1YJN3

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yjn300
3G6E3 1M1K4 3CME3 3CCL3 1K734 1KD14 1QVF2 1VQ63 3G713 1VQ73 1Q814 2QEX3 1VQ83 3CCR3 2QA43 3OW22 1K9M4 1YJW3 1Q864 1N8R4 1JJ22 1KQS2 3CD63 1QVG2 1YJ93 3I563 3CCM3 1S723 1W2B2 3CMA3 1Q824 3CCV3 1VQK3 1YHQ3 1VQN3 3CC73 3I553 1YIJ3 1VQL3 2OTJ3 1VQO3 2OTL3 1YJN3 3CCU3 3CCQ3 1YI23 1YIT3 1KC84 3CXC2 3G4S3 1VQ53 3CPW2 3CCJ3 1Q7Y4 3CCE3 1VQP3 1VQM3 1NJI4 3CCS3 1VQ93 3CC23 1M904 1VQ43 1K8A4 3CC43
chains in the Genus database with same CATH superfamily
1NU3A 2FNQA 2YFIB 1CH0A 1T5YA 2XGLA 4X2OA 1PY3A 2UGIA 3X3YA 5AI1A 3G713 3JUNA 2QEX3 1TIJA 3H51A 4KZ1A 1VQM3 2HMJB 3MYTA 1U8CB 1BANA 1IDPA 4WHAA 1K28A 2CFKA 2L4VA 1BNEA 4N6OB 3NQYA 1UI8A 1Q7HA 1YGEA 1VQQA 1MGRA 3EB8A 3MG2A 5IG3A 1E3VA 3CNXA 3EC9A 5RNTA 2CKFB 2KF3A 2CH9A 4GSPA 4LZIA 5KP3A 1L5GB 1YIJ3 1VQN3 4EBGA 3DGNA 7GSPA 4XDVA 2JQ5A 2Y74A 4K61A 1YI23 2YX9A 6RNTA 1PU4A 3EBTA 4PEJA 1VQP3 1F8NA 2K54A 3F8XA 3K0ZA 1RNTA 3Q2PA 4KT3B 2F5WA 1QALA 1RN7A 1IV7A 3WHOA 4I4KA 3BNDA 3PGBA 1M1K4 3BIRA 1BRKA 1GOVA 1LQMB 1R4YA 1W6CA 4HM4B 4LSOA 5D81A 7RNTA 1AY7A 1X1YA 4BL2A 1B2ZA 4KFFA 2AAEA 3O8YA 1BOXA 1GY6A 2IYJA 3OW22 1RGGA 4LGQA 3ZFZA 2K0MA 1BNRA 1S723 3MG3A 3G8ZA 2YFJB 1I0XA 1LOVA 1DETA 1BNIA 1RCLA 2Q07A 4N6LA 4WP5A 1KWIA 8RNTA 3X40A 1I2FA 1UUGB 2ZA4A 3ZG0A 2P05A 4KVHA 2XGNA 1Q40A 2Z76A 1Q9EA 4HM2B 3D5GA 1KQS2 3UNLA 1W6YA 3NBRA 1AVKA 1JKGB 5D83A 3M8CA 4AKZA 1JKGA 1N9JA 3CC43 2R41A 2Z6BA 4R9LA 1CYVA 4N6MA 1TFOA 4O3VA 5G1KA 1BNFA 2F86B 1K9M4 4FCMA 1RKYA 1QMAA 2CHCA 1JB4A 1UI7A 5AEUB 1Q42A 4FMBA 3CCM3 1N9EA 3OXAA 1TTOA 1BNSA 4H3UA 5JBSA 2AADA 4O2HA 1OACA 1W4NA 3LT8A 4WFOA 2XFTA 7STDA 3WA2X 1SARA 1UCKA 1AQZA 2WGOA 3FGYA 1DYUA 5CK6A 1LRAA 3LT9A 2OQEC 2D42A 3BNEA 3MG1A 2IUJA 1BUJA 5FGOA 3UJMA 2CW9A 3GZRA 3J7Yd 3FG1A 3CC23 1IVWA 3LXUX 3PS8A 1BSAA 1X1XA 4IPBA 1K8A4 1LNHA 1TRPA 2PNCA 6GSPA 1KD14 1VQ63 4QWTA 1BRIA 1M9GA 4WYKA 3OWYA 1NDOB 1W02A 4K1UA 5M19A 2F5MA 4JF8A 1ROAA 1UW1A 4XB5A 1JJ22 1EA2A 4RBNA 1LXEA 2HMNB 3S67A 1QVG2 1FUTA 2W56B 2XR8B 1OGXA 3BNBA 4HYZA 2W56A 2CX0A 3CMA3 2ZHXB 2B1XB 2XEPA 5AYRB 3RDEA 4DKIA 1V57A 5LC6A 4BL3A 5AIGA 3I553 1VQL3 3NBJA 3SYUA 1IK3A 2Y73A 3KSPA 3U97A 5JPUA 2C10A 3B4PA 1FW7A 1ZS7A 1HYFA 2PZVA 3F40A 3WODG 1TU5A 1GOYA 2P09A 3WOEB 1UCJA 3B7CA 1TUHA 3EN8A 4J8TA 5CF1A 2SARA 1B2UA 3RGRA 2D1WA 3WA3A 1FUSA 2JDIH 2OQEA 2Z7AA 1WMOA 1GD4A 2E2TA 1HU9A 3EHCA 3RGAA 1A2VA 1X1WA 5KP4A 1MGWA 4N6V0 4R80A 1RN1A 2B24B 1B2SA 1MOLA 1M1XB 1X1UA 1BSDA 2XF3A 1BRHA 2CFGA 1G96A 4FMCA 1GS3A 4XBYA 3LZAA 1O7PB 5LC7A 4WWUC 1BSBA 3A5EA 3G0KA 1UDII 4HM3B 2OTL3 1N8QA 2CX1A 3D9RA 2OWPA 3G4S3 5BXQA 3NV0A 1D6ZA 4FR9A 8CHOA 4BTWA 1I2EA 2ML5A 4CPKA 4MEIA 5BU4A 3DH2A 1FA3A 3F14A 3DGYA 4CCVA 3URPA 4MMXB 2RFRA 3HIGA 2K3DA 2I9WA 2KF6A 1LOYA 1OCVA 5STDA 2BNGA 1I3IA 1AVLA 1NB5I 3HI7A 4TX4A 5BIRA 3FLJA 1GY5A 1AR0A 1D6YA 2H0IA 3V92A 2GU1A 2IA7A 3MKIA 1IQXA 1WTHA 3BU4A 1BRNL 3IMAB 4HAAA 1W00A 3A76A 4K1VA 2RGQA 3FSDA 4U13A 4IIAA 2W0QA 2BHMA 3GZXB 3OWUA 1W6GA 3AMOA 4HM6B 1JBTA 4OUQA 1UCLA 1QJGA 3FCSB 1RGAA 1NWWA 1RGKA 2STDA 4ORLA 4KFDA 3KSED 1NNVA 5ELJA 3T8NA 4XBXA 1B27A 1QVF2 1I0VA 1BVIA 3QRDA 5CXOA 1Q814 3BLZA 3FH1A 3GZYB 2CWTA 6STDA 2H0HA 4J5GA 1NO3A 4ILFA 4HVNA 1RTUA 2CK3H 1BU4A 3DMCA 1VZZA 1CQSA 3HOHA 1IYYA 4Q53A 1EUIC 3F7SA 1B2MA 1YVSA 1NB3I 1A2KA 1Q40B 2P0MA 2F99A 3JUQA 4HBRA 1UUWB 4HZBB 1BNJA 3ZG5A 5AEWB 1DMMA 2KF5A 1FGRA 2ZL8A 3DGLA 3GAXA 3KCHA 5I97A 1I8VA 4K90B 3UB1A 3JUMA 2O9UX 1Y4KA 3HK4A 3DM8A 4XDWA 3FF2A 2HOHA 1MWUA 1HZ1A 1D6UA 3D3LA 1MNLA 2UUGC 3KIIA 4EV5A 1IT7A 3D4AA 1I2GA 3EX9A 5IG4A 4FCJA 2KCDA 4R1KA 3DY5A 3Q1CA 4XBTA 3LOYA 3G16A 1I70A 4FCZA 1RHLA 1OH0A 3LTBA 4L8PA 3EQQB 2WOFA 2CIUA 3GSPA 5FW5A 1V74A 2IMJA 3FF0A 2O3OA 3EJVA 3KKGA 1TRQA 2A15A 4IT7A 2HMLB 2RCDA 3SXXA 1SJWA 1O7GB 3FZWA 1OUNA 3SOYA 5EEOA 1EKMA 3S5CA 1RJOA 3ECFA 4WYKB 2QA43 1IT8A 1RGFA 3D5IA 2LQVA 1BAOA 2BT3A 1Q864 1N8R4 1STDA 1FUWA 1K41A 2QIYA 3NXJA 1O7NB 1YJW3 3FG3A 4RNTA 3UL6A 1DE3A 1SQWA 1GMQA 4X2HA 1B3SA 1BIRA 1IVVA 3X42A 5M18A 1QAKA 3X3ZA 3CCU3 1QAFA 3CXC2 2GEYA 4ZM8A 4LEHA 3K7CA 4NPBA 1YGWA 3SVAA 1B20A 3VF1A 2XRXB 1OPYA 2CFWA 2CG1A 1GMPA 4CJNA 1SPUA 3K63A 1FGOA 1IVXA 2FXTA 1SIHA 1US1A 3K5TA 1OF5A 2F4YA 4STDA 1C7HA 3UL5A 4HM7B 5AYSC 3BNCA 1T3BA 3EF8A 4JRFA 2RNTA 1B2XA 4R9KA 1IQYA 1GOUA 1FYSA 1O7WB 2M7OA 3DGOA 4EW5A 1RSNA 1ULJB 1V58A 2WOHA 3PCRA 4GB5A 4OVMA 3KE7A 4MMZB 5DREA 3V98A 1VQ53 1STFI 1LOWA 2XFSA 1WQLB 2HMOB 3NV0B 1PFPA 5IEOA 3B8LA 1RGEA 3N8BA 3T0UA 1N5PA 1UCIA 1JBRA 1RGLA 4EV2A 1DMQA 5IW9A 5M1AA 3H3HA 3CME3 1JB5A 1RGCA 3X41A 3JVCA 3MWZA 3PZWA 1GYBA 3ER7A 1ZO2A 3GWRA 2CFDA 1O7HB 3DZLA 1B21A 1RCKA 1YJ93 2ZDJA 1TFKA 1W2B2 3AGNA 4BTXA 2C4BA 1FZUA 4HZ9B 2W2CA 3CCV3 4EYCA 1S5AA 1YHQ3 4HM1B 1W7CA 5G1LA 1O7MB 5JPPA 1TJDA 5IERA 3QK9A 3S29A 1CEWI 2UX0A 3LMLA 4BTYA 3STDA 3N9HA 1OHPA 2CC3A 3AMOB 4J5KA 5IG0A 3WR2A 1M904 1ZX2A 5CF2A 5GSPA 1MWTA 3B4OA 4MJDA 3DXOA 1T2HA 3DGMA 3EBYA 4HKVB 5IF6A 1TP6A 4R4KA 1LVNA 3NBBA 3GZBA 2C11A 1RMSA 1RNBA 5CLKA 3NHXA 1BNGA 1JN5B 1KSIA 2P38A 1JN5A 2KAAA 3DUKA 3LTAA 4O8SA 2KF4A 5KP1A 3CCS3 5AIHA 1R4CA 3BB9A 3I563 3N54B 1IU7A 3KZTA 1RGHA 1BSEA 5DRVA 4FMDA 3OX9A 3X3XA 2CG0A 4L7KA 2GU3A 1MWRA 3FKAA 2BMRB 3JUOA 5AIIA 1A2PA 1G0TA 1YIT3 5EVHA 1RDSA 1DMNA 1SIIA 2W04A 5IG5A 3CCE3 3AHWA 3HX8A 1WMNA 1DVCA 2L1SA 3NX0A 3AGOA 1A67A 3VGNA 4O02B 1ZGXA 2E2VA 3MHEA 2F98A 5G2GA 3PYJA 3SEDA 3TDGA 4LYLB 3L0RA 3LH4A 4L8OA 3OWSA 3KN4A 1RN4A 1WNHA 2V1LA 1GY7A 2KRTA 3ALAA 3V99A 4BU4A 3KFQC 2IUKA 2MF7A 2GEXA 3S28A 1IVUA 4HOHA 3CCR3 4EXRA 2BMQB 2GXFA 1BRJA 2H0GA 2LYXA 2RSXA 1FGTA 3K9MC 3HZPA 3WDGB 3PCSA 3HIIA 3ROBA 4NREA 2BIRA 3NQZA 1ROVA 2BU4A 3PXMA 4AEQA 1UGIA 3WOFB 4HM8B 1KC84 1BSCA 4GL6A 3NM2A 4EC6A 3CCJ3 1I3FA 1NJI4 1VQ93 1LOXA 3F8HA 3NUVA 4RNZA 3CNMA 3Q90A 1VQ43 2OOVC 2SBLA 3LTCA 3T8UA 1J2BA 1JRQA 3F7XA 1IQ8A 4RZMA 3RNTA 1C54A 1VQ73 1VQ83 1HKXA 3I0YA 1JB2A 3JUPA 3E99A 1Q824 4N6NB 2Z77A 2J8XB 2HMKB 2OTJ3 1VQO3 2BO9B 1RRLA 1YJN3 1JBSA 1OHOA 2W9PA 1GMRA 4LMIA 3CPW2 3IPTA 1PYLA 2BMOB 2KXGA 4G1MB 3CU3A 1E97A 3MSOA 2RBIA 5HOHA 1BRSA 1OHSA 1N5HA 3G6E3 4RNYA 1JZOA 2XH9A 5ELUA 2F56A 1U5OA 3CCL3 1K734 5D82A 2OCTA 1W01A 1OF5B 4J9AA 3AHSA 2GBXB 3NM7A 1IV9A 3FG4A 1OGZA 4N6TA 4AKYA 3F9SA 1T2IA 1GSPA 5TGNA 1ASKA 2OOVA 3U1WA 2WGQA 1FGMA 4MMYB 5A0OB 1BRGA 2W9QA 2CFLA 3EE1A 3CC73 1CYUA 3LTDA 1W5ZA 1JV2B 1UUVB 1JNQA 4BIRA 4H61A 5AIFA 1ISKA 1Q7Y4 4XM4A 1EQKA 1LNIA 4NHFA 1EEJA 1Z1SA 4N6UA 3OV4A 1YVBI 5EQLA 1MWSA 5HGRA 3S27A 4CDLA 2FGTA 2GSPA 2W03A 2YFLB 1E3RA 1G02A 3SOAA 1GD3A 3MPHA 2IY2A 4GHOA 2E2UA 1ULIB 3CPOA 3EN1B 4HJLB 4OK0A 4I5QA 2INXA 3IJEB 2CWVA 4FMAA 4N3VA 3SX1A 5IEPA 1YNVX 1W2ZA 3CD63 3SLUA 2XSHB 1JZDA 2WO0A 3LYGA 3Q3FA 1BUQA 1RLSA 1BGSA 4HM5B 2HMMB 3GRDA 2R4IA 2CWUA 5IENA 1VQK3 4HM0B 3D79A 1AV4A 1WMPA 2XSOB 2W6JH 3VSYA 3CCQ3 1EG9B 9RNTA 1DVDA 2ML6A 1RRHA 5BVBA 2MC8A 1FGQA 1LQGC 1UGHI 2P0XA 2QGUA 4KFEA 2GBWB 1A90A 3WMDA
chains in the Genus database with same CATH topology
1NU3A 2FNQA 2YFIB 1T5YA 2XGLA 4X2OA 3X3YA 5AI1A 3G713 3JUNA 2QEX3 1TIJA 3H51A 4KZ1A 2HMJB 3MYTA 1U8CB 1IDPA 4WHAA 1K28A 2CFKA 2L4VA 4N6OB 3NQYA 1UI8A 1YGEA 3EB8A 3MG2A 5IG3A 1E3VA 3CNXA 3EC9A 2CKFB 5KP3A 2CH9A 1L5GB 4LZIA 1VQN3 1YIJ3 4EBGA 3DGNA 4XDVA 2JQ5A 2Y74A 4K61A 1YI23 2YX9A 1PU4A 3EBTA 4PEJA 1VQP3 1F8NA 2K54A 3F8XA 3K0ZA 3Q2PA 1QALA 1RN7A 1IV7A 4I4KA 3BNDA 3PGBA 1M1K4 1W6CA 4HM4B 4LSOA 5D81A 4KFFA 3O8YA 1GY6A 3OW22 4LGQA 2K0MA 1S723 3MG3A 3G8ZA 2YFJB 4N6LA 2Q07A 4WP5A 1KWIA 3X40A 2P05A 4KVHA 2XGNA 1Q40A 2Z76A 4HM2B 3UNLA 1W6YA 3NBRA 1AVKA 1JKGB 5D83A 3M8CA 4AKZA 1JKGA 1N9JA 3CC43 2Z6BA 4R9LA 1CYVA 4N6MA 1TFOA 4O3VA 2F86B 1K9M4 4FCMA 1RKYA 1QMAA 2CHCA 1JB4A 1UI7A 5AEUB 1Q42A 4FMBA 3CCM3 1N9EA 3OXAA 4H3UA 5JBSA 4O2HA 1OACA 1W4NA 3LT8A 4WFOA 2XFTA 7STDA 3WA2X 3FGYA 2WGOA 1DYUA 5CK6A 3LT9A 2OQEC 2D42A 3BNEA 3MG1A 2IUJA 5FGOA 3UJMA 2CW9A 3GZRA 3J7Yd 3FG1A 3CC23 1IVWA 3LXUX 3PS8A 4IPBA 1K8A4 1LNHA 2PNCA 1KD14 1VQ63 4QWTA 1M9GA 4WYKA 3OWYA 1NDOB 1W02A 4K1UA 4JF8A 1ROAA 1UW1A 4XB5A 1JJ22 1EA2A 4RBNA 1LXEA 2HMNB 3S67A 1QVG2 1KQS2 2W56B 2XR8B 1OGXA 3BNBA 4HYZA 2W56A 3CMA3 2B1XB 2XEPA 5AYRB 3RDEA 5LC6A 5AIGA 3I553 1VQL3 3NBJA 1IK3A 2Y73A 3KSPA 3U97A 5JPUA 2C10A 3B4PA 2PZVA 3F40A 3WODG 1TU5A 2P09A 3WOEB 3B7CA 1TUHA 3EN8A 4J8TA 5CF1A 3RGRA 2D1WA 3WA3A 2JDIH 2OQEA 2Z7AA 1WMOA 1GD4A 2E2TA 1HU9A 3EHCA 3RGAA 1A2VA 5KP4A 4N6V0 4R80A 2B24B 1MOLA 1M1XB 2XF3A 2CFGA 1G96A 4FMCA 1GS3A 4XBYA 3LZAA 1O7PB 5LC7A 4WWUC 3G0KA 4HM3B 2OTL3 1N8QA 3D9RA 2OWPA 3G4S3 5BXQA 3NV0A 1D6ZA 4FR9A 8CHOA 4BTWA 2ML5A 4MEIA 3F14A 4CCVA 4MMXB 2RFRA 3HIGA 2I9WA 1OCVA 5STDA 2BNGA 1AVLA 1NB5I 3HI7A 4TX4A 3FLJA 1GY5A 1AR0A 1D6YA 3V92A 2GU1A 2IA7A 3MKIA 1IQXA 1WTHA 3IMAB 1W00A 3A76A 4K1VA 2RGQA 3FSDA 4U13A 4IIAA 2W0QA 2BHMA 3GZXB 3OWUA 1W6GA 3AMOA 4HM6B 4OUQA 1QJGA 3FCSB 1NWWA 2STDA 4ORLA 4KFDA 3KSED 5ELJA 3T8NA 4XBXA 1QVF2 3QRDA 5CXOA 1Q814 3BLZA 3FH1A 3GZYB 2CWTA 6STDA 1NO3A 4HVNA 2CK3H 3DMCA 1VZZA 1CQSA 4Q53A 3F7SA 1NB3I 1A2KA 1Q40B 2P0MA 2F99A 3JUQA 4HBRA 1UUWB 4HZBB 5AEWB 3CCS3 1VQM3 1DMMA 2ZL8A 1FGRA 3DGLA 3GAXA 5I97A 4K90B 3UB1A 3JUMA 2O9UX 1Y4KA 3HK4A 3DM8A 4XDWA 3FF2A 1D6UA 3D3LA 1MNLA 3KIIA 4EV5A 1IT7A 3EX9A 5IG4A 4FCJA 2KCDA 4R1KA 3DY5A 3Q1CA 4XBTA 3LOYA 3G16A 4FCZA 4L8PA 1OH0A 3LTBA 3EQQB 2WOFA 2CIUA 5FW5A 1V74A 2IMJA 3FF0A 2O3OA 3EJVA 3KKGA 2A15A 4IT7A 2HMLB 2RCDA 3SXXA 1SJWA 1O7GB 3FZWA 1OUNA 3SOYA 5EEOA 1EKMA 3S5CA 1RJOA 3ECFA 4WYKB 2QA43 1IT8A 2LQVA 2BT3A 1Q864 1N8R4 1STDA 1FUWA 1K41A 2QIYA 3NXJA 1O7NB 3FG3A 3UL6A 1SQWA 4X2HA 1IVVA 3X42A 3CCU3 1QAKA 3X3ZA 1QAFA 3CXC2 2GEYA 4ZM8A 4LEHA 3K7CA 3SVAA 3VF1A 2XRXB 1OPYA 2CFWA 2CG1A 1SPUA 3K63A 1FGOA 1IVXA 2FXTA 1SIHA 1US1A 3K5TA 1OF5A 4STDA 1C7HA 3UL5A 4HM7B 5AYSC 3BNCA 3EF8A 4JRFA 4R9KA 1IQYA 1O7WB 2M7OA 3DGOA 1ULJB 2WOHA 3PCRA 4GB5A 4OVMA 3KE7A 4MMZB 5DREA 3V98A 1VQ53 1STFI 2XFSA 1FA3A 1WQLB 2HMOB 3NV0B 1PFPA 5IEOA 3B8LA 3N8BA 3T0UA 1N5PA 4EV2A 1DMQA 5IW9A 3H3HA 3CME3 1JB5A 3X41A 3JVCA 3MWZA 3PZWA 1GYBA 3ER7A 1ZO2A 3GWRA 2CFDA 1O7HB 3DZLA 1YJ93 2ZDJA 1TFKA 1W2B2 4BTXA 4HZ9B 2W2CA 3CCV3 4EYCA 1S5AA 1YHQ3 4HM1B 1W7CA 1O7MB 5JPPA 5IERA 3QK9A 3S29A 1CEWI 2UX0A 3LMLA 4BTYA 3STDA 3N9HA 1OHPA 2CC3A 3AMOB 5IG0A 1M904 1ZX2A 5CF2A 3B4OA 4MJDA 3DXOA 3DGMA 3EBYA 4HKVB 5IF6A 1TP6A 4R4KA 1LVNA 3NBBA 3GZBA 2C11A 5CLKA 3NHXA 1JN5B 1KSIA 2P38A 1JN5A 3DUKA 3LTAA 4O8SA 5KP1A 5AIHA 1R4CA 3BB9A 3I563 3N54B 1IU7A 3KZTA 5DRVA 4FMDA 3OX9A 3X3XA 2CG0A 4L7KA 2GU3A 3FKAA 2BMRB 3JUOA 5AIIA 1YIT3 5EVHA 1SIIA 1DMNA 2W04A 5IG5A 3CCE3 3HX8A 1WMNA 1DVCA 3NX0A 1A67A 3VGNA 4O02B 3MHEA 2E2VA 2F98A 5G2GA 3PYJA 3SEDA 3TDGA 3L0RA 3LH4A 4L8OA 3OWSA 3KN4A 1WNHA 2V1LA 1GY7A 2KRTA 3ALAA 3V99A 3KFQC 2IUKA 2MF7A 2GEXA 3S28A 1IVUA 3CCR3 4EXRA 2BMQB 2GXFA 2RSXA 2LYXA 1FGTA 3K9MC 3HZPA 3WDGB 3PCSA 3HIIA 3ROBA 4NREA 3NQZA 1ROVA 3PXMA 4AEQA 3WOFB 4HM8B 1KC84 4GL6A 4EC6A 3NM2A 3CCJ3 1NJI4 1VQ93 1LOXA 3F8HA 3NUVA 4RNZA 3CNMA 3Q90A 1VQ43 2OOVC 2SBLA 3LTCA 3T8UA 1J2BA 1JRQA 3F7XA 1IQ8A 4RZMA 1VQ73 1VQ83 1HKXA 3I0YA 1JB2A 3JUPA 3E99A 1Q824 4N6NB 2Z77A 2HMKB 2OTJ3 1VQO3 2BO9B 1RRLA 1YJN3 1OHOA 2W9PA 4LMIA 3CPW2 3IPTA 2BMOB 2KXGA 4G1MB 3CU3A 1E97A 3MSOA 1OHSA 1N5HA 3G6E3 4RNYA 2XH9A 5ELUA 1U5OA 3CCL3 1K734 5D82A 2OCTA 1W01A 1OF5B 4J9AA 2GBXB 3NM7A 1IV9A 3FG4A 1OGZA 4N6TA 4AKYA 3F9SA 5TGNA 2OOVA 1ASKA 3U1WA 2WGQA 1FGMA 4MMYB 5A0OB 2W9QA 2CFLA 3EE1A 3CC73 1CYUA 3LTDA 1W5ZA 1JV2B 1UUVB 1JNQA 4H61A 5AIFA 1ISKA 1Q7Y4 4XM4A 1EQKA 4NHFA 1Z1SA 4N6UA 3OV4A 1YVBI 5EQLA 5HGRA 3S27A 4CDLA 2FGTA 2W03A 2YFLB 1E3RA 3SOAA 1GD3A 3MPHA 4HJLB 2E2UA 1ULIB 3CPOA 3EN1B 4OK0A 5IEPA 1YJW3 2INXA 3IJEB 2CWVA 4FMAA 4N3VA 3SX1A 3CD63 1W2ZA 3SLUA 2XSHB 1BUQA 2WO0A 3LYGA 4HM5B 2HMMB 3GRDA 2R4IA 2CWUA 5IENA 1VQK3 4HM0B 1AV4A 1WMPA 2XSOB 2W6JH 3VSYA 3CCQ3 1EG9B 1DVDA 2ML6A 1RRHA 5BVBA 2MC8A 1FGQA 2P0XA 2QGUA 4KFEA 2GBWB 1A90A 3WMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E 3;  1M1K 4;  3CME 3;  3CCL 3;  1K73 4;  1KD1 4;  1QVF 2;  1VQ6 3;  3G71 3;  1VQ7 3;  1Q81 4;  2QEX 3;  1VQ8 3;  3CCR 3;  2QA4 3;  3OW2 2;  1K9M 4;  1YJW 3;  1Q86 4;  1N8R 4;  1JJ2 2;  1KQS 2;  3CD6 3;  1QVG 2;  1YJ9 3;  3I56 3;  3CCM 3;  1S72 3;  1W2B 2;  3CMA 3;  1Q82 4;  3CCV 3;  1VQK 3;  1YHQ 3;  1VQN 3;  3CC7 3;  3I55 3;  1YIJ 3;  1VQL 3;  2OTJ 3;  1VQO 3;  2OTL 3;  1YJN 3;  3CCU 3;  3CCQ 3;  1YI2 3;  1YIT 3;  1KC8 4;  3CXC 2;  3G4S 3;  1VQ5 3;  3CPW 2;  3CCJ 3;  1Q7Y 4;  3CCE 3;  1VQP 3;  1VQM 3;  1NJI 4;  3CCS 3;  1VQ9 3;  3CC2 3;  1M90 4;  1VQ4 3;  1K8A 4;  3CC4 3; 
#chains in the Genus database with same CATH topology
 1NU3 A;  2FNQ A;  2YFI B;  1CH0 A;  1T5Y A;  2XGL A;  4X2O A;  1PY3 A;  2UGI A;  3X3Y A;  5AI1 A;  3G71 3;  3JUN A;  2QEX 3;  1TIJ A;  3H51 A;  4KZ1 A;  1VQM 3;  2HMJ B;  3MYT A;  1U8C B;  1BAN A;  1IDP A;  4WHA A;  1K28 A;  2CFK A;  2L4V A;  1BNE A;  4N6O B;  3NQY A;  1UI8 A;  1Q7H A;  1YGE A;  1VQQ A;  1MGR A;  3EB8 A;  3MG2 A;  5IG3 A;  1E3V A;  3CNX A;  3EC9 A;  5RNT A;  2CKF B;  2KF3 A;  2CH9 A;  4GSP A;  4LZI A;  5KP3 A;  1L5G B;  1YIJ 3;  1VQN 3;  4EBG A;  3DGN A;  7GSP A;  4XDV A;  2JQ5 A;  2Y74 A;  4K61 A;  1YI2 3;  2YX9 A;  6RNT A;  1PU4 A;  3EBT A;  4PEJ A;  1VQP 3;  1F8N A;  2K54 A;  3F8X A;  3K0Z A;  1RNT A;  3Q2P A;  4KT3 B;  2F5W A;  1QAL A;  1RN7 A;  1IV7 A;  3WHO A;  4I4K A;  3BND A;  3PGB A;  1M1K 4;  3BIR A;  1BRK A;  1GOV A;  1LQM B;  1R4Y A;  1W6C A;  4HM4 B;  4LSO A;  5D81 A;  7RNT A;  1AY7 A;  1X1Y A;  4BL2 A;  1B2Z A;  4KFF A;  2AAE A;  3O8Y A;  1BOX A;  1GY6 A;  2IYJ A;  3OW2 2;  1RGG A;  4LGQ A;  3ZFZ A;  2K0M A;  1BNR A;  1S72 3;  3MG3 A;  3G8Z A;  2YFJ B;  1I0X A;  1LOV A;  1DET A;  1BNI A;  1RCL A;  2Q07 A;  4N6L A;  4WP5 A;  1KWI A;  8RNT A;  3X40 A;  1I2F A;  1UUG B;  2ZA4 A;  3ZG0 A;  2P05 A;  4KVH A;  2XGN A;  1Q40 A;  2Z76 A;  1Q9E A;  4HM2 B;  3D5G A;  1KQS 2;  3UNL A;  1W6Y A;  3NBR A;  1AVK A;  1JKG B;  5D83 A;  3M8C A;  4AKZ A;  1JKG A;  1N9J A;  3CC4 3;  2R41 A;  2Z6B A;  4R9L A;  1CYV A;  4N6M A;  1TFO A;  4O3V A;  5G1K A;  1BNF A;  2F86 B;  1K9M 4;  4FCM A;  1RKY A;  1QMA A;  2CHC A;  1JB4 A;  1UI7 A;  5AEU B;  1Q42 A;  4FMB A;  3CCM 3;  1N9E A;  3OXA A;  1TTO A;  1BNS A;  4H3U A;  5JBS A;  2AAD A;  4O2H A;  1OAC A;  1W4N A;  3LT8 A;  4WFO A;  2XFT A;  7STD A;  3WA2 X;  1SAR A;  1UCK A;  1AQZ A;  2WGO A;  3FGY A;  1DYU A;  5CK6 A;  1LRA A;  3LT9 A;  2OQE C;  2D42 A;  3BNE A;  3MG1 A;  2IUJ A;  1BUJ A;  5FGO A;  3UJM A;  2CW9 A;  3GZR A;  3J7Y d;  3FG1 A;  3CC2 3;  1IVW A;  3LXU X;  3PS8 A;  1BSA A;  1X1X A;  4IPB A;  1K8A 4;  1LNH A;  1TRP A;  2PNC A;  6GSP A;  1KD1 4;  1VQ6 3;  4QWT A;  1BRI A;  1M9G A;  4WYK A;  3OWY A;  1NDO B;  1W02 A;  4K1U A;  5M19 A;  2F5M A;  4JF8 A;  1ROA A;  1UW1 A;  4XB5 A;  1JJ2 2;  1EA2 A;  4RBN A;  1LXE A;  2HMN B;  3S67 A;  1QVG 2;  1FUT A;  2W56 B;  2XR8 B;  1OGX A;  3BNB A;  4HYZ A;  2W56 A;  2CX0 A;  3CMA 3;  2ZHX B;  2B1X B;  2XEP A;  5AYR B;  3RDE A;  4DKI A;  1V57 A;  5LC6 A;  4BL3 A;  5AIG A;  3I55 3;  1VQL 3;  3NBJ A;  3SYU A;  1IK3 A;  2Y73 A;  3KSP A;  3U97 A;  5JPU A;  2C10 A;  3B4P A;  1FW7 A;  1ZS7 A;  1HYF A;  2PZV A;  3F40 A;  3WOD G;  1TU5 A;  1GOY A;  2P09 A;  3WOE B;  1UCJ A;  3B7C A;  1TUH A;  3EN8 A;  4J8T A;  5CF1 A;  2SAR A;  1B2U A;  3RGR A;  2D1W A;  3WA3 A;  1FUS A;  2JDI H;  2OQE A;  2Z7A A;  1WMO A;  1GD4 A;  2E2T A;  1HU9 A;  3EHC A;  3RGA A;  1A2V A;  1X1W A;  5KP4 A;  1MGW A;  4N6V 0;  4R80 A;  1RN1 A;  2B24 B;  1B2S A;  1MOL A;  1M1X B;  1X1U A;  1BSD A;  2XF3 A;  1BRH A;  2CFG A;  1G96 A;  4FMC A;  1GS3 A;  4XBY A;  3LZA A;  1O7P B;  5LC7 A;  4WWU C;  1BSB A;  3A5E A;  3G0K A;  1UDI I;  4HM3 B;  2OTL 3;  1N8Q A;  2CX1 A;  3D9R A;  2OWP A;  3G4S 3;  5BXQ A;  3NV0 A;  1D6Z A;  4FR9 A;  8CHO A;  4BTW A;  1I2E A;  2ML5 A;  4CPK A;  4MEI A;  5BU4 A;  3DH2 A;  1FA3 A;  3F14 A;  3DGY A;  4CCV A;  3URP A;  4MMX B;  2RFR A;  3HIG A;  2K3D A;  2I9W A;  2KF6 A;  1LOY A;  1OCV A;  5STD A;  2BNG A;  1I3I A;  1AVL A;  1NB5 I;  3HI7 A;  4TX4 A;  5BIR A;  3FLJ A;  1GY5 A;  1AR0 A;  1D6Y A;  2H0I A;  3V92 A;  2GU1 A;  2IA7 A;  3MKI A;  1IQX A;  1WTH A;  3BU4 A;  1BRN L;  3IMA B;  4HAA A;  1W00 A;  3A76 A;  4K1V A;  2RGQ A;  3FSD A;  4U13 A;  4IIA A;  2W0Q A;  2BHM A;  3GZX B;  3OWU A;  1W6G A;  3AMO A;  4HM6 B;  1JBT A;  4OUQ A;  1UCL A;  1QJG A;  3FCS B;  1RGA A;  1NWW A;  1RGK A;  2STD A;  4ORL A;  4KFD A;  3KSE D;  1NNV A;  5ELJ A;  3T8N A;  4XBX A;  1B27 A;  1QVF 2;  1I0V A;  1BVI A;  3QRD A;  5CXO A;  1Q81 4;  3BLZ A;  3FH1 A;  3GZY B;  2CWT A;  6STD A;  2H0H A;  4J5G A;  1NO3 A;  4ILF A;  4HVN A;  1RTU A;  2CK3 H;  1BU4 A;  3DMC A;  1VZZ A;  1CQS A;  3HOH A;  1IYY A;  4Q53 A;  1EUI C;  3F7S A;  1B2M A;  1YVS A;  1NB3 I;  1A2K A;  1Q40 B;  2P0M A;  2F99 A;  3JUQ A;  4HBR A;  1UUW B;  4HZB B;  1BNJ A;  3ZG5 A;  5AEW B;  1DMM A;  2KF5 A;  1FGR A;  2ZL8 A;  3DGL A;  3GAX A;  3KCH A;  5I97 A;  1I8V A;  4K90 B;  3UB1 A;  3JUM A;  2O9U X;  1Y4K A;  3HK4 A;  3DM8 A;  4XDW A;  3FF2 A;  2HOH A;  1MWU A;  1HZ1 A;  1D6U A;  3D3L A;  1MNL A;  2UUG C;  3KII A;  4EV5 A;  1IT7 A;  3D4A A;  1I2G A;  3EX9 A;  5IG4 A;  4FCJ A;  2KCD A;  4R1K A;  3DY5 A;  3Q1C A;  4XBT A;  3LOY A;  3G16 A;  1I70 A;  4FCZ A;  1RHL A;  1OH0 A;  3LTB A;  4L8P A;  3EQQ B;  2WOF A;  2CIU A;  3GSP A;  5FW5 A;  1V74 A;  2IMJ A;  3FF0 A;  2O3O A;  3EJV A;  3KKG A;  1TRQ A;  2A15 A;  4IT7 A;  2HML B;  2RCD A;  3SXX A;  1SJW A;  1O7G B;  3FZW A;  1OUN A;  3SOY A;  5EEO A;  1EKM A;  3S5C A;  1RJO A;  3ECF A;  4WYK B;  2QA4 3;  1IT8 A;  1RGF A;  3D5I A;  2LQV A;  1BAO A;  2BT3 A;  1Q86 4;  1N8R 4;  1STD A;  1FUW A;  1K41 A;  2QIY A;  3NXJ A;  1O7N B;  1YJW 3;  3FG3 A;  4RNT A;  3UL6 A;  1DE3 A;  1SQW A;  1GMQ A;  4X2H A;  1B3S A;  1BIR A;  1IVV A;  3X42 A;  5M18 A;  1QAK A;  3X3Z A;  3CCU 3;  1QAF A;  3CXC 2;  2GEY A;  4ZM8 A;  4LEH A;  3K7C A;  4NPB A;  1YGW A;  3SVA A;  1B20 A;  3VF1 A;  2XRX B;  1OPY A;  2CFW A;  2CG1 A;  1GMP A;  4CJN A;  1SPU A;  3K63 A;  1FGO A;  1IVX A;  2FXT A;  1SIH A;  1US1 A;  3K5T A;  1OF5 A;  2F4Y A;  4STD A;  1C7H A;  3UL5 A;  4HM7 B;  5AYS C;  3BNC A;  1T3B A;  3EF8 A;  4JRF A;  2RNT A;  1B2X A;  4R9K A;  1IQY A;  1GOU A;  1FYS A;  1O7W B;  2M7O A;  3DGO A;  4EW5 A;  1RSN A;  1ULJ B;  1V58 A;  2WOH A;  3PCR A;  4GB5 A;  4OVM A;  3KE7 A;  4MMZ B;  5DRE A;  3V98 A;  1VQ5 3;  1STF I;  1LOW A;  2XFS A;  1WQL B;  2HMO B;  3NV0 B;  1PFP A;  5IEO A;  3B8L A;  1RGE A;  3N8B A;  3T0U A;  1N5P A;  1UCI A;  1JBR A;  1RGL A;  4EV2 A;  1DMQ A;  5IW9 A;  5M1A A;  3H3H A;  3CME 3;  1JB5 A;  1RGC A;  3X41 A;  3JVC A;  3MWZ A;  3PZW A;  1GYB A;  3ER7 A;  1ZO2 A;  3GWR A;  2CFD A;  1O7H B;  3DZL A;  1B21 A;  1RCK A;  1YJ9 3;  2ZDJ A;  1TFK A;  1W2B 2;  3AGN A;  4BTX A;  2C4B A;  1FZU A;  4HZ9 B;  2W2C A;  3CCV 3;  4EYC A;  1S5A A;  1YHQ 3;  4HM1 B;  1W7C A;  5G1L A;  1O7M B;  5JPP A;  1TJD A;  5IER A;  3QK9 A;  3S29 A;  1CEW I;  2UX0 A;  3LML A;  4BTY A;  3STD A;  3N9H A;  1OHP A;  2CC3 A;  3AMO B;  4J5K A;  5IG0 A;  3WR2 A;  1M90 4;  1ZX2 A;  5CF2 A;  5GSP A;  1MWT A;  3B4O A;  4MJD A;  3DXO A;  1T2H A;  3DGM A;  3EBY A;  4HKV B;  5IF6 A;  1TP6 A;  4R4K A;  1LVN A;  3NBB A;  3GZB A;  2C11 A;  1RMS A;  1RNB A;  5CLK A;  3NHX A;  1BNG A;  1JN5 B;  1KSI A;  2P38 A;  1JN5 A;  2KAA A;  3DUK A;  3LTA A;  4O8S A;  2KF4 A;  5KP1 A;  3CCS 3;  5AIH A;  1R4C A;  3BB9 A;  3I56 3;  3N54 B;  1IU7 A;  3KZT A;  1RGH A;  1BSE A;  5DRV A;  4FMD A;  3OX9 A;  3X3X A;  2CG0 A;  4L7K A;  2GU3 A;  1MWR A;  3FKA A;  2BMR B;  3JUO A;  5AII A;  1A2P A;  1G0T A;  1YIT 3;  5EVH A;  1RDS A;  1DMN A;  1SII A;  2W04 A;  5IG5 A;  3CCE 3;  3AHW A;  3HX8 A;  1WMN A;  1DVC A;  2L1S A;  3NX0 A;  3AGO A;  1A67 A;  3VGN A;  4O02 B;  1ZGX A;  2E2V A;  3MHE A;  2F98 A;  5G2G A;  3PYJ A;  3SED A;  3TDG A;  4LYL B;  3L0R A;  3LH4 A;  4L8O A;  3OWS A;  3KN4 A;  1RN4 A;  1WNH A;  2V1L A;  1GY7 A;  2KRT A;  3ALA A;  3V99 A;  4BU4 A;  3KFQ C;  2IUK A;  2MF7 A;  2GEX A;  3S28 A;  1IVU A;  4HOH A;  3CCR 3;  4EXR A;  2BMQ B;  2GXF A;  1BRJ A;  2H0G A;  2LYX A;  2RSX A;  1FGT A;  3K9M C;  3HZP A;  3WDG B;  3PCS A;  3HII A;  3ROB A;  4NRE A;  2BIR A;  3NQZ A;  1ROV A;  2BU4 A;  3PXM A;  4AEQ A;  1UGI A;  3WOF B;  4HM8 B;  1KC8 4;  1BSC A;  4GL6 A;  3NM2 A;  4EC6 A;  3CCJ 3;  1I3F A;  1NJI 4;  1VQ9 3;  1LOX A;  3F8H A;  3NUV A;  4RNZ A;  3CNM A;  3Q90 A;  1VQ4 3;  2OOV C;  2SBL A;  3LTC A;  3T8U A;  1J2B A;  1JRQ A;  3F7X A;  1IQ8 A;  4RZM A;  3RNT A;  1C54 A;  1VQ7 3;  1VQ8 3;  1HKX A;  3I0Y A;  1JB2 A;  3JUP A;  3E99 A;  1Q82 4;  4N6N B;  2Z77 A;  2J8X B;  2HMK B;  2OTJ 3;  1VQO 3;  2BO9 B;  1RRL A;  1YJN 3;  1JBS A;  1OHO A;  2W9P A;  1GMR A;  4LMI A;  3CPW 2;  3IPT A;  1PYL A;  2BMO B;  2KXG A;  4G1M B;  3CU3 A;  1E97 A;  3MSO A;  2RBI A;  5HOH A;  1BRS A;  1OHS A;  1N5H A;  3G6E 3;  4RNY A;  1JZO A;  2XH9 A;  5ELU A;  2F56 A;  1U5O A;  3CCL 3;  1K73 4;  5D82 A;  2OCT A;  1W01 A;  1OF5 B;  4J9A A;  3AHS A;  2GBX B;  3NM7 A;  1IV9 A;  3FG4 A;  1OGZ A;  4N6T A;  4AKY A;  3F9S A;  1T2I A;  1GSP A;  5TGN A;  1ASK A;  2OOV A;  3U1W A;  2WGQ A;  1FGM A;  4MMY B;  5A0O B;  1BRG A;  2W9Q A;  2CFL A;  3EE1 A;  3CC7 3;  1CYU A;  3LTD A;  1W5Z A;  1JV2 B;  1UUV B;  1JNQ A;  4BIR A;  4H61 A;  5AIF A;  1ISK A;  1Q7Y 4;  4XM4 A;  1EQK A;  1LNI A;  4NHF A;  1EEJ A;  1Z1S A;  4N6U A;  3OV4 A;  1YVB I;  5EQL A;  1MWS A;  5HGR A;  3S27 A;  4CDL A;  2FGT A;  2GSP A;  2W03 A;  2YFL B;  1E3R A;  1G02 A;  3SOA A;  1GD3 A;  3MPH A;  2IY2 A;  4GHO A;  2E2U A;  1ULI B;  3CPO A;  3EN1 B;  4HJL B;  4OK0 A;  4I5Q A;  2INX A;  3IJE B;  2CWV A;  4FMA A;  4N3V A;  3SX1 A;  5IEP A;  1YNV X;  1W2Z A;  3CD6 3;  3SLU A;  2XSH B;  1JZD A;  2WO0 A;  3LYG A;  3Q3F A;  1BUQ A;  1RLS A;  1BGS A;  4HM5 B;  2HMM B;  3GRD A;  2R4I A;  2CWU A;  5IEN A;  1VQK 3;  4HM0 B;  3D79 A;  1AV4 A;  1WMP A;  2XSO B;  2W6J H;  3VSY A;  3CCQ 3;  1EG9 B;  9RNT A;  1DVD A;  2ML6 A;  1RRH A;  5BVB A;  2MC8 A;  1FGQ A;  1LQG C;  1UGH I;  2P0X A;  2QGU A;  4KFE A;  2GBW B;  1A90 A;  3WMD A; 
#chains in the Genus database with same CATH homology
 1NU3 A;  2FNQ A;  2YFI B;  1T5Y A;  2XGL A;  4X2O A;  3X3Y A;  5AI1 A;  3G71 3;  3JUN A;  2QEX 3;  1TIJ A;  3H51 A;  4KZ1 A;  2HMJ B;  3MYT A;  1U8C B;  1IDP A;  4WHA A;  1K28 A;  2CFK A;  2L4V A;  4N6O B;  3NQY A;  1UI8 A;  1YGE A;  3EB8 A;  3MG2 A;  5IG3 A;  1E3V A;  3CNX A;  3EC9 A;  2CKF B;  5KP3 A;  2CH9 A;  1L5G B;  4LZI A;  1VQN 3;  1YIJ 3;  4EBG A;  3DGN A;  4XDV A;  2JQ5 A;  2Y74 A;  4K61 A;  1YI2 3;  2YX9 A;  1PU4 A;  3EBT A;  4PEJ A;  1VQP 3;  1F8N A;  2K54 A;  3F8X A;  3K0Z A;  3Q2P A;  1QAL A;  1RN7 A;  1IV7 A;  4I4K A;  3BND A;  3PGB A;  1M1K 4;  1W6C A;  4HM4 B;  4LSO A;  5D81 A;  4KFF A;  3O8Y A;  1GY6 A;  3OW2 2;  4LGQ A;  2K0M A;  1S72 3;  3MG3 A;  3G8Z A;  2YFJ B;  4N6L A;  2Q07 A;  4WP5 A;  1KWI A;  3X40 A;  2P05 A;  4KVH A;  2XGN A;  1Q40 A;  2Z76 A;  4HM2 B;  3UNL A;  1W6Y A;  3NBR A;  1AVK A;  1JKG B;  5D83 A;  3M8C A;  4AKZ A;  1JKG A;  1N9J A;  3CC4 3;  2Z6B A;  4R9L A;  1CYV A;  4N6M A;  1TFO A;  4O3V A;  2F86 B;  1K9M 4;  4FCM A;  1RKY A;  1QMA A;  2CHC A;  1JB4 A;  1UI7 A;  5AEU B;  1Q42 A;  4FMB A;  3CCM 3;  1N9E A;  3OXA A;  4H3U A;  5JBS A;  4O2H A;  1OAC A;  1W4N A;  3LT8 A;  4WFO A;  2XFT A;  7STD A;  3WA2 X;  3FGY A;  2WGO A;  1DYU A;  5CK6 A;  3LT9 A;  2OQE C;  2D42 A;  3BNE A;  3MG1 A;  2IUJ A;  5FGO A;  3UJM A;  2CW9 A;  3GZR A;  3J7Y d;  3FG1 A;  3CC2 3;  1IVW A;  3LXU X;  3PS8 A;  4IPB A;  1K8A 4;  1LNH A;  2PNC A;  1KD1 4;  1VQ6 3;  4QWT A;  1M9G A;  4WYK A;  3OWY A;  1NDO B;  1W02 A;  4K1U A;  4JF8 A;  1ROA A;  1UW1 A;  4XB5 A;  1JJ2 2;  1EA2 A;  4RBN A;  1LXE A;  2HMN B;  3S67 A;  1QVG 2;  1KQS 2;  2W56 B;  2XR8 B;  1OGX A;  3BNB A;  4HYZ A;  2W56 A;  3CMA 3;  2B1X B;  2XEP A;  5AYR B;  3RDE A;  5LC6 A;  5AIG A;  3I55 3;  1VQL 3;  3NBJ A;  1IK3 A;  2Y73 A;  3KSP A;  3U97 A;  5JPU A;  2C10 A;  3B4P A;  2PZV A;  3F40 A;  3WOD G;  1TU5 A;  2P09 A;  3WOE B;  3B7C A;  1TUH A;  3EN8 A;  4J8T A;  5CF1 A;  3RGR A;  2D1W A;  3WA3 A;  2JDI H;  2OQE A;  2Z7A A;  1WMO A;  1GD4 A;  2E2T A;  1HU9 A;  3EHC A;  3RGA A;  1A2V A;  5KP4 A;  4N6V 0;  4R80 A;  2B24 B;  1MOL A;  1M1X B;  2XF3 A;  2CFG A;  1G96 A;  4FMC A;  1GS3 A;  4XBY A;  3LZA A;  1O7P B;  5LC7 A;  4WWU C;  3G0K A;  4HM3 B;  2OTL 3;  1N8Q A;  3D9R A;  2OWP A;  3G4S 3;  5BXQ A;  3NV0 A;  1D6Z A;  4FR9 A;  8CHO A;  4BTW A;  2ML5 A;  4MEI A;  3F14 A;  4CCV A;  4MMX B;  2RFR A;  3HIG A;  2I9W A;  1OCV A;  5STD A;  2BNG A;  1AVL A;  1NB5 I;  3HI7 A;  4TX4 A;  3FLJ A;  1GY5 A;  1AR0 A;  1D6Y A;  3V92 A;  2GU1 A;  2IA7 A;  3MKI A;  1IQX A;  1WTH A;  3IMA B;  1W00 A;  3A76 A;  4K1V A;  2RGQ A;  3FSD A;  4U13 A;  4IIA A;  2W0Q A;  2BHM A;  3GZX B;  3OWU A;  1W6G A;  3AMO A;  4HM6 B;  4OUQ A;  1QJG A;  3FCS B;  1NWW A;  2STD A;  4ORL A;  4KFD A;  3KSE D;  5ELJ A;  3T8N A;  4XBX A;  1QVF 2;  3QRD A;  5CXO A;  1Q81 4;  3BLZ A;  3FH1 A;  3GZY B;  2CWT A;  6STD A;  1NO3 A;  4HVN A;  2CK3 H;  3DMC A;  1VZZ A;  1CQS A;  4Q53 A;  3F7S A;  1NB3 I;  1A2K A;  1Q40 B;  2P0M A;  2F99 A;  3JUQ A;  4HBR A;  1UUW B;  4HZB B;  5AEW B;  3CCS 3;  1VQM 3;  1DMM A;  2ZL8 A;  1FGR A;  3DGL A;  3GAX A;  5I97 A;  4K90 B;  3UB1 A;  3JUM A;  2O9U X;  1Y4K A;  3HK4 A;  3DM8 A;  4XDW A;  3FF2 A;  1D6U A;  3D3L A;  1MNL A;  3KII A;  4EV5 A;  1IT7 A;  3EX9 A;  5IG4 A;  4FCJ A;  2KCD A;  4R1K A;  3DY5 A;  3Q1C A;  4XBT A;  3LOY A;  3G16 A;  4FCZ A;  4L8P A;  1OH0 A;  3LTB A;  3EQQ B;  2WOF A;  2CIU A;  5FW5 A;  1V74 A;  2IMJ A;  3FF0 A;  2O3O A;  3EJV A;  3KKG A;  2A15 A;  4IT7 A;  2HML B;  2RCD A;  3SXX A;  1SJW A;  1O7G B;  3FZW A;  1OUN A;  3SOY A;  5EEO A;  1EKM A;  3S5C A;  1RJO A;  3ECF A;  4WYK B;  2QA4 3;  1IT8 A;  2LQV A;  2BT3 A;  1Q86 4;  1N8R 4;  1STD A;  1FUW A;  1K41 A;  2QIY A;  3NXJ A;  1O7N B;  3FG3 A;  3UL6 A;  1SQW A;  4X2H A;  1IVV A;  3X42 A;  3CCU 3;  1QAK A;  3X3Z A;  1QAF A;  3CXC 2;  2GEY A;  4ZM8 A;  4LEH A;  3K7C A;  3SVA A;  3VF1 A;  2XRX B;  1OPY A;  2CFW A;  2CG1 A;  1SPU A;  3K63 A;  1FGO A;  1IVX A;  2FXT A;  1SIH A;  1US1 A;  3K5T A;  1OF5 A;  4STD A;  1C7H A;  3UL5 A;  4HM7 B;  5AYS C;  3BNC A;  3EF8 A;  4JRF A;  4R9K A;  1IQY A;  1O7W B;  2M7O A;  3DGO A;  1ULJ B;  2WOH A;  3PCR A;  4GB5 A;  4OVM A;  3KE7 A;  4MMZ B;  5DRE A;  3V98 A;  1VQ5 3;  1STF I;  2XFS A;  1FA3 A;  1WQL B;  2HMO B;  3NV0 B;  1PFP A;  5IEO A;  3B8L A;  3N8B A;  3T0U A;  1N5P A;  4EV2 A;  1DMQ A;  5IW9 A;  3H3H A;  3CME 3;  1JB5 A;  3X41 A;  3JVC A;  3MWZ A;  3PZW A;  1GYB A;  3ER7 A;  1ZO2 A;  3GWR A;  2CFD A;  1O7H B;  3DZL A;  1YJ9 3;  2ZDJ A;  1TFK A;  1W2B 2;  4BTX A;  4HZ9 B;  2W2C A;  3CCV 3;  4EYC A;  1S5A A;  1YHQ 3;  4HM1 B;  1W7C A;  1O7M B;  5JPP A;  5IER A;  3QK9 A;  3S29 A;  1CEW I;  2UX0 A;  3LML A;  4BTY A;  3STD A;  3N9H A;  1OHP A;  2CC3 A;  3AMO B;  5IG0 A;  1M90 4;  1ZX2 A;  5CF2 A;  3B4O A;  4MJD A;  3DXO A;  3DGM A;  3EBY A;  4HKV B;  5IF6 A;  1TP6 A;  4R4K A;  1LVN A;  3NBB A;  3GZB A;  2C11 A;  5CLK A;  3NHX A;  1JN5 B;  1KSI A;  2P38 A;  1JN5 A;  3DUK A;  3LTA A;  4O8S A;  5KP1 A;  5AIH A;  1R4C A;  3BB9 A;  3I56 3;  3N54 B;  1IU7 A;  3KZT A;  5DRV A;  4FMD A;  3OX9 A;  3X3X A;  2CG0 A;  4L7K A;  2GU3 A;  3FKA A;  2BMR B;  3JUO A;  5AII A;  1YIT 3;  5EVH A;  1SII A;  1DMN A;  2W04 A;  5IG5 A;  3CCE 3;  3HX8 A;  1WMN A;  1DVC A;  3NX0 A;  1A67 A;  3VGN A;  4O02 B;  3MHE A;  2E2V A;  2F98 A;  5G2G A;  3PYJ A;  3SED A;  3TDG A;  3L0R A;  3LH4 A;  4L8O A;  3OWS A;  3KN4 A;  1WNH A;  2V1L A;  1GY7 A;  2KRT A;  3ALA A;  3V99 A;  3KFQ C;  2IUK A;  2MF7 A;  2GEX A;  3S28 A;  1IVU A;  3CCR 3;  4EXR A;  2BMQ B;  2GXF A;  2RSX A;  2LYX A;  1FGT A;  3K9M C;  3HZP A;  3WDG B;  3PCS A;  3HII A;  3ROB A;  4NRE A;  3NQZ A;  1ROV A;  3PXM A;  4AEQ A;  3WOF B;  4HM8 B;  1KC8 4;  4GL6 A;  4EC6 A;  3NM2 A;  3CCJ 3;  1NJI 4;  1VQ9 3;  1LOX A;  3F8H A;  3NUV A;  4RNZ A;  3CNM A;  3Q90 A;  1VQ4 3;  2OOV C;  2SBL A;  3LTC A;  3T8U A;  1J2B A;  1JRQ A;  3F7X A;  1IQ8 A;  4RZM A;  1VQ7 3;  1VQ8 3;  1HKX A;  3I0Y A;  1JB2 A;  3JUP A;  3E99 A;  1Q82 4;  4N6N B;  2Z77 A;  2HMK B;  2OTJ 3;  1VQO 3;  2BO9 B;  1RRL A;  1YJN 3;  1OHO A;  2W9P A;  4LMI A;  3CPW 2;  3IPT A;  2BMO B;  2KXG A;  4G1M B;  3CU3 A;  1E97 A;  3MSO A;  1OHS A;  1N5H A;  3G6E 3;  4RNY A;  2XH9 A;  5ELU A;  1U5O A;  3CCL 3;  1K73 4;  5D82 A;  2OCT A;  1W01 A;  1OF5 B;  4J9A A;  2GBX B;  3NM7 A;  1IV9 A;  3FG4 A;  1OGZ A;  4N6T A;  4AKY A;  3F9S A;  5TGN A;  2OOV A;  1ASK A;  3U1W A;  2WGQ A;  1FGM A;  4MMY B;  5A0O B;  2W9Q A;  2CFL A;  3EE1 A;  3CC7 3;  1CYU A;  3LTD A;  1W5Z A;  1JV2 B;  1UUV B;  1JNQ A;  4H61 A;  5AIF A;  1ISK A;  1Q7Y 4;  4XM4 A;  1EQK A;  4NHF A;  1Z1S A;  4N6U A;  3OV4 A;  1YVB I;  5EQL A;  5HGR A;  3S27 A;  4CDL A;  2FGT A;  2W03 A;  2YFL B;  1E3R A;  3SOA A;  1GD3 A;  3MPH A;  4HJL B;  2E2U A;  1ULI B;  3CPO A;  3EN1 B;  4OK0 A;  5IEP A;  1YJW 3;  2INX A;  3IJE B;  2CWV A;  4FMA A;  4N3V A;  3SX1 A;  3CD6 3;  1W2Z A;  3SLU A;  2XSH B;  1BUQ A;  2WO0 A;  3LYG A;  4HM5 B;  2HMM B;  3GRD A;  2R4I A;  2CWU A;  5IEN A;  1VQK 3;  4HM0 B;  1AV4 A;  1WMP A;  2XSO B;  2W6J H;  3VSY A;  3CCQ 3;  1EG9 B;  1DVD A;  2ML6 A;  1RRH A;  5BVB A;  2MC8 A;  1FGQ A;  2P0X A;  2QGU A;  4KFE A;  2GBW B;  1A90 A;  3WMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...