2ZHXB

Crystal structure of uracil-dna glycosylase from mycobacterium tuberculosis in complex with a proteinaceous inhibitor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-DNA glycosylase
publication title Unique features of the structure and interactions of mycobacterial uracil-DNA glycosylase: structure of a complex of the Mycobacterium tuberculosis enzyme in comparison with those from other sources
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 82
sequence length 82
chains with identical sequence D, F, H, J, L, N
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 2zhxB00
1UGIA 1LQGC 2ZHXB 1UGHI 4LYLB 1UUGB 2J8XB 2UGIA 1EUIC 2UUGC 1UDII 1LQMB
chains in the Genus database with same CATH superfamily
3VGNA 4BIRA 1RN7A 2KAAA 1V74A 4RNZA 2OCTA 1PFPA 4RNTA 1RGKA 3GRDA 4R1KA 2C11A 1B21A 1BAOA 1JBTA 3F8HA 3RDEA 3KSED 4RBNA 3MG1A 3PXMA 3BNEA 1YVSA 2W56A 4AKZA 2B1XB 3G0KA 4H61A 3CD63 1TP6A 3DGYA 3NX0A 5IG3A 2H0HA 3PYJA 3EN1B 3V92A 4RZMA 1EG9B 2INXA 1DMNA 1RKYA 1Q40A 1YNVX 3K9MC 4J5GA 1FUSA 3GZBA 1CYVA 3HOHA 3HZPA 3X41A 4CJNA 2HMLB 3CCL3 1VQ43 4MMZB 2F5WA 3UNLA 5RNTA 3X3XA 4KT3B 2QEX3 3EB8A 1LNIA 1T5YA 1D6YA 3BB9A 3S5CA 3UJMA 4L8PA 4RNYA 5KP3A 1YHQ3 1HYFA 3GSPA 3CC23 3D4AA 3LTCA 2CWTA 3PCSA 1A2KA 3O8YA 2OOVA 1GOYA 4GB5A 1T2HA 1TRQA 3D5IA 2C4BA 3HI7A 5D82A 2E2TA 3X42A 1YIJ3 3JUPA 4L8OA 5G1KA 4ZM8A 2CH9A 2LYXA 5IEPA 3BNBA 2W9PA 5DRVA 3D9RA 7RNTA 1WMNA 1GS3A 3PGBA 1W4NA 1ZO2A 4WYKA 2YFIB 4XB5A 3RNTA 3ECFA 5ELUA 1FYSA 2BU4A 1YI23 1QMAA 1IK3A 1FGMA 1ULJB 5M1AA 1JBRA 1IU7A 1OHSA 1IVUA 2GEXA 1L5GB 1YJN3 3AMOB 3F9SA 4GHOA 3CCV3 1IV9A 1MNLA 2R41A 3DXOA 4HYZA 2GXFA 3DGOA 1PYLA 3ZG5A 1ULIB 5A0OB 1AR0A 1MOLA 2WOHA 2XSOB 5HGRA 1VQM3 3EHCA 5G1LA 2OQEC 1SIIA 2KRTA 1BNFA 4FCJA 3NQYA 2UX0A 3PCRA 4LYLB 3UB1A 4BTXA 5KP1A 4NPBA 5BU4A 2MC8A 7STDA 1RNBA 1JNQA 3UL6A 3IMAB 4HM7B 5M18A 3ALAA 3G8ZA 3DMCA 1BRKA 3JUNA 1YGWA 1BSAA 1I2EA 3KFQC 1PU4A 4HJLB 1GD4A 3FG4A 3QK9A 3CPW2 4R9LA 2E2UA 1NNVA 3DGMA 1ZGXA 3KSPA 1IVWA 4HM5B 4BTWA 1W02A 1ZS7A 4NREA 1R4YA 1KWIA 2FXTA 3MG2A 4MEIA 1W5ZA 5BVBA 1LVNA 4J8TA 2GU1A 3JUQA 4G1MB 3T8NA 1OCVA 2Z76A 3LXUX 1W6GA 4X2OA 3WA3A 5IW9A 1K8A4 2F56A 1UUVB 3LZAA 3LOYA 3S27A 5CF1A 1CEWI 1SQWA 3URPA 5KP4A 1V58A 2F86B 4XM4A 3LH4A 3U1WA 3ZG0A 1M9GA 1D6UA 3OW22 1M1K4 3F7SA 1HKXA 2H0IA 1QAFA 2XH9A 3EJVA 3ER7A 3SOYA 1W01A 4HM8B 1BNRA 2CFDA 1BANA 1K28A 4KZ1A 4KFFA 4BL3A 2HMKB 3B4PA 1LOYA 1UCIA 1IVXA 4X2HA 2CX1A 1Q7Y4 2XFSA 2P0MA 3BNCA 4K90B 1KD14 1FGTA 1MWSA 1RGLA 2WO0A 3FLJA 3GAXA 3GZYB 1C7HA 4J9AA 1Q42A 2CWVA 1LNHA 2QGUA 3N54B 3I563 3CCS3 4HM6B 1Q9EA 1EEJA 3FH1A 1EQKA 1B2UA 3CCU3 4JF8A 1QJGA 3CPOA 1GD3A 4XBTA 2Y74A 1BOXA 2CK3H 4MJDA 3D5GA 1IT7A 3STDA 2Z77A 1LQGC 1RDSA 1D6ZA 2KF6A 2ZA4A 3WODG 3CXC2 3FG1A 5FGOA 2BIRA 1N9EA 2L1SA 1HZ1A 2XSHB 2YX9A 1LQMB 4CPKA 2STDA 3EF8A 4IPBA 2SARA 1JB2A 1RTUA 1NDOB 2GBWB 4R80A 1VQ93 3LTAA 3M8CA 1B3SA 3CCM3 1GOVA 2XFTA 1I3FA 2K0MA 2F4YA 2F5MA 5ELJA 3JVCA 1NJI4 1IQYA 2BNGA 2KF5A 4K1VA 5AIHA 5JBSA 3S29A 3RGRA 2CKFB 1BRIA 2W03A 1I0XA 1GYBA 3NQZA 2GBXB 3AHSA 1TUHA 1B2SA 3NV0B 3OWSA 1X1UA 4EW5A 2QIYA 1B2XA 1OACA 1RHLA 1WTHA 3KKGA 4ILFA 3NHXA 1W2B2 3VF1A 2AAEA 2P0XA 3DGLA 4O02B 5AIFA 2BHMA 4WP5A 1LOVA 3AMOA 2RBIA 2Y73A 3AHWA 1Z1SA 3U97A 3UL5A 2GSPA 3MSOA 3E99A 1DYUA 1EA2A 4PEJA 3N9HA 1RLSA 3J7Yd 3H51A 1E97A 3PS8A 1YGEA 1GMRA 1GSPA 3OWYA 2ML6A 5CF2A 3NM2A 1GOUA 3QRDA 7GSPA 1B2MA 4FCZA 4LGQA 1AY7A 1UGHI 1TTOA 2Q07A 5AEWB 1YIT3 1RCLA 4LMIA 1JB4A 3BNDA 1VQL3 1MWTA 2ML5A 4L7KA 1TFKA 4I5QA 1AQZA 1NO3A 2CW9A 5EQLA 4AKYA 2IYJA 4J5KA 1SPUA 3K7CA 2OTJ3 2Z7AA 3FG3A 4WFOA 1C54A 3DGNA 1TFOA 3HX8A 2F99A 1X1XA 2K3DA 4FMBA 2XGLA 2CFGA 2ZDJA 4TX4A 3G6E3 1FZUA 1I0VA 4HZ9B 1TU5A 1LOXA 3LTBA 3FCSB 2KCDA 2HMMB 4R9KA 1LXEA 3FGYA 5GSPA 2WOFA 2L4VA 5M19A 1VQN3 1RN4A 3AGOA 4N6TA 1JN5B 3K5TA 1N9JA 1JJ22 2HMNB 1CH0A 3OX9A 5BXQA 2CWUA 3ROBA 4EBGA 1AV4A 1GMQA 1RMSA 2P05A 3BU4A 2O3OA 3NUVA 1U8CB 1BRNL 4CCVA 3JUMA 1S5AA 3GZRA 1T2IA 1RSNA 3NM7A 3ZFZA 1I2FA 3WOFB 2YFLB 2XGNA 2FNQA 1OGZA 4N6OB 2A15A 1S723 2Z6BA 1DE3A 1G0TA 3EBYA 1BGSA 2IMJA 3F14A 1AVKA 3CCR3 4WWUC 3KIIA 1BRSA 1W6YA 3WDGB 4O2HA 1J2BA 1WQLB 3T0UA 3BLZA 4HZBB 4N3VA 4HM2B 2W04A 3N8BA 2RCDA 4CDLA 3MG3A 1LOWA 2D1WA 1WNHA 2OOVC 4K61A 1BU4A 3MKIA 1RGGA 2QA43 1WMPA 2E2VA 3FF0A 2CIUA 2W0QA 1Q7HA 5CLKA 2HMJB 2XR8B 1RGHA 1IQ8A 3LYGA 5IEOA 3G713 4BTYA 2CFLA 1JKGB 5AEUB 1RGCA 3CCJ3 1Q824 1QALA 4K1UA 4Q53A 2CG0A 1NB3I 3OWUA 2W2CA 1KC84 2YFJB 1OF5B 1ROAA 3EQQB 1JBSA 1UI8A 3CU3A 1EKMA 1DVDA 2RGQA 2J8XB 1FA3A 3KE7A 4JRFA 1BRHA 3CC43 1BSCA 4O3VA 1QVF2 3DUKA 2GEYA 1UW1A 3S28A 1BSEA 1SARA 3NBRA 1BNEA 4N6MA 2BMOB 3LT9A 3V99A 3KN4A 5JPUA 4XDVA 5EEOA 3JUOA 1VQQA 1YVBI 4XDWA 2GU3A 1EUIC 1JZOA 1STFI 2XRXB 3NV0A 1NB5I 3HIIA 4HVNA 1HU9A 2M7OA 3MWZA 1BNJA 1GY5A 3SXXA 1I70A 2IY2A 1JZDA 1B20A 5AIIA 5LC6A 2CFWA 4EV5A 1O7GB 3F40A 1JV2B 5AYSC 1VQ53 1O7HB 1ZX2A 1IYYA 1DVCA 2ZHXB 4DKIA 5CXOA 3CCE3 1M904 2UGIA 3Q2PA 4GSPA 2B24B 2W6JH 1US1A 4ORLA 1BNGA 2H0GA 3WMDA 4I4KA 1OUNA 1KQS2 1PY3A 1SIHA 2K54A 5CK6A 2OQEA 3B8LA 3TDGA 1DMQA 3CC73 1A2PA 4OUQA 4KVHA 1SJWA 5TGNA 1V57A 4HM4B 1UCJA 4MMYB 9RNTA 4N6UA 5D83A 2OWPA 1FUWA 2RSXA 4WHAA 4EYCA 1UCKA 5AYRB 1O7WB 4HOHA 2CG1A 1NWWA 3CCQ3 1O7NB 1E3RA 1VQP3 3MYTA 1IQXA 3FSDA 1MGWA 3LMLA 4OVMA 2AADA 3DM8A 2CC3A 4XBXA 1VQ63 4N6NB 4N6LA 1GY6A 4IIAA 3MHEA 1UGIA 3B4OA 1VQ73 2HOHA 3RGAA 5IG4A 1RRLA 1B27A 2RFRA 2OTL3 1JN5A 1RJOA 1N5HA 4FMCA 1BSDA 5IG0A 3GZXB 1UCLA 1R4CA 2IUKA 5EVHA 3T8UA 1Y4KA 2P09A 1N5PA 8RNTA 1ROVA 1N8R4 5JPPA 4HBRA 3CMA3 1TIJA 3F8XA 2CX0A 1BSBA 1U5OA 1RN1A 1B2ZA 2CFKA 2W56B 3I0YA 3KZTA 3CNMA 4OK0A 1RGAA 1A67A 1JRQA 1K9M4 2R4IA 3PZWA 4XBYA 1UUGB 2W9QA 3FZWA 4KFDA 3WR2A 2UUGC 1N8QA 6GSPA 4R4KA 5D81A 5I97A 1BUQA 1VQO3 1Q40B 1G96A 1W6CA 3X3ZA 3CME3 3FKAA 1DMMA 1FW7A 2BMRB 1FUTA 1RNTA 3DH2A 3EE1A 5IG5A 2CHCA 1GMPA 1OH0A 3L0RA 6STDA 1IVVA 4BU4A 2WGQA 5FW5A 1O7MB 1X1WA 2I9WA 3H3HA 1BVIA 3SOAA 3MPHA 1YJW3 2WGOA 4U13A 1BRJA 3WHOA 2IUJA 1RRHA 1IDPA 1W00A 2RNTA 3HK4A 1JKGA 1VZZA 1W2ZA 5LC7A 4FMAA 1BUJA 6RNTA 3Q3FA 3X3YA 1JB5A 1T3BA 4H3UA 1O7PB 3EN8A 1FGRA 2LQVA 1NU3A 3NXJA 1OF5A 3WOEB 1IV7A 4WYKB 1DETA 1A2VA 1FGQA 2PNCA 5DREA 1YJ93 3B7CA 2C10A 2JQ5A 1A90A 2PZVA 3NBBA 1CQSA 1MWRA 4STDA 4GL6A 1MGRA 5HOHA 3OV4A 1UDII 2JDIH 1OHOA 3DZLA 1RGFA 5IERA 3K63A 3F7XA 1FGOA 2HMOB 2KF3A 3FF2A 4NHFA 4BL2A 3X40A 2D42A 1I2GA 2XF3A 3D79A 1Q864 1TJDA 4LSOA 3SYUA 2XEPA 4HAAA 1BNSA 1KSIA 4QWTA 1BIRA 3G16A 3HIGA 1ISKA 4MMXB 1K734 3SX1A 2BMQB 4N6V0 4AEQA 4O8SA 1OPYA 1X1YA 1OGXA 1OHPA 3AGNA 3OXAA 4FCMA 1I3IA 3A5EA 1RCKA 3DY5A 5AIGA 1CYUA 1VQK3 1M1XB 5STDA 1G02A 1F8NA 2KXGA 5BIRA 1LRAA 1TRPA 5G2GA 1STDA 4HM3B 1E3VA 1MWUA 3IJEB 3Q90A 1IT8A 1K41A 1WMOA 3S67A 4IT7A 2IA7A 1AVLA 4HKVB 5IF6A 5IENA 4EV2A 4LEHA 2FGTA 4FMDA 2P38A 4HM0B 1BRGA 3LTDA 3IPTA 3G4S3 4EXRA 3BIRA 3EBTA 1UUWB 2ZL8A 3GWRA 3I553 4LZIA 1VQ83 2V1LA 3A76A 3KCHA 1GY7A 3CNXA 8CHOA 3SEDA 3WA2X 1RGEA 2O9UX 3Q1CA 5AI1A 3V98A 1Q814 3NBJA 2MF7A 1W7CA 3D3LA 3EX9A 2KF4A 3VSYA 3EC9A 4HM1B 4KFEA 1UI7A 1QVG2 1ASKA 2SBLA 1QAKA 3SLUA 3LT8A 4FR9A 2BO9B 4EC6A 2BT3A 3K0ZA 1I8VA 2F98A 3SVAA 1BNIA
chains in the Genus database with same CATH topology
1UGIA 1LQGC 2ZHXB 1UGHI 4LYLB 1UUGB 2J8XB 2UGIA 1EUIC 2UUGC 1UDII 1LQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGI A;  1LQG C;  2ZHX B;  1UGH I;  4LYL B;  1UUG B;  2J8X B;  2UGI A;  1EUI C;  2UUG C;  1UDI I;  1LQM B; 
#chains in the Genus database with same CATH topology
 3VGN A;  4BIR A;  1RN7 A;  2KAA A;  1V74 A;  4RNZ A;  2OCT A;  1PFP A;  4RNT A;  1RGK A;  3GRD A;  4R1K A;  2C11 A;  1B21 A;  1BAO A;  1JBT A;  3F8H A;  3RDE A;  3KSE D;  4RBN A;  3MG1 A;  3PXM A;  3BNE A;  1YVS A;  2W56 A;  4AKZ A;  2B1X B;  3G0K A;  4H61 A;  3CD6 3;  1TP6 A;  3DGY A;  3NX0 A;  5IG3 A;  2H0H A;  3PYJ A;  3EN1 B;  3V92 A;  4RZM A;  1EG9 B;  2INX A;  1DMN A;  1RKY A;  1Q40 A;  1YNV X;  3K9M C;  4J5G A;  1FUS A;  3GZB A;  1CYV A;  3HOH A;  3HZP A;  3X41 A;  4CJN A;  2HML B;  3CCL 3;  1VQ4 3;  4MMZ B;  2F5W A;  3UNL A;  5RNT A;  3X3X A;  4KT3 B;  2QEX 3;  3EB8 A;  1LNI A;  1T5Y A;  1D6Y A;  3BB9 A;  3S5C A;  3UJM A;  4L8P A;  4RNY A;  5KP3 A;  1YHQ 3;  1HYF A;  3GSP A;  3CC2 3;  3D4A A;  3LTC A;  2CWT A;  3PCS A;  1A2K A;  3O8Y A;  2OOV A;  1GOY A;  4GB5 A;  1T2H A;  1TRQ A;  3D5I A;  2C4B A;  3HI7 A;  5D82 A;  2E2T A;  3X42 A;  1YIJ 3;  3JUP A;  4L8O A;  5G1K A;  4ZM8 A;  2CH9 A;  2LYX A;  5IEP A;  3BNB A;  2W9P A;  5DRV A;  3D9R A;  7RNT A;  1WMN A;  1GS3 A;  3PGB A;  1W4N A;  1ZO2 A;  4WYK A;  2YFI B;  4XB5 A;  3RNT A;  3ECF A;  5ELU A;  1FYS A;  2BU4 A;  1YI2 3;  1QMA A;  1IK3 A;  1FGM A;  1ULJ B;  5M1A A;  1JBR A;  1IU7 A;  1OHS A;  1IVU A;  2GEX A;  1L5G B;  1YJN 3;  3AMO B;  3F9S A;  4GHO A;  3CCV 3;  1IV9 A;  1MNL A;  2R41 A;  3DXO A;  4HYZ A;  2GXF A;  3DGO A;  1PYL A;  3ZG5 A;  1ULI B;  5A0O B;  1AR0 A;  1MOL A;  2WOH A;  2XSO B;  5HGR A;  1VQM 3;  3EHC A;  5G1L A;  2OQE C;  1SII A;  2KRT A;  1BNF A;  4FCJ A;  3NQY A;  2UX0 A;  3PCR A;  4LYL B;  3UB1 A;  4BTX A;  5KP1 A;  4NPB A;  5BU4 A;  2MC8 A;  7STD A;  1RNB A;  1JNQ A;  3UL6 A;  3IMA B;  4HM7 B;  5M18 A;  3ALA A;  3G8Z A;  3DMC A;  1BRK A;  3JUN A;  1YGW A;  1BSA A;  1I2E A;  3KFQ C;  1PU4 A;  4HJL B;  1GD4 A;  3FG4 A;  3QK9 A;  3CPW 2;  4R9L A;  2E2U A;  1NNV A;  3DGM A;  1ZGX A;  3KSP A;  1IVW A;  4HM5 B;  4BTW A;  1W02 A;  1ZS7 A;  4NRE A;  1R4Y A;  1KWI A;  2FXT A;  3MG2 A;  4MEI A;  1W5Z A;  5BVB A;  1LVN A;  4J8T A;  2GU1 A;  3JUQ A;  4G1M B;  3T8N A;  1OCV A;  2Z76 A;  3LXU X;  1W6G A;  4X2O A;  3WA3 A;  5IW9 A;  1K8A 4;  2F56 A;  1UUV B;  3LZA A;  3LOY A;  3S27 A;  5CF1 A;  1CEW I;  1SQW A;  3URP A;  5KP4 A;  1V58 A;  2F86 B;  4XM4 A;  3LH4 A;  3U1W A;  3ZG0 A;  1M9G A;  1D6U A;  3OW2 2;  1M1K 4;  3F7S A;  1HKX A;  2H0I A;  1QAF A;  2XH9 A;  3EJV A;  3ER7 A;  3SOY A;  1W01 A;  4HM8 B;  1BNR A;  2CFD A;  1BAN A;  1K28 A;  4KZ1 A;  4KFF A;  4BL3 A;  2HMK B;  3B4P A;  1LOY A;  1UCI A;  1IVX A;  4X2H A;  2CX1 A;  1Q7Y 4;  2XFS A;  2P0M A;  3BNC A;  4K90 B;  1KD1 4;  1FGT A;  1MWS A;  1RGL A;  2WO0 A;  3FLJ A;  3GAX A;  3GZY B;  1C7H A;  4J9A A;  1Q42 A;  2CWV A;  1LNH A;  2QGU A;  3N54 B;  3I56 3;  3CCS 3;  4HM6 B;  1Q9E A;  1EEJ A;  3FH1 A;  1EQK A;  1B2U A;  3CCU 3;  4JF8 A;  1QJG A;  3CPO A;  1GD3 A;  4XBT A;  2Y74 A;  1BOX A;  2CK3 H;  4MJD A;  3D5G A;  1IT7 A;  3STD A;  2Z77 A;  1LQG C;  1RDS A;  1D6Z A;  2KF6 A;  2ZA4 A;  3WOD G;  3CXC 2;  3FG1 A;  5FGO A;  2BIR A;  1N9E A;  2L1S A;  1HZ1 A;  2XSH B;  2YX9 A;  1LQM B;  4CPK A;  2STD A;  3EF8 A;  4IPB A;  2SAR A;  1JB2 A;  1RTU A;  1NDO B;  2GBW B;  4R80 A;  1VQ9 3;  3LTA A;  3M8C A;  1B3S A;  3CCM 3;  1GOV A;  2XFT A;  1I3F A;  2K0M A;  2F4Y A;  2F5M A;  5ELJ A;  3JVC A;  1NJI 4;  1IQY A;  2BNG A;  2KF5 A;  4K1V A;  5AIH A;  5JBS A;  3S29 A;  3RGR A;  2CKF B;  1BRI A;  2W03 A;  1I0X A;  1GYB A;  3NQZ A;  2GBX B;  3AHS A;  1TUH A;  1B2S A;  3NV0 B;  3OWS A;  1X1U A;  4EW5 A;  2QIY A;  1B2X A;  1OAC A;  1RHL A;  1WTH A;  3KKG A;  4ILF A;  3NHX A;  1W2B 2;  3VF1 A;  2AAE A;  2P0X A;  3DGL A;  4O02 B;  5AIF A;  2BHM A;  4WP5 A;  1LOV A;  3AMO A;  2RBI A;  2Y73 A;  3AHW A;  1Z1S A;  3U97 A;  3UL5 A;  2GSP A;  3MSO A;  3E99 A;  1DYU A;  1EA2 A;  4PEJ A;  3N9H A;  1RLS A;  3J7Y d;  3H51 A;  1E97 A;  3PS8 A;  1YGE A;  1GMR A;  1GSP A;  3OWY A;  2ML6 A;  5CF2 A;  3NM2 A;  1GOU A;  3QRD A;  7GSP A;  1B2M A;  4FCZ A;  4LGQ A;  1AY7 A;  1UGH I;  1TTO A;  2Q07 A;  5AEW B;  1YIT 3;  1RCL A;  4LMI A;  1JB4 A;  3BND A;  1VQL 3;  1MWT A;  2ML5 A;  4L7K A;  1TFK A;  4I5Q A;  1AQZ A;  1NO3 A;  2CW9 A;  5EQL A;  4AKY A;  2IYJ A;  4J5K A;  1SPU A;  3K7C A;  2OTJ 3;  2Z7A A;  3FG3 A;  4WFO A;  1C54 A;  3DGN A;  1TFO A;  3HX8 A;  2F99 A;  1X1X A;  2K3D A;  4FMB A;  2XGL A;  2CFG A;  2ZDJ A;  4TX4 A;  3G6E 3;  1FZU A;  1I0V A;  4HZ9 B;  1TU5 A;  1LOX A;  3LTB A;  3FCS B;  2KCD A;  2HMM B;  4R9K A;  1LXE A;  3FGY A;  5GSP A;  2WOF A;  2L4V A;  5M19 A;  1VQN 3;  1RN4 A;  3AGO A;  4N6T A;  1JN5 B;  3K5T A;  1N9J A;  1JJ2 2;  2HMN B;  1CH0 A;  3OX9 A;  5BXQ A;  2CWU A;  3ROB A;  4EBG A;  1AV4 A;  1GMQ A;  1RMS A;  2P05 A;  3BU4 A;  2O3O A;  3NUV A;  1U8C B;  1BRN L;  4CCV A;  3JUM A;  1S5A A;  3GZR A;  1T2I A;  1RSN A;  3NM7 A;  3ZFZ A;  1I2F A;  3WOF B;  2YFL B;  2XGN A;  2FNQ A;  1OGZ A;  4N6O B;  2A15 A;  1S72 3;  2Z6B A;  1DE3 A;  1G0T A;  3EBY A;  1BGS A;  2IMJ A;  3F14 A;  1AVK A;  3CCR 3;  4WWU C;  3KII A;  1BRS A;  1W6Y A;  3WDG B;  4O2H A;  1J2B A;  1WQL B;  3T0U A;  3BLZ A;  4HZB B;  4N3V A;  4HM2 B;  2W04 A;  3N8B A;  2RCD A;  4CDL A;  3MG3 A;  1LOW A;  2D1W A;  1WNH A;  2OOV C;  4K61 A;  1BU4 A;  3MKI A;  1RGG A;  2QA4 3;  1WMP A;  2E2V A;  3FF0 A;  2CIU A;  2W0Q A;  1Q7H A;  5CLK A;  2HMJ B;  2XR8 B;  1RGH A;  1IQ8 A;  3LYG A;  5IEO A;  3G71 3;  4BTY A;  2CFL A;  1JKG B;  5AEU B;  1RGC A;  3CCJ 3;  1Q82 4;  1QAL A;  4K1U A;  4Q53 A;  2CG0 A;  1NB3 I;  3OWU A;  2W2C A;  1KC8 4;  2YFJ B;  1OF5 B;  1ROA A;  3EQQ B;  1JBS A;  1UI8 A;  3CU3 A;  1EKM A;  1DVD A;  2RGQ A;  2J8X B;  1FA3 A;  3KE7 A;  4JRF A;  1BRH A;  3CC4 3;  1BSC A;  4O3V A;  1QVF 2;  3DUK A;  2GEY A;  1UW1 A;  3S28 A;  1BSE A;  1SAR A;  3NBR A;  1BNE A;  4N6M A;  2BMO B;  3LT9 A;  3V99 A;  3KN4 A;  5JPU A;  4XDV A;  5EEO A;  3JUO A;  1VQQ A;  1YVB I;  4XDW A;  2GU3 A;  1EUI C;  1JZO A;  1STF I;  2XRX B;  3NV0 A;  1NB5 I;  3HII A;  4HVN A;  1HU9 A;  2M7O A;  3MWZ A;  1BNJ A;  1GY5 A;  3SXX A;  1I70 A;  2IY2 A;  1JZD A;  1B20 A;  5AII A;  5LC6 A;  2CFW A;  4EV5 A;  1O7G B;  3F40 A;  1JV2 B;  5AYS C;  1VQ5 3;  1O7H B;  1ZX2 A;  1IYY A;  1DVC A;  2ZHX B;  4DKI A;  5CXO A;  3CCE 3;  1M90 4;  2UGI A;  3Q2P A;  4GSP A;  2B24 B;  2W6J H;  1US1 A;  4ORL A;  1BNG A;  2H0G A;  3WMD A;  4I4K A;  1OUN A;  1KQS 2;  1PY3 A;  1SIH A;  2K54 A;  5CK6 A;  2OQE A;  3B8L A;  3TDG A;  1DMQ A;  3CC7 3;  1A2P A;  4OUQ A;  4KVH A;  1SJW A;  5TGN A;  1V57 A;  4HM4 B;  1UCJ A;  4MMY B;  9RNT A;  4N6U A;  5D83 A;  2OWP A;  1FUW A;  2RSX A;  4WHA A;  4EYC A;  1UCK A;  5AYR B;  1O7W B;  4HOH A;  2CG1 A;  1NWW A;  3CCQ 3;  1O7N B;  1E3R A;  1VQP 3;  3MYT A;  1IQX A;  3FSD A;  1MGW A;  3LML A;  4OVM A;  2AAD A;  3DM8 A;  2CC3 A;  4XBX A;  1VQ6 3;  4N6N B;  4N6L A;  1GY6 A;  4IIA A;  3MHE A;  1UGI A;  3B4O A;  1VQ7 3;  2HOH A;  3RGA A;  5IG4 A;  1RRL A;  1B27 A;  2RFR A;  2OTL 3;  1JN5 A;  1RJO A;  1N5H A;  4FMC A;  1BSD A;  5IG0 A;  3GZX B;  1UCL A;  1R4C A;  2IUK A;  5EVH A;  3T8U A;  1Y4K A;  2P09 A;  1N5P A;  8RNT A;  1ROV A;  1N8R 4;  5JPP A;  4HBR A;  3CMA 3;  1TIJ A;  3F8X A;  2CX0 A;  1BSB A;  1U5O A;  1RN1 A;  1B2Z A;  2CFK A;  2W56 B;  3I0Y A;  3KZT A;  3CNM A;  4OK0 A;  1RGA A;  1A67 A;  1JRQ A;  1K9M 4;  2R4I A;  3PZW A;  4XBY A;  1UUG B;  2W9Q A;  3FZW A;  4KFD A;  3WR2 A;  2UUG C;  1N8Q A;  6GSP A;  4R4K A;  5D81 A;  5I97 A;  1BUQ A;  1VQO 3;  1Q40 B;  1G96 A;  1W6C A;  3X3Z A;  3CME 3;  3FKA A;  1DMM A;  1FW7 A;  2BMR B;  1FUT A;  1RNT A;  3DH2 A;  3EE1 A;  5IG5 A;  2CHC A;  1GMP A;  1OH0 A;  3L0R A;  6STD A;  1IVV A;  4BU4 A;  2WGQ A;  5FW5 A;  1O7M B;  1X1W A;  2I9W A;  3H3H A;  1BVI A;  3SOA A;  3MPH A;  1YJW 3;  2WGO A;  4U13 A;  1BRJ A;  3WHO A;  2IUJ A;  1RRH A;  1IDP A;  1W00 A;  2RNT A;  3HK4 A;  1JKG A;  1VZZ A;  1W2Z A;  5LC7 A;  4FMA A;  1BUJ A;  6RNT A;  3Q3F A;  3X3Y A;  1JB5 A;  1T3B A;  4H3U A;  1O7P B;  3EN8 A;  1FGR A;  2LQV A;  1NU3 A;  3NXJ A;  1OF5 A;  3WOE B;  1IV7 A;  4WYK B;  1DET A;  1A2V A;  1FGQ A;  2PNC A;  5DRE A;  1YJ9 3;  3B7C A;  2C10 A;  2JQ5 A;  1A90 A;  2PZV A;  3NBB A;  1CQS A;  1MWR A;  4STD A;  4GL6 A;  1MGR A;  5HOH A;  3OV4 A;  1UDI I;  2JDI H;  1OHO A;  3DZL A;  1RGF A;  5IER A;  3K63 A;  3F7X A;  1FGO A;  2HMO B;  2KF3 A;  3FF2 A;  4NHF A;  4BL2 A;  3X40 A;  2D42 A;  1I2G A;  2XF3 A;  3D79 A;  1Q86 4;  1TJD A;  4LSO A;  3SYU A;  2XEP A;  4HAA A;  1BNS A;  1KSI A;  4QWT A;  1BIR A;  3G16 A;  3HIG A;  1ISK A;  4MMX B;  1K73 4;  3SX1 A;  2BMQ B;  4N6V 0;  4AEQ A;  4O8S A;  1OPY A;  1X1Y A;  1OGX A;  1OHP A;  3AGN A;  3OXA A;  4FCM A;  1I3I A;  3A5E A;  1RCK A;  3DY5 A;  5AIG A;  1CYU A;  1VQK 3;  1M1X B;  5STD A;  1G02 A;  1F8N A;  2KXG A;  5BIR A;  1LRA A;  1TRP A;  5G2G A;  1STD A;  4HM3 B;  1E3V A;  1MWU A;  3IJE B;  3Q90 A;  1IT8 A;  1K41 A;  1WMO A;  3S67 A;  4IT7 A;  2IA7 A;  1AVL A;  4HKV B;  5IF6 A;  5IEN A;  4EV2 A;  4LEH A;  2FGT A;  4FMD A;  2P38 A;  4HM0 B;  1BRG A;  3LTD A;  3IPT A;  3G4S 3;  4EXR A;  3BIR A;  3EBT A;  1UUW B;  2ZL8 A;  3GWR A;  3I55 3;  4LZI A;  1VQ8 3;  2V1L A;  3A76 A;  3KCH A;  1GY7 A;  3CNX A;  8CHO A;  3SED A;  3WA2 X;  1RGE A;  2O9U X;  3Q1C A;  5AI1 A;  3V98 A;  1Q81 4;  3NBJ A;  2MF7 A;  1W7C A;  3D3L A;  3EX9 A;  2KF4 A;  3VSY A;  3EC9 A;  4HM1 B;  4KFE A;  1UI7 A;  1QVG 2;  1ASK A;  2SBL A;  1QAK A;  3SLU A;  3LT8 A;  4FR9 A;  2BO9 B;  4EC6 A;  2BT3 A;  3K0Z A;  1I8V A;  2F98 A;  3SVA A;  1BNI A; 
#chains in the Genus database with same CATH homology
 1UGI A;  1LQG C;  2ZHX B;  1UGH I;  4LYL B;  1UUG B;  2J8X B;  2UGI A;  1EUI C;  2UUG C;  1UDI I;  1LQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...