMJ B;  4FMD A;  4DKI A;  3CC2 3;  4XBX A;  1MGW A;  5A0O B;  3LH4 A;  3ROB A;  1KQS 2;  3U1W A;  2CFL A;  4HM6 B;  4HZB B;  1VQN 3;  4CJN A;  1B2X A;  2FNQ A;  1RSN A;  4J8T A;  1AV4 A;  1N5P A;  3D9R A;  3SX1 A;  1M9G A;  1O7G B;  2P38 A;  3EHC A;  1O7H B;  2JDI H;  3LT8 A;  4JF8 A;  1VQ9 3;  5ELJ A;  2W6J H;  2CC3 A;  4BL2 A;  3S27 A;  4HM4 B;  2INX A;  1FUS A;  1Q7Y 4;  1LOW A;  1NB3 I;  4HM0 B;  4MJD A;  2ZDJ A;  1BSD A;  1Z1S A;  5CLK A;  5CF2 A;  1W02 A;  6GSP A;  3RGA A;  1T3B A;  1OAC A;  3S28 A;  1MOL A;  2KF6 A;  2GBX B;  4ILF A;  3I55 3;  2XEP A;  4N6M A;  1Q82 4;  4IPB A;  2QA4 3;  3LTD A;  3WMD A;  1E97 A;  1N8Q A;  1IT8 A;  3PS8 A;  3UJM A;  5AII A;  1JKG B;  1BIR A;  4WHA A;  3K0Z A;  1J2B A;  1OCV A;  4MEI A;  2BMO B;  4GSP A;  3WOF B;  5IG0 A;  3IPT A;  1QAK A;  1RCL A;  3GWR A;  4EYC A;  3F40 A;  3T0U A;  3EN8 A;  3LXU X;  1BNI A;  2Y74 A;  2GXF A;  3NUV A;  1RRL A;  1A67 A;  3IMA B;  1B2S A;  3LML A;  1PYL A;  5KP3 A;  2CHC A;  1EEJ A;  3D5I A;  2BHM A;  1RMS A;  2K0M A;  3HII A;  4BU4 A;  5HOH A;  1W7C A;  3KE7 A;  4STD A;  3GRD A;  1MGR A;  2MC8 A;  2WGQ A;  4EV5 A;  1ROA A;  2Z76 A;  3CCR 3;  3RDE A;  4RZM A;  1GY7 A;  2GU3 A;  4Q53 A;  3DH2 A;  1BUQ A;  1GY5 A;  3EC9 A;  3CCU 3;  4LZI A;  3NBB A;  1JBS A;  2KXG A;  3SOY A;  2ML5 A;  3G71 3;  4U13 A;  5BIR A;  1RDS A;  3FLJ A;  2XSO B;  3LTB A;  2YFL B;  2OOV A;  3CCV 3;  1BNS A;  3UNL A;  3CC4 3;  2CG0 A;  4QWT A;  4O02 B;  1IV9 A;  5D83 A;  4RNT A;  3NQZ A;  3ZG5 A;  4N6L A;  1L5G B;  1Q42 A;  2LQV A;  4XBT A;  5IW9 A;  4N6N B;  4WFO A;  3JVC A;  3DMC A;  3KFQ C;  3S29 A;  4H61 A;  3HZP A;  2W9P A;  1SAR A;  3CNM A;  1RCK A;  1FGM A;  5AIG A;  1JB5 A;  1I0V A;  5LC7 A;  1ULJ B;  2BIR A;  2WGO A;  3CCS 3;  4CPK A;  1FGO A;  3NBR A;  2BMR B;  3DXO A;  1VQ8 3;  1ULI B;  3CXC 2;  3D3L A;  3Q90 A;  3HIG A;  4KVH A;  1A2V A;  2HMN B;  4K61 A;  3CPW 2;  1UCL A;  1BNE A;  4HM2 B;  1W2B 2;  2CX1 A;  3GZB A;  3Q3F A;  1G0T A;  1UUG B;  4RNZ A;  1BSE A;  3IJE B;  1LNH A;  1RTU A;  2GSP A;  4N3V A;  3I56 3;  1KD1 4;  7STD A;  1X1Y A;  4I5Q A;  4ORL A;  1N5H A;  2O9U X;  1QVF 2;  1DE3 A;  2FXT A;  4AKZ A;  2RGQ A;  3FZW A;  3SOA A;  2C11 A;  2CFK A;  5G2G A;  5KP1 A;  2RNT A;  4AEQ A;  3GZR A;  4HM5 B;  5M19 A;  1STF I;  5G1L A;  3PZW A;  2F86 B;  3NHX A;  1LNI A;  1K28 A;  1VQL 3;  1VZZ A;  3S5C A;  4RNY A;  3H3H A;  1B20 A;  2KF5 A;  1E3R A;  4NPB A;  3WR2 A;  2OOV C;  1RNB A;  3FF2 A;  3EBT A;  3F7X A;  3U97 A;  3PYJ A;  1GD3 A;  4EBG A;  5AIF A;  1FUW A;  1O7M B;  2KF4 A;  4CCV A;  3KKG A;  2QGU A;  1FGT A;  1ZGX A;  3J7Y d;  1VQ5 3;  3G8Z A;  1OUN A;  2HMK B;  5IG4 A;  2H0I A;  2AAE A;  2BMQ B;  1B2M A;  2IYJ A;  1MWR A;  1RGK A;  1YGE A;  3JUQ A;  1TFK A;  3NQY A;  2C10 A;  5AYS C;  2QEX 3;  3VGN A;  3KCH A;  3NM7 A;  4GB5 A;  1LRA A;  1ZS7 A;  3MHE A;  3NBJ A;  2O3O A;  1IVV A;  2I9W A;  3B8L A;  2SBL A;  1DYU A;  1FW7 A;  2XR8 B;  4IIA A;  2YFI B;  3N9H A;  5ELU A;  4GL6 A;  1X1X A;  1E3V A;  1UW1 A;  2E2T A;  2UX0 A;  3X3X A;  1TU5 A;  2C4B A;  2STD A;  3JUM A;  4N6T A;  3CMA 3;  4N6V 0;  3MG1 A;  2IUJ A;  1Y4K A;  1W6G A;  3STD A;  2W0Q A;  3MSO A;  5AEW B;  3B4O A;  1FGR A;  1BSB A;  3G4S 3;  4N6U A;  4WYK A;  1QMA A;  1GMP A;  2E2U A;  3TDG A;  1YIT 3;  3HK4 A;  1UCJ A;  1OHO A;  2D42 A;  1QVG 2;  3EBY A;  1I2G A;  4L7K A;  3A76 A;  1US1 A;  2YFJ B;  1DVC A;  5IF6 A;  3DUK A;  5LC6 A;  4BIR A;  2OTJ 3;  1TJD A;  2RBI A;  3ZG0 A;  3CCE 3;  1SIH A;  1WNH A;  3DGM A;  1SPU A;  3B7C A;  4O2H A;  1QJG A;  2GEY A;  3MG2 A;  1EKM A;  1OHS A;  1RNT A;  2YX9 A;  3CCQ 3;  1QAL A;  1BNF A;  1K41 A;  5AI1 A;  2L1S A;  1I3F A;  1ISK A;  2UUG C;  1LVN A;  3CCL 3;  1VQP 3;  3CD6 3;  2BNG A;  2PNC A;  2Z77 A;  3CPO A;  1BRJ A;  1JZD A;  2CKF B;  3JUN A;  2BU4 A;  1TRQ A;  3ALA A;  3VF1 A;  1W2Z A;  1A2K A;  1RGG A;  2P09 A;  2W2C A;  4FMA A;  4GHO A;  2H0H A;  3O8Y A;  1BSC A;  4HYZ A;  1NJI 4;  1JRQ A;  3BND A;  2F98 A;  3H51 A;  1D6Z A;  5BXQ A;  4LGQ A;  2J8X B;  1D6Y A;  3OXA A;  1YI2 3;  5BVB A;  3DGO A;  5AIH A;  1R4C A;  4HVN A;  1IDP A;  1KSI A;  3ECF A;  2OQE C;  1TP6 A;  3BLZ A;  4R80 A;  3UL6 A;  4EV2 A;  1M1K 4;  2A15 A;  3K9M C;  1HYF A;  2D1W A;  1BRH A;  2Q07 A;  4MMZ B;  1IYY A;  2CWT A;  3EN1 B;  3MKI A;  1W6C A;  1A2P A;  1I3I A;  2P05 A;  3FF0 A;  5IG3 A;  2SAR A;  3EE1 A;  1OGZ A;  5DRE A;  1TFO A;  3V99 A;  3NX0 A;  2UGI A;  1MNL A;  2CK3 H;  2XSH B;  7GSP A;  1CYU A;  3L0R A;  3DGY A;  2HML B;  1EA2 A;  3HX8 A;  1SQW A;  3EF8 A;  4X2H A;  5G1K A;  3FSD A;  4FCZ A;  3D79 A;  4K90 B;  1WMP A;  2E2V A;  2W56 B;  3T8N A;  1W4N A;  1X1U A;  3WDG B;  3KZT A;  4OK0 A;  1DMN A;  4KZ1 A;  3ER7 A;  1I8V A;  1BRI A;  4K1U A;  2K3D A;  1LOY A;  1NO3 A;  1K73 4;  1EG9 B;  1B21 A;  1CH0 A;  1LQM B;  2W56 A;  3DGL A;  3F9S A;  5IER A;  4FCM A;  3UB1 A;  1GSP A;  4HBR A;  1VQ6 3;  4CDL A;  4EW5 A;  3AMO A;  1OHP A;  1BRG A;  1W6Y A;  1FYS A;  3HOH A;  3OV4 A;  3WA3 A;  1AY7 A;  1K8A 4;  4MMX B;  4EXR A;  1YVB I;  1DMM A;  2IY2 A;  3MWZ A;  2CWU A;  2HMO B;  3OWY A;  4XDV A;  1AQZ A;  1BUJ A;  1GOU A;  2HOH A;  3G16 A;  1N9E A;  1U8C B;  5CK6 A;  3BNB A;  1WMO A;  5CF1 A;  2AAD A;  4KT3 B;  3SYU A;  1OF5 B;  1VQ7 3;  2F5W A;  1IK3 A;  1TUH A;  3LTA A;  3FKA A;  1G02 A;  1JV2 B;  2CFG A;  1VQO 3;  1MWU A;  1PY3 A;  1PU4 A;  1RGA A;  1OF5 A;  1BNG A;  4LMI A;  2R41 A;  4XM4 A;  4R1K A;  4XDW A;  5JPP A;  1RGF A;  1SII A;  5BU4 A;  2P0X A;  2Z6B A;  4X2O A;  3ZFZ A;  1IQ8 A;  3RGR A;  2KF3 A;  4WWU C;  1N9J A;  3BU4 A;  3PXM A;  1RKY A;  5FGO A;  1C7H A;  2P0M A;  1T5Y A;  1BVI A;  2XH9 A;  3BIR A;  4G1M B;  2HMM B;  3JUO A;  3NV0 B;  3CCJ 3;  3FG4 A;  1K9M 4;  4JRF A;  9RNT A;  3QRD A;  1YGW A;  1T2H A;  1Q9E A;  2CIU A;  1RHL A;  2K54 A;  1GOV A;  1KC8 4;  3WHO A;  1NNV A;  4R9K A;  3NV0 A;  3F8X A;  3D4A A; 
#chains in the Genus database with same CATH homology
 1B2S A;  2ZA4 A;  1PYL A;  5HOH A;  3D5I A;  1RNT A;  1RMS A;  4BU4 A;  1BNF A;  1I3F A;  1DET A;  1MGR A;  1BRJ A;  3DH2 A;  2BU4 A;  5GSP A;  1I0X A;  1TRQ A;  3AHW A;  1JBS A;  1RGG A;  4GHO A;  1C54 A;  1BSC A;  5BIR A;  3RNT A;  1FZU A;  1RDS A;  3AHS A;  1BNS A;  1BRS A;  4RNT A;  1B2Z A;  4J5G A;  1I2E A;  1B3S A;  1SAR A;  2F5M A;  1RCK A;  3URP A;  1I0V A;  2BIR A;  1HYF A;  1IYY A;  1BRH A;  1RLS A;  3AGN A;  1A2P A;  1I3I A;  1YNV X;  1JBR A;  1BAN A;  1BNJ A;  1BNE A;  1B2U A;  1GOY A;  1UCL A;  2SAR A;  3Q3F A;  7GSP A;  1BSE A;  2GSP A;  1RTU A;  4J5K A;  1X1Y A;  1RGE A;  1TTO A;  3A5E A;  3DGY A;  1DE3 A;  1LOV A;  1YVS A;  3GSP A;  1HZ1 A;  2RNT A;  1X1U A;  2F4Y A;  1BGS A;  2KAA A;  6RNT A;  1I8V A;  1RGL A;  1BRI A;  1B27 A;  1LOY A;  1LNI A;  1BRN L;  7RNT A;  1B21 A;  1BU4 A;  1B20 A;  1CH0 A;  2KF5 A;  3WR2 A;  1GSP A;  3AGO A;  1RNB A;  5RNT A;  1UCK A;  1MGW A;  2KF4 A;  1ZGX A;  1BRG A;  1B2X A;  1FYS A;  1RGH A;  1RSN A;  1AY7 A;  3HOH A;  1BNR A;  2AAE A;  4HOH A;  1B2M A;  1JBT A;  1RGK A;  1R4Y A;  1AQZ A;  1FUT A;  1GMR A;  1GOU A;  2HOH A;  1BUJ A;  1GMQ A;  3KCH A;  1LRA A;  1I2F A;  1FUS A;  2AAD A;  1LOW A;  3SYU A;  1FW7 A;  2F5W A;  1RN1 A;  1BAO A;  1BSD A;  1RN4 A;  1G02 A;  1UCI A;  1X1X A;  1PY3 A;  6GSP A;  1RGA A;  1T2I A;  2C4B A;  1BNG A;  2KF6 A;  1BOX A;  1RGC A;  1BSA A;  1RGF A;  1X1W A;  5BU4 A;  1BSB A;  2KF3 A;  8RNT A;  1GMP A;  1I70 A;  1TRP A;  1UCJ A;  3BU4 A;  1BIR A;  1BRK A;  2F56 A;  1I2G A;  3BIR A;  1BVI A;  4GSP A;  1RCL A;  9RNT A;  1YGW A;  3D5G A;  1T2H A;  1Q9E A;  4BIR A;  4HAA A;  1RHL A;  1GOV A;  2RBI A;  1BNI A;  3WHO A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...