1I2FA

Ribonuclease t1 v16a mutant, form ii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 23
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1i2fA00
1TRPA 1BNFA 1BNSA 4HAAA 1RNTA 1RGEA 1JBRA 2KF5A 1JBTA 1G02A 2KF3A 1B2SA 1BIRA 1R4YA 1RGKA 1RTUA 1PYLA 1BRIA 1BNJA 1TRQA 7GSPA 1GMQA 3KCHA 1DE3A 1T2IA 5BU4A 3D5GA 1BU4A 3GSPA 1I2EA 1I2GA 1I8VA 1BNRA 1TTOA 4BU4A 1YVSA 1BVIA 3AGOA 5BIRA 1BANA 1MGWA 5GSPA 3BU4A 1X1XA 1DETA 3A5EA 4BIRA 1AQZA 1FZUA 1I3FA 1I0VA 1T2HA 1LOVA 2F4YA 1C54A 1B21A 1B2MA 1HZ1A 3D5IA 1BSAA 2F56A 2C4BA 1I3IA 2GSPA 1LOYA 1BRJA 1I70A 2F5MA 1UCLA 1BRNL 2AADA 3URPA 1B20A 1BSEA 1AY7A 1LNIA 1RGLA 1B2UA 1I2FA 1MGRA 4GSPA 1GMRA 3HOHA 5HOHA 1GOUA 1HYFA 2HOHA 1RGFA 1RGAA 1JBSA 1BGSA 1BRKA 3WHOA 1CH0A 2KF6A 2ZA4A 2BU4A 1UCJA 1LOWA 1BSDA 3D4AA 1FUTA 1YNVX 1RNBA 3RNTA 1B2ZA 3AGNA 1RMSA 1UCKA 3DGYA 2BIRA 6GSPA 1YGWA 1BRSA 1GOVA 1RLSA 1X1UA 1RN4A 1UCIA 4HOHA 2AAEA 1BRGA 2RNTA 1FW7A 1SARA 1IYYA 5RNTA 4J5KA 1I0XA 1RGHA 1ZGXA 2KF4A 1RCLA 1B3SA 1BOXA 1A2PA 9RNTA 4J5GA 1GSPA 1Q9EA 8RNTA 1BNGA 1X1WA 3WR2A 1RHLA 7RNTA 3AHWA 1B2XA 1BSCA 1BUJA 2SARA 2F5WA 3AHSA 1FUSA 1LRAA 3SYUA 1RN1A 3BIRA 1FYSA 4RNTA 1BNIA 1BRHA 3DH2A 4GHOA 2KAAA 1BSBA 2RBIA 1BAOA 1GOYA 1GMPA 1B27A 1RDSA 3Q3FA 1RGCA 1RGGA 6RNTA 1RCKA 1X1YA 1RSNA 1PY3A 1BNEA
chains in the Genus database with same CATH superfamily
4HAAA 1BNSA 3SOAA 1N9EA 1IVWA 4LZIA 3OXAA 2P09A 1CYUA 2CFLA 1JBTA 1ULIB 4XDWA 3IPTA 3LYGA 1LOXA 1FUWA 1LVNA 1BRIA 3EJVA 4IPBA 1ROVA 1E97A 3U1WA 3CPOA 1ZS7A 4HM0B 1DMMA 1DE3A 3O8YA 5IG5A 1AVLA 3DY5A 4WYKB 1BU4A 4KVHA 1TU5A 3LMLA 1U5OA 1JB2A 5CXOA 3CPW2 2OQEC 1VQ93 3K9MC 1IK3A 2IA7A 4HM2B 3WDGB 5BIRA 7STDA 1VQ83 4L8OA 4KT3B 4O2HA 1OGZA 1IQXA 1NO3A 3MG3A 5D81A 8CHOA 3M8CA 2HMLB 1AR0A 1EG9B 1W00A 2F4YA 4IIAA 1CQSA 5IERA 4K90B 5M1AA 3I0YA 1B2MA 2FGTA 5FW5A 1YIT3 3D5IA 1UDII 1BSAA 1TFOA 2F56A 3AMOB 4WP5A 2GSPA 2XR8B 3SX1A 4O8SA 1LQMB 2Z6BA 3F7SA 3NQYA 2F5MA 1UCLA 1BRNL 1GD3A 3UL5A 4FMCA 4X2OA 1BSEA 1AY7A 1RGLA 2K54A 1B2UA 2J8XB 3NQZA 4GSPA 2Z76A 3LT9A 1GMRA 3HOHA 4OUQA 5FGOA 5G2GA 3H3HA 1VQK3 4EV2A 2GBXB 2L4VA 3FCSB 1W6GA 1RGFA 3LTBA 1JBSA 3QRDA 3JUQA 4MEIA 3WA2X 2F99A 2ZA4A 1M9GA 2D1WA 2P05A 2W6JH 3JVCA 5IENA 1LOWA 2Z77A 1W6YA 1BSDA 2BMRB 3OWUA 5AIHA 1FUTA 2W56B 2QEX3 1YNVX 1BUQA 4J9AA 1IV7A 2Z7AA 3K7CA 2IMJA 4FR9A 3PYJA 1Y4KA 1B2ZA 1FGMA 1KWIA 1IQ8A 2BNGA 1GY5A 1TUHA 3D9RA 1YGWA 1GOVA 5KP4A 1QAFA 1FW7A 1K734 2RNTA 2ML5A 4FMBA 1FGTA 1Q824 2W56A 4MJDA 2KF4A 3BNDA 1W02A 4N6UA 1DVCA 1Q40A 1LQGC 2MC8A 4GL6A 4R9LA 3BNBA 3DGOA 3KIIA 3T8UA 5JPUA 1N8R4 3DGNA 2ZHXB 2F5WA 1O7MB 4HBRA 3ZFZA 1M1K4 3GZYB 2K3DA 3UL6A 1QVF2 1RRHA 4LMIA 3NHXA 3DZLA 1OHSA 1NDOB 2R4IA 1N9JA 3IJEB 1VQ53 2QA43 1BRHA 3SXXA 1N5HA 1W4NA 2GU3A 5EEOA 2KAAA 3V98A 3WOFB 4HKVB 3NBRA 3FKAA 4ZM8A 4STDA 2HMNB 1GMPA 2SBLA 1STFI 5EQLA 5TGNA 1MOLA 2INXA 2CKFB 4HYZA 2C11A 4MMXB 1EEJA 3N9HA 4K1UA 4L8PA 1DVDA 3PCRA 4XDVA 1OUNA 1TRPA 1JBRA 2IUJA 3HK4A 2Y74A 4XB5A 2WO0A 1B2SA 5M19A 1BIRA 4R80A 1ZO2A 1FA3A 1JN5B 2PZVA 3X3ZA 1BNJA 4HM3B 5IEOA 3KCHA 4O3VA 1J2BA 1T2IA 1OACA 2L1SA 1JNQA 2BT3A 2CW9A 1DMNA 3F40A 3FG3A 3GSPA 1I2GA 4FMDA 3I563 3F8HA 4MMYB 4HZBB 1YHQ3 1TTOA 1QMAA 4QWTA 3F7XA 5CLKA 4DKIA 3CCR3 5GSPA 3CC73 3WMDA 1R4CA 1X1XA 3GZXB 1YJW3 2HMOB 2YFIB 1T2HA 3NUVA 4K1VA 3CC43 1LOVA 2B24B 4R9KA 1C54A 1B21A 3EBYA 4FCMA 4CCVA 1QALA 1WMNA 3EQQB 3F9SA 2UGIA 2I9WA 1EKMA 2YFJB 4FMAA 5AIGA 4XBXA 4BTWA 3CME3 5M18A 5CK6A 1WMOA 3NX0A 2WOHA 1BRJA 3E99A 2A15A 1NU3A 1JJ22 1JKGA 4XM4A 3URPA 1B20A 1LNIA 2UX0A 2ZDJA 4ORLA 1I2FA 1O7GB 1ZX2A 1WQLB 5HOHA 5AI1A 2KCDA 1GOUA 1HYFA 2W9QA 1RGAA 1OF5B 1BGSA 1SPUA 1BRKA 2OOVC 2FNQA 3WHOA 5JPPA 1Q7Y4 3WA3A 2XGLA 3FF2A 3EX9A 5A0OB 3D4AA 1OPYA 1W6CA 2H0IA 3MSOA 1JZOA 1UUGB 4WYKA 3RNTA 1K8A4 4EBGA 3D3LA 4RNYA 1RMSA 3IMAB 1AVKA 4HVNA 1RLSA 1PU4A 1K41A 1TP6A 2CX1A 1O7NB 4WFOA 1SARA 5IEPA 2QGUA 2OOVA 1UUWB 1NWWA 1UUVB 1C7HA 1RGHA 1ZGXA 3FF0A 1YIJ3 1B3SA 3EC9A 1A2PA 3F8XA 4J5GA 2JDIH 1FGOA 1KSIA 4GB5A 1A2KA 1WNHA 5STDA 3ROBA 1RHLA 7RNTA 1YVBI 1B2XA 1BSCA 4BL2A 4EC6A 3B8LA 3WODG 3AMOA 3T8NA 5I97A 5BVBA 2CH9A 1EUIC 1ASKA 3DGLA 2BMQB 1PFPA 2H0HA 1O7PB 1MWRA 3CD63 1AV4A 1FYSA 3NV0B 4RNTA 1BNIA 2RFRA 4R4KA 4LGQA 3BNEA 3DGMA 2HMMB 3L0RA 3MPHA 5LC7A 1QAKA 1IVVA 3V92A 3K5TA 3G6E3 3OW22 1BSBA 2ZL8A 2WGQA 3RGAA 1IQYA 1S723 3FG4A 2RGQA 1UI7A 3KSPA 3ER7A 3JUNA 1MWUA 5LC6A 1B27A 2F86B 3Q3FA 3VF1A 4WHAA 4N3VA 1RGGA 1Q864 4NREA 2CK3H 1RCKA 4IT7A 2FXTA 1X1YA 1RSNA 3LTDA 3FZWA 2H0GA 1BNFA 2XRXB 3X40A 2PNCA 1RGEA 1UI8A 2Q07A 5AIIA 5AEWB 2KF5A 3JUMA 1HU9A 1G02A 1Q7HA 2KF3A 1L5GB 1G0TA 3SLUA 2IUKA 1R4YA 1RTUA 3KKGA 4KZ1A 4XBTA 1N5PA 1PYLA 3ECFA 4JRFA 4NPBA 3CC23 4N6LA 5CF1A 1GMQA 3GWRA 4LEHA 2B1XB 1O7HB 3CCJ3 3D5GA 4MMZB 1UGHI 1W01A 1W2B2 2P0XA 3KSED 4G1MB 1I8VA 1N8QA 1BNRA 4BU4A 4BTYA 5JBSA 3X41A 3RGRA 3OWYA 1BVIA 3AGOA 3PGBA 1SIIA 1TJDA 1MGWA 3H51A 4J8TA 2CG1A 1LXEA 5IF6A 3BU4A 1UW1A 3A5EA 3Q2PA 4X2HA 1KC84 2WGOA 1IU7A 5DREA 3EB8A 2K0MA 1CYVA 1JB5A 2W04A 3CNMA 2CFDA 2P38A 1HZ1A 5DRVA 1RKYA 3FGYA 3PS8A 1CEWI 1I3IA 1ROAA 1U8CB 2C4BA 3NM7A 4KFDA 4BTXA 1IT7A 5IG4A 1I70A 2CIUA 1SIHA 3G8ZA 1JB4A 2AADA 2CHCA 3STDA 4AKZA 5AEUB 3X3XA 1VQ43 2CFKA 2HOHA 2XSHB 4N6OB 3CCE3 4HM4B 3N8BA 1CH0A 2KF6A 4N6NB 2BU4A 1UCJA 1D6UA 2M7OA 2P0MA 1JN5A 2R41A 2XFSA 3DXOA 2JQ5A 2OCTA 3S5CA 1VQP3 3UNLA 2CFWA 5G1KA 1IT8A 1NB5I 1GY7A 3MWZA 3RDEA 1RNBA 5IW9A 3TDGA 1T5YA 2XF3A 1US1A 1MNLA 3ALAA 3AGNA 3Q90A 1OGXA 5HGRA 1UCKA 3KE7A 3GZBA 4HM1B 1X1UA 3PZWA 5EVHA 1GS3A 1BRGA 1TFKA 2QIYA 3HX8A 3HZPA 1NNVA 1E3VA 1G96A 1WTHA 4FCZA 4TX4A 4WWUC 1KQS2 1F8NA 3EE1A 1I0XA 3UB1A 1RCLA 3K0ZA 4ILFA 3S28A 9RNTA 1FGQA 1TIJA 4Q53A 3S27A 1VQQA 3JUPA 3I553 1RRLA 2O9UX 1M904 1X1WA 1MWSA 3WR2A 1JZDA 3AHWA 1BUJA 1T3BA 2SARA 3CCM3 3G16A 3SVAA 3CCS3 1LRAA 1A2VA 3X42A 3KFQC 2BHMA 3PXMA 4R1KA 3SYUA 5BXQA 3WOEB 2CFGA 1V58A 5CF2A 1STDA 4K61A 3GZRA 2LQVA 4HM6B 5AYRB 1OF5A 4HZ9B 2O3OA 3DH2A 4GHOA 2MF7A 2OWPA 1YI23 6STDA 3CCQ3 2XSOB 3EF8A 3G4S3 3MYTA 4CDLA 3A76A 1BAOA 3S29A 1RDSA 3MHEA 3T0UA 1VQM3 4EYCA 5ELJA 1NB3I 2Y73A 3F14A 3B4PA 2W2CA 4H3UA 3EN8A 4HM8B 1A90A 3G0KA 1Q814 2GXFA 5AIFA 1RNTA 4EXRA 1KD14 1GD4A 5AYSC 2CC3A 3CU3A 1RGKA 3KN4A 4KFEA 1O7WB 1E3RA 1W7CA 3B7CA 4RZMA 1TRQA 2IYJA 3S67A 4FCJA 7GSPA 3OX9A 4I4KA 2CWUA 4EW5A 2OQEA 2OTL3 1YGEA 5BU4A 1FGRA 1NJI4 3LTCA 2LYXA 4H61A 5KP3A 1ULJB 2XFTA 4CPKA 1I2EA 1VQN3 3MKIA 1UGIA 4O02B 1K9M4 5ELUA 1D6YA 3D79A 1LNHA 2GEXA 1IV9A 3B4OA 1YVSA 2F98A 2HMKB 2C10A 1MWTA 1BANA 4NHFA 1EA2A 3V99A 1VZZA 3NV0A 2YFLB 1DETA 2XH9A 3FLJA 1AQZA 1FZUA 1I3FA 5G1LA 1I0VA 4BIRA 3CCU3 1Q40B 1VQ63 2E2UA 3NXJA 3NBBA 3MG1A 2XGNA 3NM2A 1IVXA 1QVG2 1M1XB 2D42A 2YX9A 1OHOA 3N54B 1LOYA 3UJMA 3VGNA 1IDPA 2E2VA 3OWSA 4JF8A 1MGRA 3LT8A 4KFFA 4N6TA 5IG0A 1GY6A 5KP1A 1W5ZA 1V74A 1V57A 1OH0A 1W2ZA 1DMQA 4N6MA 1YJ93 1IVUA 2GEYA 3FG1A 3PCSA 3CNXA 1SJWA 2CWTA 1HKXA 3FSDA 4HM5B 4I5QA 3HIGA 1GYBA 4CJNA 1OHPA 4LSOA 1JRQA 1D6ZA 3BNCA 1DYUA 4EV5A 3CCV3 1Z1SA 1OCVA 3DGYA 6GSPA 2BIRA 4U13A 3LTAA 1K28A 1BRSA 4HOHA 2IY2A 4N6V0 1RN4A 1UCIA 2OTJ3 2AAEA 3EBTA 4LYLB 3DM8A 1IYYA 2W0QA 5RNTA 1QJGA 2GBWB 3DUKA 3QK9A 4J5KA 3U97A 2RSXA 2V1LA 4BL3A 3ZG5A 3HI7A 3BB9A 3J7Yd 1BOXA 1WMPA 5D83A 4AEQA 1GSPA 1Q9EA 2RCDA 8RNTA 4PEJA 1BNGA 1Q42A 4HJLB 2STDA 3LXUX 3ZG0A 4OK0A 3CXC2 3Q1CA 2CG0A 5IG3A 1A67A 3BLZA 3JUOA 3AHSA 1FUSA 3GRDA 3LZAA 3K63A 2ML6A 3VSYA 1RN1A 2XEPA 4OVMA 2BO9B 3SEDA 3HIIA 3KZTA 4XBYA 3DMCA 1RJOA 3BIRA 4L7KA 1ISKA 1VQL3 3MG2A 1VQ73 3CCL3 2UUGC 1S5AA 1VQO3 4HM7B 2BMOB 2RBIA 2W9PA 2CWVA 2KXGA 3GAXA 3FH1A 4RNZA 2GU1A 1EQKA 1GOYA 3EHCA 1JV2B 2CX0A 2E2TA 2KRTA 4AKYA 3OV4A 1SQWA 2HMJB 3X3YA 1RGCA 3EN1B 5D82A 3G713 1YJN3 1JKGB 1RN7A 2WOFA 3SOYA 3NBJA 6RNTA 3CMA3 2W03A 3LH4A 3LOYA 4RBNA 1PY3A 1BNEA
chains in the Genus database with same CATH topology
1TRPA 1BNFA 1BNSA 4HAAA 1RNTA 1RGEA 1JBRA 2KF5A 1JBTA 1G02A 2KF3A 1B2SA 1BIRA 1R4YA 1RGKA 1RTUA 1PYLA 1BRIA 1BNJA 1TRQA 7GSPA 1GMQA 3KCHA 1DE3A 1T2IA 5BU4A 3D5GA 1BU4A 3GSPA 1I2EA 1I2GA 1I8VA 1BNRA 1TTOA 4BU4A 1YVSA 1BVIA 3AGOA 5BIRA 1BANA 1MGWA 5GSPA 3BU4A 1X1XA 1DETA 3A5EA 4BIRA 1AQZA 1FZUA 1I3FA 1I0VA 1T2HA 1LOVA 2F4YA 1C54A 1B21A 1B2MA 1HZ1A 3D5IA 1BSAA 2F56A 2C4BA 1I3IA 2GSPA 1LOYA 1BRJA 1I70A 2F5MA 1UCLA 1BRNL 2AADA 3URPA 1B20A 1BSEA 1AY7A 1LNIA 1RGLA 1B2UA 1I2FA 1MGRA 4GSPA 1GMRA 3HOHA 5HOHA 1GOUA 1HYFA 2HOHA 1RGFA 1RGAA 1JBSA 1BGSA 1BRKA 3WHOA 1CH0A 2KF6A 2ZA4A 2BU4A 1UCJA 1LOWA 1BSDA 3D4AA 1FUTA 1YNVX 1RNBA 3RNTA 1B2ZA 3AGNA 1RMSA 1UCKA 3DGYA 2BIRA 6GSPA 1YGWA 1BRSA 1GOVA 1RLSA 1X1UA 1RN4A 1UCIA 4HOHA 2AAEA 1BRGA 2RNTA 1FW7A 1SARA 1IYYA 5RNTA 4J5KA 1I0XA 1RGHA 1ZGXA 2KF4A 1RCLA 1B3SA 1BOXA 1A2PA 9RNTA 4J5GA 1GSPA 1Q9EA 8RNTA 1BNGA 1X1WA 3WR2A 1RHLA 7RNTA 3AHWA 1B2XA 1BSCA 1BUJA 2SARA 2F5WA 3AHSA 1FUSA 1LRAA 3SYUA 1RN1A 3BIRA 1FYSA 4RNTA 1BNIA 1BRHA 3DH2A 4GHOA 2KAAA 1BSBA 2RBIA 1BAOA 1GOYA 1GMPA 1B27A 1RDSA 3Q3FA 1RGCA 1RGGA 6RNTA 1RCKA 1X1YA 1RSNA 1PY3A 1BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRP A;  1BNF A;  1BNS A;  4HAA A;  1RNT A;  1RGE A;  1JBR A;  2KF5 A;  1JBT A;  1G02 A;  2KF3 A;  1B2S A;  1BIR A;  1R4Y A;  1RGK A;  1RTU A;  1PYL A;  1BRI A;  1BNJ A;  1TRQ A;  7GSP A;  1GMQ A;  3KCH A;  1DE3 A;  1T2I A;  5BU4 A;  3D5G A;  1BU4 A;  3GSP A;  1I2E A;  1I2G A;  1I8V A;  1BNR A;  1TTO A;  4BU4 A;  1YVS A;  1BVI A;  3AGO A;  5BIR A;  1BAN A;  1MGW A;  5GSP A;  3BU4 A;  1X1X A;  1DET A;  3A5E A;  4BIR A;  1AQZ A;  1FZU A;  1I3F A;  1I0V A;  1T2H A;  1LOV A;  2F4Y A;  1C54 A;  1B21 A;  1B2M A;  1HZ1 A;  3D5I A;  1BSA A;  2F56 A;  2C4B A;  1I3I A;  2GSP A;  1LOY A;  1BRJ A;  1I70 A;  2F5M A;  1UCL A;  1BRN L;  2AAD A;  3URP A;  1B20 A;  1BSE A;  1AY7 A;  1LNI A;  1RGL A;  1B2U A;  1I2F A;  1MGR A;  4GSP A;  1GMR A;  3HOH A;  5HOH A;  1GOU A;  1HYF A;  2HOH A;  1RGF A;  1RGA A;  1JBS A;  1BGS A;  1BRK A;  3WHO A;  1CH0 A;  2KF6 A;  2ZA4 A;  2BU4 A;  1UCJ A;  1LOW A;  1BSD A;  3D4A A;  1FUT A;  1YNV X;  1RNB A;  3RNT A;  1B2Z A;  3AGN A;  1RMS A;  1UCK A;  3DGY A;  2BIR A;  6GSP A;  1YGW A;  1BRS A;  1GOV A;  1RLS A;  1X1U A;  1RN4 A;  1UCI A;  4HOH A;  2AAE A;  1BRG A;  2RNT A;  1FW7 A;  1SAR A;  1IYY A;  5RNT A;  4J5K A;  1I0X A;  1RGH A;  1ZGX A;  2KF4 A;  1RCL A;  1B3S A;  1BOX A;  1A2P A;  9RNT A;  4J5G A;  1GSP A;  1Q9E A;  8RNT A;  1BNG A;  1X1W A;  3WR2 A;  1RHL A;  7RNT A;  3AHW A;  1B2X A;  1BSC A;  1BUJ A;  2SAR A;  2F5W A;  3AHS A;  1FUS A;  1LRA A;  3SYU A;  1RN1 A;  3BIR A;  1FYS A;  4RNT A;  1BNI A;  1BRH A;  3DH2 A;  4GHO A;  2KAA A;  1BSB A;  2RBI A;  1BAO A;  1GOY A;  1GMP A;  1B27 A;  1RDS A;  3Q3F A;  1RGC A;  1RGG A;  6RNT A;  1RCK A;  1X1Y A;  1RSN A;  1PY3 A;  1BNE A; 
#chains in the Genus database with same CATH topology
 4HAA A;  1BNS A;  3SOA A;  1N9E A;  1IVW A;  4LZI A;  3OXA A;  2P09 A;  1CYU A;  2CFL A;  1JBT A;  1ULI B;  4XDW A;  3IPT A;  3LYG A;  1LOX A;  1FUW A;  1LVN A;  1BRI A;  3EJV A;  4IPB A;  1ROV A;  1E97 A;  3U1W A;  3CPO A;  1ZS7 A;  4HM0 B;  1DMM A;  1DE3 A;  3O8Y A;  5IG5 A;  1AVL A;  3DY5 A;  4WYK B;  1BU4 A;  4KVH A;  1TU5 A;  3LML A;  1U5O A;  1JB2 A;  5CXO A;  3CPW 2;  2OQE C;  1VQ9 3;  3K9M C;  1IK3 A;  2IA7 A;  4HM2 B;  3WDG B;  5BIR A;  7STD A;  1VQ8 3;  4L8O A;  4KT3 B;  4O2H A;  1OGZ A;  1IQX A;  1NO3 A;  3MG3 A;  5D81 A;  8CHO A;  3M8C A;  2HML B;  1AR0 A;  1EG9 B;  1W00 A;  2F4Y A;  4IIA A;  1CQS A;  5IER A;  4K90 B;  5M1A A;  3I0Y A;  1B2M A;  2FGT A;  5FW5 A;  1YIT 3;  3D5I A;  1UDI I;  1BSA A;  1TFO A;  2F56 A;  3AMO B;  4WP5 A;  2GSP A;  2XR8 B;  3SX1 A;  4O8S A;  1LQM B;  2Z6B A;  3F7S A;  3NQY A;  2F5M A;  1UCL A;  1BRN L;  1GD3 A;  3UL5 A;  4FMC A;  4X2O A;  1BSE A;  1AY7 A;  1RGL A;  2K54 A;  1B2U A;  2J8X B;  3NQZ A;  4GSP A;  2Z76 A;  3LT9 A;  1GMR A;  3HOH A;  4OUQ A;  5FGO A;  5G2G A;  3H3H A;  1VQK 3;  4EV2 A;  2GBX B;  2L4V A;  3FCS B;  1W6G A;  1RGF A;  3LTB A;  1JBS A;  3QRD A;  3JUQ A;  4MEI A;  3WA2 X;  2F99 A;  2ZA4 A;  1M9G A;  2D1W A;  2P05 A;  2W6J H;  3JVC A;  5IEN A;  1LOW A;  2Z77 A;  1W6Y A;  1BSD A;  2BMR B;  3OWU A;  5AIH A;  1FUT A;  2W56 B;  2QEX 3;  1YNV X;  1BUQ A;  4J9A A;  1IV7 A;  2Z7A A;  3K7C A;  2IMJ A;  4FR9 A;  3PYJ A;  1Y4K A;  1B2Z A;  1FGM A;  1KWI A;  1IQ8 A;  2BNG A;  1GY5 A;  1TUH A;  3D9R A;  1YGW A;  1GOV A;  5KP4 A;  1QAF A;  1FW7 A;  1K73 4;  2RNT A;  2ML5 A;  4FMB A;  1FGT A;  1Q82 4;  2W56 A;  4MJD A;  2KF4 A;  3BND A;  1W02 A;  4N6U A;  1DVC A;  1Q40 A;  1LQG C;  2MC8 A;  4GL6 A;  4R9L A;  3BNB A;  3DGO A;  3KII A;  3T8U A;  5JPU A;  1N8R 4;  3DGN A;  2ZHX B;  2F5W A;  1O7M B;  4HBR A;  3ZFZ A;  1M1K 4;  3GZY B;  2K3D A;  3UL6 A;  1QVF 2;  1RRH A;  4LMI A;  3NHX A;  3DZL A;  1OHS A;  1NDO B;  2R4I A;  1N9J A;  3IJE B;  1VQ5 3;  2QA4 3;  1BRH A;  3SXX A;  1N5H A;  1W4N A;  2GU3 A;  5EEO A;  2KAA A;  3V98 A;  3WOF B;  4HKV B;  3NBR A;  3FKA A;  4ZM8 A;  4STD A;  2HMN B;  1GMP A;  2SBL A;  1STF I;  5EQL A;  5TGN A;  1MOL A;  2INX A;  2CKF B;  4HYZ A;  2C11 A;  4MMX B;  1EEJ A;  3N9H A;  4K1U A;  4L8P A;  1DVD A;  3PCR A;  4XDV A;  1OUN A;  1TRP A;  1JBR A;  2IUJ A;  3HK4 A;  2Y74 A;  4XB5 A;  2WO0 A;  1B2S A;  5M19 A;  1BIR A;  4R80 A;  1ZO2 A;  1FA3 A;  1JN5 B;  2PZV A;  3X3Z A;  1BNJ A;  4HM3 B;  5IEO A;  3KCH A;  4O3V A;  1J2B A;  1T2I A;  1OAC A;  2L1S A;  1JNQ A;  2BT3 A;  2CW9 A;  1DMN A;  3F40 A;  3FG3 A;  3GSP A;  1I2G A;  4FMD A;  3I56 3;  3F8H A;  4MMY B;  4HZB B;  1YHQ 3;  1TTO A;  1QMA A;  4QWT A;  3F7X A;  5CLK A;  4DKI A;  3CCR 3;  5GSP A;  3CC7 3;  3WMD A;  1R4C A;  1X1X A;  3GZX B;  1YJW 3;  2HMO B;  2YFI B;  1T2H A;  3NUV A;  4K1V A;  3CC4 3;  1LOV A;  2B24 B;  4R9K A;  1C54 A;  1B21 A;  3EBY A;  4FCM A;  4CCV A;  1QAL A;  1WMN A;  3EQQ B;  3F9S A;  2UGI A;  2I9W A;  1EKM A;  2YFJ B;  4FMA A;  5AIG A;  4XBX A;  4BTW A;  3CME 3;  5M18 A;  5CK6 A;  1WMO A;  3NX0 A;  2WOH A;  1BRJ A;  3E99 A;  2A15 A;  1NU3 A;  1JJ2 2;  1JKG A;  4XM4 A;  3URP A;  1B20 A;  1LNI A;  2UX0 A;  2ZDJ A;  4ORL A;  1I2F A;  1O7G B;  1ZX2 A;  1WQL B;  5HOH A;  5AI1 A;  2KCD A;  1GOU A;  1HYF A;  2W9Q A;  1RGA A;  1OF5 B;  1BGS A;  1SPU A;  1BRK A;  2OOV C;  2FNQ A;  3WHO A;  5JPP A;  1Q7Y 4;  3WA3 A;  2XGL A;  3FF2 A;  3EX9 A;  5A0O B;  3D4A A;  1OPY A;  1W6C A;  2H0I A;  3MSO A;  1JZO A;  1UUG B;  4WYK A;  3RNT A;  1K8A 4;  4EBG A;  3D3L A;  4RNY A;  1RMS A;  3IMA B;  1AVK A;  4HVN A;  1RLS A;  1PU4 A;  1K41 A;  1TP6 A;  2CX1 A;  1O7N B;  4WFO A;  1SAR A;  5IEP A;  2QGU A;  2OOV A;  1UUW B;  1NWW A;  1UUV B;  1C7H A;  1RGH A;  1ZGX A;  3FF0 A;  1YIJ 3;  1B3S A;  3EC9 A;  1A2P A;  3F8X A;  4J5G A;  2JDI H;  1FGO A;  1KSI A;  4GB5 A;  1A2K A;  1WNH A;  5STD A;  3ROB A;  1RHL A;  7RNT A;  1YVB I;  1B2X A;  1BSC A;  4BL2 A;  4EC6 A;  3B8L A;  3WOD G;  3AMO A;  3T8N A;  5I97 A;  5BVB A;  2CH9 A;  1EUI C;  1ASK A;  3DGL A;  2BMQ B;  1PFP A;  2H0H A;  1O7P B;  1MWR A;  3CD6 3;  1AV4 A;  1FYS A;  3NV0 B;  4RNT A;  1BNI A;  2RFR A;  4R4K A;  4LGQ A;  3BNE A;  3DGM A;  2HMM B;  3L0R A;  3MPH A;  5LC7 A;  1QAK A;  1IVV A;  3V92 A;  3K5T A;  3G6E 3;  3OW2 2;  1BSB A;  2ZL8 A;  2WGQ A;  3RGA A;  1IQY A;  1S72 3;  3FG4 A;  2RGQ A;  1UI7 A;  3KSP A;  3ER7 A;  3JUN A;  1MWU A;  5LC6 A;  1B27 A;  2F86 B;  3Q3F A;  3VF1 A;  4WHA A;  4N3V A;  1RGG A;  1Q86 4;  4NRE A;  2CK3 H;  1RCK A;  4IT7 A;  2FXT A;  1X1Y A;  1RSN A;  3LTD A;  3FZW A;  2H0G A;  1BNF A;  2XRX B;  3X40 A;  2PNC A;  1RGE A;  1UI8 A;  2Q07 A;  5AII A;  5AEW B;  2KF5 A;  3JUM A;  1HU9 A;  1G02 A;  1Q7H A;  2KF3 A;  1L5G B;  1G0T A;  3SLU A;  2IUK A;  1R4Y A;  1RTU A;  3KKG A;  4KZ1 A;  4XBT A;  1N5P A;  1PYL A;  3ECF A;  4JRF A;  4NPB A;  3CC2 3;  4N6L A;  5CF1 A;  1GMQ A;  3GWR A;  4LEH A;  2B1X B;  1O7H B;  3CCJ 3;  3D5G A;  4MMZ B;  1UGH I;  1W01 A;  1W2B 2;  2P0X A;  3KSE D;  4G1M B;  1I8V A;  1N8Q A;  1BNR A;  4BU4 A;  4BTY A;  5JBS A;  3X41 A;  3RGR A;  3OWY A;  1BVI A;  3AGO A;  3PGB A;  1SII A;  1TJD A;  1MGW A;  3H51 A;  4J8T A;  2CG1 A;  1LXE A;  5IF6 A;  3BU4 A;  1UW1 A;  3A5E A;  3Q2P A;  4X2H A;  1KC8 4;  2WGO A;  1IU7 A;  5DRE A;  3EB8 A;  2K0M A;  1CYV A;  1JB5 A;  2W04 A;  3CNM A;  2CFD A;  2P38 A;  1HZ1 A;  5DRV A;  1RKY A;  3FGY A;  3PS8 A;  1CEW I;  1I3I A;  1ROA A;  1U8C B;  2C4B A;  3NM7 A;  4KFD A;  4BTX A;  1IT7 A;  5IG4 A;  1I70 A;  2CIU A;  1SIH A;  3G8Z A;  1JB4 A;  2AAD A;  2CHC A;  3STD A;  4AKZ A;  5AEU B;  3X3X A;  1VQ4 3;  2CFK A;  2HOH A;  2XSH B;  4N6O B;  3CCE 3;  4HM4 B;  3N8B A;  1CH0 A;  2KF6 A;  4N6N B;  2BU4 A;  1UCJ A;  1D6U A;  2M7O A;  2P0M A;  1JN5 A;  2R41 A;  2XFS A;  3DXO A;  2JQ5 A;  2OCT A;  3S5C A;  1VQP 3;  3UNL A;  2CFW A;  5G1K A;  1IT8 A;  1NB5 I;  1GY7 A;  3MWZ A;  3RDE A;  1RNB A;  5IW9 A;  3TDG A;  1T5Y A;  2XF3 A;  1US1 A;  1MNL A;  3ALA A;  3AGN A;  3Q90 A;  1OGX A;  5HGR A;  1UCK A;  3KE7 A;  3GZB A;  4HM1 B;  1X1U A;  3PZW A;  5EVH A;  1GS3 A;  1BRG A;  1TFK A;  2QIY A;  3HX8 A;  3HZP A;  1NNV A;  1E3V A;  1G96 A;  1WTH A;  4FCZ A;  4TX4 A;  4WWU C;  1KQS 2;  1F8N A;  3EE1 A;  1I0X A;  3UB1 A;  1RCL A;  3K0Z A;  4ILF A;  3S28 A;  9RNT A;  1FGQ A;  1TIJ A;  4Q53 A;  3S27 A;  1VQQ A;  3JUP A;  3I55 3;  1RRL A;  2O9U X;  1M90 4;  1X1W A;  1MWS A;  3WR2 A;  1JZD A;  3AHW A;  1BUJ A;  1T3B A;  2SAR A;  3CCM 3;  3G16 A;  3SVA A;  3CCS 3;  1LRA A;  1A2V A;  3X42 A;  3KFQ C;  2BHM A;  3PXM A;  4R1K A;  3SYU A;  5BXQ A;  3WOE B;  2CFG A;  1V58 A;  5CF2 A;  1STD A;  4K61 A;  3GZR A;  2LQV A;  4HM6 B;  5AYR B;  1OF5 A;  4HZ9 B;  2O3O A;  3DH2 A;  4GHO A;  2MF7 A;  2OWP A;  1YI2 3;  6STD A;  3CCQ 3;  2XSO B;  3EF8 A;  3G4S 3;  3MYT A;  4CDL A;  3A76 A;  1BAO A;  3S29 A;  1RDS A;  3MHE A;  3T0U A;  1VQM 3;  4EYC A;  5ELJ A;  1NB3 I;  2Y73 A;  3F14 A;  3B4P A;  2W2C A;  4H3U A;  3EN8 A;  4HM8 B;  1A90 A;  3G0K A;  1Q81 4;  2GXF A;  5AIF A;  1RNT A;  4EXR A;  1KD1 4;  1GD4 A;  5AYS C;  2CC3 A;  3CU3 A;  1RGK A;  3KN4 A;  4KFE A;  1O7W B;  1E3R A;  1W7C A;  3B7C A;  4RZM A;  1TRQ A;  2IYJ A;  3S67 A;  4FCJ A;  7GSP A;  3OX9 A;  4I4K A;  2CWU A;  4EW5 A;  2OQE A;  2OTL 3;  1YGE A;  5BU4 A;  1FGR A;  1NJI 4;  3LTC A;  2LYX A;  4H61 A;  5KP3 A;  1ULJ B;  2XFT A;  4CPK A;  1I2E A;  1VQN 3;  3MKI A;  1UGI A;  4O02 B;  1K9M 4;  5ELU A;  1D6Y A;  3D79 A;  1LNH A;  2GEX A;  1IV9 A;  3B4O A;  1YVS A;  2F98 A;  2HMK B;  2C10 A;  1MWT A;  1BAN A;  4NHF A;  1EA2 A;  3V99 A;  1VZZ A;  3NV0 A;  2YFL B;  1DET A;  2XH9 A;  3FLJ A;  1AQZ A;  1FZU A;  1I3F A;  5G1L A;  1I0V A;  4BIR A;  3CCU 3;  1Q40 B;  1VQ6 3;  2E2U A;  3NXJ A;  3NBB A;  3MG1 A;  2XGN A;  3NM2 A;  1IVX A;  1QVG 2;  1M1X B;  2D42 A;  2YX9 A;  1OHO A;  3N54 B;  1LOY A;  3UJM A;  3VGN A;  1IDP A;  2E2V A;  3OWS A;  4JF8 A;  1MGR A;  3LT8 A;  4KFF A;  4N6T A;  5IG0 A;  1GY6 A;  5KP1 A;  1W5Z A;  1V74 A;  1V57 A;  1OH0 A;  1W2Z A;  1DMQ A;  4N6M A;  1YJ9 3;  1IVU A;  2GEY A;  3FG1 A;  3PCS A;  3CNX A;  1SJW A;  2CWT A;  1HKX A;  3FSD A;  4HM5 B;  4I5Q A;  3HIG A;  1GYB A;  4CJN A;  1OHP A;  4LSO A;  1JRQ A;  1D6Z A;  3BNC A;  1DYU A;  4EV5 A;  3CCV 3;  1Z1S A;  1OCV A;  3DGY A;  6GSP A;  2BIR A;  4U13 A;  3LTA A;  1K28 A;  1BRS A;  4HOH A;  2IY2 A;  4N6V 0;  1RN4 A;  1UCI A;  2OTJ 3;  2AAE A;  3EBT A;  4LYL B;  3DM8 A;  1IYY A;  2W0Q A;  5RNT A;  1QJG A;  2GBW B;  3DUK A;  3QK9 A;  4J5K A;  3U97 A;  2RSX A;  2V1L A;  4BL3 A;  3ZG5 A;  3HI7 A;  3BB9 A;  3J7Y d;  1BOX A;  1WMP A;  5D83 A;  4AEQ A;  1GSP A;  1Q9E A;  2RCD A;  8RNT A;  4PEJ A;  1BNG A;  1Q42 A;  4HJL B;  2STD A;  3LXU X;  3ZG0 A;  4OK0 A;  3CXC 2;  3Q1C A;  2CG0 A;  5IG3 A;  1A67 A;  3BLZ A;  3JUO A;  3AHS A;  1FUS A;  3GRD A;  3LZA A;  3K63 A;  2ML6 A;  3VSY A;  1RN1 A;  2XEP A;  4OVM A;  2BO9 B;  3SED A;  3HII A;  3KZT A;  4XBY A;  3DMC A;  1RJO A;  3BIR A;  4L7K A;  1ISK A;  1VQL 3;  3MG2 A;  1VQ7 3;  3CCL 3;  2UUG C;  1S5A A;  1VQO 3;  4HM7 B;  2BMO B;  2RBI A;  2W9P A;  2CWV A;  2KXG A;  3GAX A;  3FH1 A;  4RNZ A;  2GU1 A;  1EQK A;  1GOY A;  3EHC A;  1JV2 B;  2CX0 A;  2E2T A;  2KRT A;  4AKY A;  3OV4 A;  1SQW A;  2HMJ B;  3X3Y A;  1RGC A;  3EN1 B;  5D82 A;  3G71 3;  1YJN 3;  1JKG B;  1RN7 A;  2WOF A;  3SOY A;  3NBJ A;  6RNT A;  3CMA 3;  2W03 A;  3LH4 A;  3LOY A;  4RBN A;  1PY3 A;  1BNE A; 
#chains in the Genus database with same CATH homology
 1TRP A;  1BNF A;  1BNS A;  4HAA A;  1RNT A;  1RGE A;  1JBR A;  2KF5 A;  1JBT A;  1G02 A;  2KF3 A;  1B2S A;  1BIR A;  1R4Y A;  1RGK A;  1RTU A;  1PYL A;  1BRI A;  1BNJ A;  1TRQ A;  7GSP A;  1GMQ A;  3KCH A;  1DE3 A;  1T2I A;  5BU4 A;  3D5G A;  1BU4 A;  3GSP A;  1I2E A;  1I2G A;  1I8V A;  1BNR A;  1TTO A;  4BU4 A;  1YVS A;  1BVI A;  3AGO A;  5BIR A;  1BAN A;  1MGW A;  5GSP A;  3BU4 A;  1X1X A;  1DET A;  3A5E A;  4BIR A;  1AQZ A;  1FZU A;  1I3F A;  1I0V A;  1T2H A;  1LOV A;  2F4Y A;  1C54 A;  1B21 A;  1B2M A;  1HZ1 A;  3D5I A;  1BSA A;  2F56 A;  2C4B A;  1I3I A;  2GSP A;  1LOY A;  1BRJ A;  1I70 A;  2F5M A;  1UCL A;  1BRN L;  2AAD A;  3URP A;  1B20 A;  1BSE A;  1AY7 A;  1LNI A;  1RGL A;  1B2U A;  1I2F A;  1MGR A;  4GSP A;  1GMR A;  3HOH A;  5HOH A;  1GOU A;  1HYF A;  2HOH A;  1RGF A;  1RGA A;  1JBS A;  1BGS A;  1BRK A;  3WHO A;  1CH0 A;  2KF6 A;  2ZA4 A;  2BU4 A;  1UCJ A;  1LOW A;  1BSD A;  3D4A A;  1FUT A;  1YNV X;  1RNB A;  3RNT A;  1B2Z A;  3AGN A;  1RMS A;  1UCK A;  3DGY A;  2BIR A;  6GSP A;  1YGW A;  1BRS A;  1GOV A;  1RLS A;  1X1U A;  1RN4 A;  1UCI A;  4HOH A;  2AAE A;  1BRG A;  2RNT A;  1FW7 A;  1SAR A;  1IYY A;  5RNT A;  4J5K A;  1I0X A;  1RGH A;  1ZGX A;  2KF4 A;  1RCL A;  1B3S A;  1BOX A;  1A2P A;  9RNT A;  4J5G A;  1GSP A;  1Q9E A;  8RNT A;  1BNG A;  1X1W A;  3WR2 A;  1RHL A;  7RNT A;  3AHW A;  1B2X A;  1BSC A;  1BUJ A;  2SAR A;  2F5W A;  3AHS A;  1FUS A;  1LRA A;  3SYU A;  1RN1 A;  3BIR A;  1FYS A;  4RNT A;  1BNI A;  1BRH A;  3DH2 A;  4GHO A;  2KAA A;  1BSB A;  2RBI A;  1BAO A;  1GOY A;  1GMP A;  1B27 A;  1RDS A;  3Q3F A;  1RGC A;  1RGG A;  6RNT A;  1RCK A;  1X1Y A;  1RSN A;  1PY3 A;  1BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...