1YJN3

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yjn300
3I563 1VQ43 1VQK3 3CCJ3 1Q864 3G713 3G6E3 1YJW3 1YHQ3 1KD14 1Q7Y4 1YIJ3 1VQN3 3CME3 3CCR3 1M904 1S723 1KC84 1Q814 3CCE3 1YI23 2OTJ3 1QVG2 2QEX3 3CCV3 1VQM3 1VQO3 1K9M4 1VQ93 1QVF2 3OW22 3CCS3 1M1K4 1YIT3 1VQ63 3CD63 2QA43 1YJ93 1K8A4 1W2B2 1VQL3 1VQP3 1Q824 1KQS2 2OTL3 1N8R4 1VQ73 3CCU3 1VQ83 1K734 3CCM3 3CC23 1VQ53 3CPW2 3CCL3 1NJI4 3CXC2 3CC73 1JJ22 3CMA3 1YJN3 3I553 3CCQ3 3G4S3 3CC43
chains in the Genus database with same CATH superfamily
1BSBA 1JBTA 4R9KA 3IPTA 5I97A 3G713 1T3BA 1MWTA 2M7OA 4JF8A 2K54A 5EQLA 4O8SA 4HBRA 1BGSA 2D1WA 5AI1A 1NB5I 5HOHA 1V57A 3FSDA 4FCJA 3MKIA 3AMOA 2CHCA 3DMCA 1LXEA 3ALAA 4QWTA 1JN5A 1YVBI 5D82A 2WGOA 4HM4B 1FUWA 4MJDA 2CFGA 3FH1A 5LC6A 2JQ5A 1K8A4 2PNCA 1X1WA 2CC3A 4HM1B 2QGUA 1L5GB 1HU9A 2AAEA 3WOFB 2OTL3 1W6YA 1O7GB 1YNVX 1RSNA 1IT8A 2CX0A 1ZX2A 1J2BA 1CH0A 1OF5B 3CPW2 2KAAA 1NWWA 4HJLB 4K90B 3PCRA 2H0IA 5AIGA 2XF3A 1IVUA 1LOVA 1RN1A 1IVWA 3D5IA 2CG1A 2CG0A 3HI7A 4I4KA 1W5ZA 2XGLA 2KXGA 1WMPA 2BIRA 2BMOB 1IK3A 1KD14 4MMZB 5AEWB 1QALA 1Q7Y4 1FUSA 3F14A 6RNTA 5IG4A 1UUVB 1AY7A 4XBTA 1BRNL 1DMMA 1TP6A 1DVDA 4N6UA 3ECFA 1GY7A 3V98A 1HZ1A 1Q9EA 1N8R4 1SARA 4X2OA 1JBSA 3LTDA 5BIRA 1K734 3B8LA 3OV4A 1IDPA 1FGTA 2WGQA 3SLUA 3CXC2 1N5HA 3EF8A 3NM2A 4XB5A 3MWZA 5IG5A 1YJN3 1UCJA 1BUJA 4WYKA 4EW5A 3UJMA 2BO9B 3RGAA 3PYJA 3LTBA 2Q07A 4I5QA 1VQQA 1C54A 1BSEA 3B4PA 3DY5A 3NM7A 5CF1A 3B7CA 4HM7B 5M1AA 3EHCA 2OQEC 3Q3FA 3LZAA 4BL3A 1DMQA 3B4OA 3LXUX 1BIRA 2CFWA 2K0MA 1QVG2 3KCHA 1CYVA 3NX0A 1VQ63 5STDA 1RGEA 1BU4A 1UCKA 2CWTA 3D4AA 4BU4A 4KZ1A 1VQ73 3WODG 1W7CA 1I70A 5CK6A 1A2KA 2BHMA 4KVHA 1ROAA 3CMA3 1FUTA 2GSPA 1B27A 1Q42A 2I9WA 3WMDA 2L4VA 1BSDA 4FMBA 4N6MA 1W00A 4AKYA 1W01A 2E2UA 2FNQA 3ZFZA 3STDA 3DM8A 1GOYA 3DH2A 3AGOA 4K1UA 7RNTA 1M904 2Z77A 3BNBA 4FR9A 2ML6A 2OTJ3 4CJNA 1STDA 4O02B 3OW22 3EN1B 2AADA 3F40A 2YFJB 1GD4A 1ZO2A 4DKIA 4HM6B 4LYLB 3GAXA 1EUIC 1JB2A 1EKMA 1KSIA 2KF5A 3NV0B 1LNIA 1JB5A 2B24B 2KCDA 2HMMB 1W2ZA 2UX0A 3MYTA 3N54B 3T8NA 1T5YA 3S27A 1GYBA 3DXOA 3I563 3SOYA 2Y73A 5ELUA 8RNTA 2WOFA 2XFTA 5JPPA 4L7KA 1UI8A 2INXA 5BVBA 3O8YA 3RDEA 3BIRA 1X1YA 3E99A 2ZL8A 1V74A 2B1XB 2CK3H 2GU3A 3X41A 3PGBA 5BXQA 3VGNA 3JUPA 1KC84 2XR8B 3BU4A 4KT3B 3NV0A 4HVNA 3EBYA 4PEJA 2HMJB 3V92A 5RNTA 1JZDA 3LOYA 1BNRA 3AHWA 1IT7A 1UI7A 2IYJA 5CF2A 4XBXA 3NBJA 3MG2A 4O3VA 1RKYA 3FKAA 1O7MB 1UGIA 4XDWA 1OH0A 1MWRA 3CCM3 3M8CA 1AV4A 2D42A 3LT8A 1RGGA 2O9UX 4LZIA 1RNBA 2CW9A 1QMAA 2W56A 3MPHA 2W0QA 3F7XA 1IV7A 2F86B 2CX1A 2R41A 4GHOA 1I8VA 2P0MA 2XH9A 1B2SA 3G6E3 3ER7A 4R4KA 1B2XA 3GSPA 4HAAA 1AR0A 1TFOA 2FGTA 2LYXA 3HOHA 1Q40A 3N9HA 1IVVA 1T2HA 2QEX3 1UUWB 1K9M4 2CFDA 1ULJB 4J9AA 5IG0A 1GS3A 1VZZA 2P09A 1YIT3 2F56A 4ILFA 1FW7A 1I3IA 1RGKA 1GSPA 1SQWA 2GEYA 1D6YA 4L8PA 1NNVA 4OUQA 3H3HA 1GOUA 1RHLA 3OWSA 3WHOA 1BRHA 3U1WA 3NBRA 1NJI4 3WA2X 1U5OA 1UCLA 5D81A 2IUJA 2HMKB 8CHOA 3ZG0A 4KFDA 1LOXA 5EVHA 1GMQA 4HOHA 5EEOA 1D6ZA 1JZOA 3HIGA 3U97A 3CCJ3 2XEPA 3KFQC 1GD3A 1A90A 4N6NB 1CYUA 2RGQA 1YJW3 4N6TA 3L0RA 1A67A 2W6JH 3H51A 5IERA 1RJOA 3CCR3 2P0XA 1YVSA 2W9QA 1PU4A 3RGRA 3SYUA 3AHSA 1QVF2 1N8QA 2Z76A 4CCVA 4H3UA 1U8CB 7STDA 2QA43 1W2B2 3F7SA 4NREA 1AVLA 2F5WA 1BRIA 1US1A 5AYSC 3S67A 2XFSA 1I2EA 3A5EA 4STDA 1SIHA 3CNMA 1RLSA 1IVXA 1WTHA 1VQ53 3CC73 2ML5A 2UGIA 1RGFA 3I0YA 1SIIA 3EN8A 3HK4A 1QJGA 1EQKA 2H0GA 1WMOA 5DREA 1Q864 1IYYA 5AEUB 2XGNA 4O2HA 2A15A 1OHPA 3TDGA 1CQSA 1IQYA 1JV2B 1MWUA 1B20A 2F4YA 2XRXB 2SARA 2WO0A 4FMAA 1G96A 3V99A 1CEWI 3CCE3 1GMPA 4JRFA 1K41A 4FMDA 1RNTA 3SX1A 3DGYA 3CD63 4N6V0 2C10A 4XBYA 2O3OA 3IMAB 4AEQA 3J7Yd 2OWPA 1OHOA 1RTUA 4OVMA 1G02A 3GZYB 3CCU3 1BUQA 1PYLA 3S29A 1OCVA 1WMNA 1RMSA 3CCL3 1BSCA 3FG3A 3WR2A 7GSPA 3HX8A 1OACA 1E3RA 1V58A 3FZWA 3KN4A 3OWUA 4MEIA 4R80A 4WP5A 1BRKA 2OOVC 5G1LA 3WOEB 4WWUC 1VQK3 2L1SA 2STDA 2C11A 3N8BA 3QK9A 4LGQA 4ZM8A 4EV5A 1PFPA 3X3ZA 3ZG5A 4EYCA 1NB3I 1TFKA 3D5GA 3BB9A 1QAKA 1UCIA 1VQM3 1I0XA 1BRGA 3BNEA 4HM0B 2KRTA 2ZDJA 1LNHA 4MMYB 1VQP3 1O7PB 1O7NB 1LQGC 1BSAA 3OX9A 2CWVA 1BNJA 3S5CA 3DGMA 4NPBA 1TUHA 1JKGB 2JDIH 1LOWA 2BNGA 1O7WB 1YGWA 2KF3A 1N9EA 4LMIA 3CC23 1LOYA 1OF5A 3F8XA 1X1UA 1B2MA 1N9JA 4BL2A 3FG4A 2Z7AA 1W02A 3A76A 3NQYA 1MWSA 3I553 1Q40B 1OHSA 1VQ43 3GZXB 1EA2A 1DMNA 1RCKA 1ASKA 2GBWB 2F99A 2LQVA 1FGMA 1ROVA 2PZVA 2W03A 3LT9A 1E3VA 1OPYA 4FCZA 5IG3A 3KIIA 3OWYA 4X2HA 1YHQ3 2CFKA 1BNIA 4EXRA 2W56B 3CME3 3HZPA 1LRAA 3OXAA 2BU4A 1R4CA 1W4NA 3X42A 4HM8B 2ZA4A 3DGOA 4ORLA 1S5AA 2RCDA 4IT7A 1R4YA 1PY3A 3LMLA 1I2GA 5CLKA 1OUNA 5M19A 1LVNA 1RDSA 3SOAA 4J5KA 4FMCA 4KFEA 4N6LA 2P05A 6STDA 1O7HB 3LTCA 1LQMB 5IENA 5HGRA 2FXTA 1HYFA 2H0HA 2IMJA 4XM4A 4RBNA 2HMNB 2W9PA 1JBRA 1B2UA 1YGEA 4J5GA 4H61A 5JPUA 2GBXB 2ZHXB 3PCSA 3EX9A 1Z1SA 1OGXA 1ZGXA 2MC8A 1RGLA 3VF1A 2RFRA 3BNDA 1SJWA 1NU3A 1Q814 3K7CA 1FGQA 1UGHI 2GU1A 3KKGA 5CXOA 1N5PA 1VQO3 1ULIB 3WA3A 1WQLB 9RNTA 1GMRA 1RN7A 2IA7A 2KF6A 3JUMA 4J8TA 2WOHA 5BU4A 4HM5B 1I2FA 3DUKA 5AIFA 5A0OB 3KE7A 1VQ83 3JUOA 4HM2B 5ELJA 3QRDA 3BLZA 4EBGA 1AQZA 5D83A 4NHFA 4K61A 3G4S3 3X3YA 3FG1A 4BTWA 2V1LA 1RGHA 4FCMA 2YFIB 3GWRA 4HM3B 4CDLA 2CH9A 3AMOB 4LSOA 1VQN3 3X3XA 3G16A 5TGNA 1JN5B 1UW1A 3EQQB 4RNTA 3PZWA 3KZTA 2YX9A 3T8UA 3CCS3 1FZUA 2C4BA 2Y74A 3Q2PA 3UL6A 3WDGB 1IQXA 1BVIA 2SBLA 4TX4A 5KP3A 3ROBA 1VQL3 3GZBA 1KQS2 1BNSA 2HOHA 1D6UA 1GOVA 3MG1A 4HZBB 1RRLA 1A2VA 1NO3A 4K1VA 3K5TA 5DRVA 1JJ22 3FGYA 3NBBA 1BAOA 3K9MC 1E97A 2HMLB 4Q53A 1X1XA 1W6GA 3EE1A 2W04A 1AVKA 3AGNA 4OK0A 4BTYA 1T2IA 1JRQA 1STFI 5GSPA 5LC7A 1TTOA 4G1MB 4CPKA 2QIYA 2OCTA 3LH4A 2CWUA 3PS8A 3URPA 4WFOA 2XSOB 1NDOB 1FGOA 3GZRA 2E2TA 2RSXA 1EEJA 1BRJA 1KWIA 3D79A 3Q1CA 3FF2A 3T0UA 2BT3A 2IY2A 3CNXA 3D9RA 3UNLA 3EJVA 2CKFB 3EBTA 4BTXA 1SPUA 1OGZA 1I3FA 3IJEB 1BANA 1RGCA 3S28A 1RGAA 3MHEA 3K0ZA 4LEHA 4GB5A 3DGNA 6GSPA 2GXFA 5G2GA 5FW5A 1JKGA 1B2ZA 4RNZA 3CU3A 1RN4A 5G1KA 2RBIA 1YIJ3 1F8NA 1FYSA 4N6OB 1DE3A 1TIJA 1B3SA 1RRHA 3F9SA 1Y4KA 3MG3A 3VSYA 4BIRA 2W2CA 3EC9A 1TJDA 5JBSA 3CCV3 2RNTA 2F5MA 1A2PA 3LYGA 4IIAA 1YJ93 1ISKA 1K28A 3FCSB 1ZS7A 1IQ8A 5FGOA 5IF6A 3CPOA 3DGLA 1BRSA 1BNEA 3JUNA 4RNYA 1FGRA 2CIUA 5AIIA 5KP4A 1RCLA 3D3LA 3NHXA 3CCQ3 1QAFA 3KSED 3PXMA 2MF7A 1TRQA 1EG9B 2BMQB 1IV9A 1GY5A 1JNQA 1WNHA 3RNTA 3SVAA 4N3VA 1I0VA 3SXXA 3G8ZA 2E2VA 3KSPA 1MNLA 1S723 1C7HA 1BNGA 1YI23 1BNFA 3DZLA 4GL6A 4KFFA 2KF4A 1VQ93 5IW9A 1GY6A 3FF0A 1Q7HA 2J8XB 1M1K4 2HMOB 1BOXA 1DYUA 4R1KA 3MSOA 1B21A 2P38A 4R9LA 4XDVA 1MGRA 3EB8A 3SEDA 3JVCA 4EC6A 1MOLA 1HKXA 3JUQA 4U13A 1TU5A 1UDII 3NUVA 3UL5A 3X40A 1M1XB 1FA3A 3Q90A 3K63A 4AKZA 2GEXA 3FLJA 3F8HA 4WYKB 1W6CA 1TRPA 2YFLB 3NXJA 4IPBA 4RZMA 5AIHA 4MMXB 2OQEA 2Z6BA 3NQZA 4HYZA 4WHAA 1M9GA 5M18A 2UUGC 2XSHB 1G0TA 3UB1A 1DETA 5IEPA 2CFLA 4L8OA 3G0KA 5KP1A 1JB4A 4GSPA 1MGWA 2F98A 5AYRB 2OOVA 3GRDA 2K3DA 1Q824 2IUKA 3LTAA 5IEOA 1IU7A 2BMRB 1DVCA 3BNCA 4HKVB 2R4IA 4HZ9B 3HIIA 1UUGB 4EV2A 3CC43
chains in the Genus database with same CATH topology
4R9KA 3IPTA 5I97A 3G713 2M7OA 4JF8A 2K54A 5EQLA 4O8SA 4HBRA 2D1WA 5AI1A 1NB5I 3FSDA 4FCJA 3MKIA 3AMOA 2CHCA 3DMCA 1LXEA 3ALAA 4QWTA 1JN5A 1YVBI 5D82A 2WGOA 4HM4B 1FUWA 4MJDA 2CFGA 3FH1A 5LC6A 2JQ5A 1K8A4 2PNCA 2CC3A 4HM1B 2QGUA 1L5GB 1HU9A 3WOFB 2OTL3 1W6YA 1O7GB 1IT8A 1ZX2A 1J2BA 1OF5B 3CPW2 1NWWA 4HJLB 4K90B 3PCRA 5AIGA 2XF3A 1IVUA 1IVWA 2CG1A 2CG0A 3HI7A 4I4KA 1W5ZA 2XGLA 2KXGA 1WMPA 2BMOB 1IK3A 1KD14 4MMZB 5AEWB 1QALA 1Q7Y4 3F14A 5IG4A 1UUVB 4XBTA 1DMMA 1TP6A 1DVDA 4N6UA 3ECFA 1GY7A 3V98A 1N8R4 4X2OA 3LTDA 1K734 3B8LA 3OV4A 1IDPA 1FGTA 2WGQA 3SLUA 3CXC2 1N5HA 3EF8A 3NM2A 4XB5A 3MWZA 5IG5A 1YJN3 4WYKA 3UJMA 2BO9B 3RGAA 3PYJA 3LTBA 2Q07A 3B4PA 3DY5A 3NM7A 5CF1A 3B7CA 4HM7B 3EHCA 2OQEC 3LZAA 1DMQA 3B4OA 3LXUX 2CFWA 2K0MA 1QVG2 1CYVA 3NX0A 1VQ63 5STDA 2CWTA 4KZ1A 1VQ73 3WODG 1W7CA 5CK6A 1A2KA 2BHMA 4KVHA 1ROAA 3CMA3 1Q42A 2I9WA 3WMDA 2L4VA 4N6MA 4FMBA 1W00A 4AKYA 1W01A 2E2UA 2FNQA 3STDA 3DM8A 4K1UA 1M904 2Z77A 3BNBA 4FR9A 2ML6A 2OTJ3 1STDA 4O02B 3OW22 3EN1B 3F40A 2YFJB 1GD4A 1ZO2A 4HM6B 3GAXA 1KSIA 1JB2A 1EKMA 3NV0B 1JB5A 2B24B 2KCDA 2HMMB 1W2ZA 2UX0A 3MYTA 3N54B 3T8NA 1T5YA 3S27A 1GYBA 3DXOA 3I563 3SOYA 2Y73A 5ELUA 2WOFA 2XFTA 5JPPA 4L7KA 1UI8A 2INXA 5BVBA 3O8YA 3RDEA 3E99A 2ZL8A 1V74A 2B1XB 2CK3H 2GU3A 3X41A 3PGBA 5BXQA 3VGNA 3JUPA 1KC84 2XR8B 3NV0A 4HVNA 3EBYA 4PEJA 2HMJB 3V92A 3LOYA 1IT7A 1UI7A 5CF2A 4XBXA 3NBJA 3MG2A 4O3VA 1RKYA 3FKAA 1O7MB 4XDWA 1OH0A 3CCM3 3M8CA 1AV4A 2D42A 3LT8A 4LZIA 2O9UX 2CW9A 1QMAA 2W56A 3MPHA 2W0QA 3F7XA 1IV7A 2F86B 2P0MA 2XH9A 3G6E3 3ER7A 4R4KA 1AR0A 1TFOA 2FGTA 2LYXA 1Q40A 3N9HA 1IVVA 1K9M4 2QEX3 1UUWB 2CFDA 1ULJB 4J9AA 5IG0A 1GS3A 1VZZA 2P09A 1YIT3 1SQWA 2GEYA 1D6YA 4L8PA 4OUQA 3H3HA 3OWSA 3U1WA 3NBRA 1NJI4 3WA2X 1U5OA 5D81A 2IUJA 2HMKB 8CHOA 4KFDA 1LOXA 5EVHA 5EEOA 1D6ZA 3HIGA 3U97A 3CCJ3 1A90A 2XEPA 3KFQC 1GD3A 1CYUA 4N6NB 2RGQA 1YJW3 4N6TA 3L0RA 1A67A 2W6JH 3H51A 5IERA 1RJOA 3CCR3 2P0XA 2W9QA 1PU4A 3RGRA 1QVF2 1N8QA 2Z76A 4CCVA 4H3UA 1U8CB 7STDA 2QA43 1W2B2 3F7SA 4NREA 1AVLA 5AYSC 1US1A 2XFSA 4STDA 1SIHA 3CNMA 1IVXA 1WTHA 1VQ53 3CC73 2ML5A 3I0YA 1SIIA 3EN8A 3HK4A 1QJGA 1EQKA 1WMOA 5DREA 1Q864 5AEUB 2XGNA 4O2HA 2A15A 1OHPA 3TDGA 1CQSA 1IQYA 1JV2B 2XRXB 2WO0A 4FMAA 1G96A 3V99A 1CEWI 3CCE3 4JRFA 1K41A 4FMDA 3SX1A 3CD63 4N6V0 2C10A 4XBYA 2O3OA 3IMAB 4AEQA 3J7Yd 2OWPA 1OHOA 4OVMA 3GZYB 3CCU3 1BUQA 3S29A 1OCVA 1WMNA 3CCL3 3FG3A 3HX8A 1OACA 1E3RA 3FZWA 3KN4A 3OWUA 4MEIA 4R80A 4WP5A 2OOVC 3WOEB 1VQK3 4WWUC 2STDA 2C11A 3N8BA 3QK9A 4LGQA 4ZM8A 4EV5A 1PFPA 3X3ZA 4EYCA 1NB3I 1TFKA 3BB9A 1QAKA 1VQM3 3BNEA 4HM0B 2KRTA 2ZDJA 1LNHA 4MMYB 1VQP3 1O7PB 1O7NB 3OX9A 2CWVA 3S5CA 3DGMA 1TUHA 1JKGB 2JDIH 4LMIA 1O7WB 2BNGA 3CC23 1N9EA 1OF5A 3F8XA 1N9JA 3FG4A 2Z7AA 1W02A 3A76A 3NQYA 3I553 1Q40B 1OHSA 1VQ43 3GZXB 1EA2A 1DMNA 2GBWB 1ASKA 2PZVA 2F99A 2LQVA 1FGMA 1ROVA 4FCZA 2W03A 3LT9A 1E3VA 1OPYA 5IG3A 3KIIA 3OWYA 4X2HA 1YHQ3 2CFKA 4EXRA 2W56B 3CME3 3HZPA 3OXAA 1R4CA 1W4NA 3X42A 4HM8B 3DGOA 4ORLA 1S5AA 2RCDA 4IT7A 3LMLA 5CLKA 1OUNA 1LVNA 3SOAA 4FMCA 4KFEA 4N6LA 2P05A 6STDA 1O7HB 3LTCA 5IENA 5HGRA 2FXTA 2IMJA 4XM4A 4RBNA 2HMNB 2W9PA 1YGEA 4H61A 5JPUA 2GBXB 3PCSA 3EX9A 1Z1SA 1OGXA 2MC8A 3VF1A 2RFRA 3BNDA 1SJWA 1NU3A 1Q814 3K7CA 1FGQA 2GU1A 3KKGA 5CXOA 1N5PA 1VQO3 1ULIB 3WA3A 1WQLB 1RN7A 2IA7A 3JUMA 4J8TA 2WOHA 4HM5B 3DUKA 5AIFA 5A0OB 3KE7A 1VQ83 3JUOA 4HM2B 5ELJA 3QRDA 3BLZA 4EBGA 5D83A 4NHFA 4K61A 3G4S3 3X3YA 3FG1A 4BTWA 2V1LA 4FCMA 2YFIB 3GWRA 4HM3B 4CDLA 2CH9A 3AMOB 4LSOA 1VQN3 3X3XA 3G16A 5TGNA 1JN5B 1UW1A 3EQQB 3PZWA 3KZTA 2YX9A 3T8UA 3CCS3 2Y74A 3UL6A 3Q2PA 3WDGB 1IQXA 2SBLA 4TX4A 5KP3A 3ROBA 1VQL3 3GZBA 1KQS2 1D6UA 3MG1A 4HZBB 1RRLA 1A2VA 1NO3A 4K1VA 3K5TA 5DRVA 1JJ22 3FGYA 3NBBA 3K9MC 4Q53A 2HMLB 1E97A 1W6GA 3EE1A 2W04A 1AVKA 4OK0A 4BTYA 1JRQA 1STFI 5LC7A 4G1MB 2QIYA 2OCTA 3LH4A 2CWUA 3PS8A 4WFOA 2XSOB 1NDOB 1FGOA 3GZRA 2E2TA 2RSXA 1KWIA 3Q1CA 3FF2A 3T0UA 2BT3A 3CNXA 3D9RA 3UNLA 3EJVA 2CKFB 3EBTA 4BTXA 1SPUA 1OGZA 3IJEB 3S28A 3MHEA 3K0ZA 4LEHA 4GB5A 3DGNA 2GXFA 5G2GA 5FW5A 1JKGA 4RNZA 3CU3A 1YIJ3 1F8NA 4N6OB 1TIJA 1RRHA 3F9SA 1Y4KA 3MG3A 3VSYA 3CCV3 2W2CA 3EC9A 5JBSA 1YJ93 3LYGA 4IIAA 1ISKA 1K28A 3FCSB 1IQ8A 5FGOA 5IF6A 3CPOA 3DGLA 3JUNA 4RNYA 1FGRA 2CIUA 5AIIA 5KP4A 3D3LA 3NHXA 3CCQ3 1QAFA 3KSED 3PXMA 2MF7A 1EG9B 2BMQB 1IV9A 1GY5A 1JNQA 1WNHA 3SVAA 4N3VA 3SXXA 3G8ZA 2E2VA 3KSPA 1MNLA 1S723 1C7HA 1YI23 3DZLA 4GL6A 4KFFA 1VQ93 5IW9A 1GY6A 3FF0A 1M1K4 2HMOB 1DYUA 4R1KA 3MSOA 2P38A 4R9LA 4XDVA 3EB8A 3SEDA 3JVCA 4EC6A 1MOLA 1HKXA 3JUQA 4U13A 1TU5A 3NUVA 3UL5A 3X40A 1M1XB 1FA3A 3Q90A 3K63A 4AKZA 2GEXA 3FLJA 3F8HA 4WYKB 1W6CA 2YFLB 3NXJA 4IPBA 4RZMA 5AIHA 2OQEA 4MMXB 2Z6BA 3NQZA 4HYZA 4WHAA 1M9GA 2XSHB 3UB1A 5IEPA 2CFLA 4L8OA 3G0KA 5KP1A 1JB4A 2F98A 5AYRB 2OOVA 3GRDA 1Q824 2IUKA 3LTAA 5IEOA 1IU7A 2BMRB 1DVCA 3BNCA 4HKVB 2R4IA 4HZ9B 3HIIA 3S67A 4EV2A 3CC43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 3;  1VQ4 3;  1VQK 3;  3CCJ 3;  1Q86 4;  3G71 3;  3G6E 3;  1YJW 3;  1YHQ 3;  1KD1 4;  1Q7Y 4;  1YIJ 3;  1VQN 3;  3CME 3;  3CCR 3;  1M90 4;  1S72 3;  1KC8 4;  1Q81 4;  3CCE 3;  1YI2 3;  2OTJ 3;  1QVG 2;  2QEX 3;  3CCV 3;  1VQM 3;  1VQO 3;  1K9M 4;  1VQ9 3;  1QVF 2;  3OW2 2;  3CCS 3;  1M1K 4;  1YIT 3;  1VQ6 3;  3CD6 3;  2QA4 3;  1YJ9 3;  1K8A 4;  1W2B 2;  1VQL 3;  1VQP 3;  1Q82 4;  1KQS 2;  2OTL 3;  1N8R 4;  1VQ7 3;  3CCU 3;  1VQ8 3;  1K73 4;  3CCM 3;  3CC2 3;  1VQ5 3;  3CPW 2;  3CCL 3;  1NJI 4;  3CXC 2;  3CC7 3;  1JJ2 2;  3CMA 3;  1YJN 3;  3I55 3;  3CCQ 3;  3G4S 3;  3CC4 3; 
#chains in the Genus database with same CATH topology
 1BSB A;  1JBT A;  4R9K A;  3IPT A;  5I97 A;  3G71 3;  1T3B A;  1MWT A;  2M7O A;  4JF8 A;  2K54 A;  5EQL A;  4O8S A;  4HBR A;  1BGS A;  2D1W A;  5AI1 A;  1NB5 I;  5HOH A;  1V57 A;  3FSD A;  4FCJ A;  3MKI A;  3AMO A;  2CHC A;  3DMC A;  1LXE A;  3ALA A;  4QWT A;  1JN5 A;  1YVB I;  5D82 A;  2WGO A;  4HM4 B;  1FUW A;  4MJD A;  2CFG A;  3FH1 A;  5LC6 A;  2JQ5 A;  1K8A 4;  2PNC A;  1X1W A;  2CC3 A;  4HM1 B;  2QGU A;  1L5G B;  1HU9 A;  2AAE A;  3WOF B;  2OTL 3;  1W6Y A;  1O7G B;  1YNV X;  1RSN A;  1IT8 A;  2CX0 A;  1ZX2 A;  1J2B A;  1CH0 A;  1OF5 B;  3CPW 2;  2KAA A;  1NWW A;  4HJL B;  4K90 B;  3PCR A;  2H0I A;  5AIG A;  2XF3 A;  1IVU A;  1LOV A;  1RN1 A;  1IVW A;  3D5I A;  2CG1 A;  2CG0 A;  3HI7 A;  4I4K A;  1W5Z A;  2XGL A;  2KXG A;  1WMP A;  2BIR A;  2BMO B;  1IK3 A;  1KD1 4;  4MMZ B;  5AEW B;  1QAL A;  1Q7Y 4;  1FUS A;  3F14 A;  6RNT A;  5IG4 A;  1UUV B;  1AY7 A;  4XBT A;  1BRN L;  1DMM A;  1TP6 A;  1DVD A;  4N6U A;  3ECF A;  1GY7 A;  3V98 A;  1HZ1 A;  1Q9E A;  1N8R 4;  1SAR A;  4X2O A;  1JBS A;  3LTD A;  5BIR A;  1K73 4;  3B8L A;  3OV4 A;  1IDP A;  1FGT A;  2WGQ A;  3SLU A;  3CXC 2;  1N5H A;  3EF8 A;  3NM2 A;  4XB5 A;  3MWZ A;  5IG5 A;  1YJN 3;  1UCJ A;  1BUJ A;  4WYK A;  4EW5 A;  3UJM A;  2BO9 B;  3RGA A;  3PYJ A;  3LTB A;  2Q07 A;  4I5Q A;  1VQQ A;  1C54 A;  1BSE A;  3B4P A;  3DY5 A;  3NM7 A;  5CF1 A;  3B7C A;  4HM7 B;  5M1A A;  3EHC A;  2OQE C;  3Q3F A;  3LZA A;  4BL3 A;  1DMQ A;  3B4O A;  3LXU X;  1BIR A;  2CFW A;  2K0M A;  1QVG 2;  3KCH A;  1CYV A;  3NX0 A;  1VQ6 3;  5STD A;  1RGE A;  1BU4 A;  1UCK A;  2CWT A;  3D4A A;  4BU4 A;  4KZ1 A;  1VQ7 3;  3WOD G;  1W7C A;  1I70 A;  5CK6 A;  1A2K A;  2BHM A;  4KVH A;  1ROA A;  3CMA 3;  1FUT A;  2GSP A;  1B27 A;  1Q42 A;  2I9W A;  3WMD A;  2L4V A;  1BSD A;  4FMB A;  4N6M A;  1W00 A;  4AKY A;  1W01 A;  2E2U A;  2FNQ A;  3ZFZ A;  3STD A;  3DM8 A;  1GOY A;  3DH2 A;  3AGO A;  4K1U A;  7RNT A;  1M90 4;  2Z77 A;  3BNB A;  4FR9 A;  2ML6 A;  2OTJ 3;  4CJN A;  1STD A;  4O02 B;  3OW2 2;  3EN1 B;  2AAD A;  3F40 A;  2YFJ B;  1GD4 A;  1ZO2 A;  4DKI A;  4HM6 B;  4LYL B;  3GAX A;  1EUI C;  1JB2 A;  1EKM A;  1KSI A;  2KF5 A;  3NV0 B;  1LNI A;  1JB5 A;  2B24 B;  2KCD A;  2HMM B;  1W2Z A;  2UX0 A;  3MYT A;  3N54 B;  3T8N A;  1T5Y A;  3S27 A;  1GYB A;  3DXO A;  3I56 3;  3SOY A;  2Y73 A;  5ELU A;  8RNT A;  2WOF A;  2XFT A;  5JPP A;  4L7K A;  1UI8 A;  2INX A;  5BVB A;  3O8Y A;  3RDE A;  3BIR A;  1X1Y A;  3E99 A;  2ZL8 A;  1V74 A;  2B1X B;  2CK3 H;  2GU3 A;  3X41 A;  3PGB A;  5BXQ A;  3VGN A;  3JUP A;  1KC8 4;  2XR8 B;  3BU4 A;  4KT3 B;  3NV0 A;  4HVN A;  3EBY A;  4PEJ A;  2HMJ B;  3V92 A;  5RNT A;  1JZD A;  3LOY A;  1BNR A;  3AHW A;  1IT7 A;  1UI7 A;  2IYJ A;  5CF2 A;  4XBX A;  3NBJ A;  3MG2 A;  4O3V A;  1RKY A;  3FKA A;  1O7M B;  1UGI A;  4XDW A;  1OH0 A;  1MWR A;  3CCM 3;  3M8C A;  1AV4 A;  2D42 A;  3LT8 A;  1RGG A;  2O9U X;  4LZI A;  1RNB A;  2CW9 A;  1QMA A;  2W56 A;  3MPH A;  2W0Q A;  3F7X A;  1IV7 A;  2F86 B;  2CX1 A;  2R41 A;  4GHO A;  1I8V A;  2P0M A;  2XH9 A;  1B2S A;  3G6E 3;  3ER7 A;  4R4K A;  1B2X A;  3GSP A;  4HAA A;  1AR0 A;  1TFO A;  2FGT A;  2LYX A;  3HOH A;  1Q40 A;  3N9H A;  1IVV A;  1T2H A;  2QEX 3;  1UUW B;  1K9M 4;  2CFD A;  1ULJ B;  4J9A A;  5IG0 A;  1GS3 A;  1VZZ A;  2P09 A;  1YIT 3;  2F56 A;  4ILF A;  1FW7 A;  1I3I A;  1RGK A;  1GSP A;  1SQW A;  2GEY A;  1D6Y A;  4L8P A;  1NNV A;  4OUQ A;  3H3H A;  1GOU A;  1RHL A;  3OWS A;  3WHO A;  1BRH A;  3U1W A;  3NBR A;  1NJI 4;  3WA2 X;  1U5O A;  1UCL A;  5D81 A;  2IUJ A;  2HMK B;  8CHO A;  3ZG0 A;  4KFD A;  1LOX A;  5EVH A;  1GMQ A;  4HOH A;  5EEO A;  1D6Z A;  1JZO A;  3HIG A;  3U97 A;  3CCJ 3;  2XEP A;  3KFQ C;  1GD3 A;  1A90 A;  4N6N B;  1CYU A;  2RGQ A;  1YJW 3;  4N6T A;  3L0R A;  1A67 A;  2W6J H;  3H51 A;  5IER A;  1RJO A;  3CCR 3;  2P0X A;  1YVS A;  2W9Q A;  1PU4 A;  3RGR A;  3SYU A;  3AHS A;  1QVF 2;  1N8Q A;  2Z76 A;  4CCV A;  4H3U A;  1U8C B;  7STD A;  2QA4 3;  1W2B 2;  3F7S A;  4NRE A;  1AVL A;  2F5W A;  1BRI A;  1US1 A;  5AYS C;  3S67 A;  2XFS A;  1I2E A;  3A5E A;  4STD A;  1SIH A;  3CNM A;  1RLS A;  1IVX A;  1WTH A;  1VQ5 3;  3CC7 3;  2ML5 A;  2UGI A;  1RGF A;  3I0Y A;  1SII A;  3EN8 A;  3HK4 A;  1QJG A;  1EQK A;  2H0G A;  1WMO A;  5DRE A;  1Q86 4;  1IYY A;  5AEU B;  2XGN A;  4O2H A;  2A15 A;  1OHP A;  3TDG A;  1CQS A;  1IQY A;  1JV2 B;  1MWU A;  1B20 A;  2F4Y A;  2XRX B;  2SAR A;  2WO0 A;  4FMA A;  1G96 A;  3V99 A;  1CEW I;  3CCE 3;  1GMP A;  4JRF A;  1K41 A;  4FMD A;  1RNT A;  3SX1 A;  3DGY A;  3CD6 3;  4N6V 0;  2C10 A;  4XBY A;  2O3O A;  3IMA B;  4AEQ A;  3J7Y d;  2OWP A;  1OHO A;  1RTU A;  4OVM A;  1G02 A;  3GZY B;  3CCU 3;  1BUQ A;  1PYL A;  3S29 A;  1OCV A;  1WMN A;  1RMS A;  3CCL 3;  1BSC A;  3FG3 A;  3WR2 A;  7GSP A;  3HX8 A;  1OAC A;  1E3R A;  1V58 A;  3FZW A;  3KN4 A;  3OWU A;  4MEI A;  4R80 A;  4WP5 A;  1BRK A;  2OOV C;  5G1L A;  3WOE B;  4WWU C;  1VQK 3;  2L1S A;  2STD A;  2C11 A;  3N8B A;  3QK9 A;  4LGQ A;  4ZM8 A;  4EV5 A;  1PFP A;  3X3Z A;  3ZG5 A;  4EYC A;  1NB3 I;  1TFK A;  3D5G A;  3BB9 A;  1QAK A;  1UCI A;  1VQM 3;  1I0X A;  1BRG A;  3BNE A;  4HM0 B;  2KRT A;  2ZDJ A;  1LNH A;  4MMY B;  1VQP 3;  1O7P B;  1O7N B;  1LQG C;  1BSA A;  3OX9 A;  2CWV A;  1BNJ A;  3S5C A;  3DGM A;  4NPB A;  1TUH A;  1JKG B;  2JDI H;  1LOW A;  2BNG A;  1O7W B;  1YGW A;  2KF3 A;  1N9E A;  4LMI A;  3CC2 3;  1LOY A;  1OF5 A;  3F8X A;  1X1U A;  1B2M A;  1N9J A;  4BL2 A;  3FG4 A;  2Z7A A;  1W02 A;  3A76 A;  3NQY A;  1MWS A;  3I55 3;  1Q40 B;  1OHS A;  1VQ4 3;  3GZX B;  1EA2 A;  1DMN A;  1RCK A;  1ASK A;  2GBW B;  2F99 A;  2LQV A;  1FGM A;  1ROV A;  2PZV A;  2W03 A;  3LT9 A;  1E3V A;  1OPY A;  4FCZ A;  5IG3 A;  3KII A;  3OWY A;  4X2H A;  1YHQ 3;  2CFK A;  1BNI A;  4EXR A;  2W56 B;  3CME 3;  3HZP A;  1LRA A;  3OXA A;  2BU4 A;  1R4C A;  1W4N A;  3X42 A;  4HM8 B;  2ZA4 A;  3DGO A;  4ORL A;  1S5A A;  2RCD A;  4IT7 A;  1R4Y A;  1PY3 A;  3LML A;  1I2G A;  5CLK A;  1OUN A;  5M19 A;  1LVN A;  1RDS A;  3SOA A;  4J5K A;  4FMC A;  4KFE A;  4N6L A;  2P05 A;  6STD A;  1O7H B;  3LTC A;  1LQM B;  5IEN A;  5HGR A;  2FXT A;  1HYF A;  2H0H A;  2IMJ A;  4XM4 A;  4RBN A;  2HMN B;  2W9P A;  1JBR A;  1B2U A;  1YGE A;  4J5G A;  4H61 A;  5JPU A;  2GBX B;  2ZHX B;  3PCS A;  3EX9 A;  1Z1S A;  1OGX A;  1ZGX A;  2MC8 A;  1RGL A;  3VF1 A;  2RFR A;  3BND A;  1SJW A;  1NU3 A;  1Q81 4;  3K7C A;  1FGQ A;  1UGH I;  2GU1 A;  3KKG A;  5CXO A;  1N5P A;  1VQO 3;  1ULI B;  3WA3 A;  1WQL B;  9RNT A;  1GMR A;  1RN7 A;  2IA7 A;  2KF6 A;  3JUM A;  4J8T A;  2WOH A;  5BU4 A;  4HM5 B;  1I2F A;  3DUK A;  5AIF A;  5A0O B;  3KE7 A;  1VQ8 3;  3JUO A;  4HM2 B;  5ELJ A;  3QRD A;  3BLZ A;  4EBG A;  1AQZ A;  5D83 A;  4NHF A;  4K61 A;  3G4S 3;  3X3Y A;  3FG1 A;  4BTW A;  2V1L A;  1RGH A;  4FCM A;  2YFI B;  3GWR A;  4HM3 B;  4CDL A;  2CH9 A;  3AMO B;  4LSO A;  1VQN 3;  3X3X A;  3G16 A;  5TGN A;  1JN5 B;  1UW1 A;  3EQQ B;  4RNT A;  3PZW A;  3KZT A;  2YX9 A;  3T8U A;  3CCS 3;  1FZU A;  2C4B A;  2Y74 A;  3Q2P A;  3UL6 A;  3WDG B;  1IQX A;  1BVI A;  2SBL A;  4TX4 A;  5KP3 A;  3ROB A;  1VQL 3;  3GZB A;  1KQS 2;  1BNS A;  2HOH A;  1D6U A;  1GOV A;  3MG1 A;  4HZB B;  1RRL A;  1A2V A;  1NO3 A;  4K1V A;  3K5T A;  5DRV A;  1JJ2 2;  3FGY A;  3NBB A;  1BAO A;  3K9M C;  1E97 A;  2HML B;  4Q53 A;  1X1X A;  1W6G A;  3EE1 A;  2W04 A;  1AVK A;  3AGN A;  4OK0 A;  4BTY A;  1T2I A;  1JRQ A;  1STF I;  5GSP A;  5LC7 A;  1TTO A;  4G1M B;  4CPK A;  2QIY A;  2OCT A;  3LH4 A;  2CWU A;  3PS8 A;  3URP A;  4WFO A;  2XSO B;  1NDO B;  1FGO A;  3GZR A;  2E2T A;  2RSX A;  1EEJ A;  1BRJ A;  1KWI A;  3D79 A;  3Q1C A;  3FF2 A;  3T0U A;  2BT3 A;  2IY2 A;  3CNX A;  3D9R A;  3UNL A;  3EJV A;  2CKF B;  3EBT A;  4BTX A;  1SPU A;  1OGZ A;  1I3F A;  3IJE B;  1BAN A;  1RGC A;  3S28 A;  1RGA A;  3MHE A;  3K0Z A;  4LEH A;  4GB5 A;  3DGN A;  6GSP A;  2GXF A;  5G2G A;  5FW5 A;  1JKG A;  1B2Z A;  4RNZ A;  3CU3 A;  1RN4 A;  5G1K A;  2RBI A;  1YIJ 3;  1F8N A;  1FYS A;  4N6O B;  1DE3 A;  1TIJ A;  1B3S A;  1RRH A;  3F9S A;  1Y4K A;  3MG3 A;  3VSY A;  4BIR A;  2W2C A;  3EC9 A;  1TJD A;  5JBS A;  3CCV 3;  2RNT A;  2F5M A;  1A2P A;  3LYG A;  4IIA A;  1YJ9 3;  1ISK A;  1K28 A;  3FCS B;  1ZS7 A;  1IQ8 A;  5FGO A;  5IF6 A;  3CPO A;  3DGL A;  1BRS A;  1BNE A;  3JUN A;  4RNY A;  1FGR A;  2CIU A;  5AII A;  5KP4 A;  1RCL A;  3D3L A;  3NHX A;  3CCQ 3;  1QAF A;  3KSE D;  3PXM A;  2MF7 A;  1TRQ A;  1EG9 B;  2BMQ B;  1IV9 A;  1GY5 A;  1JNQ A;  1WNH A;  3RNT A;  3SVA A;  4N3V A;  1I0V A;  3SXX A;  3G8Z A;  2E2V A;  3KSP A;  1MNL A;  1S72 3;  1C7H A;  1BNG A;  1YI2 3;  1BNF A;  3DZL A;  4GL6 A;  4KFF A;  2KF4 A;  1VQ9 3;  5IW9 A;  1GY6 A;  3FF0 A;  1Q7H A;  2J8X B;  1M1K 4;  2HMO B;  1BOX A;  1DYU A;  4R1K A;  3MSO A;  1B21 A;  2P38 A;  4R9L A;  4XDV A;  1MGR A;  3EB8 A;  3SED A;  3JVC A;  4EC6 A;  1MOL A;  1HKX A;  3JUQ A;  4U13 A;  1TU5 A;  1UDI I;  3NUV A;  3UL5 A;  3X40 A;  1M1X B;  1FA3 A;  3Q90 A;  3K63 A;  4AKZ A;  2GEX A;  3FLJ A;  3F8H A;  4WYK B;  1W6C A;  1TRP A;  2YFL B;  3NXJ A;  4IPB A;  4RZM A;  5AIH A;  4MMX B;  2OQE A;  2Z6B A;  3NQZ A;  4HYZ A;  4WHA A;  1M9G A;  5M18 A;  2UUG C;  2XSH B;  1G0T A;  3UB1 A;  1DET A;  5IEP A;  2CFL A;  4L8O A;  3G0K A;  5KP1 A;  1JB4 A;  4GSP A;  1MGW A;  2F98 A;  5AYR B;  2OOV A;  3GRD A;  2K3D A;  1Q82 4;  2IUK A;  3LTA A;  5IEO A;  1IU7 A;  2BMR B;  1DVC A;  3BNC A;  4HKV B;  2R4I A;  4HZ9 B;  3HII A;  1UUG B;  4EV2 A;  3CC4 3; 
#chains in the Genus database with same CATH homology
 4R9K A;  3IPT A;  5I97 A;  3G71 3;  2M7O A;  4JF8 A;  2K54 A;  5EQL A;  4O8S A;  4HBR A;  2D1W A;  5AI1 A;  1NB5 I;  3FSD A;  4FCJ A;  3MKI A;  3AMO A;  2CHC A;  3DMC A;  1LXE A;  3ALA A;  4QWT A;  1JN5 A;  1YVB I;  5D82 A;  2WGO A;  4HM4 B;  1FUW A;  4MJD A;  2CFG A;  3FH1 A;  5LC6 A;  2JQ5 A;  1K8A 4;  2PNC A;  2CC3 A;  4HM1 B;  2QGU A;  1L5G B;  1HU9 A;  3WOF B;  2OTL 3;  1W6Y A;  1O7G B;  1IT8 A;  1ZX2 A;  1J2B A;  1OF5 B;  3CPW 2;  1NWW A;  4HJL B;  4K90 B;  3PCR A;  5AIG A;  2XF3 A;  1IVU A;  1IVW A;  2CG1 A;  2CG0 A;  3HI7 A;  4I4K A;  1W5Z A;  2XGL A;  2KXG A;  1WMP A;  2BMO B;  1IK3 A;  1KD1 4;  4MMZ B;  5AEW B;  1QAL A;  1Q7Y 4;  3F14 A;  5IG4 A;  1UUV B;  4XBT A;  1DMM A;  1TP6 A;  1DVD A;  4N6U A;  3ECF A;  1GY7 A;  3V98 A;  1N8R 4;  4X2O A;  3LTD A;  1K73 4;  3B8L A;  3OV4 A;  1IDP A;  1FGT A;  2WGQ A;  3SLU A;  3CXC 2;  1N5H A;  3EF8 A;  3NM2 A;  4XB5 A;  3MWZ A;  5IG5 A;  1YJN 3;  4WYK A;  3UJM A;  2BO9 B;  3RGA A;  3PYJ A;  3LTB A;  2Q07 A;  3B4P A;  3DY5 A;  3NM7 A;  5CF1 A;  3B7C A;  4HM7 B;  3EHC A;  2OQE C;  3LZA A;  1DMQ A;  3B4O A;  3LXU X;  2CFW A;  2K0M A;  1QVG 2;  1CYV A;  3NX0 A;  1VQ6 3;  5STD A;  2CWT A;  4KZ1 A;  1VQ7 3;  3WOD G;  1W7C A;  5CK6 A;  1A2K A;  2BHM A;  4KVH A;  1ROA A;  3CMA 3;  1Q42 A;  2I9W A;  3WMD A;  2L4V A;  4N6M A;  4FMB A;  1W00 A;  4AKY A;  1W01 A;  2E2U A;  2FNQ A;  3STD A;  3DM8 A;  4K1U A;  1M90 4;  2Z77 A;  3BNB A;  4FR9 A;  2ML6 A;  2OTJ 3;  1STD A;  4O02 B;  3OW2 2;  3EN1 B;  3F40 A;  2YFJ B;  1GD4 A;  1ZO2 A;  4HM6 B;  3GAX A;  1KSI A;  1JB2 A;  1EKM A;  3NV0 B;  1JB5 A;  2B24 B;  2KCD A;  2HMM B;  1W2Z A;  2UX0 A;  3MYT A;  3N54 B;  3T8N A;  1T5Y A;  3S27 A;  1GYB A;  3DXO A;  3I56 3;  3SOY A;  2Y73 A;  5ELU A;  2WOF A;  2XFT A;  5JPP A;  4L7K A;  1UI8 A;  2INX A;  5BVB A;  3O8Y A;  3RDE A;  3E99 A;  2ZL8 A;  1V74 A;  2B1X B;  2CK3 H;  2GU3 A;  3X41 A;  3PGB A;  5BXQ A;  3VGN A;  3JUP A;  1KC8 4;  2XR8 B;  3NV0 A;  4HVN A;  3EBY A;  4PEJ A;  2HMJ B;  3V92 A;  3LOY A;  1IT7 A;  1UI7 A;  5CF2 A;  4XBX A;  3NBJ A;  3MG2 A;  4O3V A;  1RKY A;  3FKA A;  1O7M B;  4XDW A;  1OH0 A;  3CCM 3;  3M8C A;  1AV4 A;  2D42 A;  3LT8 A;  4LZI A;  2O9U X;  2CW9 A;  1QMA A;  2W56 A;  3MPH A;  2W0Q A;  3F7X A;  1IV7 A;  2F86 B;  2P0M A;  2XH9 A;  3G6E 3;  3ER7 A;  4R4K A;  1AR0 A;  1TFO A;  2FGT A;  2LYX A;  1Q40 A;  3N9H A;  1IVV A;  1K9M 4;  2QEX 3;  1UUW B;  2CFD A;  1ULJ B;  4J9A A;  5IG0 A;  1GS3 A;  1VZZ A;  2P09 A;  1YIT 3;  1SQW A;  2GEY A;  1D6Y A;  4L8P A;  4OUQ A;  3H3H A;  3OWS A;  3U1W A;  3NBR A;  1NJI 4;  3WA2 X;  1U5O A;  5D81 A;  2IUJ A;  2HMK B;  8CHO A;  4KFD A;  1LOX A;  5EVH A;  5EEO A;  1D6Z A;  3HIG A;  3U97 A;  3CCJ 3;  1A90 A;  2XEP A;  3KFQ C;  1GD3 A;  1CYU A;  4N6N B;  2RGQ A;  1YJW 3;  4N6T A;  3L0R A;  1A67 A;  2W6J H;  3H51 A;  5IER A;  1RJO A;  3CCR 3;  2P0X A;  2W9Q A;  1PU4 A;  3RGR A;  1QVF 2;  1N8Q A;  2Z76 A;  4CCV A;  4H3U A;  1U8C B;  7STD A;  2QA4 3;  1W2B 2;  3F7S A;  4NRE A;  1AVL A;  5AYS C;  1US1 A;  2XFS A;  4STD A;  1SIH A;  3CNM A;  1IVX A;  1WTH A;  1VQ5 3;  3CC7 3;  2ML5 A;  3I0Y A;  1SII A;  3EN8 A;  3HK4 A;  1QJG A;  1EQK A;  1WMO A;  5DRE A;  1Q86 4;  5AEU B;  2XGN A;  4O2H A;  2A15 A;  1OHP A;  3TDG A;  1CQS A;  1IQY A;  1JV2 B;  2XRX B;  2WO0 A;  4FMA A;  1G96 A;  3V99 A;  1CEW I;  3CCE 3;  4JRF A;  1K41 A;  4FMD A;  3SX1 A;  3CD6 3;  4N6V 0;  2C10 A;  4XBY A;  2O3O A;  3IMA B;  4AEQ A;  3J7Y d;  2OWP A;  1OHO A;  4OVM A;  3GZY B;  3CCU 3;  1BUQ A;  3S29 A;  1OCV A;  1WMN A;  3CCL 3;  3FG3 A;  3HX8 A;  1OAC A;  1E3R A;  3FZW A;  3KN4 A;  3OWU A;  4MEI A;  4R80 A;  4WP5 A;  2OOV C;  3WOE B;  1VQK 3;  4WWU C;  2STD A;  2C11 A;  3N8B A;  3QK9 A;  4LGQ A;  4ZM8 A;  4EV5 A;  1PFP A;  3X3Z A;  4EYC A;  1NB3 I;  1TFK A;  3BB9 A;  1QAK A;  1VQM 3;  3BNE A;  4HM0 B;  2KRT A;  2ZDJ A;  1LNH A;  4MMY B;  1VQP 3;  1O7P B;  1O7N B;  3OX9 A;  2CWV A;  3S5C A;  3DGM A;  1TUH A;  1JKG B;  2JDI H;  4LMI A;  1O7W B;  2BNG A;  3CC2 3;  1N9E A;  1OF5 A;  3F8X A;  1N9J A;  3FG4 A;  2Z7A A;  1W02 A;  3A76 A;  3NQY A;  3I55 3;  1Q40 B;  1OHS A;  1VQ4 3;  3GZX B;  1EA2 A;  1DMN A;  2GBW B;  1ASK A;  2PZV A;  2F99 A;  2LQV A;  1FGM A;  1ROV A;  4FCZ A;  2W03 A;  3LT9 A;  1E3V A;  1OPY A;  5IG3 A;  3KII A;  3OWY A;  4X2H A;  1YHQ 3;  2CFK A;  4EXR A;  2W56 B;  3CME 3;  3HZP A;  3OXA A;  1R4C A;  1W4N A;  3X42 A;  4HM8 B;  3DGO A;  4ORL A;  1S5A A;  2RCD A;  4IT7 A;  3LML A;  5CLK A;  1OUN A;  1LVN A;  3SOA A;  4FMC A;  4KFE A;  4N6L A;  2P05 A;  6STD A;  1O7H B;  3LTC A;  5IEN A;  5HGR A;  2FXT A;  2IMJ A;  4XM4 A;  4RBN A;  2HMN B;  2W9P A;  1YGE A;  4H61 A;  5JPU A;  2GBX B;  3PCS A;  3EX9 A;  1Z1S A;  1OGX A;  2MC8 A;  3VF1 A;  2RFR A;  3BND A;  1SJW A;  1NU3 A;  1Q81 4;  3K7C A;  1FGQ A;  2GU1 A;  3KKG A;  5CXO A;  1N5P A;  1VQO 3;  1ULI B;  3WA3 A;  1WQL B;  1RN7 A;  2IA7 A;  3JUM A;  4J8T A;  2WOH A;  4HM5 B;  3DUK A;  5AIF A;  5A0O B;  3KE7 A;  1VQ8 3;  3JUO A;  4HM2 B;  5ELJ A;  3QRD A;  3BLZ A;  4EBG A;  5D83 A;  4NHF A;  4K61 A;  3G4S 3;  3X3Y A;  3FG1 A;  4BTW A;  2V1L A;  4FCM A;  2YFI B;  3GWR A;  4HM3 B;  4CDL A;  2CH9 A;  3AMO B;  4LSO A;  1VQN 3;  3X3X A;  3G16 A;  5TGN A;  1JN5 B;  1UW1 A;  3EQQ B;  3PZW A;  3KZT A;  2YX9 A;  3T8U A;  3CCS 3;  2Y74 A;  3UL6 A;  3Q2P A;  3WDG B;  1IQX A;  2SBL A;  4TX4 A;  5KP3 A;  3ROB A;  1VQL 3;  3GZB A;  1KQS 2;  1D6U A;  3MG1 A;  4HZB B;  1RRL A;  1A2V A;  1NO3 A;  4K1V A;  3K5T A;  5DRV A;  1JJ2 2;  3FGY A;  3NBB A;  3K9M C;  4Q53 A;  2HML B;  1E97 A;  1W6G A;  3EE1 A;  2W04 A;  1AVK A;  4OK0 A;  4BTY A;  1JRQ A;  1STF I;  5LC7 A;  4G1M B;  2QIY A;  2OCT A;  3LH4 A;  2CWU A;  3PS8 A;  4WFO A;  2XSO B;  1NDO B;  1FGO A;  3GZR A;  2E2T A;  2RSX A;  1KWI A;  3Q1C A;  3FF2 A;  3T0U A;  2BT3 A;  3CNX A;  3D9R A;  3UNL A;  3EJV A;  2CKF B;  3EBT A;  4BTX A;  1SPU A;  1OGZ A;  3IJE B;  3S28 A;  3MHE A;  3K0Z A;  4LEH A;  4GB5 A;  3DGN A;  2GXF A;  5G2G A;  5FW5 A;  1JKG A;  4RNZ A;  3CU3 A;  1YIJ 3;  1F8N A;  4N6O B;  1TIJ A;  1RRH A;  3F9S A;  1Y4K A;  3MG3 A;  3VSY A;  3CCV 3;  2W2C A;  3EC9 A;  5JBS A;  1YJ9 3;  3LYG A;  4IIA A;  1ISK A;  1K28 A;  3FCS B;  1IQ8 A;  5FGO A;  5IF6 A;  3CPO A;  3DGL A;  3JUN A;  4RNY A;  1FGR A;  2CIU A;  5AII A;  5KP4 A;  3D3L A;  3NHX A;  3CCQ 3;  1QAF A;  3KSE D;  3PXM A;  2MF7 A;  1EG9 B;  2BMQ B;  1IV9 A;  1GY5 A;  1JNQ A;  1WNH A;  3SVA A;  4N3V A;  3SXX A;  3G8Z A;  2E2V A;  3KSP A;  1MNL A;  1S72 3;  1C7H A;  1YI2 3;  3DZL A;  4GL6 A;  4KFF A;  1VQ9 3;  5IW9 A;  1GY6 A;  3FF0 A;  1M1K 4;  2HMO B;  1DYU A;  4R1K A;  3MSO A;  2P38 A;  4R9L A;  4XDV A;  3EB8 A;  3SED A;  3JVC A;  4EC6 A;  1MOL A;  1HKX A;  3JUQ A;  4U13 A;  1TU5 A;  3NUV A;  3UL5 A;  3X40 A;  1M1X B;  1FA3 A;  3Q90 A;  3K63 A;  4AKZ A;  2GEX A;  3FLJ A;  3F8H A;  4WYK B;  1W6C A;  2YFL B;  3NXJ A;  4IPB A;  4RZM A;  5AIH A;  2OQE A;  4MMX B;  2Z6B A;  3NQZ A;  4HYZ A;  4WHA A;  1M9G A;  2XSH B;  3UB1 A;  5IEP A;  2CFL A;  4L8O A;  3G0K A;  5KP1 A;  1JB4 A;  2F98 A;  5AYR B;  2OOV A;  3GRD A;  1Q82 4;  2IUK A;  3LTA A;  5IEO A;  1IU7 A;  2BMR B;  1DVC A;  3BNC A;  4HKV B;  2R4I A;  4HZ9 B;  3HII A;  3S67 A;  4EV2 A;  3CC4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...