2ZHXB

Crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-DNA glycosylase
publication title Unique features of the structure and interactions of mycobacterial uracil-DNA glycosylase: structure of a complex of the Mycobacterium tuberculosis enzyme in comparison with those from other sources
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 82
sequence length 82
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2zhxB00
1EUIC 2ZHXB 1UUGB 1UGHI 1LQGC 1UGIA 2UGIA 1LQMB 2UUGC 4LYLB 1UDII 2J8XB
chains in the Genus database with same CATH superfamily
3CCQ3 1TTOA 3SOYA 5LC7A 2R41A 2RBIA 2ZA4A 3EE1A 1KWIA 2I9WA 4BTYA 5IW9A 1JN5A 1GS3A 1U8CB 4FR9A 5AI1A 2PZVA 4X2OA 5FGOA 3WOEB 1BSEA 4BTWA 2Z7AA 3IMAB 2XF3A 3EQQB 1RGLA 3G6E3 1Q40B 2W56A 4R9KA 2CG1A 4KZ1A 3UL5A 3CCM3 1I0XA 4K90B 5KP1A 4K61A 3I553 3LTAA 1SIHA 3AHWA 3GAXA 3JUOA 1VZZA 1AVLA 1ULIB 3QK9A 3S28A 1IK3A 1W5ZA 1YGEA 3F8XA 1FUTA 2F56A 1CYVA 2CWTA 4WWUC 5AYRB 4WYKB 2W9PA 2E2VA 2M7OA 3BNBA 3I563 5AEUB 1KC84 3V92A 3NM2A 1B3SA 3ECFA 1BRGA 3E99A 2XR8B 3F14A 4LSOA 5GSPA 3N9HA 2OQEA 3KSPA 2MC8A 3WODG 1F8NA 1BUJA 2GBXB 1U5OA 3CC43 1LVNA 5M1AA 1BNSA 1PYLA 1YHQ3 3ZG0A 1RN7A 5ELUA 3DXOA 3RDEA 1YNVX 3MHEA 4R4KA 4HM4B 4NPBA 8CHOA 2P38A 1BRIA 1ISKA 1DMQA 1LOVA 5G2GA 3GZBA 1K734 2Y73A 1GOVA 5JBSA 1UDII 3CC73 5CF2A 4H61A 1WMOA 2CWVA 3AHSA 4KVHA 1VQ43 5IEOA 4J9AA 1AQZA 1RGAA 1FYSA 2IY2A 3SLUA 4CCVA 4WFOA 3T0UA 4HM1B 2RFRA 1LNIA 4RNYA 2W9QA 1FZUA 3F9SA 3HX8A 1JKGB 3K9MC 4RNZA 1LQMB 4MJDA 1MWSA 3GWRA 5CK6A 1LNHA 1GD4A 1RN1A 3VSYA 2BHMA 3MYTA 1RCLA 2D42A 1W02A 1MWRA 5HOHA 1VQ63 1I2FA 1EKMA 3B4OA 1BNRA 1OF5B 2JQ5A 2CG0A 1SQWA 2XFSA 3X41A 1RDSA 1JB5A 1YJW3 5IG3A 1W2ZA 2HMNB 1KSIA 3EBYA 2XRXB 1BANA 3AGNA 3CCL3 1VQO3 1DVDA 1B21A 3DGOA 3MKIA 2WO0A 1RTUA 3H51A 4LEHA 3S5CA 1ZX2A 3OWSA 4K1UA 5IG4A 1QVF2 1AVKA 1US1A 3JUQA 5M18A 4O02B 3K5TA 3CD63 3FH1A 1IQYA 2KCDA 1STFI 1B2MA 2L4VA 3BNCA 3CNXA 1GYBA 1I70A 2R4IA 2KF4A 2CX1A 5BVBA 1NJI4 3X3YA 3NV0A 3LTCA 3MSOA 1BNFA 1VQ83 4EXRA 4AKZA 1UUGB 2BU4A 3UL6A 1ZGXA 8RNTA 3D5IA 4HZBB 4XM4A 2XSHB 2WOFA 2OOVA 5M19A 2C11A 2MF7A 1QJGA 3KE7A 3EN1B 4XBYA 4EC6A 2P0XA 2F98A 3L0RA 2K3DA 3FGYA 1MWUA 4JF8A 3WOFB 4EV5A 1AV4A 2O9UX 4HBRA 1C54A 3VF1A 3CC23 3NQYA 2OTJ3 3FSDA 1EQKA 1WMPA 1RHLA 2GSPA 4KFFA 1RGFA 3MG1A 2CC3A 5LC6A 3Q2PA 3CME3 1VQN3 2XSOB 1RRLA 2YFLB 4PEJA 3DZLA 1RGCA 1AY7A 2CKFB 5DRVA 2H0IA 3OXAA 4N6LA 4HM7B 3V99A 5EQLA 3PCSA 2WGOA 3WA2X 1M904 2K0MA 4MMXB 2CFWA 2GXFA 1OH0A 1B2ZA 1DETA 1O7GB 1W00A 1B2SA 1HU9A 1JZOA 1JBTA 3ZG5A 3HZPA 2KXGA 3NBBA 2BNGA 1BNJA 5AYSC 4CJNA 3FF2A 3MG3A 4IIAA 1OGZA 1RMSA 5IERA 1K9M4 4WHAA 2W04A 3CCV3 3G16A 5BXQA 1FA3A 2CH9A 4N6TA 5KP3A 1NB5I 4CPKA 4EBGA 3D79A 3DH2A 1B2XA 1UCIA 1IV7A 1UI7A 5AIIA 3MG2A 3GZXB 1EA2A 1BRJA 1DMMA 1AR0A 4N6OB 4XDWA 3PCRA 3X40A 1TFKA 2Y74A 3F7SA 4LZIA 2IYJA 3KKGA 4KFEA 1TJDA 3FG3A 1NDOB 3JVCA 1C7HA 3KIIA 1EEJA 4XBXA 3GZYB 1TFOA 4O3VA 2F4YA 3DY5A 3I0YA 1A2KA 2CX0A 3D9RA 1VQL3 5D82A 3CMA3 1EUIC 4JRFA 5JPUA 1GY7A 4QWTA 5AIHA 3NUVA 1W01A 1E3RA 1TP6A 1GMQA 1QALA 1FGTA 2YFIB 2H0HA 2HMJB 1BNIA 3SXXA 5G1KA 1IVVA 1CH0A 1GD3A 3LTDA 1KD14 3PGBA 4FCZA 1LOYA 2F86B 2QEX3 3OWYA 2AAEA 2Z77A 4MEIA 4STDA 3EF8A 4RBNA 4CDLA 1VQM3 1Q40A 3SX1A 1M9GA 2P05A 1IVWA 1GMRA 3X42A 4BTXA 2QIYA 1RRHA 1IT7A 1BSCA 1RGHA 2WOHA 2JDIH 3EJVA 3LH4A 1O7MB 1VQ93 3D3LA 4HZ9B 3JUPA 2W2CA 2O3OA 2UUGC 3T8UA 1Y4KA 1RJOA 3FG1A 1T2HA 1BRSA 3T8NA 4R1KA 9RNTA 1YIT3 3O8YA 4ZM8A 1HYFA 1UI8A 3UNLA 3A76A 4L7KA 3DGNA 3PXMA 3CCU3 1I2GA 1I3FA 3STDA 1JV2B 1PY3A 3FCSB 2RSXA 5DREA 2HMMB 1IVUA 4MMYB 5TGNA 2ZL8A 4J5KA 3CCR3 1IT8A 4I4KA 1PU4A 1BRKA 3K7CA 4KT3B 4IT7A 2QGUA 1DYUA 1S5AA 3G8ZA 3LT9A 2FNQA 3IPTA 3B4PA 2W6JH 1JB4A 1HZ1A 1KQS2 4I5QA 3BIRA 3BLZA 1Q42A 3DUKA 1O7HB 1L5GB 3U1WA 2ZDJA 6STDA 1W7CA 2GEXA 1I8VA 2B24B 1RNTA 2K54A 3K63A 4HKVB 3OWUA 3GRDA 1FGQA 4HM6B 3SYUA 5BIRA 3OX9A 3V98A 7RNTA 1YGWA 2AADA 2E2UA 1Q9EA 1RSNA 3PZWA 3D4AA 4HVNA 5CF1A 2IMJA 3LT8A 3NV0B 4O8SA 4R9LA 3SEDA 1W2B2 2F5WA 1JKGA 1BUQA 2GBWB 2GEYA 3NBJA 2W0QA 4DKIA 2INXA 2C4BA 1ZS7A 4RNTA 2CIUA 3EBTA 1FW7A 4L8OA 3KCHA 3PYJA 3N54B 3G713 3N8BA 4BL3A 1ROVA 1MGWA 1BGSA 3G4S3 3CPW2 3B7CA 1VQP3 2GU3A 1OF5A 3NQZA 3LTBA 1VQ73 1FGOA 1JZDA 3NX0A 1B20A 1BU4A 2HMKB 1BOXA 3ROBA 3CXC2 3A5EA 5IF6A 1Z1SA 3IJEB 4OUQA 4HAAA 2WGQA 1MOLA 3AMOB 3BNDA 1JRQA 1T5YA 1M1XB 1QAKA 1M1K4 3WHOA 3Q1CA 3VGNA 1A90A 2ML5A 2P09A 7STDA 4XDVA 1JNQA 4MMZB 1IDPA 4OK0A 4FCMA 5I97A 1YVBI 3KZTA 2YX9A 3DGMA 4HM5B 2HOHA 2J8XB 2F99A 1A2VA 1OHSA 3FF0A 1RLSA 1ROAA 3SOAA 4EW5A 3J7Yd 1JN5B 1PFPA 2BMQB 2BO9B 2XGLA 3CU3A 2W03A 5AEWB 4FMAA 2P0MA 1ASKA 3RNTA 3UJMA 1WTHA 2CHCA 2C10A 1X1YA 4U13A 2Z6BA 5ELJA 1TIJA 2CW9A 3MWZA 3OV4A 1OUNA 5A0OB 2IUKA 2XEPA 1WMNA 3M8CA 2Q07A 3ZFZA 3CCE3 2CFLA 2L1SA 2W56B 1A2PA 3WA3A 2STDA 5AIGA 3D5GA 1GOUA 1X1UA 3TDGA 4LGQA 1UCLA 3JUNA 2XH9A 4HM3B 5EEOA 1N9EA 1N8R4 1CEWI 4HYZA 2OWPA 5FW5A 3KN4A 4G1MB 2CWUA 1N9JA 1K8A4 2H0GA 1LQGC 1I2EA 3K0ZA 1I3IA 3RGRA 1OPYA 3RGAA 4OVMA 2KF3A 3NBRA 1CQSA 3HK4A 3ALAA 4FCJA 2BT3A 3NHXA 4KFDA 1IU7A 1GY6A 1O7WB 3HOHA 1SJWA 1ULJB 3B8LA 1DVCA 2ZHXB 4WP5A 5HGRA 3S29A 1YIJ3 1D6YA 1UCJA 1S723 4R80A 4N6MA 1OACA 3GSPA 4HJLB 1IQ8A 4GSPA 4IPBA 3UB1A 1Q7HA 3DGLA 3EN8A 3WDGB 5CLKA 1Q824 3CNMA 1E3VA 2UGIA 1TUHA 2BMRB 3BU4A 3OW22 1N5PA 3KFQC 1UUVB 3BNEA 2HMLB 3EC9A 4K1VA 3X3ZA 1O7PB 1UCKA 1GSPA 4HM2B 5IG0A 2KRTA 3Q3FA 1ZO2A 1NB3I 1OHOA 2CFGA 1YVSA 3NXJA 6RNTA 1YJ93 2F5MA 3ER7A 4J5GA 1CYUA 3X3XA 4N6UA 1R4YA 3JUMA 1JJ22 1GOYA 3FZWA 4H3UA 4WYKA 1TRQA 1RKYA 1D6UA 1TU5A 3NM7A 3BB9A 4FMCA 5RNTA 1K41A 1T3BA 5D83A 1BVIA 1SIIA 5STDA 1LOWA 2GU1A 1Q864 5JPPA 3LXUX 3S67A 4HM8B 2BMOB 1NU3A 1O7NB 2OCTA 3LOYA 4ILFA 4AKYA 4NHFA 1X1XA 3EX9A 3MPHA 1W6YA 4FMDA 1DMNA 4X2HA 1Q7Y4 1SPUA 1JB2A 3S27A 3F8HA 5G1LA 5KP4A 1VQ53 1W6CA 4NREA 1FGRA 2QA43 1E97A 7GSPA 5IEPA 1V74A 4AEQA 1BSAA 1RGGA 2CFDA 1RN4A 2IA7A 1WQLB 1BIRA 2XGNA 1RCKA 3Q90A 2OOVC 1JBSA 4FMBA 1B27A 1OGXA 1UW1A 2B1XB 1VQQA 4XB5A 2KF6A 2D1WA 4L8PA 2Z76A 5EVHA 4EV2A 1QVG2 1A67A 4GB5A 1TRPA 2PNCA 1QMAA 1UGIA 4BU4A 1K28A 4HM0B 4Q53A 1BNGA 1MNLA 1SARA 3FG4A 2FXTA 6GSPA 1WNHA 4O2HA 4ORLA 2LYXA 3F40A 1IVXA 1BSDA 3HIIA 3WMDA 2CK3H 1VQK3 2RCDA 3KSED 5D81A 1NWWA 1W4NA 1STDA 2KF5A 2SARA 3QRDA 3CCJ3 4N6NB 1IYYA 1YI23 1BSBA 3GZRA 1LXEA 1G96A 1GY5A 3F7XA 3PS8A 3CPOA 4LMIA 1LRAA 3HIGA 3G0KA 2KAAA 4BIRA 1B2UA 1V57A 3LZAA 2IUJA 2ML6A 4HOHA 1MWTA 1RNBA 2OTL3 1G02A 4RZMA 5IG5A 1UGHI 1N8QA 2V1LA 1BNEA 3LYGA 1RGKA 1BAOA 2RGQA 1JBRA 1GMPA 2CFKA 1FUWA 1D6ZA 1EG9B 1NO3A 5BU4A 3EHCA 5AIFA 1BRNL 4N6V0 3FKAA 1DE3A 4J8TA 1J2BA 3LMLA 1UUWB 4TX4A 1OCVA 3EB8A 1FUSA 2RNTA 4XBTA 1IQXA 4N3VA 4LYLB 1IV9A 2UX0A 3DGYA 2LQVA 1HKXA 5CXOA 1N5HA 1MGRA 1LOXA 3AGOA 3WR2A 1RGEA 3URPA 5IENA 2YFJB 1V58A 4GL6A 3DMCA 3AMOA 1I0VA 1Q814 1YJN3 3FLJA 1QAFA 4BL2A 1R4CA 3SVAA 1BRHA 2E2TA 1G0TA 3DM8A 1NNVA 1W6GA 3H3HA 2BIRA 2FGTA 1X1WA 2SBLA 1T2IA 3U97A 2HMOB 2OQEC 2A15A 4GHOA 4EYCA 1FGMA 1OHPA 3HI7A 2XFTA 3CCS3
chains in the Genus database with same CATH topology
1EUIC 2ZHXB 1UUGB 1UGHI 1LQGC 1UGIA 2UGIA 1LQMB 2UUGC 4LYLB 1UDII 2J8XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUI C;  2ZHX B;  1UUG B;  1UGH I;  1LQG C;  1UGI A;  2UGI A;  1LQM B;  2UUG C;  4LYL B;  1UDI I;  2J8X B; 
#chains in the Genus database with same CATH topology
 3CCQ 3;  1TTO A;  3SOY A;  5LC7 A;  2R41 A;  2RBI A;  2ZA4 A;  3EE1 A;  1KWI A;  2I9W A;  4BTY A;  5IW9 A;  1JN5 A;  1GS3 A;  1U8C B;  4FR9 A;  5AI1 A;  2PZV A;  4X2O A;  5FGO A;  3WOE B;  1BSE A;  4BTW A;  2Z7A A;  3IMA B;  2XF3 A;  3EQQ B;  1RGL A;  3G6E 3;  1Q40 B;  2W56 A;  4R9K A;  2CG1 A;  4KZ1 A;  3UL5 A;  3CCM 3;  1I0X A;  4K90 B;  5KP1 A;  4K61 A;  3I55 3;  3LTA A;  1SIH A;  3AHW A;  3GAX A;  3JUO A;  1VZZ A;  1AVL A;  1ULI B;  3QK9 A;  3S28 A;  1IK3 A;  1W5Z A;  1YGE A;  3F8X A;  1FUT A;  2F56 A;  1CYV A;  2CWT A;  4WWU C;  5AYR B;  4WYK B;  2W9P A;  2E2V A;  2M7O A;  3BNB A;  3I56 3;  5AEU B;  1KC8 4;  3V92 A;  3NM2 A;  1B3S A;  3ECF A;  1BRG A;  3E99 A;  2XR8 B;  3F14 A;  4LSO A;  5GSP A;  3N9H A;  2OQE A;  3KSP A;  2MC8 A;  3WOD G;  1F8N A;  1BUJ A;  2GBX B;  1U5O A;  3CC4 3;  1LVN A;  5M1A A;  1BNS A;  1PYL A;  1YHQ 3;  3ZG0 A;  1RN7 A;  5ELU A;  3DXO A;  3RDE A;  1YNV X;  3MHE A;  4R4K A;  4HM4 B;  4NPB A;  8CHO A;  2P38 A;  1BRI A;  1ISK A;  1DMQ A;  1LOV A;  5G2G A;  3GZB A;  1K73 4;  2Y73 A;  1GOV A;  5JBS A;  1UDI I;  3CC7 3;  5CF2 A;  4H61 A;  1WMO A;  2CWV A;  3AHS A;  4KVH A;  1VQ4 3;  5IEO A;  4J9A A;  1AQZ A;  1RGA A;  1FYS A;  2IY2 A;  3SLU A;  4CCV A;  4WFO A;  3T0U A;  4HM1 B;  2RFR A;  1LNI A;  4RNY A;  2W9Q A;  1FZU A;  3F9S A;  3HX8 A;  1JKG B;  3K9M C;  4RNZ A;  1LQM B;  4MJD A;  1MWS A;  3GWR A;  5CK6 A;  1LNH A;  1GD4 A;  1RN1 A;  3VSY A;  2BHM A;  3MYT A;  1RCL A;  2D42 A;  1W02 A;  1MWR A;  5HOH A;  1VQ6 3;  1I2F A;  1EKM A;  3B4O A;  1BNR A;  1OF5 B;  2JQ5 A;  2CG0 A;  1SQW A;  2XFS A;  3X41 A;  1RDS A;  1JB5 A;  1YJW 3;  5IG3 A;  1W2Z A;  2HMN B;  1KSI A;  3EBY A;  2XRX B;  1BAN A;  3AGN A;  3CCL 3;  1VQO 3;  1DVD A;  1B21 A;  3DGO A;  3MKI A;  2WO0 A;  1RTU A;  3H51 A;  4LEH A;  3S5C A;  1ZX2 A;  3OWS A;  4K1U A;  5IG4 A;  1QVF 2;  1AVK A;  1US1 A;  3JUQ A;  5M18 A;  4O02 B;  3K5T A;  3CD6 3;  3FH1 A;  1IQY A;  2KCD A;  1STF I;  1B2M A;  2L4V A;  3BNC A;  3CNX A;  1GYB A;  1I70 A;  2R4I A;  2KF4 A;  2CX1 A;  5BVB A;  1NJI 4;  3X3Y A;  3NV0 A;  3LTC A;  3MSO A;  1BNF A;  1VQ8 3;  4EXR A;  4AKZ A;  1UUG B;  2BU4 A;  3UL6 A;  1ZGX A;  8RNT A;  3D5I A;  4HZB B;  4XM4 A;  2XSH B;  2WOF A;  2OOV A;  5M19 A;  2C11 A;  2MF7 A;  1QJG A;  3KE7 A;  3EN1 B;  4XBY A;  4EC6 A;  2P0X A;  2F98 A;  3L0R A;  2K3D A;  3FGY A;  1MWU A;  4JF8 A;  3WOF B;  4EV5 A;  1AV4 A;  2O9U X;  4HBR A;  1C54 A;  3VF1 A;  3CC2 3;  3NQY A;  2OTJ 3;  3FSD A;  1EQK A;  1WMP A;  1RHL A;  2GSP A;  4KFF A;  1RGF A;  3MG1 A;  2CC3 A;  5LC6 A;  3Q2P A;  3CME 3;  1VQN 3;  2XSO B;  1RRL A;  2YFL B;  4PEJ A;  3DZL A;  1RGC A;  1AY7 A;  2CKF B;  5DRV A;  2H0I A;  3OXA A;  4N6L A;  4HM7 B;  3V99 A;  5EQL A;  3PCS A;  2WGO A;  3WA2 X;  1M90 4;  2K0M A;  4MMX B;  2CFW A;  2GXF A;  1OH0 A;  1B2Z A;  1DET A;  1O7G B;  1W00 A;  1B2S A;  1HU9 A;  1JZO A;  1JBT A;  3ZG5 A;  3HZP A;  2KXG A;  3NBB A;  2BNG A;  1BNJ A;  5AYS C;  4CJN A;  3FF2 A;  3MG3 A;  4IIA A;  1OGZ A;  1RMS A;  5IER A;  1K9M 4;  4WHA A;  2W04 A;  3CCV 3;  3G16 A;  5BXQ A;  1FA3 A;  2CH9 A;  4N6T A;  5KP3 A;  1NB5 I;  4CPK A;  4EBG A;  3D79 A;  3DH2 A;  1B2X A;  1UCI A;  1IV7 A;  1UI7 A;  5AII A;  3MG2 A;  3GZX B;  1EA2 A;  1BRJ A;  1DMM A;  1AR0 A;  4N6O B;  4XDW A;  3PCR A;  3X40 A;  1TFK A;  2Y74 A;  3F7S A;  4LZI A;  2IYJ A;  3KKG A;  4KFE A;  1TJD A;  3FG3 A;  1NDO B;  3JVC A;  1C7H A;  3KII A;  1EEJ A;  4XBX A;  3GZY B;  1TFO A;  4O3V A;  2F4Y A;  3DY5 A;  3I0Y A;  1A2K A;  2CX0 A;  3D9R A;  1VQL 3;  5D82 A;  3CMA 3;  1EUI C;  4JRF A;  5JPU A;  1GY7 A;  4QWT A;  5AIH A;  3NUV A;  1W01 A;  1E3R A;  1TP6 A;  1GMQ A;  1QAL A;  1FGT A;  2YFI B;  2H0H A;  2HMJ B;  1BNI A;  3SXX A;  5G1K A;  1IVV A;  1CH0 A;  1GD3 A;  3LTD A;  1KD1 4;  3PGB A;  4FCZ A;  1LOY A;  2F86 B;  2QEX 3;  3OWY A;  2AAE A;  2Z77 A;  4MEI A;  4STD A;  3EF8 A;  4RBN A;  4CDL A;  1VQM 3;  1Q40 A;  3SX1 A;  1M9G A;  2P05 A;  1IVW A;  1GMR A;  3X42 A;  4BTX A;  2QIY A;  1RRH A;  1IT7 A;  1BSC A;  1RGH A;  2WOH A;  2JDI H;  3EJV A;  3LH4 A;  1O7M B;  1VQ9 3;  3D3L A;  4HZ9 B;  3JUP A;  2W2C A;  2O3O A;  2UUG C;  3T8U A;  1Y4K A;  1RJO A;  3FG1 A;  1T2H A;  1BRS A;  3T8N A;  4R1K A;  9RNT A;  1YIT 3;  3O8Y A;  4ZM8 A;  1HYF A;  1UI8 A;  3UNL A;  3A76 A;  4L7K A;  3DGN A;  3PXM A;  3CCU 3;  1I2G A;  1I3F A;  3STD A;  1JV2 B;  1PY3 A;  3FCS B;  2RSX A;  5DRE A;  2HMM B;  1IVU A;  4MMY B;  5TGN A;  2ZL8 A;  4J5K A;  3CCR 3;  1IT8 A;  4I4K A;  1PU4 A;  1BRK A;  3K7C A;  4KT3 B;  4IT7 A;  2QGU A;  1DYU A;  1S5A A;  3G8Z A;  3LT9 A;  2FNQ A;  3IPT A;  3B4P A;  2W6J H;  1JB4 A;  1HZ1 A;  1KQS 2;  4I5Q A;  3BIR A;  3BLZ A;  1Q42 A;  3DUK A;  1O7H B;  1L5G B;  3U1W A;  2ZDJ A;  6STD A;  1W7C A;  2GEX A;  1I8V A;  2B24 B;  1RNT A;  2K54 A;  3K63 A;  4HKV B;  3OWU A;  3GRD A;  1FGQ A;  4HM6 B;  3SYU A;  5BIR A;  3OX9 A;  3V98 A;  7RNT A;  1YGW A;  2AAD A;  2E2U A;  1Q9E A;  1RSN A;  3PZW A;  3D4A A;  4HVN A;  5CF1 A;  2IMJ A;  3LT8 A;  3NV0 B;  4O8S A;  4R9L A;  3SED A;  1W2B 2;  2F5W A;  1JKG A;  1BUQ A;  2GBW B;  2GEY A;  3NBJ A;  2W0Q A;  4DKI A;  2INX A;  2C4B A;  1ZS7 A;  4RNT A;  2CIU A;  3EBT A;  1FW7 A;  4L8O A;  3KCH A;  3PYJ A;  3N54 B;  3G71 3;  3N8B A;  4BL3 A;  1ROV A;  1MGW A;  1BGS A;  3G4S 3;  3CPW 2;  3B7C A;  1VQP 3;  2GU3 A;  1OF5 A;  3NQZ A;  3LTB A;  1VQ7 3;  1FGO A;  1JZD A;  3NX0 A;  1B20 A;  1BU4 A;  2HMK B;  1BOX A;  3ROB A;  3CXC 2;  3A5E A;  5IF6 A;  1Z1S A;  3IJE B;  4OUQ A;  4HAA A;  2WGQ A;  1MOL A;  3AMO B;  3BND A;  1JRQ A;  1T5Y A;  1M1X B;  1QAK A;  1M1K 4;  3WHO A;  3Q1C A;  3VGN A;  1A90 A;  2ML5 A;  2P09 A;  7STD A;  4XDV A;  1JNQ A;  4MMZ B;  1IDP A;  4OK0 A;  4FCM A;  5I97 A;  1YVB I;  3KZT A;  2YX9 A;  3DGM A;  4HM5 B;  2HOH A;  2J8X B;  2F99 A;  1A2V A;  1OHS A;  3FF0 A;  1RLS A;  1ROA A;  3SOA A;  4EW5 A;  3J7Y d;  1JN5 B;  1PFP A;  2BMQ B;  2BO9 B;  2XGL A;  3CU3 A;  2W03 A;  5AEW B;  4FMA A;  2P0M A;  1ASK A;  3RNT A;  3UJM A;  1WTH A;  2CHC A;  2C10 A;  1X1Y A;  4U13 A;  2Z6B A;  5ELJ A;  1TIJ A;  2CW9 A;  3MWZ A;  3OV4 A;  1OUN A;  5A0O B;  2IUK A;  2XEP A;  1WMN A;  3M8C A;  2Q07 A;  3ZFZ A;  3CCE 3;  2CFL A;  2L1S A;  2W56 B;  1A2P A;  3WA3 A;  2STD A;  5AIG A;  3D5G A;  1GOU A;  1X1U A;  3TDG A;  4LGQ A;  1UCL A;  3JUN A;  2XH9 A;  4HM3 B;  5EEO A;  1N9E A;  1N8R 4;  1CEW I;  4HYZ A;  2OWP A;  5FW5 A;  3KN4 A;  4G1M B;  2CWU A;  1N9J A;  1K8A 4;  2H0G A;  1LQG C;  1I2E A;  3K0Z A;  1I3I A;  3RGR A;  1OPY A;  3RGA A;  4OVM A;  2KF3 A;  3NBR A;  1CQS A;  3HK4 A;  3ALA A;  4FCJ A;  2BT3 A;  3NHX A;  4KFD A;  1IU7 A;  1GY6 A;  1O7W B;  3HOH A;  1SJW A;  1ULJ B;  3B8L A;  1DVC A;  2ZHX B;  4WP5 A;  5HGR A;  3S29 A;  1YIJ 3;  1D6Y A;  1UCJ A;  1S72 3;  4R80 A;  4N6M A;  1OAC A;  3GSP A;  4HJL B;  1IQ8 A;  4GSP A;  4IPB A;  3UB1 A;  1Q7H A;  3DGL A;  3EN8 A;  3WDG B;  5CLK A;  1Q82 4;  3CNM A;  1E3V A;  2UGI A;  1TUH A;  2BMR B;  3BU4 A;  3OW2 2;  1N5P A;  3KFQ C;  1UUV B;  3BNE A;  2HML B;  3EC9 A;  4K1V A;  3X3Z A;  1O7P B;  1UCK A;  1GSP A;  4HM2 B;  5IG0 A;  2KRT A;  3Q3F A;  1ZO2 A;  1NB3 I;  1OHO A;  2CFG A;  1YVS A;  3NXJ A;  6RNT A;  1YJ9 3;  2F5M A;  3ER7 A;  4J5G A;  1CYU A;  3X3X A;  4N6U A;  1R4Y A;  3JUM A;  1JJ2 2;  1GOY A;  3FZW A;  4H3U A;  4WYK A;  1TRQ A;  1RKY A;  1D6U A;  1TU5 A;  3NM7 A;  3BB9 A;  4FMC A;  5RNT A;  1K41 A;  1T3B A;  5D83 A;  1BVI A;  1SII A;  5STD A;  1LOW A;  2GU1 A;  1Q86 4;  5JPP A;  3LXU X;  3S67 A;  4HM8 B;  2BMO B;  1NU3 A;  1O7N B;  2OCT A;  3LOY A;  4ILF A;  4AKY A;  4NHF A;  1X1X A;  3EX9 A;  3MPH A;  1W6Y A;  4FMD A;  1DMN A;  4X2H A;  1Q7Y 4;  1SPU A;  1JB2 A;  3S27 A;  3F8H A;  5G1L A;  5KP4 A;  1VQ5 3;  1W6C A;  4NRE A;  1FGR A;  2QA4 3;  1E97 A;  7GSP A;  5IEP A;  1V74 A;  4AEQ A;  1BSA A;  1RGG A;  2CFD A;  1RN4 A;  2IA7 A;  1WQL B;  1BIR A;  2XGN A;  1RCK A;  3Q90 A;  2OOV C;  1JBS A;  4FMB A;  1B27 A;  1OGX A;  1UW1 A;  2B1X B;  1VQQ A;  4XB5 A;  2KF6 A;  2D1W A;  4L8P A;  2Z76 A;  5EVH A;  4EV2 A;  1QVG 2;  1A67 A;  4GB5 A;  1TRP A;  2PNC A;  1QMA A;  1UGI A;  4BU4 A;  1K28 A;  4HM0 B;  4Q53 A;  1BNG A;  1MNL A;  1SAR A;  3FG4 A;  2FXT A;  6GSP A;  1WNH A;  4O2H A;  4ORL A;  2LYX A;  3F40 A;  1IVX A;  1BSD A;  3HII A;  3WMD A;  2CK3 H;  1VQK 3;  2RCD A;  3KSE D;  5D81 A;  1NWW A;  1W4N A;  1STD A;  2KF5 A;  2SAR A;  3QRD A;  3CCJ 3;  4N6N B;  1IYY A;  1YI2 3;  1BSB A;  3GZR A;  1LXE A;  1G96 A;  1GY5 A;  3F7X A;  3PS8 A;  3CPO A;  4LMI A;  1LRA A;  3HIG A;  3G0K A;  2KAA A;  4BIR A;  1B2U A;  1V57 A;  3LZA A;  2IUJ A;  2ML6 A;  4HOH A;  1MWT A;  1RNB A;  2OTL 3;  1G02 A;  4RZM A;  5IG5 A;  1UGH I;  1N8Q A;  2V1L A;  1BNE A;  3LYG A;  1RGK A;  1BAO A;  2RGQ A;  1JBR A;  1GMP A;  2CFK A;  1FUW A;  1D6Z A;  1EG9 B;  1NO3 A;  5BU4 A;  3EHC A;  5AIF A;  1BRN L;  4N6V 0;  3FKA A;  1DE3 A;  4J8T A;  1J2B A;  3LML A;  1UUW B;  4TX4 A;  1OCV A;  3EB8 A;  1FUS A;  2RNT A;  4XBT A;  1IQX A;  4N3V A;  4LYL B;  1IV9 A;  2UX0 A;  3DGY A;  2LQV A;  1HKX A;  5CXO A;  1N5H A;  1MGR A;  1LOX A;  3AGO A;  3WR2 A;  1RGE A;  3URP A;  5IEN A;  2YFJ B;  1V58 A;  4GL6 A;  3DMC A;  3AMO A;  1I0V A;  1Q81 4;  1YJN 3;  3FLJ A;  1QAF A;  4BL2 A;  1R4C A;  3SVA A;  1BRH A;  2E2T A;  1G0T A;  3DM8 A;  1NNV A;  1W6G A;  3H3H A;  2BIR A;  2FGT A;  1X1W A;  2SBL A;  1T2I A;  3U97 A;  2HMO B;  2OQE C;  2A15 A;  4GHO A;  4EYC A;  1FGM A;  1OHP A;  3HI7 A;  2XFT A;  3CCS 3; 
#chains in the Genus database with same CATH homology
 1EUI C;  2ZHX B;  1UUG B;  1UGH I;  1LQG C;  1UGI A;  2UGI A;  1LQM B;  2UUG C;  4LYL B;  1UDI I;  2J8X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...