1I2FA

Ribonuclease t1 v16a mutant, form ii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i2fA00
2BU4A 2GSPA 2AAEA 4GSPA 1BOXA 4BU4A 3WR2A 1FZUA 1HZ1A 1I8VA 3BIRA 2HOHA 1BRJA 3DH2A 1BNRA 1AQZA 2RNTA 1JBSA 3DGYA 1I0VA 3BU4A 3KCHA 3RNTA 2F5WA 1I3FA 1HYFA 1I2FA 5HOHA 7RNTA 1BRSA 1UCJA 3Q3FA 1TRPA 1G02A 1BNFA 1PYLA 1BUJA 3D4AA 1B2SA 1UCIA 1MGWA 1GMPA 1A2PA 1X1YA 1BRKA 1I2GA 1BSEA 1TRQA 9RNTA 1X1WA 1BNJA 4HOHA 1B2XA 2BIRA 1RGHA 1B20A 1RMSA 1RCLA 1RTUA 1SARA 1X1UA 3AGOA 1RGFA 1RNTA 1FUTA 1FW7A 1RGGA 2C4BA 1YGWA 1R4YA 1TTOA 1BU4A 1I0XA 1BGSA 1C54A 1IYYA 4HAAA 4BIRA 1RGKA 3A5EA 3WHOA 1AY7A 1GMQA 1X1XA 1RDSA 2ZA4A 2AADA 1RCKA 5BU4A 1UCLA 1BNGA 1UCKA 1RGEA 3GSPA 1BNSA 1T2IA 1BRNL 1BSDA 1GSPA 1Q9EA 1JBTA 3HOHA 1JBRA 1B3SA 3D5IA 1BANA 3AHWA 1BRHA 1DE3A 3URPA 2F4YA 1B27A 1RN4A 6RNTA 1RSNA 3AHSA 1BNEA 7GSPA 1BAOA 1BVIA 1B2MA 4GHOA 2KF4A 2KF6A 1ZGXA 2KF5A 1I3IA 1BRIA 1CH0A 1I2EA 1RHLA 3AGNA 4RNTA 1RGAA 1GOUA 1BNIA 1BIRA 1I70A 1LOYA 1BSCA 2KAAA 1RGCA 1B2UA 1BRGA 1PY3A 3D5GA 1GOVA 4J5KA 8RNTA 2KF3A 1RNBA 3SYUA 1RGLA 1T2HA 1LRAA 2F5MA 1FYSA 6GSPA 2SARA 1BSBA 1GOYA 5GSPA 4J5GA 1LNIA 1B21A 1GMRA 1LOWA 1DETA 1LOVA 2RBIA 1FUSA 1YNVX 5RNTA 1RLSA 1RN1A 2F56A 1MGRA 1B2ZA 1YVSA 5BIRA 1BSAA
chains in the Genus database with same CATH superfamily
4LYLB 2BU4A 3DXOA 5AIHA 1VQM3 4OVMA 3UJMA 2O9UX 4WHAA 1HZ1A 1Q7HA 2WOHA 1A2KA 1US1A 3BIRA 3D79A 3FF0A 3DH2A 3I0YA 3WOEB 3X42A 3JUPA 1AQZA 1O7PB 2RFRA 4JF8A 4XDVA 5IENA 2C11A 1J2BA 3PXMA 4G1MB 3RNTA 2F5WA 2PNCA 1TFOA 2OOVA 1NJI4 4N6TA 3K9MC 1Q7Y4 1U8CB 1RJOA 3G16A 3KSED 3DZLA 3Q3FA 3FG4A 1FGRA 4KFEA 2H0IA 3OV4A 2JQ5A 3EHCA 3GZXB 1PU4A 4FMDA 3D4AA 3VF1A 2CX1A 2MF7A 1TU5A 1IVXA 4N6V0 2M7OA 1OF5A 4KFFA 1ZX2A 4LEHA 4X2HA 2IA7A 2L1SA 1BNJA 1OHSA 1W01A 3FG1A 1FGQA 3DGNA 4FMBA 1E3VA 5IEOA 5M19A 1VQ83 5CK6A 1RMSA 1RTUA 1SARA 3AGOA 1X1UA 3L0RA 1C7HA 3RDEA 4NHFA 1ISKA 3MG2A 1FUTA 3A76A 3Q2PA 3FLJA 3F7XA 3WOFB 1LQGC 3UB1A 4BL2A 1I0XA 1KSIA 1FGMA 1TUHA 1W6CA 4LZIA 2D1WA 3EBYA 3MYTA 4BIRA 3LXUX 3UL5A 1VQQA 3JUQA 2F99A 1X1XA 2ML6A 4PEJA 2AADA 4IIAA 1BNGA 1UCKA 1UI7A 2CFDA 4FMCA 4N6LA 3NM2A 1T2IA 2D42A 3NX0A 3HX8A 4KVHA 4EBGA 1OACA 1IU7A 1UW1A 2CWTA 2K3DA 1Q9EA 3CNXA 3NV0A 4IPBA 4ORLA 1Q814 2BNGA 4FCJA 4HM3B 1VQP3 1BANA 1UGIA 1EA2A 1B27A 6RNTA 1JN5A 2HMOB 1DMNA 1EKMA 2E2VA 3K5TA 3V98A 3EE1A 2QA43 1JKGA 4GHOA 2R4IA 1ASKA 2KF5A 2XF3A 4GB5A 4HVNA 2IYJA 4HKVB 4HJLB 4L8OA 4ZM8A 3PZWA 2I9WA 4RNTA 3ER7A 4RBNA 3I563 1I70A 2UGIA 3CNMA 3MG1A 5CF1A 1QAKA 3DGMA 1O7MB 4QWTA 4WWUC 1GOVA 3B4OA 5ELJA 1SIIA 1OPYA 3FF2A 4MJDA 1VQK3 3CMA3 1O7HB 3OWUA 1FYSA 3DY5A 2CWVA 2GEXA 4J5GA 2HMNB 5JPUA 2P0MA 3CME3 2XH9A 4EC6A 2F86B 3EBTA 1K9M4 1STFI 2JDIH 3KFQC 4HM8B 1A90A 1RN1A 2YFLB 1QVG2 2Q07A 5JBSA 1YVSA 4RNYA 1KQS2 4LGQA 1SIHA 3HZPA 3JVCA 4O8SA 3ZG5A 2P05A 5M18A 5AIFA 3S29A 1YIT3 3HI7A 1KWIA 3MHEA 4GSPA 1GS3A 3Q1CA 4BU4A 3WR2A 5IG3A 1GY7A 3J7Yd 1Y4KA 1BRJA 1TP6A 2E2TA 4HM1B 1Z1SA 3IMAB 1BNRA 1WQLB 2H0GA 3N8BA 1JBSA 1DMQA 2Z6BA 3ZG0A 4XM4A 4HM5B 3BU4A 4JRFA 4O3VA 6STDA 1W5ZA 2IUJA 1ZS7A 2GU3A 2OQEA 1WMPA 1IVUA 1FGOA 1LNHA 7STDA 1IVWA 4FMAA 3STDA 5IG4A 3NBBA 3CCM3 1IV9A 5AI1A 1TJDA 1N9EA 1RRLA 2FXTA 1WNHA 2PZVA 2Z77A 1BNFA 1NNVA 1JZOA 4K1VA 5HGRA 5LC6A 1B2SA 2A15A 5CLKA 5D81A 1YVBI 3G713 3CPW2 1MGWA 2W56A 4WYKA 3EQQB 1I2GA 1GD3A 4RNZA 1VZZA 3GZYB 5AYSC 4EYCA 2ZL8A 3UL6A 1QJGA 4O02B 1DVDA 3NHXA 4HOHA 1B2XA 3GZBA 2BIRA 4CCVA 4EV5A 2OWPA 1RCLA 3JUMA 1DVCA 4HZ9B 1F8NA 4J9AA 1U5OA 3DUKA 1M9GA 1MWSA 1UUWB 3D9RA 3GZRA 2GEYA 3FG3A 3MKIA 2CG0A 3S5CA 2C4BA 1YGWA 5CXOA 1R4YA 3D3LA 1BU4A 4ILFA 3LOYA 4MMYB 1C54A 4J8TA 2BO9B 2SBLA 1W6YA 3A5EA 3WHOA 3F8HA 3LT9A 3WA2X 2ZA4A 5G1LA 1DMMA 4DKIA 5KP4A 1EEJA 1RGEA 3K7CA 3EC9A 4HYZA 4HZBB 1BSDA 2KCDA 4I5QA 5EVHA 1GSPA 2P09A 3O8YA 1O7NB 4KZ1A 2CH9A 2CW9A 3AHWA 1BRHA 3F8XA 1UUGB 1UUVB 3LTBA 4TX4A 5EEOA 3CCR3 1VQL3 2E2UA 5FGOA 3BB9A 1W2ZA 3LH4A 1RSNA 1S723 1BNEA 1GY5A 3OW22 1B2MA 2BHMA 2CG1A 2IUKA 2HMKB 1AR0A 2K0MA 1EQKA 2KRTA 2KF4A 3CC73 3KSPA 3LZAA 1BRIA 2MC8A 1T5YA 1CH0A 4AKZA 3MPHA 2GXFA 2XSOB 3KN4A 3PCSA 1ULJB 1CEWI 1LOYA 2W6JH 4N6OB 1OH0A 3S28A 1RGCA 1VQ43 1D6ZA 1N9JA 1RN7A 2K54A 3ECFA 1BRGA 3LTDA 5KP3A 5AEUB 2WGQA 4RZMA 1RGLA 1OGZA 1AV4A 5BVBA 5DREA 1BSBA 5AEWB 2CIUA 5A0OB 1CQSA 3X3YA 1D6UA 4H3UA 1LNIA 1WMOA 2OQEC 5AYRB 4CJNA 1VQN3 1B21A 4XBYA 2XRXB 1AVLA 2RSXA 3SVAA 2RBIA 5IG0A 1FUSA 1YNVX 5KP1A 2XFTA 2C10A 4HM2B 1IT8A 1NB3I 1D6YA 2W04A 1MGRA 1Q42A 4HM4B 3NM7A 5IEPA 1M904 4N6MA 3X3ZA 3N9HA 1IDPA 3NQYA 1K28A 1LVNA 3G4S3 1N5PA 3MWZA 1GD4A 1FZUA 1M1XB 5CF2A 1N5HA 1I8VA 1OHPA 1OGXA 4N3VA 2HOHA 4U13A 1MWUA 5AIIA 1NB5I 4AKYA 1V58A 3BLZA 2BMOB 4R9KA 4CDLA 1JB4A 3S67A 2QIYA 3EX9A 3GWRA 3JUNA 1IQYA 3KCHA 3SEDA 8CHOA 1I3FA 2H0HA 2QEX3 1R4CA 7RNTA 1BRSA 2XR8B 1UCJA 1V57A 5AIGA 2WOFA 4BTWA 2W03A 3HK4A 2P0XA 1JV2B 1PYLA 4MEIA 1JB2A 1K8A4 1GMPA 2INXA 1Q824 1ROVA 1X1YA 1BSEA 1O7WB 3LT8A 3AMOA 4FCMA 1Q40B 4K61A 1L5GB 3H51A 1TRQA 3VGNA 2GBWB 3SLUA 4BTXA 3DMCA 3EB8A 9RNTA 1W2B2 2IY2A 1FUWA 5STDA 3MG3A 4EW5A 5I97A 3DGLA 1B20A 5G1KA 4MMXB 3EN1B 1OHOA 4HM0B 4LMIA 3U97A 3B8LA 1RGFA 5D83A 3PS8A 3CCJ3 4HM6B 2UX0A 3LTCA 1FW7A 4LSOA 1YJN3 4HM7B 3GAXA 1JJ22 2Z7AA 3JUOA 1BGSA 1IYYA 2FNQA 1RGKA 2XEPA 1GMQA 1RDSA 3S27A 5BU4A 1UCLA 1GY6A 2UUGC 3CD63 1IV7A 1BNSA 2HMJB 2BT3A 1A2VA 3GSPA 4O2HA 4STDA 1BRNL 3B7CA 3MSOA 2B24B 4H61A 3NBJA 1JBTA 1JBRA 1OF5B 2ZHXB 3D5IA 3CCQ3 2W56B 4HBRA 4WYKB 3CPOA 2CKFB 1E3RA 1TFKA 2F4YA 1RN4A 3NQZA 1YJ93 1JZDA 3PCRA 1BVIA 4WP5A 1VQ63 1E97A 2IMJA 2KF6A 1ZGXA 1MWRA 1GYBA 1I3IA 1S5AA 2L4VA 3N54B 2OCTA 1I2EA 3AGNA 3B4PA 1RGAA 1Q864 1KC84 1GOUA 1SPUA 1OUNA 4K1UA 5BXQA 1BSCA 2KAAA 1N8R4 2XSHB 2Y73A 1B2UA 2YX9A 3D5GA 1NO3A 4J5KA 3EJVA 4XBXA 3ROBA 4BTYA 8RNTA 3SYUA 3CCE3 3G6E3 1UGHI 3NXJA 4XDWA 1LRAA 2XGLA 1LQMB 1W02A 2F5MA 4EV2A 6GSPA 2SARA 1GOYA 1T3BA 3QK9A 2OTJ3 4R9LA 1YIJ3 1SJWA 4KT3B 4L7KA 1IQXA 1RRHA 2P38A 5FW5A 1GMRA 4CPKA 3CCL3 1NDOB 1V74A 1LOWA 2GU1A 4N6NB 2CK3H 1DETA 3ALAA 4R1KA 3UNLA 3GRDA 5RNTA 1G0TA 1IQ8A 4I4KA 1RLSA 2Y74A 2F56A 3WODG 4KFDA 1QALA 1STDA 2OTL3 4XB5A 1B2ZA 1BSAA 3KIIA 4MMZB 3SXXA 1YI23 4GL6A 1JN5B 2RCDA 4OK0A 1PFPA 2F98A 2GSPA 2AAEA 2HMMB 1JKGB 2CX0A 1BOXA 2BMQB 1LOXA 2GBXB 2R41A 4Q53A 1VQ53 2W9PA 1BUQA 3IPTA 3VSYA 3F40A 3FZWA 3HIGA 1W00A 3H3HA 3OX9A 2RNTA 3TDGA 1UI8A 1W4NA 3F7SA 3WMDA 3DGYA 1I0VA 4OUQA 3FCSB 2CWUA 1YJW3 2LYXA 3NV0B 3IJEB 2RGQA 3FSDA 4N6UA 3CCU3 4R80A 2CFLA 1HYFA 1I2FA 2YFJB 5HOHA 1ZO2A 1K41A 3LMLA 1QVF2 2QGUA 1CYUA 1ROAA 2W9QA 3BNEA 1TRPA 2J8XB 3T8NA 3WDGB 1WTHA 2STDA 1SQWA 1MNLA 3CC43 2O3OA 1G02A 3CXC2 2W0QA 3I553 1K734 1BUJA 5IW9A 3F9SA 3EN8A 1UCIA 2BMRB 1KD14 1A2PA 3OXAA 3SOYA 1BRKA 5DRVA 5LC7A 1WMNA 1QMAA 2WO0A 4FR9A 3X3XA 1YHQ3 1HKXA 1X1WA 2CFWA 1IVVA 1RGHA 2W2CA 3KE7A 1VQO3 1Q40A 3G0KA 3AMOB 4L8PA 2ML5A 3FH1A 3KZTA 2KXGA 5IERA 1JRQA 3RGAA 3DGOA 1RNTA 3G8ZA 1W6GA 3PGBA 1QAFA 1RGGA 3M8CA 3BNBA 1TTOA 3U1WA 4R4KA 4BL3A 3HIIA 4HAAA 1NU3A 3ZFZA 1AY7A 2OOVC 3RGRA 1RCKA 1MWTA 3NBRA 4XBTA 1NWWA 1ULIB 1IT7A 1UDII 1EG9B 2Z76A 1FGTA 1OCVA 2XGNA 3HOHA 1N8QA 1B3SA 3QRDA 4EXRA 2CHCA 5D82A 4AEQA 1DE3A 3URPA 3T8UA 4NREA 3WA3A 3E99A 3CC23 3AHSA 2FGTA 7GSPA 1BAOA 2ZDJA 2V1LA 5M1AA 5TGNA 3V92A 3X40A 5EQLA 3DM8A 1TIJA 1DYUA 1O7GB 3F14A 3T0UA 3LYGA 1RHLA 1CYVA 1MOLA 1W7CA 3Q90A 4IT7A 5ELUA 5G2GA 1BNIA 3SX1A 1BIRA 2CC3A 2XFSA 5IG5A 5JPPA 1LXEA 3BNCA 3EF8A 2YFIB 2B1XB 1PY3A 1HU9A 2KF3A 1RNBA 3SOAA 1YGEA 2CFKA 4FCZA 1T2HA 3CU3A 2LQVA 3OWYA 1VQ93 3OWSA 4K90B 5GSPA 3NUVA 3V99A 3CCS3 3LTAA 3FGYA 2WGOA 1JNQA 3BNDA 3PYJA 5IF6A 1AVKA 2CFGA 1LOVA 3CCV3 1G96A 4WFOA 3K0ZA 3FKAA 4NPBA 4X2OA 1IK3A 3K63A 2HMLB 1RKYA 1VQ73 1M1K4 3X41A 1JB5A 1EUIC 5BIRA 3KKGA 1A67A 1FA3A
chains in the Genus database with same CATH topology
2BU4A 2GSPA 2AAEA 4GSPA 1BOXA 4BU4A 3WR2A 1FZUA 1HZ1A 1I8VA 3BIRA 2HOHA 1BRJA 3DH2A 1BNRA 1AQZA 2RNTA 1JBSA 3DGYA 1I0VA 3BU4A 3KCHA 3RNTA 2F5WA 1I3FA 1HYFA 1I2FA 5HOHA 7RNTA 1BRSA 1UCJA 3Q3FA 1TRPA 1G02A 1BNFA 1PYLA 1BUJA 3D4AA 1B2SA 1UCIA 1MGWA 1GMPA 1A2PA 1X1YA 1BRKA 1I2GA 1BSEA 1TRQA 9RNTA 1X1WA 1BNJA 4HOHA 1B2XA 2BIRA 1RGHA 1B20A 1RMSA 1RCLA 1RTUA 1SARA 1X1UA 3AGOA 1RGFA 1RNTA 1FUTA 1FW7A 1RGGA 2C4BA 1YGWA 1R4YA 1TTOA 1BU4A 1I0XA 1BGSA 1C54A 1IYYA 4HAAA 4BIRA 1RGKA 3A5EA 3WHOA 1AY7A 1GMQA 1X1XA 1RDSA 2ZA4A 2AADA 1RCKA 5BU4A 1UCLA 1BNGA 1UCKA 1RGEA 3GSPA 1BNSA 1T2IA 1BRNL 1BSDA 1GSPA 1Q9EA 1JBTA 3HOHA 1JBRA 1B3SA 3D5IA 1BANA 3AHWA 1BRHA 1DE3A 3URPA 2F4YA 1B27A 1RN4A 6RNTA 1RSNA 3AHSA 1BNEA 7GSPA 1BAOA 1BVIA 1B2MA 4GHOA 2KF4A 2KF6A 1ZGXA 2KF5A 1I3IA 1BRIA 1CH0A 1I2EA 1RHLA 3AGNA 4RNTA 1RGAA 1GOUA 1BNIA 1BIRA 1I70A 1LOYA 1BSCA 2KAAA 1RGCA 1B2UA 1BRGA 1PY3A 3D5GA 1GOVA 4J5KA 8RNTA 2KF3A 1RNBA 3SYUA 1RGLA 1T2HA 1LRAA 2F5MA 1FYSA 6GSPA 2SARA 1BSBA 1GOYA 5GSPA 4J5GA 1LNIA 1B21A 1GMRA 1LOWA 1DETA 1LOVA 2RBIA 1FUSA 1YNVX 5RNTA 1RLSA 1RN1A 2F56A 1MGRA 1B2ZA 1YVSA 5BIRA 1BSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU4 A;  2GSP A;  2AAE A;  4GSP A;  1BOX A;  4BU4 A;  3WR2 A;  1FZU A;  1HZ1 A;  1I8V A;  3BIR A;  2HOH A;  1BRJ A;  3DH2 A;  1BNR A;  1AQZ A;  2RNT A;  1JBS A;  3DGY A;  1I0V A;  3BU4 A;  3KCH A;  3RNT A;  2F5W A;  1I3F A;  1HYF A;  1I2F A;  5HOH A;  7RNT A;  1BRS A;  1UCJ A;  3Q3F A;  1TRP A;  1G02 A;  1BNF A;  1PYL A;  1BUJ A;  3D4A A;  1B2S A;  1UCI A;  1MGW A;  1GMP A;  1A2P A;  1X1Y A;  1BRK A;  1I2G A;  1BSE A;  1TRQ A;  9RNT A;  1X1W A;  1BNJ A;  4HOH A;  1B2X A;  2BIR A;  1RGH A;  1B20 A;  1RMS A;  1RCL A;  1RTU A;  1SAR A;  1X1U A;  3AGO A;  1RGF A;  1RNT A;  1FUT A;  1FW7 A;  1RGG A;  2C4B A;  1YGW A;  1R4Y A;  1TTO A;  1BU4 A;  1I0X A;  1BGS A;  1C54 A;  1IYY A;  4HAA A;  4BIR A;  1RGK A;  3A5E A;  3WHO A;  1AY7 A;  1GMQ A;  1X1X A;  1RDS A;  2ZA4 A;  2AAD A;  1RCK A;  5BU4 A;  1UCL A;  1BNG A;  1UCK A;  1RGE A;  3GSP A;  1BNS A;  1T2I A;  1BRN L;  1BSD A;  1GSP A;  1Q9E A;  1JBT A;  3HOH A;  1JBR A;  1B3S A;  3D5I A;  1BAN A;  3AHW A;  1BRH A;  1DE3 A;  3URP A;  2F4Y A;  1B27 A;  1RN4 A;  6RNT A;  1RSN A;  3AHS A;  1BNE A;  7GSP A;  1BAO A;  1BVI A;  1B2M A;  4GHO A;  2KF4 A;  2KF6 A;  1ZGX A;  2KF5 A;  1I3I A;  1BRI A;  1CH0 A;  1I2E A;  1RHL A;  3AGN A;  4RNT A;  1RGA A;  1GOU A;  1BNI A;  1BIR A;  1I70 A;  1LOY A;  1BSC A;  2KAA A;  1RGC A;  1B2U A;  1BRG A;  1PY3 A;  3D5G A;  1GOV A;  4J5K A;  8RNT A;  2KF3 A;  1RNB A;  3SYU A;  1RGL A;  1T2H A;  1LRA A;  2F5M A;  1FYS A;  6GSP A;  2SAR A;  1BSB A;  1GOY A;  5GSP A;  4J5G A;  1LNI A;  1B21 A;  1GMR A;  1LOW A;  1DET A;  1LOV A;  2RBI A;  1FUS A;  1YNV X;  5RNT A;  1RLS A;  1RN1 A;  2F56 A;  1MGR A;  1B2Z A;  1YVS A;  5BIR A;  1BSA A; 
#chains in the Genus database with same CATH topology
 4LYL B;  2BU4 A;  3DXO A;  5AIH A;  1VQM 3;  4OVM A;  3UJM A;  2O9U X;  4WHA A;  1HZ1 A;  1Q7H A;  2WOH A;  1A2K A;  1US1 A;  3BIR A;  3D79 A;  3FF0 A;  3DH2 A;  3I0Y A;  3WOE B;  3X42 A;  3JUP A;  1AQZ A;  1O7P B;  2RFR A;  4JF8 A;  4XDV A;  5IEN A;  2C11 A;  1J2B A;  3PXM A;  4G1M B;  3RNT A;  2F5W A;  2PNC A;  1TFO A;  2OOV A;  1NJI 4;  4N6T A;  3K9M C;  1Q7Y 4;  1U8C B;  1RJO A;  3G16 A;  3KSE D;  3DZL A;  3Q3F A;  3FG4 A;  1FGR A;  4KFE A;  2H0I A;  3OV4 A;  2JQ5 A;  3EHC A;  3GZX B;  1PU4 A;  4FMD A;  3D4A A;  3VF1 A;  2CX1 A;  2MF7 A;  1TU5 A;  1IVX A;  4N6V 0;  2M7O A;  1OF5 A;  4KFF A;  1ZX2 A;  4LEH A;  4X2H A;  2IA7 A;  2L1S A;  1BNJ A;  1OHS A;  1W01 A;  3FG1 A;  1FGQ A;  3DGN A;  4FMB A;  1E3V A;  5IEO A;  5M19 A;  1VQ8 3;  5CK6 A;  1RMS A;  1RTU A;  1SAR A;  3AGO A;  1X1U A;  3L0R A;  1C7H A;  3RDE A;  4NHF A;  1ISK A;  3MG2 A;  1FUT A;  3A76 A;  3Q2P A;  3FLJ A;  3F7X A;  3WOF B;  1LQG C;  3UB1 A;  4BL2 A;  1I0X A;  1KSI A;  1FGM A;  1TUH A;  1W6C A;  4LZI A;  2D1W A;  3EBY A;  3MYT A;  4BIR A;  3LXU X;  3UL5 A;  1VQQ A;  3JUQ A;  2F99 A;  1X1X A;  2ML6 A;  4PEJ A;  2AAD A;  4IIA A;  1BNG A;  1UCK A;  1UI7 A;  2CFD A;  4FMC A;  4N6L A;  3NM2 A;  1T2I A;  2D42 A;  3NX0 A;  3HX8 A;  4KVH A;  4EBG A;  1OAC A;  1IU7 A;  1UW1 A;  2CWT A;  2K3D A;  1Q9E A;  3CNX A;  3NV0 A;  4IPB A;  4ORL A;  1Q81 4;  2BNG A;  4FCJ A;  4HM3 B;  1VQP 3;  1BAN A;  1UGI A;  1EA2 A;  1B27 A;  6RNT A;  1JN5 A;  2HMO B;  1DMN A;  1EKM A;  2E2V A;  3K5T A;  3V98 A;  3EE1 A;  2QA4 3;  1JKG A;  4GHO A;  2R4I A;  1ASK A;  2KF5 A;  2XF3 A;  4GB5 A;  4HVN A;  2IYJ A;  4HKV B;  4HJL B;  4L8O A;  4ZM8 A;  3PZW A;  2I9W A;  4RNT A;  3ER7 A;  4RBN A;  3I56 3;  1I70 A;  2UGI A;  3CNM A;  3MG1 A;  5CF1 A;  1QAK A;  3DGM A;  1O7M B;  4QWT A;  4WWU C;  1GOV A;  3B4O A;  5ELJ A;  1SII A;  1OPY A;  3FF2 A;  4MJD A;  1VQK 3;  3CMA 3;  1O7H B;  3OWU A;  1FYS A;  3DY5 A;  2CWV A;  2GEX A;  4J5G A;  2HMN B;  5JPU A;  2P0M A;  3CME 3;  2XH9 A;  4EC6 A;  2F86 B;  3EBT A;  1K9M 4;  1STF I;  2JDI H;  3KFQ C;  4HM8 B;  1A90 A;  1RN1 A;  2YFL B;  1QVG 2;  2Q07 A;  5JBS A;  1YVS A;  4RNY A;  1KQS 2;  4LGQ A;  1SIH A;  3HZP A;  3JVC A;  4O8S A;  3ZG5 A;  2P05 A;  5M18 A;  5AIF A;  3S29 A;  1YIT 3;  3HI7 A;  1KWI A;  3MHE A;  4GSP A;  1GS3 A;  3Q1C A;  4BU4 A;  3WR2 A;  5IG3 A;  1GY7 A;  3J7Y d;  1Y4K A;  1BRJ A;  1TP6 A;  2E2T A;  4HM1 B;  1Z1S A;  3IMA B;  1BNR A;  1WQL B;  2H0G A;  3N8B A;  1JBS A;  1DMQ A;  2Z6B A;  3ZG0 A;  4XM4 A;  4HM5 B;  3BU4 A;  4JRF A;  4O3V A;  6STD A;  1W5Z A;  2IUJ A;  1ZS7 A;  2GU3 A;  2OQE A;  1WMP A;  1IVU A;  1FGO A;  1LNH A;  7STD A;  1IVW A;  4FMA A;  3STD A;  5IG4 A;  3NBB A;  3CCM 3;  1IV9 A;  5AI1 A;  1TJD A;  1N9E A;  1RRL A;  2FXT A;  1WNH A;  2PZV A;  2Z77 A;  1BNF A;  1NNV A;  1JZO A;  4K1V A;  5HGR A;  5LC6 A;  1B2S A;  2A15 A;  5CLK A;  5D81 A;  1YVB I;  3G71 3;  3CPW 2;  1MGW A;  2W56 A;  4WYK A;  3EQQ B;  1I2G A;  1GD3 A;  4RNZ A;  1VZZ A;  3GZY B;  5AYS C;  4EYC A;  2ZL8 A;  3UL6 A;  1QJG A;  4O02 B;  1DVD A;  3NHX A;  4HOH A;  1B2X A;  3GZB A;  2BIR A;  4CCV A;  4EV5 A;  2OWP A;  1RCL A;  3JUM A;  1DVC A;  4HZ9 B;  1F8N A;  4J9A A;  1U5O A;  3DUK A;  1M9G A;  1MWS A;  1UUW B;  3D9R A;  3GZR A;  2GEY A;  3FG3 A;  3MKI A;  2CG0 A;  3S5C A;  2C4B A;  1YGW A;  5CXO A;  1R4Y A;  3D3L A;  1BU4 A;  4ILF A;  3LOY A;  4MMY B;  1C54 A;  4J8T A;  2BO9 B;  2SBL A;  1W6Y A;  3A5E A;  3WHO A;  3F8H A;  3LT9 A;  3WA2 X;  2ZA4 A;  5G1L A;  1DMM A;  4DKI A;  5KP4 A;  1EEJ A;  1RGE A;  3K7C A;  3EC9 A;  4HYZ A;  4HZB B;  1BSD A;  2KCD A;  4I5Q A;  5EVH A;  1GSP A;  2P09 A;  3O8Y A;  1O7N B;  4KZ1 A;  2CH9 A;  2CW9 A;  3AHW A;  1BRH A;  3F8X A;  1UUG B;  1UUV B;  3LTB A;  4TX4 A;  5EEO A;  3CCR 3;  1VQL 3;  2E2U A;  5FGO A;  3BB9 A;  1W2Z A;  3LH4 A;  1RSN A;  1S72 3;  1BNE A;  1GY5 A;  3OW2 2;  1B2M A;  2BHM A;  2CG1 A;  2IUK A;  2HMK B;  1AR0 A;  2K0M A;  1EQK A;  2KRT A;  2KF4 A;  3CC7 3;  3KSP A;  3LZA A;  1BRI A;  2MC8 A;  1T5Y A;  1CH0 A;  4AKZ A;  3MPH A;  2GXF A;  2XSO B;  3KN4 A;  3PCS A;  1ULJ B;  1CEW I;  1LOY A;  2W6J H;  4N6O B;  1OH0 A;  3S28 A;  1RGC A;  1VQ4 3;  1D6Z A;  1N9J A;  1RN7 A;  2K54 A;  3ECF A;  1BRG A;  3LTD A;  5KP3 A;  5AEU B;  2WGQ A;  4RZM A;  1RGL A;  1OGZ A;  1AV4 A;  5BVB A;  5DRE A;  1BSB A;  5AEW B;  2CIU A;  5A0O B;  1CQS A;  3X3Y A;  1D6U A;  4H3U A;  1LNI A;  1WMO A;  2OQE C;  5AYR B;  4CJN A;  1VQN 3;  1B21 A;  4XBY A;  2XRX B;  1AVL A;  2RSX A;  3SVA A;  2RBI A;  5IG0 A;  1FUS A;  1YNV X;  5KP1 A;  2XFT A;  2C10 A;  4HM2 B;  1IT8 A;  1NB3 I;  1D6Y A;  2W04 A;  1MGR A;  1Q42 A;  4HM4 B;  3NM7 A;  5IEP A;  1M90 4;  4N6M A;  3X3Z A;  3N9H A;  1IDP A;  3NQY A;  1K28 A;  1LVN A;  3G4S 3;  1N5P A;  3MWZ A;  1GD4 A;  1FZU A;  1M1X B;  5CF2 A;  1N5H A;  1I8V A;  1OHP A;  1OGX A;  4N3V A;  2HOH A;  4U13 A;  1MWU A;  5AII A;  1NB5 I;  4AKY A;  1V58 A;  3BLZ A;  2BMO B;  4R9K A;  4CDL A;  1JB4 A;  3S67 A;  2QIY A;  3EX9 A;  3GWR A;  3JUN A;  1IQY A;  3KCH A;  3SED A;  8CHO A;  1I3F A;  2H0H A;  2QEX 3;  1R4C A;  7RNT A;  1BRS A;  2XR8 B;  1UCJ A;  1V57 A;  5AIG A;  2WOF A;  4BTW A;  2W03 A;  3HK4 A;  2P0X A;  1JV2 B;  1PYL A;  4MEI A;  1JB2 A;  1K8A 4;  1GMP A;  2INX A;  1Q82 4;  1ROV A;  1X1Y A;  1BSE A;  1O7W B;  3LT8 A;  3AMO A;  4FCM A;  1Q40 B;  4K61 A;  1L5G B;  3H51 A;  1TRQ A;  3VGN A;  2GBW B;  3SLU A;  4BTX A;  3DMC A;  3EB8 A;  9RNT A;  1W2B 2;  2IY2 A;  1FUW A;  5STD A;  3MG3 A;  4EW5 A;  5I97 A;  3DGL A;  1B20 A;  5G1K A;  4MMX B;  3EN1 B;  1OHO A;  4HM0 B;  4LMI A;  3U97 A;  3B8L A;  1RGF A;  5D83 A;  3PS8 A;  3CCJ 3;  4HM6 B;  2UX0 A;  3LTC A;  1FW7 A;  4LSO A;  1YJN 3;  4HM7 B;  3GAX A;  1JJ2 2;  2Z7A A;  3JUO A;  1BGS A;  1IYY A;  2FNQ A;  1RGK A;  2XEP A;  1GMQ A;  1RDS A;  3S27 A;  5BU4 A;  1UCL A;  1GY6 A;  2UUG C;  3CD6 3;  1IV7 A;  1BNS A;  2HMJ B;  2BT3 A;  1A2V A;  3GSP A;  4O2H A;  4STD A;  1BRN L;  3B7C A;  3MSO A;  2B24 B;  4H61 A;  3NBJ A;  1JBT A;  1JBR A;  1OF5 B;  2ZHX B;  3D5I A;  3CCQ 3;  2W56 B;  4HBR A;  4WYK B;  3CPO A;  2CKF B;  1E3R A;  1TFK A;  2F4Y A;  1RN4 A;  3NQZ A;  1YJ9 3;  1JZD A;  3PCR A;  1BVI A;  4WP5 A;  1VQ6 3;  1E97 A;  2IMJ A;  2KF6 A;  1ZGX A;  1MWR A;  1GYB A;  1I3I A;  1S5A A;  2L4V A;  3N54 B;  2OCT A;  1I2E A;  3AGN A;  3B4P A;  1RGA A;  1Q86 4;  1KC8 4;  1GOU A;  1SPU A;  1OUN A;  4K1U A;  5BXQ A;  1BSC A;  2KAA A;  1N8R 4;  2XSH B;  2Y73 A;  1B2U A;  2YX9 A;  3D5G A;  1NO3 A;  4J5K A;  3EJV A;  4XBX A;  3ROB A;  4BTY A;  8RNT A;  3SYU A;  3CCE 3;  3G6E 3;  1UGH I;  3NXJ A;  4XDW A;  1LRA A;  2XGL A;  1LQM B;  1W02 A;  2F5M A;  4EV2 A;  6GSP A;  2SAR A;  1GOY A;  1T3B A;  3QK9 A;  2OTJ 3;  4R9L A;  1YIJ 3;  1SJW A;  4KT3 B;  4L7K A;  1IQX A;  1RRH A;  2P38 A;  5FW5 A;  1GMR A;  4CPK A;  3CCL 3;  1NDO B;  1V74 A;  1LOW A;  2GU1 A;  4N6N B;  2CK3 H;  1DET A;  3ALA A;  4R1K A;  3UNL A;  3GRD A;  5RNT A;  1G0T A;  1IQ8 A;  4I4K A;  1RLS A;  2Y74 A;  2F56 A;  3WOD G;  4KFD A;  1QAL A;  1STD A;  2OTL 3;  4XB5 A;  1B2Z A;  1BSA A;  3KII A;  4MMZ B;  3SXX A;  1YI2 3;  4GL6 A;  1JN5 B;  2RCD A;  4OK0 A;  1PFP A;  2F98 A;  2GSP A;  2AAE A;  2HMM B;  1JKG B;  2CX0 A;  1BOX A;  2BMQ B;  1LOX A;  2GBX B;  2R41 A;  4Q53 A;  1VQ5 3;  2W9P A;  1BUQ A;  3IPT A;  3VSY A;  3F40 A;  3FZW A;  3HIG A;  1W00 A;  3H3H A;  3OX9 A;  2RNT A;  3TDG A;  1UI8 A;  1W4N A;  3F7S A;  3WMD A;  3DGY A;  1I0V A;  4OUQ A;  3FCS B;  2CWU A;  1YJW 3;  2LYX A;  3NV0 B;  3IJE B;  2RGQ A;  3FSD A;  4N6U A;  3CCU 3;  4R80 A;  2CFL A;  1HYF A;  1I2F A;  2YFJ B;  5HOH A;  1ZO2 A;  1K41 A;  3LML A;  1QVF 2;  2QGU A;  1CYU A;  1ROA A;  2W9Q A;  3BNE A;  1TRP A;  2J8X B;  3T8N A;  3WDG B;  1WTH A;  2STD A;  1SQW A;  1MNL A;  3CC4 3;  2O3O A;  1G02 A;  3CXC 2;  2W0Q A;  3I55 3;  1K73 4;  1BUJ A;  5IW9 A;  3F9S A;  3EN8 A;  1UCI A;  2BMR B;  1KD1 4;  1A2P A;  3OXA A;  3SOY A;  1BRK A;  5DRV A;  5LC7 A;  1WMN A;  1QMA A;  2WO0 A;  4FR9 A;  3X3X A;  1YHQ 3;  1HKX A;  1X1W A;  2CFW A;  1IVV A;  1RGH A;  2W2C A;  3KE7 A;  1VQO 3;  1Q40 A;  3G0K A;  3AMO B;  4L8P A;  2ML5 A;  3FH1 A;  3KZT A;  2KXG A;  5IER A;  1JRQ A;  3RGA A;  3DGO A;  1RNT A;  3G8Z A;  1W6G A;  3PGB A;  1QAF A;  1RGG A;  3M8C A;  3BNB A;  1TTO A;  3U1W A;  4R4K A;  4BL3 A;  3HII A;  4HAA A;  1NU3 A;  3ZFZ A;  1AY7 A;  2OOV C;  3RGR A;  1RCK A;  1MWT A;  3NBR A;  4XBT A;  1NWW A;  1ULI B;  1IT7 A;  1UDI I;  1EG9 B;  2Z76 A;  1FGT A;  1OCV A;  2XGN A;  3HOH A;  1N8Q A;  1B3S A;  3QRD A;  4EXR A;  2CHC A;  5D82 A;  4AEQ A;  1DE3 A;  3URP A;  3T8U A;  4NRE A;  3WA3 A;  3E99 A;  3CC2 3;  3AHS A;  2FGT A;  7GSP A;  1BAO A;  2ZDJ A;  2V1L A;  5M1A A;  5TGN A;  3V92 A;  3X40 A;  5EQL A;  3DM8 A;  1TIJ A;  1DYU A;  1O7G B;  3F14 A;  3T0U A;  3LYG A;  1RHL A;  1CYV A;  1MOL A;  1W7C A;  3Q90 A;  4IT7 A;  5ELU A;  5G2G A;  1BNI A;  3SX1 A;  1BIR A;  2CC3 A;  2XFS A;  5IG5 A;  5JPP A;  1LXE A;  3BNC A;  3EF8 A;  2YFI B;  2B1X B;  1PY3 A;  1HU9 A;  2KF3 A;  1RNB A;  3SOA A;  1YGE A;  2CFK A;  4FCZ A;  1T2H A;  3CU3 A;  2LQV A;  3OWY A;  1VQ9 3;  3OWS A;  4K90 B;  5GSP A;  3NUV A;  3V99 A;  3CCS 3;  3LTA A;  3FGY A;  2WGO A;  1JNQ A;  3BND A;  3PYJ A;  5IF6 A;  1AVK A;  2CFG A;  1LOV A;  3CCV 3;  1G96 A;  4WFO A;  3K0Z A;  3FKA A;  4NPB A;  4X2O A;  1IK3 A;  3K63 A;  2HML B;  1RKY A;  1VQ7 3;  1M1K 4;  3X41 A;  1JB5 A;  1EUI C;  5BIR A;  3KKG A;  1A67 A;  1FA3 A; 
#chains in the Genus database with same CATH homology
 2BU4 A;  2GSP A;  2AAE A;  4GSP A;  1BOX A;  4BU4 A;  3WR2 A;  1FZU A;  1HZ1 A;  1I8V A;  3BIR A;  2HOH A;  1BRJ A;  3DH2 A;  1BNR A;  1AQZ A;  2RNT A;  1JBS A;  3DGY A;  1I0V A;  3BU4 A;  3KCH A;  3RNT A;  2F5W A;  1I3F A;  1HYF A;  1I2F A;  5HOH A;  7RNT A;  1BRS A;  1UCJ A;  3Q3F A;  1TRP A;  1G02 A;  1BNF A;  1PYL A;  1BUJ A;  3D4A A;  1B2S A;  1UCI A;  1MGW A;  1GMP A;  1A2P A;  1X1Y A;  1BRK A;  1I2G A;  1BSE A;  1TRQ A;  9RNT A;  1X1W A;  1BNJ A;  4HOH A;  1B2X A;  2BIR A;  1RGH A;  1B20 A;  1RMS A;  1RCL A;  1RTU A;  1SAR A;  1X1U A;  3AGO A;  1RGF A;  1RNT A;  1FUT A;  1FW7 A;  1RGG A;  2C4B A;  1YGW A;  1R4Y A;  1TTO A;  1BU4 A;  1I0X A;  1BGS A;  1C54 A;  1IYY A;  4HAA A;  4BIR A;  1RGK A;  3A5E A;  3WHO A;  1AY7 A;  1GMQ A;  1X1X A;  1RDS A;  2ZA4 A;  2AAD A;  1RCK A;  5BU4 A;  1UCL A;  1BNG A;  1UCK A;  1RGE A;  3GSP A;  1BNS A;  1T2I A;  1BRN L;  1BSD A;  1GSP A;  1Q9E A;  1JBT A;  3HOH A;  1JBR A;  1B3S A;  3D5I A;  1BAN A;  3AHW A;  1BRH A;  1DE3 A;  3URP A;  2F4Y A;  1B27 A;  1RN4 A;  6RNT A;  1RSN A;  3AHS A;  1BNE A;  7GSP A;  1BAO A;  1BVI A;  1B2M A;  4GHO A;  2KF4 A;  2KF6 A;  1ZGX A;  2KF5 A;  1I3I A;  1BRI A;  1CH0 A;  1I2E A;  1RHL A;  3AGN A;  4RNT A;  1RGA A;  1GOU A;  1BNI A;  1BIR A;  1I70 A;  1LOY A;  1BSC A;  2KAA A;  1RGC A;  1B2U A;  1BRG A;  1PY3 A;  3D5G A;  1GOV A;  4J5K A;  8RNT A;  2KF3 A;  1RNB A;  3SYU A;  1RGL A;  1T2H A;  1LRA A;  2F5M A;  1FYS A;  6GSP A;  2SAR A;  1BSB A;  1GOY A;  5GSP A;  4J5G A;  1LNI A;  1B21 A;  1GMR A;  1LOW A;  1DET A;  1LOV A;  2RBI A;  1FUS A;  1YNV X;  5RNT A;  1RLS A;  1RN1 A;  2F56 A;  1MGR A;  1B2Z A;  1YVS A;  5BIR A;  1BSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...