2ZHXB

Crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
publication title Unique features of the structure and interactions of mycobacterial uracil-DNA glycosylase: structure of a complex of the Mycobacterium tuberculosis enzyme in comparison with those from other sources
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 11
structure length 82
sequence length 82
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2zhxB00
1UGIA 2ZHXB 2J8XB 1LQGC 1LQMB 1EUIC 2UUGC 4LYLB 1UGHI 1UDII 2UGIA 1UUGB
chains in the Genus database with same CATH superfamily
1VQL3 1VQ43 1VZZA 1YJN3 3WDGB 1JKGB 1Z1SA 2W9QA 1UCIA 1TRQA 4MMYB 4PEJA 2AAEA 2WOHA 3N54B 3S67A 2HMOB 6RNTA 2UX0A 1A2KA 4TX4A 1JKGA 1TFOA 1STFI 2RBIA 3FCSB 4N6NB 3T8UA 1M1XB 4L7KA 4X2OA 1STDA 2OOVC 2UGIA 1IK3A 4FMAA 3Q2PA 1MGRA 3EC9A 3KCHA 3NM7A 5AIFA 1RCLA 1C7HA 3LTCA 1RMSA 4HM7B 2D42A 3AHWA 1BRHA 5TGNA 3CCJ3 2GSPA 1Q7HA 5EVHA 3X3YA 3FKAA 5IG4A 3EF8A 4EYCA 1BRJA 1RN7A 5DREA 1BNIA 4LEHA 1X1UA 1OACA 3J7Yd 4K90B 2F5MA 3OW22 3CU3A 3MG3A 1Q7Y4 1FGTA 3CCU3 1BRKA 1W00A 1Y4KA 2XR8B 1JRQA 1FGOA 2E2UA 2STDA 4WHAA 1E3RA 3UL6A 1YJW3 1X1YA 1IT7A 4HM5B 1EG9B 3JUNA 1ZO2A 1IVXA 3MG1A 1RJOA 4N6MA 1AQZA 2XFTA 3VSYA 1A90A 3S29A 1SPUA 1KWIA 2K54A 1TUHA 1DMNA 2XEPA 4HYZA 3WA3A 1A67A 1TTOA 1Q9EA 3O8YA 1FGRA 1GMRA 1VQO3 3CME3 3ECFA 1SIHA 5JPUA 4LGQA 1WQLB 2OQEA 5CXOA 1JBRA 2KCDA 1T2HA 1S5AA 4LMIA 3S27A 3NBBA 5BVBA 1OUNA 1BVIA 2Y74A 3FLJA 3FGYA 3A5EA 1US1A 7STDA 1B20A 1NJI4 3CPOA 1YGWA 3EJVA 1W02A 2CFKA 3MHEA 1GOUA 1RSNA 2KF5A 3CCR3 3FF0A 8CHOA 1G02A 3S28A 3V92A 2K0MA 1BAOA 4KT3B 6GSPA 3FH1A 2HMKB 1BSAA 3E99A 1IYYA 1RTUA 5D81A 3PS8A 2W04A 4FMDA 3LT9A 3EX9A 4MMZB 3U1WA 1UI8A 1WNHA 1VQ93 2V1LA 3GZBA 1W5ZA 1WMPA 3NQZA 1OGXA 3H3HA 3UB1A 2W56B 2CK3H 2ML5A 1I8VA 1T2IA 2K3DA 5EQLA 4CCVA 3JUOA 3CC43 1FGQA 5LC7A 3SYUA 4WYKB 2ZDJA 2MC8A 3VF1A 2W56A 3GWRA 4N6TA 5HOHA 2GEXA 1TU5A 1EA2A 1BUQA 2IUKA 2XGNA 1FYSA 4XBYA 1G96A 4WYKA 3LYGA 1K734 2R41A 3OV4A 4OK0A 2E2VA 3K0ZA 4RNYA 4OVMA 1CQSA 1RGEA 2CFLA 2P09A 2RNTA 3SXXA 1KD14 1UCLA 3EE1A 2KXGA 3EN8A 3STDA 1JBSA 3NHXA 3NV0A 4STDA 1B21A 2F86B 5FGOA 4EC6A 1JBTA 1GSPA 3WHOA 1G0TA 1OHSA 4K1VA 2IYJA 4EV2A 1BRIA 1PFPA 5G1KA 4NPBA 1FA3A 5ELUA 5G2GA 3T0UA 2CG1A 3NXJA 3G4S3 1QJGA 4ILFA 1OF5B 1I2FA 4J5KA 5JBSA 5JPPA 3U97A 3MYTA 5IG0A 1AY7A 3DXOA 2INXA 1BANA 3AHSA 1N5HA 1OF5A 3V99A 3CC73 1FUTA 4RNZA 1IT8A 1HKXA 1N9JA 3DZLA 4DKIA 5BU4A 2C11A 1BSCA 3IJEB 3GZXB 2CC3A 1SJWA 3M8CA 1YJ93 2I9WA 4O3VA 1N5PA 2H0IA 4N3VA 3WODG 1N8QA 1MOLA 3MKIA 3F7XA 4X2HA 1HZ1A 2XRXB 3MSOA 4KFDA 1NB5I 3BNEA 4FMCA 1NU3A 2YFLB 3G713 3I0YA 2KAAA 1UDII 2YX9A 3KZTA 4H61A 2OTJ3 2BMRB 3ZFZA 1BRNL 1RN1A 3F7SA 5AYSC 4EXRA 5IENA 1JB5A 2W0QA 1BNGA 1W7CA 2SBLA 1AV4A 4KFFA 1RKYA 4BIRA 1IQ8A 3KSED 1K41A 1F8NA 3ER7A 5G1LA 1FUWA 2L4VA 1TFKA 2W03A 2Z77A 3ALAA 3OWYA 4L8OA 2XSOB 1V57A 4K1UA 1NO3A 4EBGA 2JQ5A 2OWPA 4BTYA 1M904 3H51A 3D5GA 1K9M4 1GD3A 3DMCA 1BNEA 3KKGA 1RGFA 3ROBA 4XB5A 3BB9A 4AEQA 3LH4A 1E3VA 1NNVA 3B4OA 3WOFB 1VQP3 5AIGA 4IPBA 3F40A 3CCS3 3SVAA 2GBXB 3BNBA 4QWTA 1E97A 1WTHA 3N8BA 1OH0A 3PZWA 2OQEC 2ZA4A 4I4KA 1RGGA 1ULIB 1MWRA 3VGNA 5FW5A 1ULJB 3A76A 4L8PA 1Q814 1RLSA 2CIUA 3NQYA 1CYVA 1LOWA 4HBRA 2QGUA 1QVF2 3LT8A 1KC84 3B8LA 1B27A 2O3OA 2D1WA 3D4AA 4KVHA 1MNLA 1GMPA 1A2PA 3WOEB 4BL3A 6STDA 1FW7A 3D5IA 1Q42A 1S723 1I2GA 1LXEA 2HMJB 1BNJA 1EUIC 2SARA 3GSPA 4LSOA 5IERA 2QA43 2CG0A 3BLZA 1VQN3 2BO9B 2OTL3 3LTDA 1B3SA 2YFJB 3CCM3 1V58A 2C10A 2IY2A 3LXUX 3DGYA 3LOYA 1OGZA 5IG3A 1LNHA 3CPW2 5HGRA 1GMQA 4HZ9B 2O9UX 3GZYB 1LNIA 4BL2A 3DGNA 2E2TA 1CEWI 2MF7A 5KP4A 4FCZA 5IG5A 5EEOA 4O2HA 1GS3A 1O7GB 1BOXA 2IA7A 3F14A 3DGLA 2XSHB 4FCJA 1UUVB 2JDIH 4XBTA 2H0GA 4XDWA 1UGHI 3B7CA 4HM8B 3ZG0A 5CF2A 4HJLB 3TDGA 1IV9A 1SIIA 1Q824 3CCV3 3EBYA 3QK9A 5AIHA 5AEUB 3PCSA 3HI7A 3PXMA 3GAXA 1MWUA 3FF2A 3PYJA 3OX9A 1GD4A 1GOVA 5D83A 3F8XA 3KN4A 3EBTA 2P0XA 4N6UA 3IPTA 1TIJA 2Y73A 4OUQA 4BTXA 1TP6A 1B2UA 3GRDA 2J8XB 4EW5A 3HIIA 4KZ1A 3N9HA 1VQ73 1JB2A 1HYFA 1X1XA 2XFSA 3B4PA 1UW1A 4FCMA 4HM0B 3KFQC 2Z6BA 1JZDA 1QAFA 2CH9A 1UGIA 2ML6A 3F9SA 3HIGA 3G6E3 3X41A 1AVLA 1MWTA 1IU7A 4AKZA 4MMXB 1VQM3 1O7WB 4CDLA 1X1WA 1BUJA 3Q90A 4NHFA 3X3ZA 1YIJ3 1RNBA 2BU4A 3EQQB 2PZVA 1NDOB 4NREA 1I0XA 1M9GA 4ORLA 3G0KA 1IDPA 1UUGB 2BT3A 2GU3A 2LQVA 3KE7A 4XM4A 3X3XA 1B2SA 1LRAA 3RGAA 1BRGA 3LTBA 2L1SA 2RSXA 3FSDA 2GEYA 2HMLB 4CPKA 4GHOA 1N9EA 1I70A 1QALA 1RRHA 1AVKA 4J9AA 1O7HB 4HM4B 3CC23 1C54A 1ZX2A 5CLKA 5ELJA 4RNTA 2BNGA 4J8TA 1SQWA 1QAKA 2C4BA 3OXAA 1W4NA 1BU4A 3D9RA 4XDVA 3UL5A 3QRDA 1PYLA 3WMDA 3D3LA 2LYXA 5KP1A 2F98A 3EHCA 1A2VA 3KSPA 3I553 4JRFA 3CCE3 5IW9A 1RN4A 4XBXA 1GY7A 3G16A 1DVCA 1UCJA 4N6V0 1Q40B 1YIT3 1BSBA 3CNXA 2RFRA 1LQGC 2FXTA 3DGOA 1R4CA 5RNTA 3ZG5A 3CD63 4HOHA 3MG2A 1Q40A 4JF8A 5BIRA 1BNRA 2H0HA 1UUWB 2RCDA 1O7MB 1EEJA 8RNTA 1ISKA 2WOFA 1DVDA 4ZM8A 1IVVA 4N6LA 2CWTA 4LYLB 4WWUC 1RGCA 3Q3FA 5M19A 1EKMA 1OPYA 1RHLA 1VQK3 1DMMA 3CNMA 4R1KA 5GSPA 1IQYA 3OWSA 2F56A 1L5GB 2Z7AA 1MGWA 1Q864 4O02B 3AMOB 4H3UA 3SOYA 1WMOA 4AKYA 1PU4A 1N8R4 4RZMA 1B2ZA 2PNCA 2OCTA 3FG1A 1IVWA 2BHMA 3HX8A 4HAAA 1CYUA 4G1MB 4O8SA 3AMOA 1MWSA 5LC6A 1NB3I 1LQMB 3FG4A 3Q1CA 1DE3A 2WO0A 4MEIA 2B1XB 4WP5A 2CFWA 4R9KA 2XF3A 2KF4A 3DGMA 1NWWA 1VQ83 1KQS2 1JNQA 1OHOA 1GYBA 2KF6A 4HM3B 2GBWB 4R4KA 1QVG2 1RGAA 1RRLA 2XGLA 2M7OA 1O7NB 1FGMA 1BRSA 1T5YA 2BMOB 1JB4A 2CX0A 1DYUA 2KRTA 1JJ22 1CH0A 3L0RA 5AI1A 1V74A 3JUPA 2P05A 2OOVA 3EB8A 1DETA 3HZPA 3K5TA 9RNTA 3CCL3 1YGEA 1BGSA 4Q53A 2RGQA 1I3FA 1ASKA 2IUJA 3WA2X 1BNFA 2WGQA 1BIRA 4GL6A 3GZRA 4HM6B 5M1AA 1LOYA 3PGBA 3K7CA 3SX1A 1GY6A 3K63A 2GXFA 1GOYA 2YFIB 1OHPA 1W2ZA 1UI7A 3MPHA 5CK6A 1D6ZA 3RNTA 1JZOA 1W6CA 1BSDA 4HM1B 1O7PB 3DH2A 1K28A 2W2CA 3PCRA 2GU1A 1ZS7A 1B2MA 5CF1A 3HK4A 1TJDA 5BXQA 4EV5A 1JV2B 3WR2A 1FUSA 4R9LA 1M1K4 5A0OB 2HMMB 4R80A 2BIRA 1J2BA 1ROAA 1I2EA 4FR9A 3NM2A 4J5GA 3NX0A 4KFEA 3SLUA 1BNSA 5IEOA 4K61A 4GB5A 1YNVX 5IF6A 5IEPA 1KSIA 1VQQA 2IMJA 1ROVA 1UCKA 3K9MC 3NUVA 1BSEA 1YI23 1RGHA 1IVUA 1QMAA 3UJMA 5AYRB 3CXC2 3I563 2B24B 1TRPA 2F5WA 3UNLA 1IQXA 2AADA 1I0VA 1YVBI 4U13A 5D82A 1IV7A 1PY3A 2KF3A 4HVNA 4FMBA 3IMAB 2CW9A 2BMQB 2ZHXB 4BTWA 5STDA 3KIIA 2QEX3 3JVCA 1FZUA 1K8A4 3FG3A 1RGLA 4IT7A 4N6OB 1RNTA 3V98A 3T8NA 3NV0B 2F99A 3JUQA 4I5QA 3SOAA 1JN5B 5AEWB 2R4IA 3JUMA 2FGTA 2HOHA 2CHCA 1SARA 1EQKA 2W6JH 1LOXA 2Q07A 1LOVA 3RDEA 1WMNA 3S5CA 1W2B2 3F8HA 1JN5A 5KP3A 3CMA3 1VQ63 2CWUA 1DMQA 3BNDA 1I3IA 2CFDA 3OWUA 4HKVB 2FNQA 2F4YA 3LZAA 1D6YA 4LZIA 1W6GA 7RNTA 5M18A 4HZBB 5AIIA 3NBRA 4WFOA 7GSPA 2QIYA 3LMLA 1GY5A 2P38A 3RGRA 1U5OA 3DUKA 3CCQ3 2CKFB 2WGOA 3FZWA 3X42A 3G8ZA 3NBJA 5DRVA 3AGOA 4CJNA 1RDSA 1U8CB 2Z76A 2CWVA 2UUGC 3HOHA 3BNCA 2A15A 1ZGXA 3BU4A 1W01A 3MWZA 5I97A 4GSPA 1VQ53 1T3BA 3X40A 3AGNA 1D6UA 3D79A 1YVSA 1RGKA 2W9PA 1YHQ3 3LTAA 2HMNB 2XH9A 2ZL8A 1LVNA 1B2XA 4IIAA 1RCKA 1OCVA 4HM2B 1AR0A 4BU4A 2P0MA 3BIRA 1HU9A 3URPA 3DM8A 3EN1B 2CFGA 4RBNA 2CX1A 3DY5A 4MJDA 3SEDA 1W6YA 1R4YA
chains in the Genus database with same CATH topology
1UGIA 2ZHXB 2J8XB 1LQGC 1LQMB 1EUIC 2UUGC 4LYLB 1UGHI 1UDII 2UGIA 1UUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGI A;  2ZHX B;  2J8X B;  1LQG C;  1LQM B;  1EUI C;  2UUG C;  4LYL B;  1UGH I;  1UDI I;  2UGI A;  1UUG B; 
#chains in the Genus database with same CATH topology
 1VQL 3;  1VQ4 3;  1VZZ A;  1YJN 3;  3WDG B;  1JKG B;  1Z1S A;  2W9Q A;  1UCI A;  1TRQ A;  4MMY B;  4PEJ A;  2AAE A;  2WOH A;  3N54 B;  3S67 A;  2HMO B;  6RNT A;  2UX0 A;  1A2K A;  4TX4 A;  1JKG A;  1TFO A;  1STF I;  2RBI A;  3FCS B;  4N6N B;  3T8U A;  1M1X B;  4L7K A;  4X2O A;  1STD A;  2OOV C;  2UGI A;  1IK3 A;  4FMA A;  3Q2P A;  1MGR A;  3EC9 A;  3KCH A;  3NM7 A;  5AIF A;  1RCL A;  1C7H A;  3LTC A;  1RMS A;  4HM7 B;  2D42 A;  3AHW A;  1BRH A;  5TGN A;  3CCJ 3;  2GSP A;  1Q7H A;  5EVH A;  3X3Y A;  3FKA A;  5IG4 A;  3EF8 A;  4EYC A;  1BRJ A;  1RN7 A;  5DRE A;  1BNI A;  4LEH A;  1X1U A;  1OAC A;  3J7Y d;  4K90 B;  2F5M A;  3OW2 2;  3CU3 A;  3MG3 A;  1Q7Y 4;  1FGT A;  3CCU 3;  1BRK A;  1W00 A;  1Y4K A;  2XR8 B;  1JRQ A;  1FGO A;  2E2U A;  2STD A;  4WHA A;  1E3R A;  3UL6 A;  1YJW 3;  1X1Y A;  1IT7 A;  4HM5 B;  1EG9 B;  3JUN A;  1ZO2 A;  1IVX A;  3MG1 A;  1RJO A;  4N6M A;  1AQZ A;  2XFT A;  3VSY A;  1A90 A;  3S29 A;  1SPU A;  1KWI A;  2K54 A;  1TUH A;  1DMN A;  2XEP A;  4HYZ A;  3WA3 A;  1A67 A;  1TTO A;  1Q9E A;  3O8Y A;  1FGR A;  1GMR A;  1VQO 3;  3CME 3;  3ECF A;  1SIH A;  5JPU A;  4LGQ A;  1WQL B;  2OQE A;  5CXO A;  1JBR A;  2KCD A;  1T2H A;  1S5A A;  4LMI A;  3S27 A;  3NBB A;  5BVB A;  1OUN A;  1BVI A;  2Y74 A;  3FLJ A;  3FGY A;  3A5E A;  1US1 A;  7STD A;  1B20 A;  1NJI 4;  3CPO A;  1YGW A;  3EJV A;  1W02 A;  2CFK A;  3MHE A;  1GOU A;  1RSN A;  2KF5 A;  3CCR 3;  3FF0 A;  8CHO A;  1G02 A;  3S28 A;  3V92 A;  2K0M A;  1BAO A;  4KT3 B;  6GSP A;  3FH1 A;  2HMK B;  1BSA A;  3E99 A;  1IYY A;  1RTU A;  5D81 A;  3PS8 A;  2W04 A;  4FMD A;  3LT9 A;  3EX9 A;  4MMZ B;  3U1W A;  1UI8 A;  1WNH A;  1VQ9 3;  2V1L A;  3GZB A;  1W5Z A;  1WMP A;  3NQZ A;  1OGX A;  3H3H A;  3UB1 A;  2W56 B;  2CK3 H;  2ML5 A;  1I8V A;  1T2I A;  2K3D A;  5EQL A;  4CCV A;  3JUO A;  3CC4 3;  1FGQ A;  5LC7 A;  3SYU A;  4WYK B;  2ZDJ A;  2MC8 A;  3VF1 A;  2W56 A;  3GWR A;  4N6T A;  5HOH A;  2GEX A;  1TU5 A;  1EA2 A;  1BUQ A;  2IUK A;  2XGN A;  1FYS A;  4XBY A;  1G96 A;  4WYK A;  3LYG A;  1K73 4;  2R41 A;  3OV4 A;  4OK0 A;  2E2V A;  3K0Z A;  4RNY A;  4OVM A;  1CQS A;  1RGE A;  2CFL A;  2P09 A;  2RNT A;  3SXX A;  1KD1 4;  1UCL A;  3EE1 A;  2KXG A;  3EN8 A;  3STD A;  1JBS A;  3NHX A;  3NV0 A;  4STD A;  1B21 A;  2F86 B;  5FGO A;  4EC6 A;  1JBT A;  1GSP A;  3WHO A;  1G0T A;  1OHS A;  4K1V A;  2IYJ A;  4EV2 A;  1BRI A;  1PFP A;  5G1K A;  4NPB A;  1FA3 A;  5ELU A;  5G2G A;  3T0U A;  2CG1 A;  3NXJ A;  3G4S 3;  1QJG A;  4ILF A;  1OF5 B;  1I2F A;  4J5K A;  5JBS A;  5JPP A;  3U97 A;  3MYT A;  5IG0 A;  1AY7 A;  3DXO A;  2INX A;  1BAN A;  3AHS A;  1N5H A;  1OF5 A;  3V99 A;  3CC7 3;  1FUT A;  4RNZ A;  1IT8 A;  1HKX A;  1N9J A;  3DZL A;  4DKI A;  5BU4 A;  2C11 A;  1BSC A;  3IJE B;  3GZX B;  2CC3 A;  1SJW A;  3M8C A;  1YJ9 3;  2I9W A;  4O3V A;  1N5P A;  2H0I A;  4N3V A;  3WOD G;  1N8Q A;  1MOL A;  3MKI A;  3F7X A;  4X2H A;  1HZ1 A;  2XRX B;  3MSO A;  4KFD A;  1NB5 I;  3BNE A;  4FMC A;  1NU3 A;  2YFL B;  3G71 3;  3I0Y A;  2KAA A;  1UDI I;  2YX9 A;  3KZT A;  4H61 A;  2OTJ 3;  2BMR B;  3ZFZ A;  1BRN L;  1RN1 A;  3F7S A;  5AYS C;  4EXR A;  5IEN A;  1JB5 A;  2W0Q A;  1BNG A;  1W7C A;  2SBL A;  1AV4 A;  4KFF A;  1RKY A;  4BIR A;  1IQ8 A;  3KSE D;  1K41 A;  1F8N A;  3ER7 A;  5G1L A;  1FUW A;  2L4V A;  1TFK A;  2W03 A;  2Z77 A;  3ALA A;  3OWY A;  4L8O A;  2XSO B;  1V57 A;  4K1U A;  1NO3 A;  4EBG A;  2JQ5 A;  2OWP A;  4BTY A;  1M90 4;  3H51 A;  3D5G A;  1K9M 4;  1GD3 A;  3DMC A;  1BNE A;  3KKG A;  1RGF A;  3ROB A;  4XB5 A;  3BB9 A;  4AEQ A;  3LH4 A;  1E3V A;  1NNV A;  3B4O A;  3WOF B;  1VQP 3;  5AIG A;  4IPB A;  3F40 A;  3CCS 3;  3SVA A;  2GBX B;  3BNB A;  4QWT A;  1E97 A;  1WTH A;  3N8B A;  1OH0 A;  3PZW A;  2OQE C;  2ZA4 A;  4I4K A;  1RGG A;  1ULI B;  1MWR A;  3VGN A;  5FW5 A;  1ULJ B;  3A76 A;  4L8P A;  1Q81 4;  1RLS A;  2CIU A;  3NQY A;  1CYV A;  1LOW A;  4HBR A;  2QGU A;  1QVF 2;  3LT8 A;  1KC8 4;  3B8L A;  1B27 A;  2O3O A;  2D1W A;  3D4A A;  4KVH A;  1MNL A;  1GMP A;  1A2P A;  3WOE B;  4BL3 A;  6STD A;  1FW7 A;  3D5I A;  1Q42 A;  1S72 3;  1I2G A;  1LXE A;  2HMJ B;  1BNJ A;  1EUI C;  2SAR A;  3GSP A;  4LSO A;  5IER A;  2QA4 3;  2CG0 A;  3BLZ A;  1VQN 3;  2BO9 B;  2OTL 3;  3LTD A;  1B3S A;  2YFJ B;  3CCM 3;  1V58 A;  2C10 A;  2IY2 A;  3LXU X;  3DGY A;  3LOY A;  1OGZ A;  5IG3 A;  1LNH A;  3CPW 2;  5HGR A;  1GMQ A;  4HZ9 B;  2O9U X;  3GZY B;  1LNI A;  4BL2 A;  3DGN A;  2E2T A;  1CEW I;  2MF7 A;  5KP4 A;  4FCZ A;  5IG5 A;  5EEO A;  4O2H A;  1GS3 A;  1O7G B;  1BOX A;  2IA7 A;  3F14 A;  3DGL A;  2XSH B;  4FCJ A;  1UUV B;  2JDI H;  4XBT A;  2H0G A;  4XDW A;  1UGH I;  3B7C A;  4HM8 B;  3ZG0 A;  5CF2 A;  4HJL B;  3TDG A;  1IV9 A;  1SII A;  1Q82 4;  3CCV 3;  3EBY A;  3QK9 A;  5AIH A;  5AEU B;  3PCS A;  3HI7 A;  3PXM A;  3GAX A;  1MWU A;  3FF2 A;  3PYJ A;  3OX9 A;  1GD4 A;  1GOV A;  5D83 A;  3F8X A;  3KN4 A;  3EBT A;  2P0X A;  4N6U A;  3IPT A;  1TIJ A;  2Y73 A;  4OUQ A;  4BTX A;  1TP6 A;  1B2U A;  3GRD A;  2J8X B;  4EW5 A;  3HII A;  4KZ1 A;  3N9H A;  1VQ7 3;  1JB2 A;  1HYF A;  1X1X A;  2XFS A;  3B4P A;  1UW1 A;  4FCM A;  4HM0 B;  3KFQ C;  2Z6B A;  1JZD A;  1QAF A;  2CH9 A;  1UGI A;  2ML6 A;  3F9S A;  3HIG A;  3G6E 3;  3X41 A;  1AVL A;  1MWT A;  1IU7 A;  4AKZ A;  4MMX B;  1VQM 3;  1O7W B;  4CDL A;  1X1W A;  1BUJ A;  3Q90 A;  4NHF A;  3X3Z A;  1YIJ 3;  1RNB A;  2BU4 A;  3EQQ B;  2PZV A;  1NDO B;  4NRE A;  1I0X A;  1M9G A;  4ORL A;  3G0K A;  1IDP A;  1UUG B;  2BT3 A;  2GU3 A;  2LQV A;  3KE7 A;  4XM4 A;  3X3X A;  1B2S A;  1LRA A;  3RGA A;  1BRG A;  3LTB A;  2L1S A;  2RSX A;  3FSD A;  2GEY A;  2HML B;  4CPK A;  4GHO A;  1N9E A;  1I70 A;  1QAL A;  1RRH A;  1AVK A;  4J9A A;  1O7H B;  4HM4 B;  3CC2 3;  1C54 A;  1ZX2 A;  5CLK A;  5ELJ A;  4RNT A;  2BNG A;  4J8T A;  1SQW A;  1QAK A;  2C4B A;  3OXA A;  1W4N A;  1BU4 A;  3D9R A;  4XDV A;  3UL5 A;  3QRD A;  1PYL A;  3WMD A;  3D3L A;  2LYX A;  5KP1 A;  2F98 A;  3EHC A;  1A2V A;  3KSP A;  3I55 3;  4JRF A;  3CCE 3;  5IW9 A;  1RN4 A;  4XBX A;  1GY7 A;  3G16 A;  1DVC A;  1UCJ A;  4N6V 0;  1Q40 B;  1YIT 3;  1BSB A;  3CNX A;  2RFR A;  1LQG C;  2FXT A;  3DGO A;  1R4C A;  5RNT A;  3ZG5 A;  3CD6 3;  4HOH A;  3MG2 A;  1Q40 A;  4JF8 A;  5BIR A;  1BNR A;  2H0H A;  1UUW B;  2RCD A;  1O7M B;  1EEJ A;  8RNT A;  1ISK A;  2WOF A;  1DVD A;  4ZM8 A;  1IVV A;  4N6L A;  2CWT A;  4LYL B;  4WWU C;  1RGC A;  3Q3F A;  5M19 A;  1EKM A;  1OPY A;  1RHL A;  1VQK 3;  1DMM A;  3CNM A;  4R1K A;  5GSP A;  1IQY A;  3OWS A;  2F56 A;  1L5G B;  2Z7A A;  1MGW A;  1Q86 4;  4O02 B;  3AMO B;  4H3U A;  3SOY A;  1WMO A;  4AKY A;  1PU4 A;  1N8R 4;  4RZM A;  1B2Z A;  2PNC A;  2OCT A;  3FG1 A;  1IVW A;  2BHM A;  3HX8 A;  4HAA A;  1CYU A;  4G1M B;  4O8S A;  3AMO A;  1MWS A;  5LC6 A;  1NB3 I;  1LQM B;  3FG4 A;  3Q1C A;  1DE3 A;  2WO0 A;  4MEI A;  2B1X B;  4WP5 A;  2CFW A;  4R9K A;  2XF3 A;  2KF4 A;  3DGM A;  1NWW A;  1VQ8 3;  1KQS 2;  1JNQ A;  1OHO A;  1GYB A;  2KF6 A;  4HM3 B;  2GBW B;  4R4K A;  1QVG 2;  1RGA A;  1RRL A;  2XGL A;  2M7O A;  1O7N B;  1FGM A;  1BRS A;  1T5Y A;  2BMO B;  1JB4 A;  2CX0 A;  1DYU A;  2KRT A;  1JJ2 2;  1CH0 A;  3L0R A;  5AI1 A;  1V74 A;  3JUP A;  2P05 A;  2OOV A;  3EB8 A;  1DET A;  3HZP A;  3K5T A;  9RNT A;  3CCL 3;  1YGE A;  1BGS A;  4Q53 A;  2RGQ A;  1I3F A;  1ASK A;  2IUJ A;  3WA2 X;  1BNF A;  2WGQ A;  1BIR A;  4GL6 A;  3GZR A;  4HM6 B;  5M1A A;  1LOY A;  3PGB A;  3K7C A;  3SX1 A;  1GY6 A;  3K63 A;  2GXF A;  1GOY A;  2YFI B;  1OHP A;  1W2Z A;  1UI7 A;  3MPH A;  5CK6 A;  1D6Z A;  3RNT A;  1JZO A;  1W6C A;  1BSD A;  4HM1 B;  1O7P B;  3DH2 A;  1K28 A;  2W2C A;  3PCR A;  2GU1 A;  1ZS7 A;  1B2M A;  5CF1 A;  3HK4 A;  1TJD A;  5BXQ A;  4EV5 A;  1JV2 B;  3WR2 A;  1FUS A;  4R9L A;  1M1K 4;  5A0O B;  2HMM B;  4R80 A;  2BIR A;  1J2B A;  1ROA A;  1I2E A;  4FR9 A;  3NM2 A;  4J5G A;  3NX0 A;  4KFE A;  3SLU A;  1BNS A;  5IEO A;  4K61 A;  4GB5 A;  1YNV X;  5IF6 A;  5IEP A;  1KSI A;  1VQQ A;  2IMJ A;  1ROV A;  1UCK A;  3K9M C;  3NUV A;  1BSE A;  1YI2 3;  1RGH A;  1IVU A;  1QMA A;  3UJM A;  5AYR B;  3CXC 2;  3I56 3;  2B24 B;  1TRP A;  2F5W A;  3UNL A;  1IQX A;  2AAD A;  1I0V A;  1YVB I;  4U13 A;  5D82 A;  1IV7 A;  1PY3 A;  2KF3 A;  4HVN A;  4FMB A;  3IMA B;  2CW9 A;  2BMQ B;  2ZHX B;  4BTW A;  5STD A;  3KII A;  2QEX 3;  3JVC A;  1FZU A;  1K8A 4;  3FG3 A;  1RGL A;  4IT7 A;  4N6O B;  1RNT A;  3V98 A;  3T8N A;  3NV0 B;  2F99 A;  3JUQ A;  4I5Q A;  3SOA A;  1JN5 B;  5AEW B;  2R4I A;  3JUM A;  2FGT A;  2HOH A;  2CHC A;  1SAR A;  1EQK A;  2W6J H;  1LOX A;  2Q07 A;  1LOV A;  3RDE A;  1WMN A;  3S5C A;  1W2B 2;  3F8H A;  1JN5 A;  5KP3 A;  3CMA 3;  1VQ6 3;  2CWU A;  1DMQ A;  3BND A;  1I3I A;  2CFD A;  3OWU A;  4HKV B;  2FNQ A;  2F4Y A;  3LZA A;  1D6Y A;  4LZI A;  1W6G A;  7RNT A;  5M18 A;  4HZB B;  5AII A;  3NBR A;  4WFO A;  7GSP A;  2QIY A;  3LML A;  1GY5 A;  2P38 A;  3RGR A;  1U5O A;  3DUK A;  3CCQ 3;  2CKF B;  2WGO A;  3FZW A;  3X42 A;  3G8Z A;  3NBJ A;  5DRV A;  3AGO A;  4CJN A;  1RDS A;  1U8C B;  2Z76 A;  2CWV A;  2UUG C;  3HOH A;  3BNC A;  2A15 A;  1ZGX A;  3BU4 A;  1W01 A;  3MWZ A;  5I97 A;  4GSP A;  1VQ5 3;  1T3B A;  3X40 A;  3AGN A;  1D6U A;  3D79 A;  1YVS A;  1RGK A;  2W9P A;  1YHQ 3;  3LTA A;  2HMN B;  2XH9 A;  2ZL8 A;  1LVN A;  1B2X A;  4IIA A;  1RCK A;  1OCV A;  4HM2 B;  1AR0 A;  4BU4 A;  2P0M A;  3BIR A;  1HU9 A;  3URP A;  3DM8 A;  3EN1 B;  2CFG A;  4RBN A;  2CX1 A;  3DY5 A;  4MJD A;  3SED A;  1W6Y A;  1R4Y A; 
#chains in the Genus database with same CATH homology
 1UGI A;  2ZHX B;  2J8X B;  1LQG C;  1LQM B;  1EUI C;  2UUG C;  4LYL B;  1UGH I;  1UDI I;  2UGI A;  1UUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...