5IENA

Structure of cdl2.2, a computationally designed vitamin-d3 binder
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
129
Chain Sequence
b'QSAKEAIEAALADFVKAYNSKDAAGVASKYMDDAAIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKLTTLDVQESGDFAFESGSISLKGPGKDSKLVDIAGKYVEVWRKGQDGGWKLYRTIANLDPAEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDL2.2
publication title Structure of CDL2.2, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 36
structure length 129
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ienA00
1JKGA 1OH0A 3SOAA 4L8OA 3ROBA 5CLKA 2RGQA 3B7CA 1JB2A 4R1KA 2RFRA 4RZMA 2YFLB 1Q40A 3EHCA 1O7PB 1OHPA 3GWRA 3MG1A 4H3UA 5IF6A 1CQSA 1EG9B 3CPOA 4X2HA 3MKIA 4PEJA 1E3RA 3BB9A 5BVBA 1W6YA 1OCVA 1JB5A 3EC9A 1UUWB 3F9SA 2W2CA 3JUMA 5FW5A 3UNLA 3MYTA 3MSOA 3EBYA 3KE7A 4XM4A 2IMJA 1JN5A 1TP6A 5AIIA 4XB5A 1GYBA 4WYKA 5AIFA 1U5OA 4XDWA 3EX9A 5IG4A 1NDOB 4IIAA 5STDA 3OV4A 2GXFA 3VGNA 2YFIB 4WWUC 3LYGA 3B8LA 1K41A 2GEXA 3G16A 5AEUB 3FF0A 4HM5B 5EVHA 1DMNA 4HM2B 2JQ5A 1C7HA 3RGAA 4HM1B 1NWWA 3IPTA 3EF8A 5G2GA 1QJGA 2OWPA 4HKVB 1Z1SA 3NBRA 3UJMA 3FF2A 4R9KA 2GEYA 1Q40B 3GZYB 3HK4A 2F99A 1GS3A 3F14A 3FH1A 2HMOB 4XDVA 3HX8A 1AR0A 3CNXA 1OF5B 4ORLA 1GY5A 5JPUA 1E3VA 3JUNA 3OXAA 3FZWA 4J9AA 5AIGA 4HM0B 4U13A 4L7KA 2B24B 2YFJB 1E97A 5CK6A 3CU3A 2XRXB 1A2KA 4WYKB 1IDPA 5KP4A 5AIHA 4HM7B 1WQLB 3B4PA 2R4IA 2CHCA 2Z7AA 1ASKA 3FGYA 1DMQA 4HZ9B 3RGRA 2GBXB 4HM6B 2QIYA 3GRDA 5DREA 2HMLB 5AEWB 3FLJA 1W01A 3JUOA 3GZRA 5TGNA 1UUVB 5CF2A 3SOYA 3NHXA 2I9WA 5IG3A 1Q42A 1ZO2A 1ZX2A 3F8XA 4K1UA 4STDA 4HVNA 2UX0A 3NUVA 1HKXA 3NV0A 4Q53A 5AI1A 2RCDA 1OGZA 3MG3A 1TUHA 2CKFB 1JKGB 5D81A 1O7WB 1O7MB 3ER7A 1ULJB 1SJWA 3DXOA 3FKAA 5IEPA 4OVMA 3KSPA 3HZPA 2HMJB 3GZBA 1ISKA 3EN8A 5D82A 2BMOB 3MG2A 3A76A 5DRVA 5CXOA 2GBWB 3OWYA 3T8UA 2F98A 4GB5A 4FCMA 1OUNA 5KP1A 2Z77A 1W00A 1STDA 2XSOB 3KKGA 2K54A 3VSYA 3K0ZA 4R9LA 3F7SA 1O7GB 4J8TA 5IG5A 4MJDA 3GZXB 5IENA 1JN5B 1EA2A 3F7XA 1GY6A 5IEOA 2STDA 3D9RA 1OHSA 4LEHA 3BLZA 3EBTA 6STDA 3OWSA 1ULIB 4HM8B 2HMMB 4CDLA 5IG0A 2A15A 1BUQA 8CHOA 3JUQA 3NV0B 1OGXA 3NXJA 4KVHA 1OHOA 3M8CA 3ECFA 1QMAA 1OF5A 5HGRA 3DZLA 2QGUA 1W02A 2Z76A 3T8NA 1S5AA 3JUPA 2HMKB 4OUQA 4X2OA 3Q90A 7STDA 3EQQB 3K7CA 1OPYA 1VZZA 3STDA 3DM8A 3G0KA 4HJLB 2INXA 3DUKA 4XBTA 2HMNB 4WP5A 3OWUA 1NU3A 2XR8B 4K1VA 1JB4A 3WMDA 2PZVA 3DMCA 4FCJA 1O7NB 3NM2A 5D83A 3SEDA 3EN1B 5IERA 5BXQA 2BMRB 2BNGA 4I4KA 4N3VA 4XBXA 5JPPA 3E99A 3H3HA 1DMMA 3F8HA 3CNMA 3EJVA 4LGQA 3G8ZA 5KP3A 4LMIA 4HZBB 3F40A 3H51A 4HM3B 3I0YA 2XSHB 1O7HB 3S5CA 1GY7A 2B1XB 3OX9A 4HM4B 4L8PA 3LZAA 2F86B 2BMQB 3FSDA 3MHEA 3B4OA 4XBYA 5CF1A 3KZTA
chains in the Genus database with same CATH superfamily
4AKYA 1JKGA 1OH0A 1V57A 3SOAA 3BIRA 1FA3A 4L8OA 5FGOA 3ROBA 5CLKA 4BTXA 1OACA 2W9PA 2W6JH 2RGQA 3WOFB 3LH4A 4NPBA 1NNVA 1VQM3 1NB5I 3J7Yd 1Q814 1RCLA 2W04A 4BL3A 3B7CA 1BGSA 1JB2A 1NB3I 4IT7A 1QVG2 4R1KA 2P0MA 2CK3H 2RFRA 3Q3FA 4RZMA 2YFLB 1Q40A 1W6CA 2C4BA 2KCDA 2ZHXB 3EHCA 3FCSB 3IJEB 3CC43 1O7PB 3WR2A 1RNBA 2W9QA 3X3ZA 1BRSA 4HBRA 1OHPA 1X1UA 3GWRA 3MG1A 4FMBA 2CWTA 4H3UA 4MMYB 5IF6A 1CQSA 1SIHA 1ZGXA 1EG9B 3DGOA 2WGOA 1YJN3 2IUKA 3RDEA 1RSNA 3CPOA 3FG3A 3L0RA 1IK3A 4X2HA 1T3BA 1VQP3 3MKIA 2E2UA 1BSCA 3K0ZA 4PEJA 3ZG0A 1E3RA 3BB9A 5BVBA 1YHQ3 1W6YA 2MC8A 1CH0A 1OCVA 1TFOA 1JB5A 4EXRA 1UGHI 3EC9A 5ELUA 3CXC2 3G713 1UUWB 5IW9A 3EE1A 1M9GA 3BU4A 3F9SA 2W2CA 3ZG5A 3JUMA 5FW5A 3UNLA 1V58A 2R41A 4HM3B 3MYTA 2IA7A 1BSEA 3O8YA 2ML6A 2IUJA 4BTYA 3MSOA 3EBYA 1FGMA 2SBLA 2IMJA 2W56B 1JN5A 3HOHA 3KE7A 4XM4A 3KN4A 2CX0A 2OCTA 3QRDA 1LQGC 1TP6A 1Q7HA 4R80A 5AIIA 3BNEA 4XB5A 1GYBA 4WYKA 1RGKA 1LOXA 2BO9B 1IVVA 4CJNA 1BNFA 1BNGA 2F5MA 1PFPA 1B2ZA 1MOLA 2CC3A 1RKYA 1LNIA 3WODG 5AIFA 5G1KA 1U5OA 4XDWA 3X3XA 3EX9A 1ZS7A 3CD63 2BT3A 5IG4A 1BNJA 1NDOB 1LXEA 1LOWA 4IIAA 1VQQA 3CPW2 4ILFA 2RSXA 1YIJ3 3NBJA 5STDA 3PS8A 3OV4A 1BOXA 3U97A 1QALA 2GXFA 3IMAB 3UL5A 1LRAA 1LVNA 3VGNA 1MWUA 3D79A 2YFIB 3PXMA 4O2HA 4WWUC 3FG1A 3I553 3LYGA 3B8LA 4EC6A 1K41A 2GEXA 3G16A 4ZM8A 5AEUB 1RJOA 1UCIA 3LT8A 3FF0A 4HM5B 5EVHA 3EB8A 1RGLA 1DMNA 2C11A 4GL6A 4HM2B 3CMA3 2JQ5A 3N9HA 3RNTA 1C7HA 4AKZA 5M1AA 4R9LA 3RGAA 1IQ8A 1JZDA 4HM1B 1NWWA 1G0TA 1SIIA 1RHLA 3CCM3 2QA43 1TRPA 5I97A 1PYLA 1C54A 3IPTA 1FW7A 3EF8A 8RNTA 5G2GA 1BSDA 1QJGA 2KF3A 2OWPA 4HKVB 3WOEB 1Z1SA 2E2TA 3NBRA 3UJMA 2XGNA 7GSPA 3FF2A 4KT3B 4R9KA 3FG4A 1HZ1A 1FUSA 2GEYA 3CCQ3 1RGFA 1Q40B 3GZYB 1MGRA 1UGIA 1B20A 3HK4A 3LT9A 2F99A 1GS3A 3SX1A 3DH2A 4EV2A 2Y73A 2RBIA 3F14A 3FH1A 1VQ73 1T2IA 2FGTA 1IQYA 2HMOB 4XDVA 2PNCA 3HX8A 1AR0A 1G96A 3CNXA 1GD3A 1RTUA 1K8A4 3S29A 1OF5B 2BHMA 2P09A 1I3FA 1BRJA 3D5GA 1GY5A 1SPUA 3HIGA 4ORLA 2OQEA 1Y4KA 1E3VA 3JUNA 5JPUA 3OXAA 1F8NA 4EW5A 3FZWA 4J9AA 1IVUA 5AIGA 1AQZA 2HOHA 5HOHA 1SARA 4HM0B 2CX1A 3NM7A 4U13A 4L7KA 2WO0A 2B24B 1IYYA 2XGLA 1TU5A 1RN7A 2YFJB 1VQO3 1Q7Y4 1E97A 3D5IA 4KZ1A 3N54B 5CK6A 3CCR3 2OOVC 1BIRA 3CU3A 2AAEA 2UUGC 3CME3 2CWUA 2XFSA 1A2KA 2XRXB 4WYKB 1IDPA 4K61A 5KP4A 2KRTA 5AIHA 1K9M4 1MNLA 4HM7B 1WQLB 3B4PA 1IT8A 2R4IA 4FMAA 1J2BA 2CHCA 2CWVA 1ASKA 2Z7AA 1RN1A 1BANA 2FNQA 3FGYA 1DMQA 5BIRA 4HZ9B 4RNZA 4MMZB 3KCHA 1BNIA 1BAOA 3RGRA 2GBXB 1VQN3 4HM6B 1S723 2QIYA 2M7OA 1I2FA 4HOHA 5JBSA 1N5HA 3U1WA 3GRDA 2H0GA 5DREA 1GMRA 2HMLB 4LYLB 5AYSC 1VQL3 2OQEC 2J8XB 3FLJA 5AEWB 1K734 1KQS2 1W01A 3JUOA 1B2SA 3GZRA 4DKIA 5BU4A 3CCU3 5TGNA 2RNTA 3NQZA 1K28A 1A90A 4I5QA 2BIRA 1KWIA 1UUVB 3X41A 2F4YA 5CF2A 3SOYA 3DGYA 1GMQA 2KAAA 3NHXA 2I9WA 5IG3A 1AVKA 1RNTA 4J5GA 1B2UA 1RCKA 2GU1A 3BNBA 3MPHA 3CCV3 2WGQA 2OTJ3 1Q42A 1ZO2A 1BRKA 1BNEA 4HYZA 4JF8A 1ZX2A 3F8XA 1HU9A 4K1UA 1IVWA 1US1A 1A2PA 4BL2A 1EKMA 1PY3A 2CH9A 1FYSA 3URPA 1N9EA 1X1YA 1BRGA 1W6GA 3S28A 3WDGB 2XH9A 4GHOA 4N6NB 1JNQA 2P0XA 4HVNA 1YVSA 4O8SA 1MWSA 4R4KA 4STDA 3K9MC 2UX0A 1UCKA 1HKXA 3NUVA 1RN4A 3NV0A 4NREA 4Q53A 1QAKA 5AI1A 2RCDA 1FGOA 1JRQA 1MGWA 1OGZA 4AEQA 3MG3A 1GOVA 3AHWA 1IT7A 1TUHA 2CKFB 1DYUA 4N6TA 3WA2X 1VQ63 1M904 3QK9A 1YGWA 1JKGB 1V74A 1T5YA 5D81A 2H0IA 1O7WB 3LTCA 1O7MB 1N8QA 4JRFA 3DGLA 3ER7A 1ULJB 2OOVA 1D6ZA 4LSOA 1D6UA 1JJ22 2WOHA 1I0VA 1SQWA 3WHOA 1NJI4 1SJWA 2K3DA 3DXOA 3FKAA 5IEPA 4OVMA 1BNSA 1ROAA 3HZPA 1W5ZA 2HMJB 2L4VA 3KSPA 1DVDA 3GZBA 3K63A 1ISKA 2V1LA 2F56A 1UDII 4WHAA 1T2HA 1STFI 1I0XA 1TIJA 3EN8A 1RGAA 3KIIA 4MEIA 1WMOA 5D82A 3V92A 2Z6BA 1G02A 2BMOB 1GMPA 3MG2A 3A76A 5DRVA 5CXOA 2GBWB 3AMOA 3Q1CA 5G1LA 3OWYA 3T8UA 2F98A 4GB5A 4EBGA 4FCMA 1OUNA 5KP1A 2L1SA 4CCVA 1JZOA 3LTDA 4H61A 3NQYA 2Z77A 3SLUA 4G1MB 1W00A 1STDA 3BNCA 2XSOB 3KKGA 2JDIH 1YIT3 1I3IA 1TJDA 4O02B 3KFQC 5GSPA 4KFEA 2K54A 3VSYA 1UI7A 1FUTA 1GSPA 1TTOA 2WOFA 2IY2A 1MWRA 3F7SA 2KXGA 1TRQA 3GAXA 3HIIA 1O7GB 2CFWA 1B27A 1GOUA 4J8TA 3NBBA 4N6V0 9RNTA 1IQXA 2CFKA 5IG5A 2O3OA 2OTL3 4MJDA 3GZXB 5IENA 3DGMA 1BNRA 1R4YA 1EEJA 1JN5B 1EA2A 3A5EA 3F7XA 1N9JA 3K5TA 4FR9A 1GD4A 1BU4A 1GY6A 2KF4A 4N6MA 5IEOA 2STDA 1BVIA 2ZL8A 1W2B2 3D3LA 3D9RA 1L5GB 1OHSA 1WMPA 1U8CB 3T0UA 1YGEA 4LEHA 1B2MA 1RRHA 3WA3A 3BLZA 1D6YA 1LQMB 1FGQA 4RNTA 5EEOA 3PYJA 4EV5A 1I70A 1YJ93 3EBTA 6STDA 2CFDA 3OWSA 1W2ZA 1ULIB 4IPBA 3UL6A 1FZUA 1BRNL 1A2VA 1W7CA 3DY5A 4HM8B 2HMMB 4CDLA 5IG0A 1B21A 1LOVA 1UUGB 2A15A 4J5KA 1RLSA 1BUQA 8CHOA 1YJW3 3S67A 1M1K4 1JBSA 3JUQA 3NV0B 2GSPA 1I8VA 4N6LA 1UCJA 3HI7A 4TX4A 1IU7A 1OGXA 1VQ93 3NXJA 2W0QA 4KVHA 2CG0A 2D1WA 1OHOA 1DETA 3M8CA 1CYVA 3AGOA 3LOYA 3GSPA 3X40A 3ECFA 1BSAA 2E2VA 2F5WA 1QMAA 5EQLA 3CCJ3 1OF5A 4K90B 2SARA 1RRLA 3ALAA 1KD14 3JVCA 5HGRA 2FXTA 3DZLA 2QGUA 3VF1A 2XFTA 1M1XB 3SXXA 3LXUX 1W02A 2Z76A 5ELJA 5A0OB 1B3SA 1Q824 1IV9A 1BRIA 3CCS3 1QVF2 3SYUA 3T8NA 1S5AA 3JUPA 2HMKB 4OUQA 1WMNA 4X2OA 1RGGA 3Q90A 4BU4A 7STDA 4N6OB 3EQQB 3K7CA 6RNTA 2K0MA 3G6E3 1KC84 1OPYA 2IYJA 1VZZA 2YX9A 3AMOB 1AV4A 3STDA 3KSED 3Q2PA 4MMXB 1VQK3 3DM8A 3G0KA 4HJLB 3PCSA 2ZDJA 2INXA 4RBNA 1CEWI 1IV7A 3DUKA 4XBTA 2HMNB 2KF6A 1LOYA 3AGNA 2LYXA 4WFOA 1QAFA 1AVLA 3I563 3PGBA 3CCL3 3ZFZA 1FGTA 3MWZA 4KFDA 4CPKA 2QEX3 4WP5A 1EQKA 1JBTA 3PCRA 3N8BA 3AHSA 3OWUA 1VQ43 4BTWA 1NU3A 1RGEA 2CFLA 2XR8B 2C10A 1TFKA 1BRHA 2BU4A 2MF7A 5RNTA 4K1VA 3LMLA 1N5PA 1JB4A 3WMDA 1RDSA 4O3VA 3V99A 1MWTA 1YI23 2PZVA 1YNVX 2CFGA 2GU3A 3DMCA 3LTBA 1NO3A 4FCJA 1N8R4 1WNHA 6GSPA 2ML5A 1O7NB 3OW22 1YVBI 2P38A 1W4NA 3NM2A 3D4AA 1RGHA 1WTHA 2UGIA 4LZIA 5D83A 4FMCA 3SEDA 3EN1B 3TDGA 2P05A 5IERA 1I2EA 5BXQA 3CCE3 2BMRB 3V98A 1RMSA 1A67A 1AY7A 2BNGA 7RNTA 3X42A 5M19A 2KF5A 1GOYA 4I4KA 1VQ53 2CIUA 4N3VA 1RGCA 4HAAA 2W03A 2W56A 4NHFA 4XBXA 5AYRB 3X3YA 3G4S3 5JPPA 3E99A 3UB1A 1JBRA 3BNDA 2H0HA 2O9UX 3H3HA 1DMMA 1DVCA 5LC7A 3F8HA 3CNMA 1FUWA 4QWTA 4OK0A 2D42A 1KSIA 2XF3A 3EJVA 3S27A 3CC23 1VQ83 4LGQA 3G8ZA 4N6UA 5KP3A 3CC73 2Q07A 3LTAA 1FGRA 1B2XA 4HZBB 4LMIA 4KFFA 1UW1A 2AADA 3PZWA 4EYCA 2Y74A 3SVAA 1Q864 3DGNA 1HYFA 1UI8A 3F40A 1I2GA 3H51A 1UCLA 1X1WA 4FMDA 3I0YA 3NX0A 2XEPA 2XSHB 2LQVA 4FCZA 1DE3A 1LNHA 1O7HB 1R4CA 3S5CA 1GY7A 2B1XB 3OX9A 1BSBA 4GSPA 4HM4B 1X1XA 1EUIC 2CG1A 4L8PA 2ZA4A 5LC6A 3LZAA 1Q9EA 2F86B 4BIRA 1BUJA 1CYUA 1IVXA 1JV2B 2BMQB 3FSDA 3MHEA 3B4OA 2CW9A 5M18A 4XBYA 4RNYA 5CF1A 1PU4A 1ROVA 3KZTA
chains in the Genus database with same CATH topology
4AKYA 1JKGA 1OH0A 3SOAA 1FA3A 4L8OA 5FGOA 3ROBA 5CLKA 1OACA 2W9PA 2W6JH 2RGQA 3WOFB 3LH4A 1VQM3 1NB5I 3J7Yd 1Q814 2W04A 3B7CA 1JB2A 1NB3I 4IT7A 1QVG2 4R1KA 2P0MA 2CK3H 2RFRA 4RZMA 2YFLB 1Q40A 1W6CA 3IJEB 2KCDA 3EHCA 3FCSB 3CC43 1O7PB 2W9QA 3X3ZA 4HBRA 1OHPA 4FMBA 3GWRA 3MG1A 4H3UA 2CWTA 5IF6A 4MMYB 1CQSA 1SIHA 3DGOA 1EG9B 2WGOA 1YJN3 2IUKA 3RDEA 3CPOA 3FG3A 3L0RA 1IK3A 4X2HA 1VQP3 3MKIA 2E2UA 4PEJA 1E3RA 3BB9A 5BVBA 1YHQ3 1W6YA 2MC8A 1OCVA 1TFOA 1JB5A 4EXRA 3EC9A 5ELUA 3CXC2 3G713 1UUWB 5IW9A 3EE1A 1M9GA 3F9SA 2W2CA 3JUMA 5FW5A 3UNLA 3MYTA 2IA7A 3O8YA 2ML6A 2IUJA 4BTYA 3MSOA 3EBYA 1FGMA 2SBLA 2IMJA 2W56B 1JN5A 3KE7A 4XM4A 3KN4A 2OCTA 3QRDA 1TP6A 4R80A 5AIIA 3BNEA 4XB5A 1GYBA 4WYKA 1LOXA 2BO9B 1IVVA 1PFPA 1MOLA 2CC3A 1RKYA 3WODG 5AIFA 1U5OA 4XDWA 3X3XA 3EX9A 3CD63 2BT3A 5IG4A 1NDOB 1LXEA 4IIAA 3CPW2 1YIJ3 2RSXA 3NBJA 5STDA 3PS8A 3OV4A 3UL5A 3U97A 1QALA 2GXFA 3IMAB 1LVNA 3VGNA 3PXMA 2YFIB 4O2HA 4WWUC 3I553 3FG1A 3LYGA 3B8LA 4EC6A 1K41A 2GEXA 3G16A 4ZM8A 5AEUB 1RJOA 3LT8A 3FF0A 4HM5B 5EVHA 3EB8A 3CMA3 1DMNA 2C11A 4GL6A 4HM2B 1VQN3 2JQ5A 3N9HA 1C7HA 4AKZA 3RGAA 1IQ8A 4HM1B 1NWWA 1SIIA 3CCM3 2QA43 5I97A 3IPTA 3EF8A 5G2GA 1QJGA 2OWPA 4HKVB 3WOEB 1Z1SA 2E2TA 3NBRA 3UJMA 2XGNA 3FF2A 4R9KA 3FG4A 2GEYA 3CCQ3 1Q40B 3GZYB 3LT9A 3HK4A 4EV2A 2F99A 1GS3A 3SX1A 2Y73A 3F14A 3FH1A 1VQ73 2FGTA 1IQYA 2HMOB 4XDVA 2PNCA 3HX8A 1AR0A 1G96A 3CNXA 1GD3A 1K8A4 3S29A 1OF5B 2BHMA 2P09A 3HIGA 1GY5A 1SPUA 4ORLA 2OQEA 5JPUA 1Y4KA 1E3VA 3JUNA 3OXAA 1F8NA 3FZWA 4J9AA 1IVUA 5AIGA 4HM0B 4U13A 3NM7A 4L7KA 2WO0A 2B24B 2XGLA 1TU5A 1RN7A 2YFJB 1VQO3 1Q7Y4 1E97A 4KZ1A 3N54B 5CK6A 3CCR3 2OOVC 3CU3A 3CME3 2CWUA 2XFSA 1A2KA 2XRXB 4WYKB 1IDPA 4K61A 5KP4A 2KRTA 5AIHA 1K9M4 1MNLA 4HM7B 1WQLB 3B4PA 1IT8A 2R4IA 4FMAA 1J2BA 2CHCA 2CWVA 1ASKA 2Z7AA 2FNQA 3FGYA 1DMQA 4HZ9B 4RNZA 4MMZB 3RGRA 2GBXB 4HM6B 1S723 2QIYA 2M7OA 5JBSA 1N5HA 3U1WA 3GRDA 5DREA 2HMLB 5AYSC 1VQL3 2OQEC 5AEWB 3FLJA 1K734 1KQS2 1W01A 3JUOA 3GZRA 3CCU3 5TGNA 3NQZA 1K28A 1A90A 1KWIA 1UUVB 3X41A 5CF2A 3SOYA 3NHXA 2I9WA 5IG3A 1AVKA 2GU1A 3BNBA 3MPHA 3CCV3 2WGQA 2OTJ3 1Q42A 1ZO2A 4HYZA 4JF8A 1ZX2A 3F8XA 1HU9A 4K1UA 1IVWA 1US1A 1EKMA 2CH9A 1N9EA 1W6GA 3S28A 3WDGB 2XH9A 4N6NB 4STDA 1JNQA 2P0XA 4HVNA 4O8SA 4R4KA 3K9MC 2UX0A 3NUVA 1HKXA 3NV0A 4NREA 4Q53A 5AI1A 1QAKA 2RCDA 1FGOA 1JRQA 1OGZA 4AEQA 3MG3A 1IT7A 1TUHA 2CKFB 1DYUA 4N6TA 3WA2X 1VQ63 1M904 3QK9A 1JKGB 1V74A 1T5YA 5D81A 1O7WB 3LTCA 1O7MB 1N8QA 4JRFA 3DGLA 3ER7A 1ULJB 2OOVA 1D6ZA 4LSOA 1D6UA 1JJ22 2WOHA 1SQWA 1NJI4 1SJWA 3DXOA 3FKAA 5IEPA 4OVMA 1ROAA 3HZPA 1W5ZA 2HMJB 2L4VA 3KSPA 1DVDA 3GZBA 3K63A 1ISKA 2V1LA 4WHAA 3EN8A 1STFI 4MEIA 1TIJA 5D82A 3V92A 3KIIA 1WMOA 2Z6BA 2BMOB 3MG2A 3A76A 5DRVA 5CXOA 2GBWB 3AMOA 3Q1CA 3OWYA 3T8UA 2F98A 4GB5A 4EBGA 4FCMA 1OUNA 5KP1A 4CCVA 3LTDA 4H61A 3NQYA 2Z77A 3SLUA 4G1MB 1W00A 1STDA 3BNCA 2XSOB 3KKGA 2JDIH 1YIT3 4O02B 3KFQC 4KFEA 2K54A 3VSYA 1UI7A 3K0ZA 4BTXA 2WOFA 4R9LA 3F7SA 3GAXA 2KXGA 3HIIA 1O7GB 2CFWA 4J8TA 3NBBA 4N6V0 5IG5A 1IQXA 2CFKA 2OTL3 2O3OA 4MJDA 3GZXB 5IENA 3DGMA 1JN5B 1EA2A 3F7XA 3K5TA 1N9JA 4FR9A 1GD4A 1GY6A 4N6MA 5IEOA 2STDA 2ZL8A 1W2B2 3D3LA 3D9RA 1L5GB 1OHSA 1WMPA 1U8CB 3T0UA 1YGEA 4LEHA 1RRHA 3WA3A 3BLZA 1D6YA 1FGQA 5EEOA 3PYJA 4EV5A 1YJ93 3EBTA 6STDA 2CFDA 3OWSA 1W2ZA 1ULIB 4IPBA 3UL6A 1A2VA 1W7CA 3DY5A 4HM8B 2HMMB 4CDLA 5IG0A 2A15A 1BUQA 8CHOA 1YJW3 3S67A 1M1K4 3JUQA 3NV0B 4N6LA 3HI7A 4TX4A 1IU7A 1OGXA 1VQ93 3NXJA 2W0QA 4KVHA 2CG0A 2D1WA 1OHOA 3M8CA 1CYVA 3LOYA 3X40A 3ECFA 2E2VA 1QMAA 5EQLA 3CCJ3 1OF5A 4K90B 1KD14 1RRLA 3ALAA 3JVCA 5HGRA 2FXTA 3DZLA 2QGUA 3VF1A 2XFTA 1M1XB 3SXXA 3LXUX 1W02A 2Z76A 5ELJA 5A0OB 1Q824 1IV9A 1QVF2 3CCS3 3T8NA 1S5AA 3JUPA 2HMKB 4OUQA 1WMNA 4X2OA 3Q90A 7STDA 4N6OB 3EQQB 3K7CA 2K0MA 3G6E3 1KC84 1OPYA 1VZZA 2YX9A 3AMOB 1AV4A 3STDA 3KSED 3Q2PA 4MMXB 1VQK3 3DM8A 3G0KA 4HJLB 3PCSA 2ZDJA 2INXA 4RBNA 1CEWI 1IV7A 3DUKA 4XBTA 2HMNB 2LYXA 4WFOA 1QAFA 1AVLA 3I563 3PGBA 3CCL3 1FGTA 3MWZA 4KFDA 2QEX3 4WP5A 1EQKA 3PCRA 3N8BA 3OWUA 1VQ43 4BTWA 1NU3A 2CFLA 2XR8B 2C10A 1TFKA 2MF7A 4K1VA 3LMLA 1N5PA 1JB4A 3WMDA 4O3VA 3V99A 1YI23 2PZVA 2CFGA 2GU3A 3DMCA 3LTBA 1NO3A 4FCJA 1N8R4 1WNHA 2ML5A 1O7NB 3OW22 1YVBI 2P38A 1W4NA 3NM2A 1WTHA 4LZIA 5D83A 4FMCA 3SEDA 3EN1B 3TDGA 2P05A 5IERA 5BXQA 3CCE3 2BMRB 3V98A 1A67A 2BNGA 3X42A 4I4KA 1VQ53 2CIUA 4N3VA 2W03A 2W56A 4NHFA 4XBXA 5AYRB 3X3YA 3G4S3 5JPPA 3E99A 3UB1A 3BNDA 2O9UX 3H3HA 1DMMA 1DVCA 5LC7A 3F8HA 3CNMA 1FUWA 4QWTA 4OK0A 2D42A 1KSIA 2XF3A 3EJVA 3S27A 3CC23 4LGQA 3G8ZA 4N6UA 5KP3A 3CC73 2Q07A 3LTAA 1FGRA 4HZBB 4LMIA 4EYCA 4KFFA 1UW1A 3PZWA 1VQ83 2Y74A 3SVAA 1Q864 3DGNA 1UI8A 3F40A 3H51A 4FMDA 4HM3B 3I0YA 3NX0A 2XEPA 2XSHB 2LQVA 4FCZA 1LNHA 1O7HB 1R4CA 3S5CA 1GY7A 2B1XB 3OX9A 4HM4B 2CG1A 4L8PA 5LC6A 3LZAA 2F86B 1CYUA 1IVXA 1JV2B 2BMQB 3FSDA 3MHEA 3B4OA 2CW9A 1PU4A 4XBYA 4RNYA 5CF1A 1ROVA 3KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKG A;  1OH0 A;  3SOA A;  4L8O A;  3ROB A;  5CLK A;  2RGQ A;  3B7C A;  1JB2 A;  4R1K A;  2RFR A;  4RZM A;  2YFL B;  1Q40 A;  3EHC A;  1O7P B;  1OHP A;  3GWR A;  3MG1 A;  4H3U A;  5IF6 A;  1CQS A;  1EG9 B;  3CPO A;  4X2H A;  3MKI A;  4PEJ A;  1E3R A;  3BB9 A;  5BVB A;  1W6Y A;  1OCV A;  1JB5 A;  3EC9 A;  1UUW B;  3F9S A;  2W2C A;  3JUM A;  5FW5 A;  3UNL A;  3MYT A;  3MSO A;  3EBY A;  3KE7 A;  4XM4 A;  2IMJ A;  1JN5 A;  1TP6 A;  5AII A;  4XB5 A;  1GYB A;  4WYK A;  5AIF A;  1U5O A;  4XDW A;  3EX9 A;  5IG4 A;  1NDO B;  4IIA A;  5STD A;  3OV4 A;  2GXF A;  3VGN A;  2YFI B;  4WWU C;  3LYG A;  3B8L A;  1K41 A;  2GEX A;  3G16 A;  5AEU B;  3FF0 A;  4HM5 B;  5EVH A;  1DMN A;  4HM2 B;  2JQ5 A;  1C7H A;  3RGA A;  4HM1 B;  1NWW A;  3IPT A;  3EF8 A;  5G2G A;  1QJG A;  2OWP A;  4HKV B;  1Z1S A;  3NBR A;  3UJM A;  3FF2 A;  4R9K A;  2GEY A;  1Q40 B;  3GZY B;  3HK4 A;  2F99 A;  1GS3 A;  3F14 A;  3FH1 A;  2HMO B;  4XDV A;  3HX8 A;  1AR0 A;  3CNX A;  1OF5 B;  4ORL A;  1GY5 A;  5JPU A;  1E3V A;  3JUN A;  3OXA A;  3FZW A;  4J9A A;  5AIG A;  4HM0 B;  4U13 A;  4L7K A;  2B24 B;  2YFJ B;  1E97 A;  5CK6 A;  3CU3 A;  2XRX B;  1A2K A;  4WYK B;  1IDP A;  5KP4 A;  5AIH A;  4HM7 B;  1WQL B;  3B4P A;  2R4I A;  2CHC A;  2Z7A A;  1ASK A;  3FGY A;  1DMQ A;  4HZ9 B;  3RGR A;  2GBX B;  4HM6 B;  2QIY A;  3GRD A;  5DRE A;  2HML B;  5AEW B;  3FLJ A;  1W01 A;  3JUO A;  3GZR A;  5TGN A;  1UUV B;  5CF2 A;  3SOY A;  3NHX A;  2I9W A;  5IG3 A;  1Q42 A;  1ZO2 A;  1ZX2 A;  3F8X A;  4K1U A;  4STD A;  4HVN A;  2UX0 A;  3NUV A;  1HKX A;  3NV0 A;  4Q53 A;  5AI1 A;  2RCD A;  1OGZ A;  3MG3 A;  1TUH A;  2CKF B;  1JKG B;  5D81 A;  1O7W B;  1O7M B;  3ER7 A;  1ULJ B;  1SJW A;  3DXO A;  3FKA A;  5IEP A;  4OVM A;  3KSP A;  3HZP A;  2HMJ B;  3GZB A;  1ISK A;  3EN8 A;  5D82 A;  2BMO B;  3MG2 A;  3A76 A;  5DRV A;  5CXO A;  2GBW B;  3OWY A;  3T8U A;  2F98 A;  4GB5 A;  4FCM A;  1OUN A;  5KP1 A;  2Z77 A;  1W00 A;  1STD A;  2XSO B;  3KKG A;  2K54 A;  3VSY A;  3K0Z A;  4R9L A;  3F7S A;  1O7G B;  4J8T A;  5IG5 A;  4MJD A;  3GZX B;  5IEN A;  1JN5 B;  1EA2 A;  3F7X A;  1GY6 A;  5IEO A;  2STD A;  3D9R A;  1OHS A;  4LEH A;  3BLZ A;  3EBT A;  6STD A;  3OWS A;  1ULI B;  4HM8 B;  2HMM B;  4CDL A;  5IG0 A;  2A15 A;  1BUQ A;  8CHO A;  3JUQ A;  3NV0 B;  1OGX A;  3NXJ A;  4KVH A;  1OHO A;  3M8C A;  3ECF A;  1QMA A;  1OF5 A;  5HGR A;  3DZL A;  2QGU A;  1W02 A;  2Z76 A;  3T8N A;  1S5A A;  3JUP A;  2HMK B;  4OUQ A;  4X2O A;  3Q90 A;  7STD A;  3EQQ B;  3K7C A;  1OPY A;  1VZZ A;  3STD A;  3DM8 A;  3G0K A;  4HJL B;  2INX A;  3DUK A;  4XBT A;  2HMN B;  4WP5 A;  3OWU A;  1NU3 A;  2XR8 B;  4K1V A;  1JB4 A;  3WMD A;  2PZV A;  3DMC A;  4FCJ A;  1O7N B;  3NM2 A;  5D83 A;  3SED A;  3EN1 B;  5IER A;  5BXQ A;  2BMR B;  2BNG A;  4I4K A;  4N3V A;  4XBX A;  5JPP A;  3E99 A;  3H3H A;  1DMM A;  3F8H A;  3CNM A;  3EJV A;  4LGQ A;  3G8Z A;  5KP3 A;  4LMI A;  4HZB B;  3F40 A;  3H51 A;  4HM3 B;  3I0Y A;  2XSH B;  1O7H B;  3S5C A;  1GY7 A;  2B1X B;  3OX9 A;  4HM4 B;  4L8P A;  3LZA A;  2F86 B;  2BMQ B;  3FSD A;  3MHE A;  3B4O A;  4XBY A;  5CF1 A;  3KZT A; 
#chains in the Genus database with same CATH topology
 4AKY A;  1JKG A;  1OH0 A;  1V57 A;  3SOA A;  3BIR A;  1FA3 A;  4L8O A;  5FGO A;  3ROB A;  5CLK A;  4BTX A;  1OAC A;  2W9P A;  2W6J H;  2RGQ A;  3WOF B;  3LH4 A;  4NPB A;  1NNV A;  1VQM 3;  1NB5 I;  3J7Y d;  1Q81 4;  1RCL A;  2W04 A;  4BL3 A;  3B7C A;  1BGS A;  1JB2 A;  1NB3 I;  4IT7 A;  1QVG 2;  4R1K A;  2P0M A;  2CK3 H;  2RFR A;  3Q3F A;  4RZM A;  2YFL B;  1Q40 A;  1W6C A;  2C4B A;  2KCD A;  2ZHX B;  3EHC A;  3FCS B;  3IJE B;  3CC4 3;  1O7P B;  3WR2 A;  1RNB A;  2W9Q A;  3X3Z A;  1BRS A;  4HBR A;  1OHP A;  1X1U A;  3GWR A;  3MG1 A;  4FMB A;  2CWT A;  4H3U A;  4MMY B;  5IF6 A;  1CQS A;  1SIH A;  1ZGX A;  1EG9 B;  3DGO A;  2WGO A;  1YJN 3;  2IUK A;  3RDE A;  1RSN A;  3CPO A;  3FG3 A;  3L0R A;  1IK3 A;  4X2H A;  1T3B A;  1VQP 3;  3MKI A;  2E2U A;  1BSC A;  3K0Z A;  4PEJ A;  3ZG0 A;  1E3R A;  3BB9 A;  5BVB A;  1YHQ 3;  1W6Y A;  2MC8 A;  1CH0 A;  1OCV A;  1TFO A;  1JB5 A;  4EXR A;  1UGH I;  3EC9 A;  5ELU A;  3CXC 2;  3G71 3;  1UUW B;  5IW9 A;  3EE1 A;  1M9G A;  3BU4 A;  3F9S A;  2W2C A;  3ZG5 A;  3JUM A;  5FW5 A;  3UNL A;  1V58 A;  2R41 A;  4HM3 B;  3MYT A;  2IA7 A;  1BSE A;  3O8Y A;  2ML6 A;  2IUJ A;  4BTY A;  3MSO A;  3EBY A;  1FGM A;  2SBL A;  2IMJ A;  2W56 B;  1JN5 A;  3HOH A;  3KE7 A;  4XM4 A;  3KN4 A;  2CX0 A;  2OCT A;  3QRD A;  1LQG C;  1TP6 A;  1Q7H A;  4R80 A;  5AII A;  3BNE A;  4XB5 A;  1GYB A;  4WYK A;  1RGK A;  1LOX A;  2BO9 B;  1IVV A;  4CJN A;  1BNF A;  1BNG A;  2F5M A;  1PFP A;  1B2Z A;  1MOL A;  2CC3 A;  1RKY A;  1LNI A;  3WOD G;  5AIF A;  5G1K A;  1U5O A;  4XDW A;  3X3X A;  3EX9 A;  1ZS7 A;  3CD6 3;  2BT3 A;  5IG4 A;  1BNJ A;  1NDO B;  1LXE A;  1LOW A;  4IIA A;  1VQQ A;  3CPW 2;  4ILF A;  2RSX A;  1YIJ 3;  3NBJ A;  5STD A;  3PS8 A;  3OV4 A;  1BOX A;  3U97 A;  1QAL A;  2GXF A;  3IMA B;  3UL5 A;  1LRA A;  1LVN A;  3VGN A;  1MWU A;  3D79 A;  2YFI B;  3PXM A;  4O2H A;  4WWU C;  3FG1 A;  3I55 3;  3LYG A;  3B8L A;  4EC6 A;  1K41 A;  2GEX A;  3G16 A;  4ZM8 A;  5AEU B;  1RJO A;  1UCI A;  3LT8 A;  3FF0 A;  4HM5 B;  5EVH A;  3EB8 A;  1RGL A;  1DMN A;  2C11 A;  4GL6 A;  4HM2 B;  3CMA 3;  2JQ5 A;  3N9H A;  3RNT A;  1C7H A;  4AKZ A;  5M1A A;  4R9L A;  3RGA A;  1IQ8 A;  1JZD A;  4HM1 B;  1NWW A;  1G0T A;  1SII A;  1RHL A;  3CCM 3;  2QA4 3;  1TRP A;  5I97 A;  1PYL A;  1C54 A;  3IPT A;  1FW7 A;  3EF8 A;  8RNT A;  5G2G A;  1BSD A;  1QJG A;  2KF3 A;  2OWP A;  4HKV B;  3WOE B;  1Z1S A;  2E2T A;  3NBR A;  3UJM A;  2XGN A;  7GSP A;  3FF2 A;  4KT3 B;  4R9K A;  3FG4 A;  1HZ1 A;  1FUS A;  2GEY A;  3CCQ 3;  1RGF A;  1Q40 B;  3GZY B;  1MGR A;  1UGI A;  1B20 A;  3HK4 A;  3LT9 A;  2F99 A;  1GS3 A;  3SX1 A;  3DH2 A;  4EV2 A;  2Y73 A;  2RBI A;  3F14 A;  3FH1 A;  1VQ7 3;  1T2I A;  2FGT A;  1IQY A;  2HMO B;  4XDV A;  2PNC A;  3HX8 A;  1AR0 A;  1G96 A;  3CNX A;  1GD3 A;  1RTU A;  1K8A 4;  3S29 A;  1OF5 B;  2BHM A;  2P09 A;  1I3F A;  1BRJ A;  3D5G A;  1GY5 A;  1SPU A;  3HIG A;  4ORL A;  2OQE A;  1Y4K A;  1E3V A;  3JUN A;  5JPU A;  3OXA A;  1F8N A;  4EW5 A;  3FZW A;  4J9A A;  1IVU A;  5AIG A;  1AQZ A;  2HOH A;  5HOH A;  1SAR A;  4HM0 B;  2CX1 A;  3NM7 A;  4U13 A;  4L7K A;  2WO0 A;  2B24 B;  1IYY A;  2XGL A;  1TU5 A;  1RN7 A;  2YFJ B;  1VQO 3;  1Q7Y 4;  1E97 A;  3D5I A;  4KZ1 A;  3N54 B;  5CK6 A;  3CCR 3;  2OOV C;  1BIR A;  3CU3 A;  2AAE A;  2UUG C;  3CME 3;  2CWU A;  2XFS A;  1A2K A;  2XRX B;  4WYK B;  1IDP A;  4K61 A;  5KP4 A;  2KRT A;  5AIH A;  1K9M 4;  1MNL A;  4HM7 B;  1WQL B;  3B4P A;  1IT8 A;  2R4I A;  4FMA A;  1J2B A;  2CHC A;  2CWV A;  1ASK A;  2Z7A A;  1RN1 A;  1BAN A;  2FNQ A;  3FGY A;  1DMQ A;  5BIR A;  4HZ9 B;  4RNZ A;  4MMZ B;  3KCH A;  1BNI A;  1BAO A;  3RGR A;  2GBX B;  1VQN 3;  4HM6 B;  1S72 3;  2QIY A;  2M7O A;  1I2F A;  4HOH A;  5JBS A;  1N5H A;  3U1W A;  3GRD A;  2H0G A;  5DRE A;  1GMR A;  2HML B;  4LYL B;  5AYS C;  1VQL 3;  2OQE C;  2J8X B;  3FLJ A;  5AEW B;  1K73 4;  1KQS 2;  1W01 A;  3JUO A;  1B2S A;  3GZR A;  4DKI A;  5BU4 A;  3CCU 3;  5TGN A;  2RNT A;  3NQZ A;  1K28 A;  1A90 A;  4I5Q A;  2BIR A;  1KWI A;  1UUV B;  3X41 A;  2F4Y A;  5CF2 A;  3SOY A;  3DGY A;  1GMQ A;  2KAA A;  3NHX A;  2I9W A;  5IG3 A;  1AVK A;  1RNT A;  4J5G A;  1B2U A;  1RCK A;  2GU1 A;  3BNB A;  3MPH A;  3CCV 3;  2WGQ A;  2OTJ 3;  1Q42 A;  1ZO2 A;  1BRK A;  1BNE A;  4HYZ A;  4JF8 A;  1ZX2 A;  3F8X A;  1HU9 A;  4K1U A;  1IVW A;  1US1 A;  1A2P A;  4BL2 A;  1EKM A;  1PY3 A;  2CH9 A;  1FYS A;  3URP A;  1N9E A;  1X1Y A;  1BRG A;  1W6G A;  3S28 A;  3WDG B;  2XH9 A;  4GHO A;  4N6N B;  1JNQ A;  2P0X A;  4HVN A;  1YVS A;  4O8S A;  1MWS A;  4R4K A;  4STD A;  3K9M C;  2UX0 A;  1UCK A;  1HKX A;  3NUV A;  1RN4 A;  3NV0 A;  4NRE A;  4Q53 A;  1QAK A;  5AI1 A;  2RCD A;  1FGO A;  1JRQ A;  1MGW A;  1OGZ A;  4AEQ A;  3MG3 A;  1GOV A;  3AHW A;  1IT7 A;  1TUH A;  2CKF B;  1DYU A;  4N6T A;  3WA2 X;  1VQ6 3;  1M90 4;  3QK9 A;  1YGW A;  1JKG B;  1V74 A;  1T5Y A;  5D81 A;  2H0I A;  1O7W B;  3LTC A;  1O7M B;  1N8Q A;  4JRF A;  3DGL A;  3ER7 A;  1ULJ B;  2OOV A;  1D6Z A;  4LSO A;  1D6U A;  1JJ2 2;  2WOH A;  1I0V A;  1SQW A;  3WHO A;  1NJI 4;  1SJW A;  2K3D A;  3DXO A;  3FKA A;  5IEP A;  4OVM A;  1BNS A;  1ROA A;  3HZP A;  1W5Z A;  2HMJ B;  2L4V A;  3KSP A;  1DVD A;  3GZB A;  3K63 A;  1ISK A;  2V1L A;  2F56 A;  1UDI I;  4WHA A;  1T2H A;  1STF I;  1I0X A;  1TIJ A;  3EN8 A;  1RGA A;  3KII A;  4MEI A;  1WMO A;  5D82 A;  3V92 A;  2Z6B A;  1G02 A;  2BMO B;  1GMP A;  3MG2 A;  3A76 A;  5DRV A;  5CXO A;  2GBW B;  3AMO A;  3Q1C A;  5G1L A;  3OWY A;  3T8U A;  2F98 A;  4GB5 A;  4EBG A;  4FCM A;  1OUN A;  5KP1 A;  2L1S A;  4CCV A;  1JZO A;  3LTD A;  4H61 A;  3NQY A;  2Z77 A;  3SLU A;  4G1M B;  1W00 A;  1STD A;  3BNC A;  2XSO B;  3KKG A;  2JDI H;  1YIT 3;  1I3I A;  1TJD A;  4O02 B;  3KFQ C;  5GSP A;  4KFE A;  2K54 A;  3VSY A;  1UI7 A;  1FUT A;  1GSP A;  1TTO A;  2WOF A;  2IY2 A;  1MWR A;  3F7S A;  2KXG A;  1TRQ A;  3GAX A;  3HII A;  1O7G B;  2CFW A;  1B27 A;  1GOU A;  4J8T A;  3NBB A;  4N6V 0;  9RNT A;  1IQX A;  2CFK A;  5IG5 A;  2O3O A;  2OTL 3;  4MJD A;  3GZX B;  5IEN A;  3DGM A;  1BNR A;  1R4Y A;  1EEJ A;  1JN5 B;  1EA2 A;  3A5E A;  3F7X A;  1N9J A;  3K5T A;  4FR9 A;  1GD4 A;  1BU4 A;  1GY6 A;  2KF4 A;  4N6M A;  5IEO A;  2STD A;  1BVI A;  2ZL8 A;  1W2B 2;  3D3L A;  3D9R A;  1L5G B;  1OHS A;  1WMP A;  1U8C B;  3T0U A;  1YGE A;  4LEH A;  1B2M A;  1RRH A;  3WA3 A;  3BLZ A;  1D6Y A;  1LQM B;  1FGQ A;  4RNT A;  5EEO A;  3PYJ A;  4EV5 A;  1I70 A;  1YJ9 3;  3EBT A;  6STD A;  2CFD A;  3OWS A;  1W2Z A;  1ULI B;  4IPB A;  3UL6 A;  1FZU A;  1BRN L;  1A2V A;  1W7C A;  3DY5 A;  4HM8 B;  2HMM B;  4CDL A;  5IG0 A;  1B21 A;  1LOV A;  1UUG B;  2A15 A;  4J5K A;  1RLS A;  1BUQ A;  8CHO A;  1YJW 3;  3S67 A;  1M1K 4;  1JBS A;  3JUQ A;  3NV0 B;  2GSP A;  1I8V A;  4N6L A;  1UCJ A;  3HI7 A;  4TX4 A;  1IU7 A;  1OGX A;  1VQ9 3;  3NXJ A;  2W0Q A;  4KVH A;  2CG0 A;  2D1W A;  1OHO A;  1DET A;  3M8C A;  1CYV A;  3AGO A;  3LOY A;  3GSP A;  3X40 A;  3ECF A;  1BSA A;  2E2V A;  2F5W A;  1QMA A;  5EQL A;  3CCJ 3;  1OF5 A;  4K90 B;  2SAR A;  1RRL A;  3ALA A;  1KD1 4;  3JVC A;  5HGR A;  2FXT A;  3DZL A;  2QGU A;  3VF1 A;  2XFT A;  1M1X B;  3SXX A;  3LXU X;  1W02 A;  2Z76 A;  5ELJ A;  5A0O B;  1B3S A;  1Q82 4;  1IV9 A;  1BRI A;  3CCS 3;  1QVF 2;  3SYU A;  3T8N A;  1S5A A;  3JUP A;  2HMK B;  4OUQ A;  1WMN A;  4X2O A;  1RGG A;  3Q90 A;  4BU4 A;  7STD A;  4N6O B;  3EQQ B;  3K7C A;  6RNT A;  2K0M A;  3G6E 3;  1KC8 4;  1OPY A;  2IYJ A;  1VZZ A;  2YX9 A;  3AMO B;  1AV4 A;  3STD A;  3KSE D;  3Q2P A;  4MMX B;  1VQK 3;  3DM8 A;  3G0K A;  4HJL B;  3PCS A;  2ZDJ A;  2INX A;  4RBN A;  1CEW I;  1IV7 A;  3DUK A;  4XBT A;  2HMN B;  2KF6 A;  1LOY A;  3AGN A;  2LYX A;  4WFO A;  1QAF A;  1AVL A;  3I56 3;  3PGB A;  3CCL 3;  3ZFZ A;  1FGT A;  3MWZ A;  4KFD A;  4CPK A;  2QEX 3;  4WP5 A;  1EQK A;  1JBT A;  3PCR A;  3N8B A;  3AHS A;  3OWU A;  1VQ4 3;  4BTW A;  1NU3 A;  1RGE A;  2CFL A;  2XR8 B;  2C10 A;  1TFK A;  1BRH A;  2BU4 A;  2MF7 A;  5RNT A;  4K1V A;  3LML A;  1N5P A;  1JB4 A;  3WMD A;  1RDS A;  4O3V A;  3V99 A;  1MWT A;  1YI2 3;  2PZV A;  1YNV X;  2CFG A;  2GU3 A;  3DMC A;  3LTB A;  1NO3 A;  4FCJ A;  1N8R 4;  1WNH A;  6GSP A;  2ML5 A;  1O7N B;  3OW2 2;  1YVB I;  2P38 A;  1W4N A;  3NM2 A;  3D4A A;  1RGH A;  1WTH A;  2UGI A;  4LZI A;  5D83 A;  4FMC A;  3SED A;  3EN1 B;  3TDG A;  2P05 A;  5IER A;  1I2E A;  5BXQ A;  3CCE 3;  2BMR B;  3V98 A;  1RMS A;  1A67 A;  1AY7 A;  2BNG A;  7RNT A;  3X42 A;  5M19 A;  2KF5 A;  1GOY A;  4I4K A;  1VQ5 3;  2CIU A;  4N3V A;  1RGC A;  4HAA A;  2W03 A;  2W56 A;  4NHF A;  4XBX A;  5AYR B;  3X3Y A;  3G4S 3;  5JPP A;  3E99 A;  3UB1 A;  1JBR A;  3BND A;  2H0H A;  2O9U X;  3H3H A;  1DMM A;  1DVC A;  5LC7 A;  3F8H A;  3CNM A;  1FUW A;  4QWT A;  4OK0 A;  2D42 A;  1KSI A;  2XF3 A;  3EJV A;  3S27 A;  3CC2 3;  1VQ8 3;  4LGQ A;  3G8Z A;  4N6U A;  5KP3 A;  3CC7 3;  2Q07 A;  3LTA A;  1FGR A;  1B2X A;  4HZB B;  4LMI A;  4KFF A;  1UW1 A;  2AAD A;  3PZW A;  4EYC A;  2Y74 A;  3SVA A;  1Q86 4;  3DGN A;  1HYF A;  1UI8 A;  3F40 A;  1I2G A;  3H51 A;  1UCL A;  1X1W A;  4FMD A;  3I0Y A;  3NX0 A;  2XEP A;  2XSH B;  2LQV A;  4FCZ A;  1DE3 A;  1LNH A;  1O7H B;  1R4C A;  3S5C A;  1GY7 A;  2B1X B;  3OX9 A;  1BSB A;  4GSP A;  4HM4 B;  1X1X A;  1EUI C;  2CG1 A;  4L8P A;  2ZA4 A;  5LC6 A;  3LZA A;  1Q9E A;  2F86 B;  4BIR A;  1BUJ A;  1CYU A;  1IVX A;  1JV2 B;  2BMQ B;  3FSD A;  3MHE A;  3B4O A;  2CW9 A;  5M18 A;  4XBY A;  4RNY A;  5CF1 A;  1PU4 A;  1ROV A;  3KZT A; 
#chains in the Genus database with same CATH homology
 4AKY A;  1JKG A;  1OH0 A;  3SOA A;  1FA3 A;  4L8O A;  5FGO A;  3ROB A;  5CLK A;  1OAC A;  2W9P A;  2W6J H;  2RGQ A;  3WOF B;  3LH4 A;  1VQM 3;  1NB5 I;  3J7Y d;  1Q81 4;  2W04 A;  3B7C A;  1JB2 A;  1NB3 I;  4IT7 A;  1QVG 2;  4R1K A;  2P0M A;  2CK3 H;  2RFR A;  4RZM A;  2YFL B;  1Q40 A;  1W6C A;  3IJE B;  2KCD A;  3EHC A;  3FCS B;  3CC4 3;  1O7P B;  2W9Q A;  3X3Z A;  4HBR A;  1OHP A;  4FMB A;  3GWR A;  3MG1 A;  4H3U A;  2CWT A;  5IF6 A;  4MMY B;  1CQS A;  1SIH A;  3DGO A;  1EG9 B;  2WGO A;  1YJN 3;  2IUK A;  3RDE A;  3CPO A;  3FG3 A;  3L0R A;  1IK3 A;  4X2H A;  1VQP 3;  3MKI A;  2E2U A;  4PEJ A;  1E3R A;  3BB9 A;  5BVB A;  1YHQ 3;  1W6Y A;  2MC8 A;  1OCV A;  1TFO A;  1JB5 A;  4EXR A;  3EC9 A;  5ELU A;  3CXC 2;  3G71 3;  1UUW B;  5IW9 A;  3EE1 A;  1M9G A;  3F9S A;  2W2C A;  3JUM A;  5FW5 A;  3UNL A;  3MYT A;  2IA7 A;  3O8Y A;  2ML6 A;  2IUJ A;  4BTY A;  3MSO A;  3EBY A;  1FGM A;  2SBL A;  2IMJ A;  2W56 B;  1JN5 A;  3KE7 A;  4XM4 A;  3KN4 A;  2OCT A;  3QRD A;  1TP6 A;  4R80 A;  5AII A;  3BNE A;  4XB5 A;  1GYB A;  4WYK A;  1LOX A;  2BO9 B;  1IVV A;  1PFP A;  1MOL A;  2CC3 A;  1RKY A;  3WOD G;  5AIF A;  1U5O A;  4XDW A;  3X3X A;  3EX9 A;  3CD6 3;  2BT3 A;  5IG4 A;  1NDO B;  1LXE A;  4IIA A;  3CPW 2;  1YIJ 3;  2RSX A;  3NBJ A;  5STD A;  3PS8 A;  3OV4 A;  3UL5 A;  3U97 A;  1QAL A;  2GXF A;  3IMA B;  1LVN A;  3VGN A;  3PXM A;  2YFI B;  4O2H A;  4WWU C;  3I55 3;  3FG1 A;  3LYG A;  3B8L A;  4EC6 A;  1K41 A;  2GEX A;  3G16 A;  4ZM8 A;  5AEU B;  1RJO A;  3LT8 A;  3FF0 A;  4HM5 B;  5EVH A;  3EB8 A;  3CMA 3;  1DMN A;  2C11 A;  4GL6 A;  4HM2 B;  1VQN 3;  2JQ5 A;  3N9H A;  1C7H A;  4AKZ A;  3RGA A;  1IQ8 A;  4HM1 B;  1NWW A;  1SII A;  3CCM 3;  2QA4 3;  5I97 A;  3IPT A;  3EF8 A;  5G2G A;  1QJG A;  2OWP A;  4HKV B;  3WOE B;  1Z1S A;  2E2T A;  3NBR A;  3UJM A;  2XGN A;  3FF2 A;  4R9K A;  3FG4 A;  2GEY A;  3CCQ 3;  1Q40 B;  3GZY B;  3LT9 A;  3HK4 A;  4EV2 A;  2F99 A;  1GS3 A;  3SX1 A;  2Y73 A;  3F14 A;  3FH1 A;  1VQ7 3;  2FGT A;  1IQY A;  2HMO B;  4XDV A;  2PNC A;  3HX8 A;  1AR0 A;  1G96 A;  3CNX A;  1GD3 A;  1K8A 4;  3S29 A;  1OF5 B;  2BHM A;  2P09 A;  3HIG A;  1GY5 A;  1SPU A;  4ORL A;  2OQE A;  5JPU A;  1Y4K A;  1E3V A;  3JUN A;  3OXA A;  1F8N A;  3FZW A;  4J9A A;  1IVU A;  5AIG A;  4HM0 B;  4U13 A;  3NM7 A;  4L7K A;  2WO0 A;  2B24 B;  2XGL A;  1TU5 A;  1RN7 A;  2YFJ B;  1VQO 3;  1Q7Y 4;  1E97 A;  4KZ1 A;  3N54 B;  5CK6 A;  3CCR 3;  2OOV C;  3CU3 A;  3CME 3;  2CWU A;  2XFS A;  1A2K A;  2XRX B;  4WYK B;  1IDP A;  4K61 A;  5KP4 A;  2KRT A;  5AIH A;  1K9M 4;  1MNL A;  4HM7 B;  1WQL B;  3B4P A;  1IT8 A;  2R4I A;  4FMA A;  1J2B A;  2CHC A;  2CWV A;  1ASK A;  2Z7A A;  2FNQ A;  3FGY A;  1DMQ A;  4HZ9 B;  4RNZ A;  4MMZ B;  3RGR A;  2GBX B;  4HM6 B;  1S72 3;  2QIY A;  2M7O A;  5JBS A;  1N5H A;  3U1W A;  3GRD A;  5DRE A;  2HML B;  5AYS C;  1VQL 3;  2OQE C;  5AEW B;  3FLJ A;  1K73 4;  1KQS 2;  1W01 A;  3JUO A;  3GZR A;  3CCU 3;  5TGN A;  3NQZ A;  1K28 A;  1A90 A;  1KWI A;  1UUV B;  3X41 A;  5CF2 A;  3SOY A;  3NHX A;  2I9W A;  5IG3 A;  1AVK A;  2GU1 A;  3BNB A;  3MPH A;  3CCV 3;  2WGQ A;  2OTJ 3;  1Q42 A;  1ZO2 A;  4HYZ A;  4JF8 A;  1ZX2 A;  3F8X A;  1HU9 A;  4K1U A;  1IVW A;  1US1 A;  1EKM A;  2CH9 A;  1N9E A;  1W6G A;  3S28 A;  3WDG B;  2XH9 A;  4N6N B;  4STD A;  1JNQ A;  2P0X A;  4HVN A;  4O8S A;  4R4K A;  3K9M C;  2UX0 A;  3NUV A;  1HKX A;  3NV0 A;  4NRE A;  4Q53 A;  5AI1 A;  1QAK A;  2RCD A;  1FGO A;  1JRQ A;  1OGZ A;  4AEQ A;  3MG3 A;  1IT7 A;  1TUH A;  2CKF B;  1DYU A;  4N6T A;  3WA2 X;  1VQ6 3;  1M90 4;  3QK9 A;  1JKG B;  1V74 A;  1T5Y A;  5D81 A;  1O7W B;  3LTC A;  1O7M B;  1N8Q A;  4JRF A;  3DGL A;  3ER7 A;  1ULJ B;  2OOV A;  1D6Z A;  4LSO A;  1D6U A;  1JJ2 2;  2WOH A;  1SQW A;  1NJI 4;  1SJW A;  3DXO A;  3FKA A;  5IEP A;  4OVM A;  1ROA A;  3HZP A;  1W5Z A;  2HMJ B;  2L4V A;  3KSP A;  1DVD A;  3GZB A;  3K63 A;  1ISK A;  2V1L A;  4WHA A;  3EN8 A;  1STF I;  4MEI A;  1TIJ A;  5D82 A;  3V92 A;  3KII A;  1WMO A;  2Z6B A;  2BMO B;  3MG2 A;  3A76 A;  5DRV A;  5CXO A;  2GBW B;  3AMO A;  3Q1C A;  3OWY A;  3T8U A;  2F98 A;  4GB5 A;  4EBG A;  4FCM A;  1OUN A;  5KP1 A;  4CCV A;  3LTD A;  4H61 A;  3NQY A;  2Z77 A;  3SLU A;  4G1M B;  1W00 A;  1STD A;  3BNC A;  2XSO B;  3KKG A;  2JDI H;  1YIT 3;  4O02 B;  3KFQ C;  4KFE A;  2K54 A;  3VSY A;  1UI7 A;  3K0Z A;  4BTX A;  2WOF A;  4R9L A;  3F7S A;  3GAX A;  2KXG A;  3HII A;  1O7G B;  2CFW A;  4J8T A;  3NBB A;  4N6V 0;  5IG5 A;  1IQX A;  2CFK A;  2OTL 3;  2O3O A;  4MJD A;  3GZX B;  5IEN A;  3DGM A;  1JN5 B;  1EA2 A;  3F7X A;  3K5T A;  1N9J A;  4FR9 A;  1GD4 A;  1GY6 A;  4N6M A;  5IEO A;  2STD A;  2ZL8 A;  1W2B 2;  3D3L A;  3D9R A;  1L5G B;  1OHS A;  1WMP A;  1U8C B;  3T0U A;  1YGE A;  4LEH A;  1RRH A;  3WA3 A;  3BLZ A;  1D6Y A;  1FGQ A;  5EEO A;  3PYJ A;  4EV5 A;  1YJ9 3;  3EBT A;  6STD A;  2CFD A;  3OWS A;  1W2Z A;  1ULI B;  4IPB A;  3UL6 A;  1A2V A;  1W7C A;  3DY5 A;  4HM8 B;  2HMM B;  4CDL A;  5IG0 A;  2A15 A;  1BUQ A;  8CHO A;  1YJW 3;  3S67 A;  1M1K 4;  3JUQ A;  3NV0 B;  4N6L A;  3HI7 A;  4TX4 A;  1IU7 A;  1OGX A;  1VQ9 3;  3NXJ A;  2W0Q A;  4KVH A;  2CG0 A;  2D1W A;  1OHO A;  3M8C A;  1CYV A;  3LOY A;  3X40 A;  3ECF A;  2E2V A;  1QMA A;  5EQL A;  3CCJ 3;  1OF5 A;  4K90 B;  1KD1 4;  1RRL A;  3ALA A;  3JVC A;  5HGR A;  2FXT A;  3DZL A;  2QGU A;  3VF1 A;  2XFT A;  1M1X B;  3SXX A;  3LXU X;  1W02 A;  2Z76 A;  5ELJ A;  5A0O B;  1Q82 4;  1IV9 A;  1QVF 2;  3CCS 3;  3T8N A;  1S5A A;  3JUP A;  2HMK B;  4OUQ A;  1WMN A;  4X2O A;  3Q90 A;  7STD A;  4N6O B;  3EQQ B;  3K7C A;  2K0M A;  3G6E 3;  1KC8 4;  1OPY A;  1VZZ A;  2YX9 A;  3AMO B;  1AV4 A;  3STD A;  3KSE D;  3Q2P A;  4MMX B;  1VQK 3;  3DM8 A;  3G0K A;  4HJL B;  3PCS A;  2ZDJ A;  2INX A;  4RBN A;  1CEW I;  1IV7 A;  3DUK A;  4XBT A;  2HMN B;  2LYX A;  4WFO A;  1QAF A;  1AVL A;  3I56 3;  3PGB A;  3CCL 3;  1FGT A;  3MWZ A;  4KFD A;  2QEX 3;  4WP5 A;  1EQK A;  3PCR A;  3N8B A;  3OWU A;  1VQ4 3;  4BTW A;  1NU3 A;  2CFL A;  2XR8 B;  2C10 A;  1TFK A;  2MF7 A;  4K1V A;  3LML A;  1N5P A;  1JB4 A;  3WMD A;  4O3V A;  3V99 A;  1YI2 3;  2PZV A;  2CFG A;  2GU3 A;  3DMC A;  3LTB A;  1NO3 A;  4FCJ A;  1N8R 4;  1WNH A;  2ML5 A;  1O7N B;  3OW2 2;  1YVB I;  2P38 A;  1W4N A;  3NM2 A;  1WTH A;  4LZI A;  5D83 A;  4FMC A;  3SED A;  3EN1 B;  3TDG A;  2P05 A;  5IER A;  5BXQ A;  3CCE 3;  2BMR B;  3V98 A;  1A67 A;  2BNG A;  3X42 A;  4I4K A;  1VQ5 3;  2CIU A;  4N3V A;  2W03 A;  2W56 A;  4NHF A;  4XBX A;  5AYR B;  3X3Y A;  3G4S 3;  5JPP A;  3E99 A;  3UB1 A;  3BND A;  2O9U X;  3H3H A;  1DMM A;  1DVC A;  5LC7 A;  3F8H A;  3CNM A;  1FUW A;  4QWT A;  4OK0 A;  2D42 A;  1KSI A;  2XF3 A;  3EJV A;  3S27 A;  3CC2 3;  4LGQ A;  3G8Z A;  4N6U A;  5KP3 A;  3CC7 3;  2Q07 A;  3LTA A;  1FGR A;  4HZB B;  4LMI A;  4EYC A;  4KFF A;  1UW1 A;  3PZW A;  1VQ8 3;  2Y74 A;  3SVA A;  1Q86 4;  3DGN A;  1UI8 A;  3F40 A;  3H51 A;  4FMD A;  4HM3 B;  3I0Y A;  3NX0 A;  2XEP A;  2XSH B;  2LQV A;  4FCZ A;  1LNH A;  1O7H B;  1R4C A;  3S5C A;  1GY7 A;  2B1X B;  3OX9 A;  4HM4 B;  2CG1 A;  4L8P A;  5LC6 A;  3LZA A;  2F86 B;  1CYU A;  1IVX A;  1JV2 B;  2BMQ B;  3FSD A;  3MHE A;  3B4O A;  2CW9 A;  1PU4 A;  4XBY A;  4RNY A;  5CF1 A;  1ROV A;  3KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...