5IENA

Structure of cdl2.2, a computationally designed vitamin-d3 binder
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
129
Chain Sequence
QSAKEAIEAALADFVKAYNSKDAAGVASKYMDDAAIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKLTTLDVQESGDFAFESGSISLKGPGKDSKLVDIAGKYVEVWRKGQDGGWKLYRTIANLDPAEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDL2.2
publication title Structure of CDL2.2, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 36
structure length 129
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ienA00
3GZXB 3B4PA 2RFRA 2JQ5A 1OHSA 4HKVB 4L7KA 3G8ZA 3GZBA 3DMCA 2IMJA 4H3UA 2W2CA 1O7GB 1OHOA 1O7NB 3FH1A 3Q90A 1DMMA 4GB5A 1WQLB 2GEXA 2HMOB 5HGRA 4X2OA 3OWYA 4Q53A 2YFLB 3H3HA 1NDOB 2BMQB 2UX0A 1A2KA 3MSOA 3ROBA 2BNGA 5DREA 4PEJA 4HZBB 3OXAA 2B1XB 5KP1A 2K54A 5D83A 1UUWB 3F14A 1QMAA 4RZMA 1K41A 2GBWB 1OCVA 1O7PB 3MG3A 1GS3A 3CPOA 3B4OA 3EBTA 4MJDA 5AIHA 4X2HA 3SOYA 3EC9A 2XR8B 5DRVA 5IERA 3MG2A 1TUHA 3F8XA 3T8UA 5IF6A 2BMOB 3HZPA 3SOAA 3NUVA 4WYKB 3WMDA 3LYGA 4WWUC 3E99A 3S5CA 3JUOA 3HX8A 3NBRA 4HM5B 3F8HA 1W01A 1ULIB 3KZTA 5CK6A 3MKIA 2STDA 3I0YA 1QJGA 3B8LA 3CNXA 1ULJB 3OWSA 4XDVA 4WP5A 2YFJB 4HM0B 3KE7A 3DUKA 4ORLA 4LEHA 1C7HA 3EN1B 3EBYA 1JB5A 4WYKA 2PZVA 3GZRA 1JN5B 2HMKB 4HM8B 5CF1A 4LMIA 4HVNA 4KVHA 4K1UA 3VGNA 3M8CA 3HK4A 1IDPA 8CHOA 5CF2A 3EF8A 3STDA 4HM6B 5IEPA 3F40A 1OF5B 1OPYA 1W02A 3G0KA 1ZX2A 5STDA 1JN5A 1S5AA 1E97A 3MHEA 4XM4A 1U5OA 1O7HB 4N3VA 4OVMA 2XSOB 3VSYA 5EVHA 2CHCA 4L8PA 1O7MB 3FGYA 1E3RA 5AEUB 1TP6A 4L8OA 3NXJA 5IEOA 1OF5A 4R1KA 3RGRA 5IG3A 5JPUA 2QIYA 1VZZA 3JUQA 4I4KA 3DM8A 3JUMA 4R9LA 1BUQA 1OUNA 3FKAA 2RCDA 4HJLB 4R9KA 3OX9A 2Z7AA 4XDWA 1JKGB 1AR0A 4HM4B 3EQQB 5D81A 3JUPA 1NU3A 4HM2B 3BB9A 5CLKA 3IPTA 4XB5A 5IG0A 1JB2A 2RGQA 2F86B 3F7XA 1W00A 5TGNA 1JKGA 2GXFA 1Z1SA 5AIIA 3MG1A 1ZO2A 4FCMA 2HMNB 4HM7B 5KP3A 2YFIB 1E3VA 1Q42A 3SEDA 5CXOA 2F98A 1W6YA 2QGUA 3KSPA 1ASKA 3CNMA 2GEYA 1EG9B 5D82A 2HMMB 5KP4A 5FW5A 5IENA 3K7CA 3K0ZA 3T8NA 1GY7A 4HM3B 4J8TA 3D9RA 1OH0A 5IG5A 1EA2A 5IG4A 3FLJA 3LZAA 1DMQA 4XBYA 3KKGA 5AIGA 4CDLA 5JPPA 1GY6A 1JB4A 2HMLB 3NHXA 3NV0B 3G16A 2Z76A 5G2GA 5AI1A 3FSDA 1Q40B 4XBTA 2INXA 2XRXB 4STDA 3DZLA 2I9WA 3EJVA 3H51A 3UJMA 1CQSA 3FZWA 3EHCA 3MYTA 6STDA 3RGAA 3EN8A 3ECFA 3NM2A 1OGZA 3NV0A 3CU3A 1OHPA 2HMJB 1DMNA 3EX9A 2CKFB 1Q40A 2OWPA 5AIFA 2F99A 3GZYB 4K1VA 4HM1B 4XBXA 1STDA 3B7CA 2GBXB 3OWUA 2R4IA 1GY5A 5BXQA 5BVBA 3JUNA 7STDA 1ISKA 1UUVB 3ER7A 3FF2A 3BLZA 1NWWA 3GWRA 4LGQA 4J9AA 4OUQA 3GRDA 3UNLA 2XSHB 1SJWA 2A15A 3A76A 5AEWB 2BMRB 4HZ9B 1HKXA 3DXOA 3F7SA 2Z77A 1O7WB 3F9SA 4FCJA 3FF0A 1GYBA 4IIAA 4U13A 2B24B 3OV4A 1OGXA
chains in the Genus database with same CATH superfamily
3GZXB 1BAOA 2OOVC 3B4PA 4LSOA 1BNIA 2F56A 1M1XB 4O02B 2RFRA 2P09A 3CPW2 1PFPA 1JZOA 8RNTA 2JQ5A 2XGLA 1OHSA 2D42A 5GSPA 4HKVB 3SX1A 1TRQA 4FMDA 4FCZA 2ML6A 1W6CA 1SQWA 4L7KA 2CG1A 1Q9EA 3KIIA 1BNGA 4N6OB 3G8ZA 3LTBA 3X3XA 1VQ73 3GZBA 4N6LA 3DMCA 2IMJA 4H3UA 1N8R4 2W2CA 1LNHA 1O7GB 1OHOA 1O7NB 2CX0A 3X40A 1RN7A 1M904 3FH1A 3Q90A 3V98A 1R4YA 1DMMA 1B3SA 1GOVA 4GB5A 1WQLB 4MMYB 2GEXA 2HMOB 1K734 5HGRA 4X2OA 3G6E3 1VQ63 2WGOA 3CMA3 3OWYA 4Q53A 1IT7A 1GMPA 2YFLB 1B2XA 1EEJA 1NDOB 2HOHA 3H3HA 1CEWI 1UCIA 2BMQB 5AYRB 1BRHA 2XFTA 2WOHA 2UX0A 4O2HA 4EC6A 1A2KA 3DGOA 3MSOA 1AY7A 2FXTA 1W7CA 2K3DA 4RNZA 1BRGA 3ROBA 2BNGA 4AKZA 1BNJA 1I0VA 2SARA 1WMNA 5DREA 4PEJA 4HZBB 1YJW3 1W2ZA 2W9QA 3OXAA 2B1XB 2E2VA 5EEOA 1Q7Y4 1IV7A 1SIHA 2K54A 4TX4A 5D83A 5KP1A 2Y74A 5EQLA 2WOFA 3D4AA 3ZFZA 1W5ZA 1UUWB 3F14A 3V92A 1QMAA 4RZMA 1K41A 2GBWB 1OCVA 1O7PB 3MG3A 1GS3A 1TFKA 3CPOA 4IT7A 2IUKA 1BRSA 1FGOA 1UGHI 3B4OA 3HIGA 3VF1A 4BL3A 3EBTA 2RBIA 2GSPA 3KSED 1YVBI 3N54B 4MJDA 5ELUA 1NB3I 5AIHA 1LQMB 5RNTA 2OTL3 3AHSA 1D6ZA 3X3YA 4X2HA 1N9EA 4J5KA 2W56B 3SOYA 1QVF2 3WOEB 3EC9A 1YHQ3 2WGQA 1RNTA 2XR8B 5DRVA 4MEIA 1GOUA 3CCV3 5IERA 2IUJA 1HU9A 3DH2A 2KXGA 3CXC2 3MG2A 1TUHA 3LOYA 3F8XA 3T8UA 5IF6A 1VQP3 1DYUA 2BMOB 5IW9A 4KZ1A 1J2BA 3HZPA 3S28A 3SOAA 4HBRA 5FGOA 1FYSA 3NUVA 4G1MB 4WYKB 1RHLA 1LNIA 3KFQC 3WMDA 1T3BA 3LYGA 1BRJA 1N5PA 3AGNA 1T2IA 1B2SA 4WWUC 1IVWA 1YIJ3 3E99A 3NBJA 1IYYA 3S5CA 3JUOA 1DE3A 1QALA 1W6GA 1IT8A 1A2VA 3HX8A 3NBRA 4HM5B 3F8HA 1W01A 5M1AA 2LYXA 1N8QA 1ULIB 2AAEA 2XGNA 1X1YA 2W0QA 2R41A 3KZTA 4N6MA 5CK6A 3MKIA 2STDA 7GSPA 1YGWA 2W56A 3Q2PA 1RNBA 1VQL3 2KF3A 2OTJ3 3I0YA 3EE1A 1QJGA 1B21A 3B8LA 5M19A 1BNRA 2IY2A 3CNXA 3LT9A 1ULJB 3UL6A 3OWSA 4XDVA 4WP5A 2CX1A 1IU7A 1V58A 1BSEA 4KT3B 1WTHA 2UGIA 3HIIA 3L0RA 2YFJB 3CCQ3 4HM0B 3KE7A 3DUKA 4ORLA 1PY3A 4LEHA 1C7HA 1I0XA 4KFEA 3EN1B 3WR2A 2M7OA 3BIRA 3EBYA 1JB5A 1RDSA 1VQ53 1RTUA 2PNCA 2PZVA 3D5IA 3GZRA 1QAFA 1LXEA 1JN5B 4WYKA 4BL2A 1Q814 1LOXA 2HMKB 4WFOA 3CC23 5LC6A 5AYSC 3PCRA 2BT3A 4HM8B 5CF1A 1W4NA 3U97A 1KC84 4LMIA 4RBNA 1GD4A 2F4YA 1K28A 3HOHA 1JJ22 1A90A 4HVNA 1NO3A 1RLSA 2C11A 2C10A 2L1SA 4K1UA 4KVHA 4HYZA 1MWRA 1GMRA 1IVXA 3VGNA 1GOYA 1BUJA 3M8CA 1RMSA 1B2UA 1YVSA 1V57A 1I2EA 4GL6A 3N8BA 3HK4A 4BTXA 1IDPA 5A0OB 3NM7A 2KF6A 2V1LA 8CHOA 5JBSA 5CF2A 1RKYA 1YIT3 2KF5A 2MF7A 3EF8A 3STDA 3T0UA 4HM6B 2W6JH 4K61A 3F40A 4BTYA 3BNEA 3D79A 4EV2A 5IEPA 1FUSA 1M1K4 1FW7A 1OF5B 1OPYA 1PYLA 2CFDA 2XF3A 1TIJA 1W02A 1DETA 3G0KA 1MWTA 1QAKA 3AGOA 3ALAA 3K5TA 3OW22 2H0HA 1UI8A 3PCSA 1Q824 1ZX2A 3DGYA 5STDA 1JN5A 1YJ93 1S5AA 2K0MA 1E97A 1BSAA 3MHEA 1I3IA 3LTAA 4XM4A 1GD3A 2OQEA 2C4BA 1U5OA 3CCJ3 1O7HB 4N3VA 4OVMA 2XSOB 3FCSB 3VSYA 2FNQA 1VQN3 1I2GA 5EVHA 1PU4A 1JBSA 2CHCA 4FMBA 1O7MB 4L8PA 4LZIA 3URPA 4EYCA 2O9UX 3FGYA 4R80A 1E3RA 3CCU3 2MC8A 2QA43 1N9JA 1JZDA 5AEUB 1K9M4 1FUTA 2BU4A 1TP6A 3WA3A 2WO0A 4L8OA 3NXJA 5M18A 3CCE3 1HYFA 1ROAA 5IEOA 5BU4A 1RN1A 3BNBA 3WODG 3X3ZA 1OF5A 4R1KA 3RGRA 1D6YA 3TDGA 5IG3A 5JPUA 2KCDA 3I553 1FGRA 1TTOA 3OV4A 4N6V0 3K9MC 2QIYA 3QRDA 1BSCA 4KFFA 3D5GA 1IVVA 1VZZA 3Q1CA 1B2MA 2XFSA 1LOYA 2CFKA 3JUQA 4I4KA 1YJN3 3DM8A 2CH9A 4GHOA 4KFDA 1LRAA 2BIRA 3JUMA 3MWZA 4R9LA 1BUQA 2YX9A 1OUNA 1U8CB 2D1WA 2RCDA 1ZGXA 3FKAA 4HJLB 4MMZB 4R9KA 3OX9A 2Z7AA 1A67A 2BO9B 4XDWA 1JKGB 1AR0A 3AHWA 2IYJA 4EXRA 4HM4B 4ILFA 3EQQB 1VQO3 5HOHA 2ZHXB 5D81A 4FMCA 3UL5A 1C54A 2JDIH 3DY5A 3JUPA 6GSPA 1NU3A 4HM2B 2P38A 1A2PA 4HAAA 1B27A 2P0XA 5IG5A 1IQYA 3D3LA 1IQXA 3BB9A 5CLKA 3MPHA 3IPTA 4XB5A 1CYVA 2CC3A 1RGLA 1RGHA 2OQEC 5IG0A 3NX0A 1M9GA 1JB2A 1BSDA 1UCLA 2RGQA 2F86B 1NNVA 1G96A 2L4VA 3LT8A 3S27A 3SXXA 3SVAA 4K90B 1IQ8A 1Q7HA 4EBGA 5BIRA 2P0MA 7RNTA 1UW1A 1RGKA 3WHOA 1IK3A 3JVCA 3F7XA 1ROVA 3O8YA 1BGSA 1RRHA 3U1WA 1NB5I 1VQ83 2P05A 1W00A 1UCJA 1B20A 1YGEA 5TGNA 1FGMA 1JKGA 2GXFA 1Z1SA 2E2TA 2O3OA 5AIIA 1UCKA 2BHMA 3LH4A 3MG1A 4N6TA 1EQKA 4FR9A 5ELJA 1ZO2A 2Q07A 1S723 3CD63 4FCMA 2HMNB 4HM7B 2AADA 5KP3A 2YFIB 1FGQA 1E3VA 1Q42A 3BU4A 3SEDA 1V74A 2H0GA 5CXOA 1T2HA 1SIIA 2F98A 1EUIC 1W6YA 1WMOA 2QGUA 1UGIA 2CWUA 3AMOB 2F5WA 3KSPA 1ASKA 4WHAA 1X1XA 2RNTA 3CC73 3CNMA 4JRFA 1I2FA 1RSNA 2GEYA 3LTDA 1EG9B 2ML5A 1N5HA 2XH9A 5D82A 4AKYA 1BU4A 2KF4A 3WDGB 2HMMB 4N6NB 5KP4A 1DVDA 5FW5A 1NJI4 1FUWA 1JNQA 2LQVA 1Y4KA 5IENA 1X1UA 2SBLA 3K0ZA 1UI7A 3K7CA 3T8NA 1YI23 3K63A 1TU5A 1GY7A 4HM3B 1CYUA 4J8TA 1G02A 4HOHA 3EB8A 1TJDA 1AQZA 3D9RA 4CJNA 1B2ZA 2GU1A 1UDII 1OH0A 1MOLA 1RGAA 1BANA 5G1LA 1RN4A 4DKIA 3RNTA 1BNFA 1FZUA 1WNHA 4RNYA 3HI7A 4J5GA 3DGLA 1EA2A 1BRNL 5IG4A 4QWTA 3FLJA 3LZAA 3LMLA 1DMQA 4XBYA 1D6UA 3KKGA 5AIGA 4CDLA 5JPPA 1FA3A 3N9HA 3CC43 1GY6A 1LOVA 1JB4A 1BNEA 2CIUA 2HMLB 3AMOA 4LYLB 3NHXA 3BNCA 2J8XB 3G16A 3NV0B 4AEQA 1WMPA 2Z76A 1QVG2 5G2GA 1RCLA 3PXMA 2RSXA 3CCM3 3X42A 5AI1A 3WOFB 3NBBA 1US1A 1I70A 1Q40B 3FSDA 2W04A 1RGEA 4XBTA 2INXA 2XRXB 3UB1A 3SYUA 2E2UA 4STDA 3GAXA 3DZLA 1BRKA 3WA2X 2I9WA 2CK3H 1K8A4 3EJVA 3H51A 3SLUA 3UJMA 3G4S3 1CQSA 1JBTA 9RNTA 1VQ43 1OACA 3FZWA 1G0TA 3EHCA 1TFOA 2GU3A 5I97A 3MYTA 6STDA 3I563 2CWTA 1BOXA 4RNTA 3RGAA 1MNLA 4CPKA 1BNSA 2CW9A 1AVKA 1HZ1A 4I5QA 3EN8A 3NQZA 2CFGA 1VQK3 1IV9A 3ECFA 1LQGC 2H0IA 1EKMA 1BVIA 3X41A 3PYJA 2QEX3 3NM2A 1Q864 1JBRA 4NHFA 1OGZA 4GSPA 3NV0A 3CCS3 2F5MA 1KSIA 3CU3A 1DVCA 1I3FA 2CFWA 1OHPA 2KAAA 1RGFA 2CFLA 1X1WA 2HMJB 1DMNA 3CCL3 1RGCA 3EX9A 1RJOA 2CKFB 1JV2B 4R4KA 4MMXB 1FGTA 1Q40A 1BSBA 2OWPA 2XEPA 2W03A 5AIFA 1VQ93 2F99A 3GZYB 1BIRA 3IJEB 4K1VA 1RRLA 4HM1B 4IPBA 4XBXA 1MWUA 1VQM3 2OOVA 1I8VA 1STDA 3B7CA 2GBXB 1BRIA 1SPUA 3OWUA 5LC7A 3J7Yd 4NREA 4NPBA 1MWSA 3DGMA 3ZG0A 1VQQA 3DGNA 4N6UA 2R4IA 1GY5A 1RCKA 3V99A 3JUNA 5BVBA 4H61A 5BXQA 7STDA 1ISKA 1UUVB 3S29A 1KD14 2W9PA 3ER7A 3FF2A 3FG4A 4BIRA 1MGWA 3NQYA 3RDEA 1IVUA 4O3VA 3BLZA 3S67A 3G713 1NWWA 3GWRA 1L5GB 2KRTA 4EV5A 3IMAB 1LVNA 4LGQA 2IA7A 4J9AA 4OK0A 4OUQA 1TRPA 2Y73A 2ZDJA 3BNDA 3GRDA 3PZWA 2CWVA 4JF8A 1MGRA 1SARA 3GSPA 2ZL8A 3UNLA 2XSHB 1GMQA 4FMAA 2UUGC 3QK9A 2ZA4A 4EW5A 1SJWA 2A15A 1AVLA 3A76A 3FG1A 1T5YA 3PGBA 3CCR3 5AEWB 2FGTA 2BMRB 4HZ9B 3CME3 2CG0A 3LXUX 1LOWA 3ZG5A 4BTWA 3FG3A 1KQS2 1F8NA 1UUGB 1HKXA 4BU4A 2OCTA 1STFI 5G1KA 3DXOA 1GSPA 3F7SA 2Z77A 4O8SA 1CH0A 1O7WB 3F9SA 1R4CA 3KN4A 1ZS7A 3LTCA 1KWIA 4CCVA 1YNVX 3KCHA 1JRQA 3PS8A 4FCJA 3FF0A 6RNTA 1W2B2 3Q3FA 1GYBA 4IIAA 4U13A 4ZM8A 2B24B 1AV4A 2Z6BA 1OGXA 3A5EA 1RGGA
chains in the Genus database with same CATH topology
3GZXB 2OOVC 3B4PA 4LSOA 1M1XB 4O02B 2RFRA 2P09A 3CPW2 1PFPA 2JQ5A 2XGLA 1OHSA 2D42A 4HKVB 3SX1A 4FMDA 4FCZA 2ML6A 1W6CA 1SQWA 4L7KA 2CG1A 3KIIA 4N6OB 3G8ZA 3LTBA 3X3XA 1VQ73 3GZBA 4N6LA 3DMCA 2IMJA 4H3UA 1N8R4 2W2CA 1LNHA 1O7GB 1OHOA 1O7NB 3X40A 1RN7A 1M904 3FH1A 3Q90A 3V98A 1DMMA 4GB5A 1WQLB 4MMYB 2GEXA 2HMOB 1K734 5HGRA 4X2OA 3G6E3 1VQ63 2WGOA 3CMA3 3OWYA 4Q53A 1IT7A 2YFLB 3H3HA 1NDOB 1CEWI 2BMQB 5AYRB 2XFTA 2WOHA 2UX0A 4O2HA 4EC6A 1A2KA 3DGOA 3MSOA 4RNZA 2FXTA 1W7CA 3ROBA 2BNGA 4AKZA 1WMNA 5DREA 4PEJA 4HZBB 1YJW3 1W2ZA 2W9QA 3OXAA 2B1XB 2E2VA 5EEOA 1Q7Y4 1IV7A 1SIHA 2K54A 4TX4A 5D83A 5KP1A 2Y74A 5EQLA 2WOFA 1W5ZA 1UUWB 3F14A 3V92A 1QMAA 4RZMA 1K41A 2GBWB 1OCVA 1O7PB 3MG3A 1GS3A 1TFKA 3CPOA 4IT7A 2IUKA 1FGOA 3HIGA 3B4OA 3VF1A 3EBTA 3KSED 1YVBI 3N54B 4MJDA 5ELUA 1NB3I 5AIHA 2OTL3 1D6ZA 3X3YA 4X2HA 1N9EA 3SOYA 2W56B 1QVF2 3WOEB 3EC9A 1YHQ3 2WGQA 2XR8B 5DRVA 4MEIA 3CCV3 5IERA 2IUJA 1HU9A 2KXGA 3CXC2 3MG2A 1TUHA 3LOYA 3F8XA 3T8UA 5IF6A 1VQP3 1DYUA 2BMOB 5IW9A 4KZ1A 1J2BA 3HZPA 3S28A 3SOAA 4HBRA 5FGOA 3NUVA 4G1MB 4WYKB 3KFQC 3WMDA 3LYGA 1N5PA 4WWUC 1IVWA 1YIJ3 3E99A 3NBJA 3S5CA 3JUOA 1QALA 1W6GA 1IT8A 1A2VA 3HX8A 3NBRA 4HM5B 3F8HA 1W01A 2LYXA 1N8QA 1ULIB 2XGNA 2W0QA 3KZTA 4N6MA 5CK6A 3MKIA 2STDA 2W56A 3Q2PA 1VQL3 2OTJ3 3I0YA 3EE1A 1QJGA 3B8LA 3CNXA 3LT9A 1ULJB 3UL6A 3OWSA 4XDVA 4WP5A 1IU7A 1WTHA 3HIIA 3L0RA 2YFJB 3CCQ3 4HM0B 3KE7A 3DUKA 4ORLA 4LEHA 1C7HA 4KFEA 3EN1B 2M7OA 1VQ53 3EBYA 1JB5A 2PNCA 4WYKA 2PZVA 3GZRA 1QAFA 1LXEA 1JN5B 1Q814 1LOXA 2HMKB 4WFOA 3CC23 5LC6A 5AYSC 3PCRA 2BT3A 4HM8B 5CF1A 1W4NA 3U97A 1KC84 4LMIA 4RBNA 1GD4A 1JJ22 1K28A 1A90A 4HVNA 1NO3A 2C10A 2C11A 4KVHA 4K1UA 4HYZA 1IVXA 3VGNA 3M8CA 4GL6A 3N8BA 3HK4A 4BTXA 1IDPA 5A0OB 3NM7A 2V1LA 8CHOA 5JBSA 1RKYA 5CF2A 1YIT3 2MF7A 3EF8A 3STDA 3T0UA 4HM6B 2W6JH 4K61A 3F40A 4BTYA 3BNEA 4EV2A 5IEPA 1M1K4 1OF5B 1OPYA 2CFDA 2XF3A 1TIJA 1W02A 3G0KA 1QAKA 3ALAA 3K5TA 3OW22 3PCSA 1UI8A 1Q824 1ZX2A 5STDA 1YJ93 1JN5A 1S5AA 2K0MA 1E97A 3MHEA 3LTAA 4XM4A 1GD3A 2OQEA 1U5OA 3CCJ3 1O7HB 4N3VA 4OVMA 2XSOB 3FCSB 3VSYA 2FNQA 1VQN3 5EVHA 1PU4A 2CHCA 4FMBA 1O7MB 4L8PA 4LZIA 4EYCA 3CCU3 2O9UX 3FGYA 4R80A 1E3RA 2MC8A 2QA43 1N9JA 1K9M4 5AEUB 1TP6A 3WA3A 2WO0A 4L8OA 3NXJA 3CCE3 1ROAA 5IEOA 3BNBA 3WODG 3X3ZA 1OF5A 4R1KA 3RGRA 1D6YA 3TDGA 5IG3A 5JPUA 2KCDA 3I553 1FGRA 3OV4A 4N6V0 3K9MC 2QIYA 3QRDA 4KFFA 1IVVA 1VZZA 3Q1CA 2XFSA 2CFKA 3JUQA 4I4KA 1YJN3 3DM8A 2CH9A 4KFDA 3MWZA 3JUMA 4R9LA 1BUQA 2YX9A 1OUNA 1U8CB 2D1WA 2RCDA 3FKAA 4HJLB 4MMZB 4R9KA 1A67A 3OX9A 2Z7AA 2BO9B 4XDWA 1JKGB 1AR0A 4EXRA 4HM4B 3EQQB 1VQO3 5D81A 4FMCA 3UL5A 2JDIH 3DY5A 3JUPA 1NU3A 4HM2B 2P38A 2P0XA 1IQYA 3D3LA 1IQXA 3BB9A 5CLKA 3MPHA 3IPTA 4XB5A 1CYVA 2CC3A 5IG0A 2OQEC 3NX0A 1M9GA 1JB2A 2RGQA 2F86B 2L4VA 1G96A 3LT8A 3S27A 3SXXA 4EBGA 3SVAA 4K90B 1IQ8A 2P0MA 1UW1A 1IK3A 3JVCA 3F7XA 1ROVA 3O8YA 1RRHA 3U1WA 1NB5I 1VQ83 2P05A 1W00A 1YGEA 5TGNA 1FGMA 1JKGA 2GXFA 1Z1SA 2E2TA 2O3OA 5AIIA 3LH4A 2BHMA 1EQKA 3MG1A 4N6TA 4FR9A 5ELJA 1ZO2A 2Q07A 1S723 3CD63 4FCMA 2HMNB 4HM7B 5KP3A 2YFIB 1FGQA 1E3VA 1Q42A 3SEDA 1V74A 5CXOA 1SIIA 2F98A 1W6YA 2QGUA 1WMOA 2CWUA 3AMOB 3KSPA 4WHAA 1ASKA 3CC73 3CNMA 4JRFA 2GEYA 3LTDA 1EG9B 2ML5A 1N5HA 2XH9A 5D82A 4AKYA 3WDGB 2HMMB 4N6NB 5KP4A 1DVDA 5FW5A 1NJI4 1FUWA 1JNQA 2LQVA 1Y4KA 5IENA 3K7CA 2SBLA 3K0ZA 1UI7A 1YI23 3T8NA 3K63A 1TU5A 1GY7A 4HM3B 1CYUA 4J8TA 3EB8A 3D9RA 2GU1A 1OH0A 1MOLA 5IG5A 1WNHA 4RNYA 3HI7A 3DGLA 1EA2A 5IG4A 4QWTA 3FLJA 3LZAA 3LMLA 1DMQA 4XBYA 1D6UA 3KKGA 5AIGA 4CDLA 5JPPA 1FA3A 3N9HA 3CC43 1GY6A 2CIUA 1JB4A 2HMLB 3AMOA 3NHXA 3BNCA 3G16A 3NV0B 4AEQA 1WMPA 2Z76A 1QVG2 5G2GA 3PXMA 2RSXA 3CCM3 3X42A 5AI1A 3WOFB 3NBBA 1US1A 1Q40B 3FSDA 2W04A 4XBTA 2INXA 2XRXB 3UB1A 2E2UA 4STDA 3GAXA 3DZLA 3WA2X 2I9WA 2CK3H 1K8A4 3EJVA 3H51A 3SLUA 3UJMA 3G4S3 1CQSA 1VQ43 1OACA 3FZWA 3EHCA 1TFOA 2GU3A 5I97A 3MYTA 6STDA 3I563 2CWTA 3RGAA 1MNLA 2CW9A 1AVKA 3EN8A 3NQZA 2CFGA 1VQK3 1IV9A 3ECFA 1EKMA 3X41A 3PYJA 2QEX3 3NM2A 1Q864 4NHFA 1OGZA 3CCS3 3NV0A 1KSIA 3CU3A 1DVCA 2CFWA 1OHPA 2CFLA 2HMJB 1DMNA 3CCL3 3EX9A 1RJOA 2CKFB 1JV2B 4R4KA 4MMXB 1FGTA 1Q40A 2OWPA 2XEPA 2W03A 5AIFA 1VQ93 2F99A 3GZYB 3IJEB 4K1VA 1RRLA 4HM1B 4IPBA 4XBXA 1VQM3 2OOVA 1STDA 3B7CA 2GBXB 1SPUA 3OWUA 5LC7A 3J7Yd 4NREA 3DGMA 3DGNA 4N6UA 2R4IA 1GY5A 3V99A 5BVBA 3JUNA 5BXQA 4H61A 7STDA 1ISKA 1UUVB 3S29A 1KD14 2W9PA 3ER7A 3FF2A 3FG4A 3NQYA 3RDEA 3S67A 1IVUA 4O3VA 3BLZA 3G713 1NWWA 3GWRA 1L5GB 2KRTA 4EV5A 3IMAB 1LVNA 4LGQA 2IA7A 4J9AA 4OK0A 4OUQA 2Y73A 2ZDJA 3BNDA 3GRDA 4JF8A 3PZWA 2CWVA 2ZL8A 3UNLA 2XSHB 4FMAA 3QK9A 1SJWA 2A15A 1AVLA 3A76A 3FG1A 1T5YA 3PGBA 3CCR3 5AEWB 2FGTA 2BMRB 4HZ9B 3CME3 2CG0A 3LXUX 4BTWA 3FG3A 1KQS2 1F8NA 1HKXA 2OCTA 1STFI 3DXOA 3F7SA 2Z77A 4O8SA 1O7WB 3F9SA 1R4CA 3KN4A 3LTCA 4CCVA 1KWIA 1JRQA 3PS8A 4FCJA 3FF0A 1W2B2 1GYBA 4IIAA 4U13A 4ZM8A 2B24B 1AV4A 2Z6BA 1OGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZX B;  3B4P A;  2RFR A;  2JQ5 A;  1OHS A;  4HKV B;  4L7K A;  3G8Z A;  3GZB A;  3DMC A;  2IMJ A;  4H3U A;  2W2C A;  1O7G B;  1OHO A;  1O7N B;  3FH1 A;  3Q90 A;  1DMM A;  4GB5 A;  1WQL B;  2GEX A;  2HMO B;  5HGR A;  4X2O A;  3OWY A;  4Q53 A;  2YFL B;  3H3H A;  1NDO B;  2BMQ B;  2UX0 A;  1A2K A;  3MSO A;  3ROB A;  2BNG A;  5DRE A;  4PEJ A;  4HZB B;  3OXA A;  2B1X B;  5KP1 A;  2K54 A;  5D83 A;  1UUW B;  3F14 A;  1QMA A;  4RZM A;  1K41 A;  2GBW B;  1OCV A;  1O7P B;  3MG3 A;  1GS3 A;  3CPO A;  3B4O A;  3EBT A;  4MJD A;  5AIH A;  4X2H A;  3SOY A;  3EC9 A;  2XR8 B;  5DRV A;  5IER A;  3MG2 A;  1TUH A;  3F8X A;  3T8U A;  5IF6 A;  2BMO B;  3HZP A;  3SOA A;  3NUV A;  4WYK B;  3WMD A;  3LYG A;  4WWU C;  3E99 A;  3S5C A;  3JUO A;  3HX8 A;  3NBR A;  4HM5 B;  3F8H A;  1W01 A;  1ULI B;  3KZT A;  5CK6 A;  3MKI A;  2STD A;  3I0Y A;  1QJG A;  3B8L A;  3CNX A;  1ULJ B;  3OWS A;  4XDV A;  4WP5 A;  2YFJ B;  4HM0 B;  3KE7 A;  3DUK A;  4ORL A;  4LEH A;  1C7H A;  3EN1 B;  3EBY A;  1JB5 A;  4WYK A;  2PZV A;  3GZR A;  1JN5 B;  2HMK B;  4HM8 B;  5CF1 A;  4LMI A;  4HVN A;  4KVH A;  4K1U A;  3VGN A;  3M8C A;  3HK4 A;  1IDP A;  8CHO A;  5CF2 A;  3EF8 A;  3STD A;  4HM6 B;  5IEP A;  3F40 A;  1OF5 B;  1OPY A;  1W02 A;  3G0K A;  1ZX2 A;  5STD A;  1JN5 A;  1S5A A;  1E97 A;  3MHE A;  4XM4 A;  1U5O A;  1O7H B;  4N3V A;  4OVM A;  2XSO B;  3VSY A;  5EVH A;  2CHC A;  4L8P A;  1O7M B;  3FGY A;  1E3R A;  5AEU B;  1TP6 A;  4L8O A;  3NXJ A;  5IEO A;  1OF5 A;  4R1K A;  3RGR A;  5IG3 A;  5JPU A;  2QIY A;  1VZZ A;  3JUQ A;  4I4K A;  3DM8 A;  3JUM A;  4R9L A;  1BUQ A;  1OUN A;  3FKA A;  2RCD A;  4HJL B;  4R9K A;  3OX9 A;  2Z7A A;  4XDW A;  1JKG B;  1AR0 A;  4HM4 B;  3EQQ B;  5D81 A;  3JUP A;  1NU3 A;  4HM2 B;  3BB9 A;  5CLK A;  3IPT A;  4XB5 A;  5IG0 A;  1JB2 A;  2RGQ A;  2F86 B;  3F7X A;  1W00 A;  5TGN A;  1JKG A;  2GXF A;  1Z1S A;  5AII A;  3MG1 A;  1ZO2 A;  4FCM A;  2HMN B;  4HM7 B;  5KP3 A;  2YFI B;  1E3V A;  1Q42 A;  3SED A;  5CXO A;  2F98 A;  1W6Y A;  2QGU A;  3KSP A;  1ASK A;  3CNM A;  2GEY A;  1EG9 B;  5D82 A;  2HMM B;  5KP4 A;  5FW5 A;  5IEN A;  3K7C A;  3K0Z A;  3T8N A;  1GY7 A;  4HM3 B;  4J8T A;  3D9R A;  1OH0 A;  5IG5 A;  1EA2 A;  5IG4 A;  3FLJ A;  3LZA A;  1DMQ A;  4XBY A;  3KKG A;  5AIG A;  4CDL A;  5JPP A;  1GY6 A;  1JB4 A;  2HML B;  3NHX A;  3NV0 B;  3G16 A;  2Z76 A;  5G2G A;  5AI1 A;  3FSD A;  1Q40 B;  4XBT A;  2INX A;  2XRX B;  4STD A;  3DZL A;  2I9W A;  3EJV A;  3H51 A;  3UJM A;  1CQS A;  3FZW A;  3EHC A;  3MYT A;  6STD A;  3RGA A;  3EN8 A;  3ECF A;  3NM2 A;  1OGZ A;  3NV0 A;  3CU3 A;  1OHP A;  2HMJ B;  1DMN A;  3EX9 A;  2CKF B;  1Q40 A;  2OWP A;  5AIF A;  2F99 A;  3GZY B;  4K1V A;  4HM1 B;  4XBX A;  1STD A;  3B7C A;  2GBX B;  3OWU A;  2R4I A;  1GY5 A;  5BXQ A;  5BVB A;  3JUN A;  7STD A;  1ISK A;  1UUV B;  3ER7 A;  3FF2 A;  3BLZ A;  1NWW A;  3GWR A;  4LGQ A;  4J9A A;  4OUQ A;  3GRD A;  3UNL A;  2XSH B;  1SJW A;  2A15 A;  3A76 A;  5AEW B;  2BMR B;  4HZ9 B;  1HKX A;  3DXO A;  3F7S A;  2Z77 A;  1O7W B;  3F9S A;  4FCJ A;  3FF0 A;  1GYB A;  4IIA A;  4U13 A;  2B24 B;  3OV4 A;  1OGX A; 
#chains in the Genus database with same CATH topology
 3GZX B;  1BAO A;  2OOV C;  3B4P A;  4LSO A;  1BNI A;  2F56 A;  1M1X B;  4O02 B;  2RFR A;  2P09 A;  3CPW 2;  1PFP A;  1JZO A;  8RNT A;  2JQ5 A;  2XGL A;  1OHS A;  2D42 A;  5GSP A;  4HKV B;  3SX1 A;  1TRQ A;  4FMD A;  4FCZ A;  2ML6 A;  1W6C A;  1SQW A;  4L7K A;  2CG1 A;  1Q9E A;  3KII A;  1BNG A;  4N6O B;  3G8Z A;  3LTB A;  3X3X A;  1VQ7 3;  3GZB A;  4N6L A;  3DMC A;  2IMJ A;  4H3U A;  1N8R 4;  2W2C A;  1LNH A;  1O7G B;  1OHO A;  1O7N B;  2CX0 A;  3X40 A;  1RN7 A;  1M90 4;  3FH1 A;  3Q90 A;  3V98 A;  1R4Y A;  1DMM A;  1B3S A;  1GOV A;  4GB5 A;  1WQL B;  4MMY B;  2GEX A;  2HMO B;  1K73 4;  5HGR A;  4X2O A;  3G6E 3;  1VQ6 3;  2WGO A;  3CMA 3;  3OWY A;  4Q53 A;  1IT7 A;  1GMP A;  2YFL B;  1B2X A;  1EEJ A;  1NDO B;  2HOH A;  3H3H A;  1CEW I;  1UCI A;  2BMQ B;  5AYR B;  1BRH A;  2XFT A;  2WOH A;  2UX0 A;  4O2H A;  4EC6 A;  1A2K A;  3DGO A;  3MSO A;  1AY7 A;  2FXT A;  1W7C A;  2K3D A;  4RNZ A;  1BRG A;  3ROB A;  2BNG A;  4AKZ A;  1BNJ A;  1I0V A;  2SAR A;  1WMN A;  5DRE A;  4PEJ A;  4HZB B;  1YJW 3;  1W2Z A;  2W9Q A;  3OXA A;  2B1X B;  2E2V A;  5EEO A;  1Q7Y 4;  1IV7 A;  1SIH A;  2K54 A;  4TX4 A;  5D83 A;  5KP1 A;  2Y74 A;  5EQL A;  2WOF A;  3D4A A;  3ZFZ A;  1W5Z A;  1UUW B;  3F14 A;  3V92 A;  1QMA A;  4RZM A;  1K41 A;  2GBW B;  1OCV A;  1O7P B;  3MG3 A;  1GS3 A;  1TFK A;  3CPO A;  4IT7 A;  2IUK A;  1BRS A;  1FGO A;  1UGH I;  3B4O A;  3HIG A;  3VF1 A;  4BL3 A;  3EBT A;  2RBI A;  2GSP A;  3KSE D;  1YVB I;  3N54 B;  4MJD A;  5ELU A;  1NB3 I;  5AIH A;  1LQM B;  5RNT A;  2OTL 3;  3AHS A;  1D6Z A;  3X3Y A;  4X2H A;  1N9E A;  4J5K A;  2W56 B;  3SOY A;  1QVF 2;  3WOE B;  3EC9 A;  1YHQ 3;  2WGQ A;  1RNT A;  2XR8 B;  5DRV A;  4MEI A;  1GOU A;  3CCV 3;  5IER A;  2IUJ A;  1HU9 A;  3DH2 A;  2KXG A;  3CXC 2;  3MG2 A;  1TUH A;  3LOY A;  3F8X A;  3T8U A;  5IF6 A;  1VQP 3;  1DYU A;  2BMO B;  5IW9 A;  4KZ1 A;  1J2B A;  3HZP A;  3S28 A;  3SOA A;  4HBR A;  5FGO A;  1FYS A;  3NUV A;  4G1M B;  4WYK B;  1RHL A;  1LNI A;  3KFQ C;  3WMD A;  1T3B A;  3LYG A;  1BRJ A;  1N5P A;  3AGN A;  1T2I A;  1B2S A;  4WWU C;  1IVW A;  1YIJ 3;  3E99 A;  3NBJ A;  1IYY A;  3S5C A;  3JUO A;  1DE3 A;  1QAL A;  1W6G A;  1IT8 A;  1A2V A;  3HX8 A;  3NBR A;  4HM5 B;  3F8H A;  1W01 A;  5M1A A;  2LYX A;  1N8Q A;  1ULI B;  2AAE A;  2XGN A;  1X1Y A;  2W0Q A;  2R41 A;  3KZT A;  4N6M A;  5CK6 A;  3MKI A;  2STD A;  7GSP A;  1YGW A;  2W56 A;  3Q2P A;  1RNB A;  1VQL 3;  2KF3 A;  2OTJ 3;  3I0Y A;  3EE1 A;  1QJG A;  1B21 A;  3B8L A;  5M19 A;  1BNR A;  2IY2 A;  3CNX A;  3LT9 A;  1ULJ B;  3UL6 A;  3OWS A;  4XDV A;  4WP5 A;  2CX1 A;  1IU7 A;  1V58 A;  1BSE A;  4KT3 B;  1WTH A;  2UGI A;  3HII A;  3L0R A;  2YFJ B;  3CCQ 3;  4HM0 B;  3KE7 A;  3DUK A;  4ORL A;  1PY3 A;  4LEH A;  1C7H A;  1I0X A;  4KFE A;  3EN1 B;  3WR2 A;  2M7O A;  3BIR A;  3EBY A;  1JB5 A;  1RDS A;  1VQ5 3;  1RTU A;  2PNC A;  2PZV A;  3D5I A;  3GZR A;  1QAF A;  1LXE A;  1JN5 B;  4WYK A;  4BL2 A;  1Q81 4;  1LOX A;  2HMK B;  4WFO A;  3CC2 3;  5LC6 A;  5AYS C;  3PCR A;  2BT3 A;  4HM8 B;  5CF1 A;  1W4N A;  3U97 A;  1KC8 4;  4LMI A;  4RBN A;  1GD4 A;  2F4Y A;  1K28 A;  3HOH A;  1JJ2 2;  1A90 A;  4HVN A;  1NO3 A;  1RLS A;  2C11 A;  2C10 A;  2L1S A;  4K1U A;  4KVH A;  4HYZ A;  1MWR A;  1GMR A;  1IVX A;  3VGN A;  1GOY A;  1BUJ A;  3M8C A;  1RMS A;  1B2U A;  1YVS A;  1V57 A;  1I2E A;  4GL6 A;  3N8B A;  3HK4 A;  4BTX A;  1IDP A;  5A0O B;  3NM7 A;  2KF6 A;  2V1L A;  8CHO A;  5JBS A;  5CF2 A;  1RKY A;  1YIT 3;  2KF5 A;  2MF7 A;  3EF8 A;  3STD A;  3T0U A;  4HM6 B;  2W6J H;  4K61 A;  3F40 A;  4BTY A;  3BNE A;  3D79 A;  4EV2 A;  5IEP A;  1FUS A;  1M1K 4;  1FW7 A;  1OF5 B;  1OPY A;  1PYL A;  2CFD A;  2XF3 A;  1TIJ A;  1W02 A;  1DET A;  3G0K A;  1MWT A;  1QAK A;  3AGO A;  3ALA A;  3K5T A;  3OW2 2;  2H0H A;  1UI8 A;  3PCS A;  1Q82 4;  1ZX2 A;  3DGY A;  5STD A;  1JN5 A;  1YJ9 3;  1S5A A;  2K0M A;  1E97 A;  1BSA A;  3MHE A;  1I3I A;  3LTA A;  4XM4 A;  1GD3 A;  2OQE A;  2C4B A;  1U5O A;  3CCJ 3;  1O7H B;  4N3V A;  4OVM A;  2XSO B;  3FCS B;  3VSY A;  2FNQ A;  1VQN 3;  1I2G A;  5EVH A;  1PU4 A;  1JBS A;  2CHC A;  4FMB A;  1O7M B;  4L8P A;  4LZI A;  3URP A;  4EYC A;  2O9U X;  3FGY A;  4R80 A;  1E3R A;  3CCU 3;  2MC8 A;  2QA4 3;  1N9J A;  1JZD A;  5AEU B;  1K9M 4;  1FUT A;  2BU4 A;  1TP6 A;  3WA3 A;  2WO0 A;  4L8O A;  3NXJ A;  5M18 A;  3CCE 3;  1HYF A;  1ROA A;  5IEO A;  5BU4 A;  1RN1 A;  3BNB A;  3WOD G;  3X3Z A;  1OF5 A;  4R1K A;  3RGR A;  1D6Y A;  3TDG A;  5IG3 A;  5JPU A;  2KCD A;  3I55 3;  1FGR A;  1TTO A;  3OV4 A;  4N6V 0;  3K9M C;  2QIY A;  3QRD A;  1BSC A;  4KFF A;  3D5G A;  1IVV A;  1VZZ A;  3Q1C A;  1B2M A;  2XFS A;  1LOY A;  2CFK A;  3JUQ A;  4I4K A;  1YJN 3;  3DM8 A;  2CH9 A;  4GHO A;  4KFD A;  1LRA A;  2BIR A;  3JUM A;  3MWZ A;  4R9L A;  1BUQ A;  2YX9 A;  1OUN A;  1U8C B;  2D1W A;  2RCD A;  1ZGX A;  3FKA A;  4HJL B;  4MMZ B;  4R9K A;  3OX9 A;  2Z7A A;  1A67 A;  2BO9 B;  4XDW A;  1JKG B;  1AR0 A;  3AHW A;  2IYJ A;  4EXR A;  4HM4 B;  4ILF A;  3EQQ B;  1VQO 3;  5HOH A;  2ZHX B;  5D81 A;  4FMC A;  3UL5 A;  1C54 A;  2JDI H;  3DY5 A;  3JUP A;  6GSP A;  1NU3 A;  4HM2 B;  2P38 A;  1A2P A;  4HAA A;  1B27 A;  2P0X A;  5IG5 A;  1IQY A;  3D3L A;  1IQX A;  3BB9 A;  5CLK A;  3MPH A;  3IPT A;  4XB5 A;  1CYV A;  2CC3 A;  1RGL A;  1RGH A;  2OQE C;  5IG0 A;  3NX0 A;  1M9G A;  1JB2 A;  1BSD A;  1UCL A;  2RGQ A;  2F86 B;  1NNV A;  1G96 A;  2L4V A;  3LT8 A;  3S27 A;  3SXX A;  3SVA A;  4K90 B;  1IQ8 A;  1Q7H A;  4EBG A;  5BIR A;  2P0M A;  7RNT A;  1UW1 A;  1RGK A;  3WHO A;  1IK3 A;  3JVC A;  3F7X A;  1ROV A;  3O8Y A;  1BGS A;  1RRH A;  3U1W A;  1NB5 I;  1VQ8 3;  2P05 A;  1W00 A;  1UCJ A;  1B20 A;  1YGE A;  5TGN A;  1FGM A;  1JKG A;  2GXF A;  1Z1S A;  2E2T A;  2O3O A;  5AII A;  1UCK A;  2BHM A;  3LH4 A;  3MG1 A;  4N6T A;  1EQK A;  4FR9 A;  5ELJ A;  1ZO2 A;  2Q07 A;  1S72 3;  3CD6 3;  4FCM A;  2HMN B;  4HM7 B;  2AAD A;  5KP3 A;  2YFI B;  1FGQ A;  1E3V A;  1Q42 A;  3BU4 A;  3SED A;  1V74 A;  2H0G A;  5CXO A;  1T2H A;  1SII A;  2F98 A;  1EUI C;  1W6Y A;  1WMO A;  2QGU A;  1UGI A;  2CWU A;  3AMO B;  2F5W A;  3KSP A;  1ASK A;  4WHA A;  1X1X A;  2RNT A;  3CC7 3;  3CNM A;  4JRF A;  1I2F A;  1RSN A;  2GEY A;  3LTD A;  1EG9 B;  2ML5 A;  1N5H A;  2XH9 A;  5D82 A;  4AKY A;  1BU4 A;  2KF4 A;  3WDG B;  2HMM B;  4N6N B;  5KP4 A;  1DVD A;  5FW5 A;  1NJI 4;  1FUW A;  1JNQ A;  2LQV A;  1Y4K A;  5IEN A;  1X1U A;  2SBL A;  3K0Z A;  1UI7 A;  3K7C A;  3T8N A;  1YI2 3;  3K63 A;  1TU5 A;  1GY7 A;  4HM3 B;  1CYU A;  4J8T A;  1G02 A;  4HOH A;  3EB8 A;  1TJD A;  1AQZ A;  3D9R A;  4CJN A;  1B2Z A;  2GU1 A;  1UDI I;  1OH0 A;  1MOL A;  1RGA A;  1BAN A;  5G1L A;  1RN4 A;  4DKI A;  3RNT A;  1BNF A;  1FZU A;  1WNH A;  4RNY A;  3HI7 A;  4J5G A;  3DGL A;  1EA2 A;  1BRN L;  5IG4 A;  4QWT A;  3FLJ A;  3LZA A;  3LML A;  1DMQ A;  4XBY A;  1D6U A;  3KKG A;  5AIG A;  4CDL A;  5JPP A;  1FA3 A;  3N9H A;  3CC4 3;  1GY6 A;  1LOV A;  1JB4 A;  1BNE A;  2CIU A;  2HML B;  3AMO A;  4LYL B;  3NHX A;  3BNC A;  2J8X B;  3G16 A;  3NV0 B;  4AEQ A;  1WMP A;  2Z76 A;  1QVG 2;  5G2G A;  1RCL A;  3PXM A;  2RSX A;  3CCM 3;  3X42 A;  5AI1 A;  3WOF B;  3NBB A;  1US1 A;  1I70 A;  1Q40 B;  3FSD A;  2W04 A;  1RGE A;  4XBT A;  2INX A;  2XRX B;  3UB1 A;  3SYU A;  2E2U A;  4STD A;  3GAX A;  3DZL A;  1BRK A;  3WA2 X;  2I9W A;  2CK3 H;  1K8A 4;  3EJV A;  3H51 A;  3SLU A;  3UJM A;  3G4S 3;  1CQS A;  1JBT A;  9RNT A;  1VQ4 3;  1OAC A;  3FZW A;  1G0T A;  3EHC A;  1TFO A;  2GU3 A;  5I97 A;  3MYT A;  6STD A;  3I56 3;  2CWT A;  1BOX A;  4RNT A;  3RGA A;  1MNL A;  4CPK A;  1BNS A;  2CW9 A;  1AVK A;  1HZ1 A;  4I5Q A;  3EN8 A;  3NQZ A;  2CFG A;  1VQK 3;  1IV9 A;  3ECF A;  1LQG C;  2H0I A;  1EKM A;  1BVI A;  3X41 A;  3PYJ A;  2QEX 3;  3NM2 A;  1Q86 4;  1JBR A;  4NHF A;  1OGZ A;  4GSP A;  3NV0 A;  3CCS 3;  2F5M A;  1KSI A;  3CU3 A;  1DVC A;  1I3F A;  2CFW A;  1OHP A;  2KAA A;  1RGF A;  2CFL A;  1X1W A;  2HMJ B;  1DMN A;  3CCL 3;  1RGC A;  3EX9 A;  1RJO A;  2CKF B;  1JV2 B;  4R4K A;  4MMX B;  1FGT A;  1Q40 A;  1BSB A;  2OWP A;  2XEP A;  2W03 A;  5AIF A;  1VQ9 3;  2F99 A;  3GZY B;  1BIR A;  3IJE B;  4K1V A;  1RRL A;  4HM1 B;  4IPB A;  4XBX A;  1MWU A;  1VQM 3;  2OOV A;  1I8V A;  1STD A;  3B7C A;  2GBX B;  1BRI A;  1SPU A;  3OWU A;  5LC7 A;  3J7Y d;  4NRE A;  4NPB A;  1MWS A;  3DGM A;  3ZG0 A;  1VQQ A;  3DGN A;  4N6U A;  2R4I A;  1GY5 A;  1RCK A;  3V99 A;  3JUN A;  5BVB A;  4H61 A;  5BXQ A;  7STD A;  1ISK A;  1UUV B;  3S29 A;  1KD1 4;  2W9P A;  3ER7 A;  3FF2 A;  3FG4 A;  4BIR A;  1MGW A;  3NQY A;  3RDE A;  1IVU A;  4O3V A;  3BLZ A;  3S67 A;  3G71 3;  1NWW A;  3GWR A;  1L5G B;  2KRT A;  4EV5 A;  3IMA B;  1LVN A;  4LGQ A;  2IA7 A;  4J9A A;  4OK0 A;  4OUQ A;  1TRP A;  2Y73 A;  2ZDJ A;  3BND A;  3GRD A;  3PZW A;  2CWV A;  4JF8 A;  1MGR A;  1SAR A;  3GSP A;  2ZL8 A;  3UNL A;  2XSH B;  1GMQ A;  4FMA A;  2UUG C;  3QK9 A;  2ZA4 A;  4EW5 A;  1SJW A;  2A15 A;  1AVL A;  3A76 A;  3FG1 A;  1T5Y A;  3PGB A;  3CCR 3;  5AEW B;  2FGT A;  2BMR B;  4HZ9 B;  3CME 3;  2CG0 A;  3LXU X;  1LOW A;  3ZG5 A;  4BTW A;  3FG3 A;  1KQS 2;  1F8N A;  1UUG B;  1HKX A;  4BU4 A;  2OCT A;  1STF I;  5G1K A;  3DXO A;  1GSP A;  3F7S A;  2Z77 A;  4O8S A;  1CH0 A;  1O7W B;  3F9S A;  1R4C A;  3KN4 A;  1ZS7 A;  3LTC A;  1KWI A;  4CCV A;  1YNV X;  3KCH A;  1JRQ A;  3PS8 A;  4FCJ A;  3FF0 A;  6RNT A;  1W2B 2;  3Q3F A;  1GYB A;  4IIA A;  4U13 A;  4ZM8 A;  2B24 B;  1AV4 A;  2Z6B A;  1OGX A;  3A5E A;  1RGG A; 
#chains in the Genus database with same CATH homology
 3GZX B;  2OOV C;  3B4P A;  4LSO A;  1M1X B;  4O02 B;  2RFR A;  2P09 A;  3CPW 2;  1PFP A;  2JQ5 A;  2XGL A;  1OHS A;  2D42 A;  4HKV B;  3SX1 A;  4FMD A;  4FCZ A;  2ML6 A;  1W6C A;  1SQW A;  4L7K A;  2CG1 A;  3KII A;  4N6O B;  3G8Z A;  3LTB A;  3X3X A;  1VQ7 3;  3GZB A;  4N6L A;  3DMC A;  2IMJ A;  4H3U A;  1N8R 4;  2W2C A;  1LNH A;  1O7G B;  1OHO A;  1O7N B;  3X40 A;  1RN7 A;  1M90 4;  3FH1 A;  3Q90 A;  3V98 A;  1DMM A;  4GB5 A;  1WQL B;  4MMY B;  2GEX A;  2HMO B;  1K73 4;  5HGR A;  4X2O A;  3G6E 3;  1VQ6 3;  2WGO A;  3CMA 3;  3OWY A;  4Q53 A;  1IT7 A;  2YFL B;  3H3H A;  1NDO B;  1CEW I;  2BMQ B;  5AYR B;  2XFT A;  2WOH A;  2UX0 A;  4O2H A;  4EC6 A;  1A2K A;  3DGO A;  3MSO A;  4RNZ A;  2FXT A;  1W7C A;  3ROB A;  2BNG A;  4AKZ A;  1WMN A;  5DRE A;  4PEJ A;  4HZB B;  1YJW 3;  1W2Z A;  2W9Q A;  3OXA A;  2B1X B;  2E2V A;  5EEO A;  1Q7Y 4;  1IV7 A;  1SIH A;  2K54 A;  4TX4 A;  5D83 A;  5KP1 A;  2Y74 A;  5EQL A;  2WOF A;  1W5Z A;  1UUW B;  3F14 A;  3V92 A;  1QMA A;  4RZM A;  1K41 A;  2GBW B;  1OCV A;  1O7P B;  3MG3 A;  1GS3 A;  1TFK A;  3CPO A;  4IT7 A;  2IUK A;  1FGO A;  3HIG A;  3B4O A;  3VF1 A;  3EBT A;  3KSE D;  1YVB I;  3N54 B;  4MJD A;  5ELU A;  1NB3 I;  5AIH A;  2OTL 3;  1D6Z A;  3X3Y A;  4X2H A;  1N9E A;  3SOY A;  2W56 B;  1QVF 2;  3WOE B;  3EC9 A;  1YHQ 3;  2WGQ A;  2XR8 B;  5DRV A;  4MEI A;  3CCV 3;  5IER A;  2IUJ A;  1HU9 A;  2KXG A;  3CXC 2;  3MG2 A;  1TUH A;  3LOY A;  3F8X A;  3T8U A;  5IF6 A;  1VQP 3;  1DYU A;  2BMO B;  5IW9 A;  4KZ1 A;  1J2B A;  3HZP A;  3S28 A;  3SOA A;  4HBR A;  5FGO A;  3NUV A;  4G1M B;  4WYK B;  3KFQ C;  3WMD A;  3LYG A;  1N5P A;  4WWU C;  1IVW A;  1YIJ 3;  3E99 A;  3NBJ A;  3S5C A;  3JUO A;  1QAL A;  1W6G A;  1IT8 A;  1A2V A;  3HX8 A;  3NBR A;  4HM5 B;  3F8H A;  1W01 A;  2LYX A;  1N8Q A;  1ULI B;  2XGN A;  2W0Q A;  3KZT A;  4N6M A;  5CK6 A;  3MKI A;  2STD A;  2W56 A;  3Q2P A;  1VQL 3;  2OTJ 3;  3I0Y A;  3EE1 A;  1QJG A;  3B8L A;  3CNX A;  3LT9 A;  1ULJ B;  3UL6 A;  3OWS A;  4XDV A;  4WP5 A;  1IU7 A;  1WTH A;  3HII A;  3L0R A;  2YFJ B;  3CCQ 3;  4HM0 B;  3KE7 A;  3DUK A;  4ORL A;  4LEH A;  1C7H A;  4KFE A;  3EN1 B;  2M7O A;  1VQ5 3;  3EBY A;  1JB5 A;  2PNC A;  4WYK A;  2PZV A;  3GZR A;  1QAF A;  1LXE A;  1JN5 B;  1Q81 4;  1LOX A;  2HMK B;  4WFO A;  3CC2 3;  5LC6 A;  5AYS C;  3PCR A;  2BT3 A;  4HM8 B;  5CF1 A;  1W4N A;  3U97 A;  1KC8 4;  4LMI A;  4RBN A;  1GD4 A;  1JJ2 2;  1K28 A;  1A90 A;  4HVN A;  1NO3 A;  2C10 A;  2C11 A;  4KVH A;  4K1U A;  4HYZ A;  1IVX A;  3VGN A;  3M8C A;  4GL6 A;  3N8B A;  3HK4 A;  4BTX A;  1IDP A;  5A0O B;  3NM7 A;  2V1L A;  8CHO A;  5JBS A;  1RKY A;  5CF2 A;  1YIT 3;  2MF7 A;  3EF8 A;  3STD A;  3T0U A;  4HM6 B;  2W6J H;  4K61 A;  3F40 A;  4BTY A;  3BNE A;  4EV2 A;  5IEP A;  1M1K 4;  1OF5 B;  1OPY A;  2CFD A;  2XF3 A;  1TIJ A;  1W02 A;  3G0K A;  1QAK A;  3ALA A;  3K5T A;  3OW2 2;  3PCS A;  1UI8 A;  1Q82 4;  1ZX2 A;  5STD A;  1YJ9 3;  1JN5 A;  1S5A A;  2K0M A;  1E97 A;  3MHE A;  3LTA A;  4XM4 A;  1GD3 A;  2OQE A;  1U5O A;  3CCJ 3;  1O7H B;  4N3V A;  4OVM A;  2XSO B;  3FCS B;  3VSY A;  2FNQ A;  1VQN 3;  5EVH A;  1PU4 A;  2CHC A;  4FMB A;  1O7M B;  4L8P A;  4LZI A;  4EYC A;  3CCU 3;  2O9U X;  3FGY A;  4R80 A;  1E3R A;  2MC8 A;  2QA4 3;  1N9J A;  1K9M 4;  5AEU B;  1TP6 A;  3WA3 A;  2WO0 A;  4L8O A;  3NXJ A;  3CCE 3;  1ROA A;  5IEO A;  3BNB A;  3WOD G;  3X3Z A;  1OF5 A;  4R1K A;  3RGR A;  1D6Y A;  3TDG A;  5IG3 A;  5JPU A;  2KCD A;  3I55 3;  1FGR A;  3OV4 A;  4N6V 0;  3K9M C;  2QIY A;  3QRD A;  4KFF A;  1IVV A;  1VZZ A;  3Q1C A;  2XFS A;  2CFK A;  3JUQ A;  4I4K A;  1YJN 3;  3DM8 A;  2CH9 A;  4KFD A;  3MWZ A;  3JUM A;  4R9L A;  1BUQ A;  2YX9 A;  1OUN A;  1U8C B;  2D1W A;  2RCD A;  3FKA A;  4HJL B;  4MMZ B;  4R9K A;  1A67 A;  3OX9 A;  2Z7A A;  2BO9 B;  4XDW A;  1JKG B;  1AR0 A;  4EXR A;  4HM4 B;  3EQQ B;  1VQO 3;  5D81 A;  4FMC A;  3UL5 A;  2JDI H;  3DY5 A;  3JUP A;  1NU3 A;  4HM2 B;  2P38 A;  2P0X A;  1IQY A;  3D3L A;  1IQX A;  3BB9 A;  5CLK A;  3MPH A;  3IPT A;  4XB5 A;  1CYV A;  2CC3 A;  5IG0 A;  2OQE C;  3NX0 A;  1M9G A;  1JB2 A;  2RGQ A;  2F86 B;  2L4V A;  1G96 A;  3LT8 A;  3S27 A;  3SXX A;  4EBG A;  3SVA A;  4K90 B;  1IQ8 A;  2P0M A;  1UW1 A;  1IK3 A;  3JVC A;  3F7X A;  1ROV A;  3O8Y A;  1RRH A;  3U1W A;  1NB5 I;  1VQ8 3;  2P05 A;  1W00 A;  1YGE A;  5TGN A;  1FGM A;  1JKG A;  2GXF A;  1Z1S A;  2E2T A;  2O3O A;  5AII A;  3LH4 A;  2BHM A;  1EQK A;  3MG1 A;  4N6T A;  4FR9 A;  5ELJ A;  1ZO2 A;  2Q07 A;  1S72 3;  3CD6 3;  4FCM A;  2HMN B;  4HM7 B;  5KP3 A;  2YFI B;  1FGQ A;  1E3V A;  1Q42 A;  3SED A;  1V74 A;  5CXO A;  1SII A;  2F98 A;  1W6Y A;  2QGU A;  1WMO A;  2CWU A;  3AMO B;  3KSP A;  4WHA A;  1ASK A;  3CC7 3;  3CNM A;  4JRF A;  2GEY A;  3LTD A;  1EG9 B;  2ML5 A;  1N5H A;  2XH9 A;  5D82 A;  4AKY A;  3WDG B;  2HMM B;  4N6N B;  5KP4 A;  1DVD A;  5FW5 A;  1NJI 4;  1FUW A;  1JNQ A;  2LQV A;  1Y4K A;  5IEN A;  3K7C A;  2SBL A;  3K0Z A;  1UI7 A;  1YI2 3;  3T8N A;  3K63 A;  1TU5 A;  1GY7 A;  4HM3 B;  1CYU A;  4J8T A;  3EB8 A;  3D9R A;  2GU1 A;  1OH0 A;  1MOL A;  5IG5 A;  1WNH A;  4RNY A;  3HI7 A;  3DGL A;  1EA2 A;  5IG4 A;  4QWT A;  3FLJ A;  3LZA A;  3LML A;  1DMQ A;  4XBY A;  1D6U A;  3KKG A;  5AIG A;  4CDL A;  5JPP A;  1FA3 A;  3N9H A;  3CC4 3;  1GY6 A;  2CIU A;  1JB4 A;  2HML B;  3AMO A;  3NHX A;  3BNC A;  3G16 A;  3NV0 B;  4AEQ A;  1WMP A;  2Z76 A;  1QVG 2;  5G2G A;  3PXM A;  2RSX A;  3CCM 3;  3X42 A;  5AI1 A;  3WOF B;  3NBB A;  1US1 A;  1Q40 B;  3FSD A;  2W04 A;  4XBT A;  2INX A;  2XRX B;  3UB1 A;  2E2U A;  4STD A;  3GAX A;  3DZL A;  3WA2 X;  2I9W A;  2CK3 H;  1K8A 4;  3EJV A;  3H51 A;  3SLU A;  3UJM A;  3G4S 3;  1CQS A;  1VQ4 3;  1OAC A;  3FZW A;  3EHC A;  1TFO A;  2GU3 A;  5I97 A;  3MYT A;  6STD A;  3I56 3;  2CWT A;  3RGA A;  1MNL A;  2CW9 A;  1AVK A;  3EN8 A;  3NQZ A;  2CFG A;  1VQK 3;  1IV9 A;  3ECF A;  1EKM A;  3X41 A;  3PYJ A;  2QEX 3;  3NM2 A;  1Q86 4;  4NHF A;  1OGZ A;  3CCS 3;  3NV0 A;  1KSI A;  3CU3 A;  1DVC A;  2CFW A;  1OHP A;  2CFL A;  2HMJ B;  1DMN A;  3CCL 3;  3EX9 A;  1RJO A;  2CKF B;  1JV2 B;  4R4K A;  4MMX B;  1FGT A;  1Q40 A;  2OWP A;  2XEP A;  2W03 A;  5AIF A;  1VQ9 3;  2F99 A;  3GZY B;  3IJE B;  4K1V A;  1RRL A;  4HM1 B;  4IPB A;  4XBX A;  1VQM 3;  2OOV A;  1STD A;  3B7C A;  2GBX B;  1SPU A;  3OWU A;  5LC7 A;  3J7Y d;  4NRE A;  3DGM A;  3DGN A;  4N6U A;  2R4I A;  1GY5 A;  3V99 A;  5BVB A;  3JUN A;  5BXQ A;  4H61 A;  7STD A;  1ISK A;  1UUV B;  3S29 A;  1KD1 4;  2W9P A;  3ER7 A;  3FF2 A;  3FG4 A;  3NQY A;  3RDE A;  3S67 A;  1IVU A;  4O3V A;  3BLZ A;  3G71 3;  1NWW A;  3GWR A;  1L5G B;  2KRT A;  4EV5 A;  3IMA B;  1LVN A;  4LGQ A;  2IA7 A;  4J9A A;  4OK0 A;  4OUQ A;  2Y73 A;  2ZDJ A;  3BND A;  3GRD A;  4JF8 A;  3PZW A;  2CWV A;  2ZL8 A;  3UNL A;  2XSH B;  4FMA A;  3QK9 A;  1SJW A;  2A15 A;  1AVL A;  3A76 A;  3FG1 A;  1T5Y A;  3PGB A;  3CCR 3;  5AEW B;  2FGT A;  2BMR B;  4HZ9 B;  3CME 3;  2CG0 A;  3LXU X;  4BTW A;  3FG3 A;  1KQS 2;  1F8N A;  1HKX A;  2OCT A;  1STF I;  3DXO A;  3F7S A;  2Z77 A;  4O8S A;  1O7W B;  3F9S A;  1R4C A;  3KN4 A;  3LTC A;  4CCV A;  1KWI A;  1JRQ A;  3PS8 A;  4FCJ A;  3FF0 A;  1W2B 2;  1GYB A;  4IIA A;  4U13 A;  4ZM8 A;  2B24 B;  1AV4 A;  2Z6B A;  1OGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...