5IENA

Structure of cdl2.2, a computationally designed vitamin-d3 binder
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
129
Chain Sequence
QSAKEAIEAALADFVKAYNSKDAAGVASKYMDDAAIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKLTTLDVQESGDFAFESGSISLKGPGKDSKLVDIAGKYVEVWRKGQDGGWKLYRTIANLDPAEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of CDL2.2, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords CDL2.2
total genus 36
structure length 129
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ienA00
4HM1B 4ORLA 8CHOA 3HZPA 4HKVB 1VZZA 2BMQB 3B4PA 2HMNB 3OWYA 2XRXB 3EX9A 4GB5A 4HM6B 5CF2A 1BUQA 3A76A 3B8LA 2RGQA 2INXA 3NHXA 5FW5A 3Q90A 1K41A 2F86B 4I4KA 5IENA 3JUMA 3EBYA 7STDA 1NDOB 3JUNA 1W02A 5BVBA 3K0ZA 5AIGA 1OGXA 2PZVA 3MG1A 3OXAA 3EC9A 4WYKB 3GWRA 4XBXA 3EN1B 3FH1A 3SOYA 4L7KA 3S5CA 2R4IA 3NXJA 3GZRA 3F8HA 3GZBA 5AIFA 1OHSA 3KSPA 2XR8B 4J8TA 3WMDA 1OHPA 3D9RA 2HMLB 2RFRA 3EBTA 3F7SA 2Z77A 2GXFA 3G0KA 3MG3A 4HM7B 5EVHA 5AEUB 5IF6A 5AI1A 4WYKA 5DRVA 1ULIB 1ZX2A 3FLJA 3ECFA 4OUQA 4L8PA 3GZXB 2A15A 3LZAA 4FCJA 4LEHA 4R9KA 2XSHB 5D82A 3FKAA 4WWUC 5IG3A 3OX9A 3CNXA 1S5AA 1ASKA 3GZYB 4J9AA 4HJLB 1A2KA 2GEXA 5D83A 3RGRA 3STDA 3GRDA 1O7HB 1C7HA 5KP3A 1JB2A 2I9WA 5IG5A 5JPUA 1O7WB 1IDPA 3NV0B 3VGNA 3MSOA 2HMMB 1EA2A 1W01A 6STDA 3FZWA 4HZ9B 3UJMA 4XBYA 2K54A 3NBRA 1DMMA 4XDWA 3DXOA 1OCVA 1AR0A 3HX8A 2YFIB 3KKGA 4CDLA 1OUNA 2GEYA 3BLZA 2Z7AA 3BB9A 3VSYA 2UX0A 4MJDA 4HZBB 1GY6A 1NWWA 3IPTA 1JN5B 3MG2A 5CLKA 1OGZA 5BXQA 3FGYA 1OF5B 3G8ZA 1NU3A 5CK6A 3CU3A 4STDA 4HM8B 3RGAA 4WP5A 2GBWB 2XSOB 4OVMA 1O7MB 4K1VA 1OPYA 1GYBA 1U5OA 1UUWB 3JUPA 1Z1SA 3B4OA 4RZMA 3F7XA 5G2GA 1W00A 4HM3B 2IMJA 3EJVA 1ULJB 3F14A 4HM0B 2W2CA 3EF8A 2B24B 3F8XA 3T8NA 2HMJB 1DMQA 3H51A 4XM4A 1JB5A 2OWPA 1HKXA 1JB4A 4XBTA 2HMOB 2Z76A 4HVNA 4XB5A 4L8OA 2GBXB 3CPOA 1EG9B 4N3VA 5JPPA 4R9LA 2CKFB 1JN5A 2RCDA 1E3RA 3T8UA 3CNMA 1GY7A 5IG0A 1JKGB 4XDVA 3I0YA 1TUHA 1E3VA 4HM4B 5KP4A 4LMIA 3NUVA 3DUKA 3SOAA 4PEJA 2YFLB 3FF2A 4X2HA 3M8CA 1QJGA 4K1UA 3DM8A 4HM5B 2B1XB 3OV4A 3B7CA 3FF0A 5CXOA 5IEOA 3MHEA 1E97A 4Q53A 4LGQA 3EN8A 3E99A 3H3HA 1UUVB 1W6YA 1Q40B 1OHOA 3DMCA 3EHCA 3EQQB 3NM2A 2JQ5A 1Q42A 1STDA 3LYGA 4FCMA 4HM2B 2STDA 5AIIA 5HGRA 5STDA 4R1KA 1O7PB 5IEPA 5IERA 1DMNA 1OH0A 3KZTA 1O7NB 1CQSA 2BMOB 3DZLA 5CF1A 5IG4A 2F99A 1SJWA 5TGNA 1GS3A 2BMRB 1GY5A 2QIYA 3G16A 4X2OA 5AEWB 3ROBA 1O7GB 1OF5A 3FSDA 1WQLB 4KVHA 3OWUA 5AIHA 1ZO2A 3JUOA 3OWSA 5KP1A 1JKGA 2HMKB 3HK4A 5D81A 1TP6A 3JUQA 2YFJB 4H3UA 3F9SA 3F40A 3K7CA 2QGUA 3SEDA 3ER7A 3MKIA 2CHCA 3UNLA 1ISKA 1Q40A 5DREA 3MYTA 4U13A 1QMAA 2F98A 3NV0A 4IIAA 2BNGA 3KE7A
chains in the Genus database with same CATH superfamily
2H0IA 8CHOA 3HZPA 1BNJA 1D6YA 4EV2A 1CH0A 3EX9A 1BUQA 1EQKA 3A76A 1A67A 2RGQA 5FW5A 1MOLA 3D5GA 2F86B 2O3OA 5IENA 3G713 2Q07A 2RNTA 4HYZA 1RLSA 1K9M4 1KC84 5AIGA 3MG1A 1YI23 1AVKA 1PYLA 2D42A 2IUKA 2KF5A 3O8YA 3ZG5A 3NXJA 3S27A 1TFOA 1X1UA 3PGBA 1BSBA 1W5ZA 1BIRA 3GZBA 3PXMA 5AIFA 3X3YA 3QRDA 2XR8B 4J8TA 3WMDA 1MGRA 3D9RA 3IMAB 2RFRA 1WNHA 3NQZA 5EEOA 2Z77A 2GXFA 3MG3A 4FCZA 4ILFA 1JZOA 3WOFB 3FLJA 3V98A 3BIRA 1YIJ3 4OUQA 2CFGA 3GZXB 2A15A 4FCJA 4R9KA 3DY5A 3OX9A 1U8CB 1BSCA 3GZYB 2HOHA 1L5GB 1BAOA 1N5HA 1JBTA 1UDII 2GEXA 1FGRA 1IK3A 3GRDA 1O7HB 1C7HA 1M1K4 2MC8A 3CME3 1I0VA 1IDPA 1VQ43 3NV0B 3OW22 3MSOA 1UW1A 1EA2A 1FYSA 3D79A 1WTHA 3FZWA 4HZ9B 4IPBA 1T2IA 4XBYA 1DMMA 1OCVA 2XFTA 2ZHXB 4CDLA 1OUNA 3BB9A 3DGYA 2UX0A 3KFQC 1BU4A 1GY6A 1NWWA 2OQEA 5CLKA 1KWIA 3MG2A 4BTWA 1VQ63 3FGYA 4N6MA 5CK6A 4KFFA 4STDA 3RGAA 4HM8B 2H0HA 1RN4A 4WP5A 3CC73 3CCV3 2GBWB 4OVMA 4R4KA 1SARA 1OPYA 2F56A 2QA43 3B4OA 2CK3H 3CCR3 1UI8A 2L1SA 1EEJA 1OACA 2IYJA 3LXUX 1BRJA 3EJVA 4JF8A 1TFKA 2CW9A 4EW5A 3F8XA 1VQO3 1K28A 1ROAA 2WOFA 1DMQA 3H51A 1N8R4 2P0MA 1TU5A 1B20A 3DGOA 1B21A 1X1YA 3PYJA 3RDEA 4AKZA 1YJN3 2W9PA 4MMYB 2W56A 2GU1A 3T8UA 1VQQA 4H61A 3CCQ3 1JKGB 4XDVA 3I0YA 1VQ53 1TUHA 4HM4B 1BNGA 3J7Yd 5KP4A 1QAFA 1FGMA 2YFLB 1QJGA 4HM5B 2CG1A 2B1XB 1N8QA 3NQYA 5ELJA 1CYVA 4LGQA 1B2UA 1UUVB 1W6YA 3DMCA 3CCJ3 3EQQB 3CD63 1Q42A 1STDA 4LYLB 1F8NA 5AIIA 1I2EA 1LOVA 5IEPA 2GU3A 4GHOA 1DMNA 3KZTA 1O7NB 3DZLA 1IQXA 5TGNA 1VQ73 1VQ83 1GS3A 2CX1A 3DGLA 1GY5A 2K3DA 4X2OA 1BRHA 1RGCA 1OF5A 3SX1A 1NNVA 2XH9A 3OWUA 1JV2B 1ZO2A 5AIHA 4RBNA 1B2ZA 1RDSA 1G02A 4G1MB 2KF6A 2F5WA 3DGMA 1QVF2 4CPKA 1I3FA 3F40A 3SEDA 1MWSA 2QGUA 2RSXA 4RNYA 1KD14 4U13A 2F98A 2P38A 3LH4A 5AYRB 2BNGA 3KE7A 1R4YA 1D6UA 4FMCA 3URPA 5M19A 1I0XA 1R4CA 4HKVB 5JBSA 2BMQB 2HMNB 4GB5A 3GSPA 3SYUA 4I4KA 3JUMA 4KFEA 1UGHI 2SBLA 2FGTA 1BSEA 1NDOB 3JUNA 1W02A 3LTDA 1B27A 7STDA 5LC7A 3AMOB 3K0ZA 1VQP3 4FMAA 1OGXA 1IVWA 2C10A 3MPHA 3OXAA 4WYKB 4CCVA 1J2BA 2LQVA 1AVLA 1FZUA 3EN1B 3FH1A 4RNTA 1W6CA 4J5KA 3S5CA 3CCE3 1W6GA 3WOEB 6RNTA 1RGHA 3KSPA 3SLUA 1YGEA 2SARA 1LNIA 4O02B 3LT8A 3MWZA 2QEX3 2KAAA 1TJDA 3EBTA 1TIJA 1JBSA 3G0KA 4GL6A 2CFWA 1YGWA 1I70A 1ZX2A 4J5GA 3LZAA 1FGQA 1SIHA 1V58A 2PNCA 3CNXA 2CG0A 2UGIA 4HJLB 8RNTA 3RGRA 3STDA 3X40A 1TRPA 4K90B 3D4AA 2H0GA 1T2HA 1A90A 2HMMB 1RNTA 1W01A 3EE1A 3FG4A 3NBRA 4XDWA 3DXOA 3KKGA 3Q1CA 2GEYA 2OTL3 2BIRA 1S723 1YHQ3 3N9HA 1BANA 3BNCA 3IPTA 3WODG 1OF5B 1AQZA 3G8ZA 1NU3A 1UCIA 2WGOA 3RNTA 1LVNA 2XSOB 1I8VA 1O7MB 2Y73A 2LYXA 1Z1SA 1GMQA 4EYCA 1W00A 2IUJA 4O8SA 1N9JA 3EF8A 2B24B 1RGFA 2HMJB 1PFPA 2OWPA 1RGKA 1RN7A 3G4S3 2E2UA 5ELUA 2Z76A 4HVNA 4BTYA 1JZDA 1VQL3 3CPOA 4N3VA 2OCTA 1JN5A 2RCDA 3N54B 4HAAA 1RCKA 1SIIA 1Q824 1RNBA 2K0MA 5IG0A 1FUTA 2XGNA 3HIIA 3X3XA 1SPUA 4LMIA 3SOAA 4PEJA 4X2HA 1M1XB 3DM8A 1AV4A 5LC6A 3WA2X 3PCRA 2JDIH 4O2HA 1GOYA 3B7CA 1I2FA 1RMSA 4CJNA 3CCM3 1E97A 3BNEA 3E99A 5FGOA 1YIT3 1OHOA 3ALAA 4FCMA 2STDA 1CEWI 1WMOA 9RNTA 1OH0A 4EV5A 1C54A 3CCU3 2BMOB 1CYUA 1DVCA 2F99A 1SJWA 3FG3A 3PZWA 7RNTA 3G16A 3U97A 3AMOA 1O7GB 1PU4A 3FSDA 1WQLB 4KVHA 5GSPA 1EUIC 3JUOA 3OWSA 1MGWA 1YNVX 2HMKB 5BU4A 5KP1A 1VQN3 5D81A 3JUQA 3S67A 2YFJB 1K734 3F9SA 1LOXA 1HU9A 5BIRA 3FG1A 3UNLA 1BGSA 5M1AA 5HOHA 3NV0A 4IIAA 1AY7A 1FUWA 1MWUA 2GSPA 3V99A 1M9GA 4OK0A 1VZZA 3B4PA 3OWYA 2XRXB 2F4YA 3LTAA 2INXA 3Q90A 1K41A 1GMRA 3EBYA 1K8A4 2CH9A 1BNRA 3I563 3Q2PA 3SXXA 2PZVA 4EC6A 4N6NB 5M18A 2P05A 1UUGB 4K61A 4L7KA 2R4IA 1STFI 3F8HA 1GD4A 1GOUA 1RRLA 4QWTA 1BNSA 1OHPA 1RJOA 2HMLB 3S29A 1I3IA 2ML5A 1YVBI 1NB3I 2P09A 3DH2A 4HM7B 5EVHA 5AEUB 3NBJA 4WYKA 5AI1A 1DETA 1ULIB 5DRVA 1FW7A 3ECFA 4LEHA 2F5MA 3WR2A 1FGOA 1IU7A 1VQ93 5D82A 3HI7A 4WWUC 4FR9A 4DKIA 5IG3A 3EB8A 5G1LA 3KN4A 1RGAA 2W9QA 1ASKA 4KFDA 1A2KA 5D83A 1G96A 5KP3A 3SVAA 1JB2A 2I9WA 1RGLA 1IT7A 1RGGA 1B3SA 2WOHA 3JVCA 1O7WB 2WGQA 2XFSA 2XEPA 3IJEB 3ZFZA 3G6E3 2FXTA 3KIIA 2K54A 3UJMA 1BRNL 4AEQA 3HX8A 1AR0A 1IV9A 1LQGC 1A2PA 1IVUA 2CC3A 4TX4A 3VSYA 5I97A 1QVG2 1OGZA 5BXQA 1GOVA 3UB1A 4LZIA 2BHMA 3BU4A 3CU3A 2XGLA 1T3BA 3V92A 1YJ93 4N6OB 1PY3A 2AADA 3N8BA 5IW9A 4KT3B 1QAKA 2W0QA 1U5OA 1GYBA 1UUWB 5RNTA 3JUPA 4RZMA 1LQMB 1NO3A 1B2SA 2W04A 2IMJA 3NX0A 2W2CA 1RGEA 1W2ZA 3L0RA 1ZS7A 1JB5A 1UCKA 2CWTA 1KQS2 4XBTA 2Y74A 1RKYA 1Q814 2HMOB 2MF7A 1V74A 1UI7A 4XB5A 4L8OA 1EG9B 2V1LA 4ZM8A 4R9LA 4NHFA 1IQYA 1T5YA 2YX9A 1MWRA 2BO9B 1I2GA 3X42A 2M7OA 1FA3A 1E3VA 1GMPA 1Q7HA 1W7CA 3GAXA 1IQ8A 3NUVA 1X1XA 2O9UX 2OQEC 3BNDA 3AGOA 3FF2A 1MWTA 2CWVA 3M8CA 3UL5A 4K1UA 1HZ1A 3OV4A 3CPW2 3FF0A 4MMXB 5CXOA 3AHWA 3MHEA 5IEOA 3WA3A 4Q53A 2KF3A 2C11A 2W03A 3H3HA 3EHCA 1M904 1Q40B 3D5IA 4HM2B 1G0TA 4IT7A 1LNHA 3BNBA 5STDA 4N6UA 1N9EA 1LXEA 3D3LA 1UGIA 3LTCA 1GSPA 4R1KA 3TDGA 5IERA 1JBRA 1CQSA 2FNQA 1BRGA 5IG4A 1B2XA 1JRQA 2QIYA 5EQLA 1N5PA 2OTJ3 3ROBA 1Q864 4I5QA 1BNFA 2C4BA 1LRAA 3PCSA 1BNEA 3AGNA 1TP6A 2CFKA 2BU4A 4H3UA 4EBGA 2KRTA 3K7CA 1RHLA 3ER7A 3A5EA 3CCL3 1BOXA 4R80A 1ISKA 1BNIA 1Q40A 1Y4KA 2E2TA 3MYTA 5DREA 3AHSA 2J8XB 4HM1B 4ORLA 1MNLA 2CWUA 2KF4A 2CFDA 1BSAA 4HM6B 5CF2A 3S28A 3B8LA 2CX0A 1JJ22 3NHXA 1UCJA 2KXGA 1VQK3 5BVBA 3KCHA 3EC9A 3GWRA 4XBXA 1BVIA 4NREA 3SOYA 1DYUA 3GZRA 4HBRA 3FCSB 1WMPA 1OHSA 3CMA3 1X1WA 2IY2A 3KSED 2XF3A 4RNZA 3F7SA 1RRHA 5IF6A 3K63A 3NM7A 1TTOA 3PS8A 3LT9A 4L8PA 1RTUA 2ML6A 2XSHB 3LTBA 3FKAA 4O3VA 1ROVA 1TRQA 4LSOA 5AYSC 1S5AA 3ZG0A 4J9AA 2ZDJA 3LMLA 4AKYA 5IG5A 7GSPA 5JPUA 1Q9EA 3CCS3 3VGNA 2OOVA 1SQWA 4BTXA 3QK9A 6STDA 1YVSA 4FMDA 1IVVA 2RBIA 3X41A 1KSIA 2YFIB 4MEIA 1US1A 2E2VA 3BLZA 3X3ZA 2Z7AA 4GSPA 4MJDA 4HZBB 4EXRA 1DVDA 3U1WA 1JN5B 4JRFA 3HIGA 3VF1A 1B2MA 3CXC2 1RCLA 1QALA 2WO0A 4MMZB 4K1VA 1BRIA 3K9MC 5G2GA 3F7XA 4HM3B 3F14A 1ULJB 4HM0B 3T8NA 1BRKA 1V57A 2AAEA 4XM4A 4N6LA 4WFOA 1UCLA 6GSPA 1HKXA 1JB4A 4BIRA 2W6JH 3CC23 1ZGXA 2ZA4A 1W4NA 2UUGC 1GD3A 1IV7A 2L4VA 3Q3FA 2GBXB 2OOVC 5JPPA 1LOWA 2CKFB 1NJI4 2W56B 1JNQA 1LOYA 1E3RA 1YJW3 4KZ1A 3CNMA 1GY7A 3WDGB 2CFLA 4FMBA 2KCDA 3DUKA 3CC43 1IT8A 1WMNA 4N6TA 2BT3A 1IVXA 4WHAA 1BUJA 1BSDA 4BL3A 4HOHA 3EN8A 3WHOA 5G1KA 4N6V0 3HOHA 1EKMA 1HYFA 2CIUA 2JQ5A 3LYGA 3NM2A 5HGRA 3NBBA 1BRSA 1O7PB 3LOYA 1IYYA 5CF1A 1RSNA 2BMRB 3I553 5A0OB 3DGNA 5AEWB 2Z6BA 1FUSA 3K5TA 1W2B2 1FGTA 1JKGA 3T0UA 3HK4A 4NPBA 4BU4A 1A2VA 1RN1A 2P0XA 1D6ZA 2D1WA 2ZL8A 4BL2A 1DE3A 3MKIA 2CHCA 3UL6A 2R41A 1Q7Y4 1NB5I 1VQM3 1QMAA 2IA7A
chains in the Genus database with same CATH topology
8CHOA 3HZPA 1D6YA 4EV2A 3EX9A 1BUQA 1EQKA 3A76A 1A67A 2RGQA 5FW5A 1MOLA 2F86B 2O3OA 5IENA 3G713 2Q07A 4HYZA 1K9M4 1KC84 5AIGA 3MG1A 1YI23 1AVKA 2D42A 2IUKA 3O8YA 3NXJA 3S27A 1TFOA 3PGBA 1W5ZA 3GZBA 3PXMA 5AIFA 3X3YA 3QRDA 2XR8B 4J8TA 3WMDA 3D9RA 3IMAB 2RFRA 1WNHA 3NQZA 5EEOA 2Z77A 2GXFA 3MG3A 4FCZA 3WOFB 3FLJA 3V98A 1YIJ3 4OUQA 2CFGA 3GZXB 2A15A 4FCJA 4R9KA 3DY5A 3OX9A 1U8CB 3GZYB 1L5GB 1N5HA 2GEXA 1FGRA 1IK3A 3GRDA 1O7HB 1C7HA 1M1K4 2MC8A 3CME3 1IDPA 1VQ43 3NV0B 3OW22 3MSOA 1UW1A 1EA2A 3FZWA 1WTHA 4HZ9B 4IPBA 4XBYA 1DMMA 1OCVA 2XFTA 4CDLA 1OUNA 3BB9A 2UX0A 3KFQC 1GY6A 1NWWA 2OQEA 5CLKA 1KWIA 3MG2A 4BTWA 1VQ63 3FGYA 4N6MA 5CK6A 4KFFA 4STDA 3RGAA 4HM8B 4WP5A 3CC73 3CCV3 2GBWB 4OVMA 4R4KA 1OPYA 2QA43 3B4OA 2CK3H 3CCR3 1UI8A 1OACA 4JF8A 3LXUX 3EJVA 1TFKA 2CW9A 1VQO3 3F8XA 1K28A 1ROAA 2WOFA 1DMQA 3H51A 1N8R4 2P0MA 1TU5A 3PYJA 3DGOA 4AKZA 3RDEA 1YJN3 2W9PA 4MMYB 2W56A 2GU1A 3T8UA 4H61A 3CCQ3 1JKGB 4XDVA 3I0YA 1VQ53 1TUHA 4HM4B 3J7Yd 5KP4A 1QAFA 1FGMA 2YFLB 1QJGA 4HM5B 2CG1A 2B1XB 1N8QA 3NQYA 5ELJA 1CYVA 4LGQA 1UUVB 1W6YA 3DMCA 3CCJ3 3EQQB 3CD63 1Q42A 1STDA 1F8NA 5AIIA 5IEPA 2GU3A 1DMNA 3KZTA 1O7NB 3DZLA 1IQXA 5TGNA 1VQ73 1VQ83 1GS3A 3DGLA 1GY5A 4X2OA 1OF5A 3SX1A 2XH9A 3OWUA 1JV2B 1ZO2A 5AIHA 4G1MB 3DGMA 1QVF2 3F40A 3SEDA 2QGUA 2RSXA 4RNYA 1KD14 4U13A 2P38A 2F98A 3LH4A 5AYRB 2BNGA 3KE7A 4FMCA 1D6UA 1R4CA 4HKVB 5JBSA 2BMQB 2HMNB 4GB5A 4I4KA 3JUMA 4KFEA 7STDA 2SBLA 2FGTA 1NDOB 3JUNA 1W02A 3LTDA 1VQP3 5LC7A 3AMOB 3K0ZA 4FMAA 1OGXA 1IVWA 2C10A 3MPHA 3OXAA 4WYKB 4CCVA 1J2BA 2LQVA 1AVLA 3EN1B 3FH1A 1W6CA 3S5CA 3CCE3 1W6GA 3WOEB 3KSPA 3SLUA 1YGEA 4O02B 3LT8A 3MWZA 2QEX3 3EBTA 1TIJA 3G0KA 4GL6A 2CFWA 1ZX2A 3LZAA 1FGQA 1SIHA 2PNCA 3CNXA 2CG0A 4HJLB 3RGRA 3STDA 3X40A 4K90B 1A90A 2HMMB 1W01A 3EE1A 3FG4A 3NBRA 4XDWA 3DXOA 3KKGA 3Q1CA 2GEYA 2OTL3 1S723 1YHQ3 3N9HA 3BNCA 3IPTA 3WODG 1OF5B 3G8ZA 1NU3A 2WGOA 1LVNA 2XSOB 1O7MB 2Y73A 2LYXA 1Z1SA 4EYCA 1W00A 2IUJA 4O8SA 1N9JA 3EF8A 2B24B 2HMJB 1PFPA 2OWPA 1RN7A 3G4S3 2E2UA 5ELUA 2Z76A 4HVNA 4BTYA 1VQL3 3CPOA 4N3VA 2OCTA 1JN5A 2RCDA 3N54B 1SIIA 1Q824 2K0MA 5IG0A 2XGNA 3HIIA 3X3XA 1SPUA 4LMIA 3SOAA 4PEJA 4X2HA 1M1XB 3DM8A 1AV4A 5LC6A 3WA2X 3PCRA 2JDIH 4O2HA 3B7CA 3CCM3 1E97A 3BNEA 3E99A 5FGOA 1YIT3 1OHOA 3ALAA 4FCMA 2STDA 1CEWI 1WMOA 1OH0A 4EV5A 3CCU3 2BMOB 1CYUA 1DVCA 2F99A 1SJWA 3FG3A 3PZWA 3G16A 3U97A 3AMOA 1O7GB 1PU4A 3FSDA 1WQLB 4KVHA 3OWSA 3JUOA 5KP1A 1VQN3 2HMKB 5D81A 3JUQA 3S67A 2YFJB 1K734 3F9SA 1LOXA 1HU9A 3FG1A 3UNLA 3NV0A 4IIAA 1FUWA 3V99A 1M9GA 4OK0A 1VZZA 3B4PA 3OWYA 2XRXB 3LTAA 2INXA 3Q90A 1K41A 3EBYA 1K8A4 2CH9A 3I563 3Q2PA 3SXXA 2PZVA 4EC6A 4N6NB 2P05A 4K61A 4L7KA 2R4IA 1STFI 3F8HA 1GD4A 1RRLA 4QWTA 1OHPA 1RJOA 2HMLB 3S29A 2ML5A 1YVBI 1NB3I 2P09A 5EVHA 4HM7B 5AEUB 3NBJA 4WYKA 5AI1A 1ULIB 5DRVA 3ECFA 4LEHA 1FGOA 1IU7A 1VQ93 5D82A 3HI7A 4WWUC 4FR9A 5IG3A 3EB8A 3KN4A 2W9QA 1ASKA 4KFDA 1A2KA 5D83A 1G96A 5KP3A 3SVAA 1JB2A 2I9WA 2WOHA 1IT7A 3JVCA 1O7WB 2WGQA 2XFSA 2XEPA 3IJEB 3G6E3 2FXTA 3KIIA 2K54A 3UJMA 4AEQA 3HX8A 1AR0A 1IV9A 4TX4A 1IVUA 2CC3A 3VSYA 5I97A 1QVG2 1OGZA 5BXQA 3UB1A 4LZIA 2BHMA 3CU3A 3V92A 2XGLA 1YJ93 4N6OB 3N8BA 5IW9A 1QAKA 2W0QA 1U5OA 1GYBA 1UUWB 3JUPA 4RZMA 2W04A 1NO3A 2IMJA 3NX0A 2W2CA 1W2ZA 3L0RA 1JB5A 2CWTA 1KQS2 4XBTA 2Y74A 1RKYA 1Q814 2HMOB 2MF7A 1V74A 1UI7A 4XB5A 4L8OA 1EG9B 2V1LA 4ZM8A 4R9LA 4NHFA 1IQYA 1T5YA 2YX9A 2BO9B 3X42A 2M7OA 1FA3A 1E3VA 1W7CA 4RBNA 3GAXA 1IQ8A 3NUVA 2O9UX 2OQEC 3BNDA 3FF2A 2CWVA 3UL5A 3M8CA 4K1UA 3OV4A 3CPW2 3FF0A 4MMXB 5CXOA 5IEOA 3MHEA 3WA3A 4Q53A 2C11A 2W03A 3H3HA 3EHCA 1M904 1Q40B 4HM2B 4IT7A 1LNHA 3BNBA 5STDA 4N6UA 1N9EA 1LXEA 3D3LA 3LTCA 4R1KA 3TDGA 5IERA 1CQSA 2FNQA 5IG4A 1JRQA 2QIYA 5EQLA 1N5PA 2OTJ3 3ROBA 1Q864 3PCSA 1TP6A 2CFKA 4H3UA 4EBGA 2KRTA 3K7CA 3ER7A 3CCL3 4R80A 1ISKA 1Q40A 1Y4KA 2E2TA 3MYTA 5DREA 4HM1B 4ORLA 1MNLA 2CWUA 2CFDA 4HM6B 5CF2A 3S28A 3B8LA 1JJ22 3NHXA 2KXGA 1VQK3 5BVBA 3EC9A 3GWRA 4XBXA 4NREA 3SOYA 1DYUA 3GZRA 4HBRA 3FCSB 1WMPA 1OHSA 3CMA3 3KSED 2XF3A 4RNZA 3F7SA 1RRHA 5IF6A 3K63A 3NM7A 3PS8A 3LT9A 4L8PA 2ML6A 2XSHB 3LTBA 3FKAA 4O3VA 1ROVA 4LSOA 5AYSC 1S5AA 4J9AA 2ZDJA 3LMLA 4AKYA 5IG5A 5JPUA 3CCS3 3VGNA 2OOVA 1SQWA 4BTXA 3QK9A 6STDA 4FMDA 1IVVA 3X41A 1KSIA 2YFIB 4MEIA 1US1A 2E2VA 3BLZA 3X3ZA 2Z7AA 1DVDA 4MJDA 4HZBB 4EXRA 3U1WA 1JN5B 4JRFA 3HIGA 3VF1A 3CXC2 1QALA 2WO0A 4MMZB 4K1VA 3K9MC 5G2GA 3F7XA 4HM3B 3F14A 1ULJB 4HM0B 3T8NA 4XM4A 4WFOA 4N6LA 1HKXA 1JB4A 2W6JH 3CC23 1W4NA 1GD3A 1IV7A 2L4VA 2GBXB 2OOVC 5JPPA 2CKFB 1NJI4 2W56B 1JNQA 1YJW3 1E3RA 4KZ1A 3CNMA 1GY7A 3WDGB 2CFLA 4FMBA 2KCDA 3DUKA 3CC43 1IT8A 1WMNA 4N6TA 2BT3A 1IVXA 4WHAA 3EN8A 4N6V0 1EKMA 2CIUA 3NM2A 2JQ5A 3LYGA 5HGRA 3NBBA 1O7PB 3LOYA 5CF1A 2BMRB 3I553 5A0OB 3DGNA 5AEWB 2Z6BA 3K5TA 1W2B2 1FGTA 1JKGA 3T0UA 3HK4A 1A2VA 2P0XA 1D6ZA 2D1WA 2ZL8A 3MKIA 2CHCA 3UL6A 1NB5I 1Q7Y4 1VQM3 1QMAA 2IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM1 B;  4ORL A;  8CHO A;  3HZP A;  4HKV B;  1VZZ A;  2BMQ B;  3B4P A;  2HMN B;  3OWY A;  2XRX B;  3EX9 A;  4GB5 A;  4HM6 B;  5CF2 A;  1BUQ A;  3A76 A;  3B8L A;  2RGQ A;  2INX A;  3NHX A;  5FW5 A;  3Q90 A;  1K41 A;  2F86 B;  4I4K A;  5IEN A;  3JUM A;  3EBY A;  7STD A;  1NDO B;  3JUN A;  1W02 A;  5BVB A;  3K0Z A;  5AIG A;  1OGX A;  2PZV A;  3MG1 A;  3OXA A;  3EC9 A;  4WYK B;  3GWR A;  4XBX A;  3EN1 B;  3FH1 A;  3SOY A;  4L7K A;  3S5C A;  2R4I A;  3NXJ A;  3GZR A;  3F8H A;  3GZB A;  5AIF A;  1OHS A;  3KSP A;  2XR8 B;  4J8T A;  3WMD A;  1OHP A;  3D9R A;  2HML B;  2RFR A;  3EBT A;  3F7S A;  2Z77 A;  2GXF A;  3G0K A;  3MG3 A;  4HM7 B;  5EVH A;  5AEU B;  5IF6 A;  5AI1 A;  4WYK A;  5DRV A;  1ULI B;  1ZX2 A;  3FLJ A;  3ECF A;  4OUQ A;  4L8P A;  3GZX B;  2A15 A;  3LZA A;  4FCJ A;  4LEH A;  4R9K A;  2XSH B;  5D82 A;  3FKA A;  4WWU C;  5IG3 A;  3OX9 A;  3CNX A;  1S5A A;  1ASK A;  3GZY B;  4J9A A;  4HJL B;  1A2K A;  2GEX A;  5D83 A;  3RGR A;  3STD A;  3GRD A;  1O7H B;  1C7H A;  5KP3 A;  1JB2 A;  2I9W A;  5IG5 A;  5JPU A;  1O7W B;  1IDP A;  3NV0 B;  3VGN A;  3MSO A;  2HMM B;  1EA2 A;  1W01 A;  6STD A;  3FZW A;  4HZ9 B;  3UJM A;  4XBY A;  2K54 A;  3NBR A;  1DMM A;  4XDW A;  3DXO A;  1OCV A;  1AR0 A;  3HX8 A;  2YFI B;  3KKG A;  4CDL A;  1OUN A;  2GEY A;  3BLZ A;  2Z7A A;  3BB9 A;  3VSY A;  2UX0 A;  4MJD A;  4HZB B;  1GY6 A;  1NWW A;  3IPT A;  1JN5 B;  3MG2 A;  5CLK A;  1OGZ A;  5BXQ A;  3FGY A;  1OF5 B;  3G8Z A;  1NU3 A;  5CK6 A;  3CU3 A;  4STD A;  4HM8 B;  3RGA A;  4WP5 A;  2GBW B;  2XSO B;  4OVM A;  1O7M B;  4K1V A;  1OPY A;  1GYB A;  1U5O A;  1UUW B;  3JUP A;  1Z1S A;  3B4O A;  4RZM A;  3F7X A;  5G2G A;  1W00 A;  4HM3 B;  2IMJ A;  3EJV A;  1ULJ B;  3F14 A;  4HM0 B;  2W2C A;  3EF8 A;  2B24 B;  3F8X A;  3T8N A;  2HMJ B;  1DMQ A;  3H51 A;  4XM4 A;  1JB5 A;  2OWP A;  1HKX A;  1JB4 A;  4XBT A;  2HMO B;  2Z76 A;  4HVN A;  4XB5 A;  4L8O A;  2GBX B;  3CPO A;  1EG9 B;  4N3V A;  5JPP A;  4R9L A;  2CKF B;  1JN5 A;  2RCD A;  1E3R A;  3T8U A;  3CNM A;  1GY7 A;  5IG0 A;  1JKG B;  4XDV A;  3I0Y A;  1TUH A;  1E3V A;  4HM4 B;  5KP4 A;  4LMI A;  3NUV A;  3DUK A;  3SOA A;  4PEJ A;  2YFL B;  3FF2 A;  4X2H A;  3M8C A;  1QJG A;  4K1U A;  3DM8 A;  4HM5 B;  2B1X B;  3OV4 A;  3B7C A;  3FF0 A;  5CXO A;  5IEO A;  3MHE A;  1E97 A;  4Q53 A;  4LGQ A;  3EN8 A;  3E99 A;  3H3H A;  1UUV B;  1W6Y A;  1Q40 B;  1OHO A;  3DMC A;  3EHC A;  3EQQ B;  3NM2 A;  2JQ5 A;  1Q42 A;  1STD A;  3LYG A;  4FCM A;  4HM2 B;  2STD A;  5AII A;  5HGR A;  5STD A;  4R1K A;  1O7P B;  5IEP A;  5IER A;  1DMN A;  1OH0 A;  3KZT A;  1O7N B;  1CQS A;  2BMO B;  3DZL A;  5CF1 A;  5IG4 A;  2F99 A;  1SJW A;  5TGN A;  1GS3 A;  2BMR B;  1GY5 A;  2QIY A;  3G16 A;  4X2O A;  5AEW B;  3ROB A;  1O7G B;  1OF5 A;  3FSD A;  1WQL B;  4KVH A;  3OWU A;  5AIH A;  1ZO2 A;  3JUO A;  3OWS A;  5KP1 A;  1JKG A;  2HMK B;  3HK4 A;  5D81 A;  1TP6 A;  3JUQ A;  2YFJ B;  4H3U A;  3F9S A;  3F40 A;  3K7C A;  2QGU A;  3SED A;  3ER7 A;  3MKI A;  2CHC A;  3UNL A;  1ISK A;  1Q40 A;  5DRE A;  3MYT A;  4U13 A;  1QMA A;  2F98 A;  3NV0 A;  4IIA A;  2BNG A;  3KE7 A; 
#chains in the Genus database with same CATH topology
 2H0I A;  8CHO A;  3HZP A;  1BNJ A;  1D6Y A;  4EV2 A;  1CH0 A;  3EX9 A;  1BUQ A;  1EQK A;  3A76 A;  1A67 A;  2RGQ A;  5FW5 A;  1MOL A;  3D5G A;  2F86 B;  2O3O A;  5IEN A;  3G71 3;  2Q07 A;  2RNT A;  4HYZ A;  1RLS A;  1K9M 4;  1KC8 4;  5AIG A;  3MG1 A;  1YI2 3;  1AVK A;  1PYL A;  2D42 A;  2IUK A;  2KF5 A;  3O8Y A;  3ZG5 A;  3NXJ A;  3S27 A;  1TFO A;  1X1U A;  3PGB A;  1BSB A;  1W5Z A;  1BIR A;  3GZB A;  3PXM A;  5AIF A;  3X3Y A;  3QRD A;  2XR8 B;  4J8T A;  3WMD A;  1MGR A;  3D9R A;  3IMA B;  2RFR A;  1WNH A;  3NQZ A;  5EEO A;  2Z77 A;  2GXF A;  3MG3 A;  4FCZ A;  4ILF A;  1JZO A;  3WOF B;  3FLJ A;  3V98 A;  3BIR A;  1YIJ 3;  4OUQ A;  2CFG A;  3GZX B;  2A15 A;  4FCJ A;  4R9K A;  3DY5 A;  3OX9 A;  1U8C B;  1BSC A;  3GZY B;  2HOH A;  1L5G B;  1BAO A;  1N5H A;  1JBT A;  1UDI I;  2GEX A;  1FGR A;  1IK3 A;  3GRD A;  1O7H B;  1C7H A;  1M1K 4;  2MC8 A;  3CME 3;  1I0V A;  1IDP A;  1VQ4 3;  3NV0 B;  3OW2 2;  3MSO A;  1UW1 A;  1EA2 A;  1FYS A;  3D79 A;  1WTH A;  3FZW A;  4HZ9 B;  4IPB A;  1T2I A;  4XBY A;  1DMM A;  1OCV A;  2XFT A;  2ZHX B;  4CDL A;  1OUN A;  3BB9 A;  3DGY A;  2UX0 A;  3KFQ C;  1BU4 A;  1GY6 A;  1NWW A;  2OQE A;  5CLK A;  1KWI A;  3MG2 A;  4BTW A;  1VQ6 3;  3FGY A;  4N6M A;  5CK6 A;  4KFF A;  4STD A;  3RGA A;  4HM8 B;  2H0H A;  1RN4 A;  4WP5 A;  3CC7 3;  3CCV 3;  2GBW B;  4OVM A;  4R4K A;  1SAR A;  1OPY A;  2F56 A;  2QA4 3;  3B4O A;  2CK3 H;  3CCR 3;  1UI8 A;  2L1S A;  1EEJ A;  1OAC A;  2IYJ A;  3LXU X;  1BRJ A;  3EJV A;  4JF8 A;  1TFK A;  2CW9 A;  4EW5 A;  3F8X A;  1VQO 3;  1K28 A;  1ROA A;  2WOF A;  1DMQ A;  3H51 A;  1N8R 4;  2P0M A;  1TU5 A;  1B20 A;  3DGO A;  1B21 A;  1X1Y A;  3PYJ A;  3RDE A;  4AKZ A;  1YJN 3;  2W9P A;  4MMY B;  2W56 A;  2GU1 A;  3T8U A;  1VQQ A;  4H61 A;  3CCQ 3;  1JKG B;  4XDV A;  3I0Y A;  1VQ5 3;  1TUH A;  4HM4 B;  1BNG A;  3J7Y d;  5KP4 A;  1QAF A;  1FGM A;  2YFL B;  1QJG A;  4HM5 B;  2CG1 A;  2B1X B;  1N8Q A;  3NQY A;  5ELJ A;  1CYV A;  4LGQ A;  1B2U A;  1UUV B;  1W6Y A;  3DMC A;  3CCJ 3;  3EQQ B;  3CD6 3;  1Q42 A;  1STD A;  4LYL B;  1F8N A;  5AII A;  1I2E A;  1LOV A;  5IEP A;  2GU3 A;  4GHO A;  1DMN A;  3KZT A;  1O7N B;  3DZL A;  1IQX A;  5TGN A;  1VQ7 3;  1VQ8 3;  1GS3 A;  2CX1 A;  3DGL A;  1GY5 A;  2K3D A;  4X2O A;  1BRH A;  1RGC A;  1OF5 A;  3SX1 A;  1NNV A;  2XH9 A;  3OWU A;  1JV2 B;  1ZO2 A;  5AIH A;  4RBN A;  1B2Z A;  1RDS A;  1G02 A;  4G1M B;  2KF6 A;  2F5W A;  3DGM A;  1QVF 2;  4CPK A;  1I3F A;  3F40 A;  3SED A;  1MWS A;  2QGU A;  2RSX A;  4RNY A;  1KD1 4;  4U13 A;  2F98 A;  2P38 A;  3LH4 A;  5AYR B;  2BNG A;  3KE7 A;  1R4Y A;  1D6U A;  4FMC A;  3URP A;  5M19 A;  1I0X A;  1R4C A;  4HKV B;  5JBS A;  2BMQ B;  2HMN B;  4GB5 A;  3GSP A;  3SYU A;  4I4K A;  3JUM A;  4KFE A;  1UGH I;  2SBL A;  2FGT A;  1BSE A;  1NDO B;  3JUN A;  1W02 A;  3LTD A;  1B27 A;  7STD A;  5LC7 A;  3AMO B;  3K0Z A;  1VQP 3;  4FMA A;  1OGX A;  1IVW A;  2C10 A;  3MPH A;  3OXA A;  4WYK B;  4CCV A;  1J2B A;  2LQV A;  1AVL A;  1FZU A;  3EN1 B;  3FH1 A;  4RNT A;  1W6C A;  4J5K A;  3S5C A;  3CCE 3;  1W6G A;  3WOE B;  6RNT A;  1RGH A;  3KSP A;  3SLU A;  1YGE A;  2SAR A;  1LNI A;  4O02 B;  3LT8 A;  3MWZ A;  2QEX 3;  2KAA A;  1TJD A;  3EBT A;  1TIJ A;  1JBS A;  3G0K A;  4GL6 A;  2CFW A;  1YGW A;  1I70 A;  1ZX2 A;  4J5G A;  3LZA A;  1FGQ A;  1SIH A;  1V58 A;  2PNC A;  3CNX A;  2CG0 A;  2UGI A;  4HJL B;  8RNT A;  3RGR A;  3STD A;  3X40 A;  1TRP A;  4K90 B;  3D4A A;  2H0G A;  1T2H A;  1A90 A;  2HMM B;  1RNT A;  1W01 A;  3EE1 A;  3FG4 A;  3NBR A;  4XDW A;  3DXO A;  3KKG A;  3Q1C A;  2GEY A;  2OTL 3;  2BIR A;  1S72 3;  1YHQ 3;  3N9H A;  1BAN A;  3BNC A;  3IPT A;  3WOD G;  1OF5 B;  1AQZ A;  3G8Z A;  1NU3 A;  1UCI A;  2WGO A;  3RNT A;  1LVN A;  2XSO B;  1I8V A;  1O7M B;  2Y73 A;  2LYX A;  1Z1S A;  1GMQ A;  4EYC A;  1W00 A;  2IUJ A;  4O8S A;  1N9J A;  3EF8 A;  2B24 B;  1RGF A;  2HMJ B;  1PFP A;  2OWP A;  1RGK A;  1RN7 A;  3G4S 3;  2E2U A;  5ELU A;  2Z76 A;  4HVN A;  4BTY A;  1JZD A;  1VQL 3;  3CPO A;  4N3V A;  2OCT A;  1JN5 A;  2RCD A;  3N54 B;  4HAA A;  1RCK A;  1SII A;  1Q82 4;  1RNB A;  2K0M A;  5IG0 A;  1FUT A;  2XGN A;  3HII A;  3X3X A;  1SPU A;  4LMI A;  3SOA A;  4PEJ A;  4X2H A;  1M1X B;  3DM8 A;  1AV4 A;  5LC6 A;  3WA2 X;  3PCR A;  2JDI H;  4O2H A;  1GOY A;  3B7C A;  1I2F A;  1RMS A;  4CJN A;  3CCM 3;  1E97 A;  3BNE A;  3E99 A;  5FGO A;  1YIT 3;  1OHO A;  3ALA A;  4FCM A;  2STD A;  1CEW I;  1WMO A;  9RNT A;  1OH0 A;  4EV5 A;  1C54 A;  3CCU 3;  2BMO B;  1CYU A;  1DVC A;  2F99 A;  1SJW A;  3FG3 A;  3PZW A;  7RNT A;  3G16 A;  3U97 A;  3AMO A;  1O7G B;  1PU4 A;  3FSD A;  1WQL B;  4KVH A;  5GSP A;  1EUI C;  3JUO A;  3OWS A;  1MGW A;  1YNV X;  2HMK B;  5BU4 A;  5KP1 A;  1VQN 3;  5D81 A;  3JUQ A;  3S67 A;  2YFJ B;  1K73 4;  3F9S A;  1LOX A;  1HU9 A;  5BIR A;  3FG1 A;  3UNL A;  1BGS A;  5M1A A;  5HOH A;  3NV0 A;  4IIA A;  1AY7 A;  1FUW A;  1MWU A;  2GSP A;  3V99 A;  1M9G A;  4OK0 A;  1VZZ A;  3B4P A;  3OWY A;  2XRX B;  2F4Y A;  3LTA A;  2INX A;  3Q90 A;  1K41 A;  1GMR A;  3EBY A;  1K8A 4;  2CH9 A;  1BNR A;  3I56 3;  3Q2P A;  3SXX A;  2PZV A;  4EC6 A;  4N6N B;  5M18 A;  2P05 A;  1UUG B;  4K61 A;  4L7K A;  2R4I A;  1STF I;  3F8H A;  1GD4 A;  1GOU A;  1RRL A;  4QWT A;  1BNS A;  1OHP A;  1RJO A;  2HML B;  3S29 A;  1I3I A;  2ML5 A;  1YVB I;  1NB3 I;  2P09 A;  3DH2 A;  4HM7 B;  5EVH A;  5AEU B;  3NBJ A;  4WYK A;  5AI1 A;  1DET A;  1ULI B;  5DRV A;  1FW7 A;  3ECF A;  4LEH A;  2F5M A;  3WR2 A;  1FGO A;  1IU7 A;  1VQ9 3;  5D82 A;  3HI7 A;  4WWU C;  4FR9 A;  4DKI A;  5IG3 A;  3EB8 A;  5G1L A;  3KN4 A;  1RGA A;  2W9Q A;  1ASK A;  4KFD A;  1A2K A;  5D83 A;  1G96 A;  5KP3 A;  3SVA A;  1JB2 A;  2I9W A;  1RGL A;  1IT7 A;  1RGG A;  1B3S A;  2WOH A;  3JVC A;  1O7W B;  2WGQ A;  2XFS A;  2XEP A;  3IJE B;  3ZFZ A;  3G6E 3;  2FXT A;  3KII A;  2K54 A;  3UJM A;  1BRN L;  4AEQ A;  3HX8 A;  1AR0 A;  1IV9 A;  1LQG C;  1A2P A;  1IVU A;  2CC3 A;  4TX4 A;  3VSY A;  5I97 A;  1QVG 2;  1OGZ A;  5BXQ A;  1GOV A;  3UB1 A;  4LZI A;  2BHM A;  3BU4 A;  3CU3 A;  2XGL A;  1T3B A;  3V92 A;  1YJ9 3;  4N6O B;  1PY3 A;  2AAD A;  3N8B A;  5IW9 A;  4KT3 B;  1QAK A;  2W0Q A;  1U5O A;  1GYB A;  1UUW B;  5RNT A;  3JUP A;  4RZM A;  1LQM B;  1NO3 A;  1B2S A;  2W04 A;  2IMJ A;  3NX0 A;  2W2C A;  1RGE A;  1W2Z A;  3L0R A;  1ZS7 A;  1JB5 A;  1UCK A;  2CWT A;  1KQS 2;  4XBT A;  2Y74 A;  1RKY A;  1Q81 4;  2HMO B;  2MF7 A;  1V74 A;  1UI7 A;  4XB5 A;  4L8O A;  1EG9 B;  2V1L A;  4ZM8 A;  4R9L A;  4NHF A;  1IQY A;  1T5Y A;  2YX9 A;  1MWR A;  2BO9 B;  1I2G A;  3X42 A;  2M7O A;  1FA3 A;  1E3V A;  1GMP A;  1Q7H A;  1W7C A;  3GAX A;  1IQ8 A;  3NUV A;  1X1X A;  2O9U X;  2OQE C;  3BND A;  3AGO A;  3FF2 A;  1MWT A;  2CWV A;  3M8C A;  3UL5 A;  4K1U A;  1HZ1 A;  3OV4 A;  3CPW 2;  3FF0 A;  4MMX B;  5CXO A;  3AHW A;  3MHE A;  5IEO A;  3WA3 A;  4Q53 A;  2KF3 A;  2C11 A;  2W03 A;  3H3H A;  3EHC A;  1M90 4;  1Q40 B;  3D5I A;  4HM2 B;  1G0T A;  4IT7 A;  1LNH A;  3BNB A;  5STD A;  4N6U A;  1N9E A;  1LXE A;  3D3L A;  1UGI A;  3LTC A;  1GSP A;  4R1K A;  3TDG A;  5IER A;  1JBR A;  1CQS A;  2FNQ A;  1BRG A;  5IG4 A;  1B2X A;  1JRQ A;  2QIY A;  5EQL A;  1N5P A;  2OTJ 3;  3ROB A;  1Q86 4;  4I5Q A;  1BNF A;  2C4B A;  1LRA A;  3PCS A;  1BNE A;  3AGN A;  1TP6 A;  2CFK A;  2BU4 A;  4H3U A;  4EBG A;  2KRT A;  3K7C A;  1RHL A;  3ER7 A;  3A5E A;  3CCL 3;  1BOX A;  4R80 A;  1ISK A;  1BNI A;  1Q40 A;  1Y4K A;  2E2T A;  3MYT A;  5DRE A;  3AHS A;  2J8X B;  4HM1 B;  4ORL A;  1MNL A;  2CWU A;  2KF4 A;  2CFD A;  1BSA A;  4HM6 B;  5CF2 A;  3S28 A;  3B8L A;  2CX0 A;  1JJ2 2;  3NHX A;  1UCJ A;  2KXG A;  1VQK 3;  5BVB A;  3KCH A;  3EC9 A;  3GWR A;  4XBX A;  1BVI A;  4NRE A;  3SOY A;  1DYU A;  3GZR A;  4HBR A;  3FCS B;  1WMP A;  1OHS A;  3CMA 3;  1X1W A;  2IY2 A;  3KSE D;  2XF3 A;  4RNZ A;  3F7S A;  1RRH A;  5IF6 A;  3K63 A;  3NM7 A;  1TTO A;  3PS8 A;  3LT9 A;  4L8P A;  1RTU A;  2ML6 A;  2XSH B;  3LTB A;  3FKA A;  4O3V A;  1ROV A;  1TRQ A;  4LSO A;  5AYS C;  1S5A A;  3ZG0 A;  4J9A A;  2ZDJ A;  3LML A;  4AKY A;  5IG5 A;  7GSP A;  5JPU A;  1Q9E A;  3CCS 3;  3VGN A;  2OOV A;  1SQW A;  4BTX A;  3QK9 A;  6STD A;  1YVS A;  4FMD A;  1IVV A;  2RBI A;  3X41 A;  1KSI A;  2YFI B;  4MEI A;  1US1 A;  2E2V A;  3BLZ A;  3X3Z A;  2Z7A A;  4GSP A;  4MJD A;  4HZB B;  4EXR A;  1DVD A;  3U1W A;  1JN5 B;  4JRF A;  3HIG A;  3VF1 A;  1B2M A;  3CXC 2;  1RCL A;  1QAL A;  2WO0 A;  4MMZ B;  4K1V A;  1BRI A;  3K9M C;  5G2G A;  3F7X A;  4HM3 B;  3F14 A;  1ULJ B;  4HM0 B;  3T8N A;  1BRK A;  1V57 A;  2AAE A;  4XM4 A;  4N6L A;  4WFO A;  1UCL A;  6GSP A;  1HKX A;  1JB4 A;  4BIR A;  2W6J H;  3CC2 3;  1ZGX A;  2ZA4 A;  1W4N A;  2UUG C;  1GD3 A;  1IV7 A;  2L4V A;  3Q3F A;  2GBX B;  2OOV C;  5JPP A;  1LOW A;  2CKF B;  1NJI 4;  2W56 B;  1JNQ A;  1LOY A;  1E3R A;  1YJW 3;  4KZ1 A;  3CNM A;  1GY7 A;  3WDG B;  2CFL A;  4FMB A;  2KCD A;  3DUK A;  3CC4 3;  1IT8 A;  1WMN A;  4N6T A;  2BT3 A;  1IVX A;  4WHA A;  1BUJ A;  1BSD A;  4BL3 A;  4HOH A;  3EN8 A;  3WHO A;  5G1K A;  4N6V 0;  3HOH A;  1EKM A;  1HYF A;  2CIU A;  2JQ5 A;  3LYG A;  3NM2 A;  5HGR A;  3NBB A;  1BRS A;  1O7P B;  3LOY A;  1IYY A;  5CF1 A;  1RSN A;  2BMR B;  3I55 3;  5A0O B;  3DGN A;  5AEW B;  2Z6B A;  1FUS A;  3K5T A;  1W2B 2;  1FGT A;  1JKG A;  3T0U A;  3HK4 A;  4NPB A;  4BU4 A;  1A2V A;  1RN1 A;  2P0X A;  1D6Z A;  2D1W A;  2ZL8 A;  4BL2 A;  1DE3 A;  3MKI A;  2CHC A;  3UL6 A;  2R41 A;  1Q7Y 4;  1NB5 I;  1VQM 3;  1QMA A;  2IA7 A; 
#chains in the Genus database with same CATH homology
 8CHO A;  3HZP A;  1D6Y A;  4EV2 A;  3EX9 A;  1BUQ A;  1EQK A;  3A76 A;  1A67 A;  2RGQ A;  5FW5 A;  1MOL A;  2F86 B;  2O3O A;  5IEN A;  3G71 3;  2Q07 A;  4HYZ A;  1K9M 4;  1KC8 4;  5AIG A;  3MG1 A;  1YI2 3;  1AVK A;  2D42 A;  2IUK A;  3O8Y A;  3NXJ A;  3S27 A;  1TFO A;  3PGB A;  1W5Z A;  3GZB A;  3PXM A;  5AIF A;  3X3Y A;  3QRD A;  2XR8 B;  4J8T A;  3WMD A;  3D9R A;  3IMA B;  2RFR A;  1WNH A;  3NQZ A;  5EEO A;  2Z77 A;  2GXF A;  3MG3 A;  4FCZ A;  3WOF B;  3FLJ A;  3V98 A;  1YIJ 3;  4OUQ A;  2CFG A;  3GZX B;  2A15 A;  4FCJ A;  4R9K A;  3DY5 A;  3OX9 A;  1U8C B;  3GZY B;  1L5G B;  1N5H A;  2GEX A;  1FGR A;  1IK3 A;  3GRD A;  1O7H B;  1C7H A;  1M1K 4;  2MC8 A;  3CME 3;  1IDP A;  1VQ4 3;  3NV0 B;  3OW2 2;  3MSO A;  1UW1 A;  1EA2 A;  3FZW A;  1WTH A;  4HZ9 B;  4IPB A;  4XBY A;  1DMM A;  1OCV A;  2XFT A;  4CDL A;  1OUN A;  3BB9 A;  2UX0 A;  3KFQ C;  1GY6 A;  1NWW A;  2OQE A;  5CLK A;  1KWI A;  3MG2 A;  4BTW A;  1VQ6 3;  3FGY A;  4N6M A;  5CK6 A;  4KFF A;  4STD A;  3RGA A;  4HM8 B;  4WP5 A;  3CC7 3;  3CCV 3;  2GBW B;  4OVM A;  4R4K A;  1OPY A;  2QA4 3;  3B4O A;  2CK3 H;  3CCR 3;  1UI8 A;  1OAC A;  4JF8 A;  3LXU X;  3EJV A;  1TFK A;  2CW9 A;  1VQO 3;  3F8X A;  1K28 A;  1ROA A;  2WOF A;  1DMQ A;  3H51 A;  1N8R 4;  2P0M A;  1TU5 A;  3PYJ A;  3DGO A;  4AKZ A;  3RDE A;  1YJN 3;  2W9P A;  4MMY B;  2W56 A;  2GU1 A;  3T8U A;  4H61 A;  3CCQ 3;  1JKG B;  4XDV A;  3I0Y A;  1VQ5 3;  1TUH A;  4HM4 B;  3J7Y d;  5KP4 A;  1QAF A;  1FGM A;  2YFL B;  1QJG A;  4HM5 B;  2CG1 A;  2B1X B;  1N8Q A;  3NQY A;  5ELJ A;  1CYV A;  4LGQ A;  1UUV B;  1W6Y A;  3DMC A;  3CCJ 3;  3EQQ B;  3CD6 3;  1Q42 A;  1STD A;  1F8N A;  5AII A;  5IEP A;  2GU3 A;  1DMN A;  3KZT A;  1O7N B;  3DZL A;  1IQX A;  5TGN A;  1VQ7 3;  1VQ8 3;  1GS3 A;  3DGL A;  1GY5 A;  4X2O A;  1OF5 A;  3SX1 A;  2XH9 A;  3OWU A;  1JV2 B;  1ZO2 A;  5AIH A;  4G1M B;  3DGM A;  1QVF 2;  3F40 A;  3SED A;  2QGU A;  2RSX A;  4RNY A;  1KD1 4;  4U13 A;  2P38 A;  2F98 A;  3LH4 A;  5AYR B;  2BNG A;  3KE7 A;  4FMC A;  1D6U A;  1R4C A;  4HKV B;  5JBS A;  2BMQ B;  2HMN B;  4GB5 A;  4I4K A;  3JUM A;  4KFE A;  7STD A;  2SBL A;  2FGT A;  1NDO B;  3JUN A;  1W02 A;  3LTD A;  1VQP 3;  5LC7 A;  3AMO B;  3K0Z A;  4FMA A;  1OGX A;  1IVW A;  2C10 A;  3MPH A;  3OXA A;  4WYK B;  4CCV A;  1J2B A;  2LQV A;  1AVL A;  3EN1 B;  3FH1 A;  1W6C A;  3S5C A;  3CCE 3;  1W6G A;  3WOE B;  3KSP A;  3SLU A;  1YGE A;  4O02 B;  3LT8 A;  3MWZ A;  2QEX 3;  3EBT A;  1TIJ A;  3G0K A;  4GL6 A;  2CFW A;  1ZX2 A;  3LZA A;  1FGQ A;  1SIH A;  2PNC A;  3CNX A;  2CG0 A;  4HJL B;  3RGR A;  3STD A;  3X40 A;  4K90 B;  1A90 A;  2HMM B;  1W01 A;  3EE1 A;  3FG4 A;  3NBR A;  4XDW A;  3DXO A;  3KKG A;  3Q1C A;  2GEY A;  2OTL 3;  1S72 3;  1YHQ 3;  3N9H A;  3BNC A;  3IPT A;  3WOD G;  1OF5 B;  3G8Z A;  1NU3 A;  2WGO A;  1LVN A;  2XSO B;  1O7M B;  2Y73 A;  2LYX A;  1Z1S A;  4EYC A;  1W00 A;  2IUJ A;  4O8S A;  1N9J A;  3EF8 A;  2B24 B;  2HMJ B;  1PFP A;  2OWP A;  1RN7 A;  3G4S 3;  2E2U A;  5ELU A;  2Z76 A;  4HVN A;  4BTY A;  1VQL 3;  3CPO A;  4N3V A;  2OCT A;  1JN5 A;  2RCD A;  3N54 B;  1SII A;  1Q82 4;  2K0M A;  5IG0 A;  2XGN A;  3HII A;  3X3X A;  1SPU A;  4LMI A;  3SOA A;  4PEJ A;  4X2H A;  1M1X B;  3DM8 A;  1AV4 A;  5LC6 A;  3WA2 X;  3PCR A;  2JDI H;  4O2H A;  3B7C A;  3CCM 3;  1E97 A;  3BNE A;  3E99 A;  5FGO A;  1YIT 3;  1OHO A;  3ALA A;  4FCM A;  2STD A;  1CEW I;  1WMO A;  1OH0 A;  4EV5 A;  3CCU 3;  2BMO B;  1CYU A;  1DVC A;  2F99 A;  1SJW A;  3FG3 A;  3PZW A;  3G16 A;  3U97 A;  3AMO A;  1O7G B;  1PU4 A;  3FSD A;  1WQL B;  4KVH A;  3OWS A;  3JUO A;  5KP1 A;  1VQN 3;  2HMK B;  5D81 A;  3JUQ A;  3S67 A;  2YFJ B;  1K73 4;  3F9S A;  1LOX A;  1HU9 A;  3FG1 A;  3UNL A;  3NV0 A;  4IIA A;  1FUW A;  3V99 A;  1M9G A;  4OK0 A;  1VZZ A;  3B4P A;  3OWY A;  2XRX B;  3LTA A;  2INX A;  3Q90 A;  1K41 A;  3EBY A;  1K8A 4;  2CH9 A;  3I56 3;  3Q2P A;  3SXX A;  2PZV A;  4EC6 A;  4N6N B;  2P05 A;  4K61 A;  4L7K A;  2R4I A;  1STF I;  3F8H A;  1GD4 A;  1RRL A;  4QWT A;  1OHP A;  1RJO A;  2HML B;  3S29 A;  2ML5 A;  1YVB I;  1NB3 I;  2P09 A;  5EVH A;  4HM7 B;  5AEU B;  3NBJ A;  4WYK A;  5AI1 A;  1ULI B;  5DRV A;  3ECF A;  4LEH A;  1FGO A;  1IU7 A;  1VQ9 3;  5D82 A;  3HI7 A;  4WWU C;  4FR9 A;  5IG3 A;  3EB8 A;  3KN4 A;  2W9Q A;  1ASK A;  4KFD A;  1A2K A;  5D83 A;  1G96 A;  5KP3 A;  3SVA A;  1JB2 A;  2I9W A;  2WOH A;  1IT7 A;  3JVC A;  1O7W B;  2WGQ A;  2XFS A;  2XEP A;  3IJE B;  3G6E 3;  2FXT A;  3KII A;  2K54 A;  3UJM A;  4AEQ A;  3HX8 A;  1AR0 A;  1IV9 A;  4TX4 A;  1IVU A;  2CC3 A;  3VSY A;  5I97 A;  1QVG 2;  1OGZ A;  5BXQ A;  3UB1 A;  4LZI A;  2BHM A;  3CU3 A;  3V92 A;  2XGL A;  1YJ9 3;  4N6O B;  3N8B A;  5IW9 A;  1QAK A;  2W0Q A;  1U5O A;  1GYB A;  1UUW B;  3JUP A;  4RZM A;  2W04 A;  1NO3 A;  2IMJ A;  3NX0 A;  2W2C A;  1W2Z A;  3L0R A;  1JB5 A;  2CWT A;  1KQS 2;  4XBT A;  2Y74 A;  1RKY A;  1Q81 4;  2HMO B;  2MF7 A;  1V74 A;  1UI7 A;  4XB5 A;  4L8O A;  1EG9 B;  2V1L A;  4ZM8 A;  4R9L A;  4NHF A;  1IQY A;  1T5Y A;  2YX9 A;  2BO9 B;  3X42 A;  2M7O A;  1FA3 A;  1E3V A;  1W7C A;  4RBN A;  3GAX A;  1IQ8 A;  3NUV A;  2O9U X;  2OQE C;  3BND A;  3FF2 A;  2CWV A;  3UL5 A;  3M8C A;  4K1U A;  3OV4 A;  3CPW 2;  3FF0 A;  4MMX B;  5CXO A;  5IEO A;  3MHE A;  3WA3 A;  4Q53 A;  2C11 A;  2W03 A;  3H3H A;  3EHC A;  1M90 4;  1Q40 B;  4HM2 B;  4IT7 A;  1LNH A;  3BNB A;  5STD A;  4N6U A;  1N9E A;  1LXE A;  3D3L A;  3LTC A;  4R1K A;  3TDG A;  5IER A;  1CQS A;  2FNQ A;  5IG4 A;  1JRQ A;  2QIY A;  5EQL A;  1N5P A;  2OTJ 3;  3ROB A;  1Q86 4;  3PCS A;  1TP6 A;  2CFK A;  4H3U A;  4EBG A;  2KRT A;  3K7C A;  3ER7 A;  3CCL 3;  4R80 A;  1ISK A;  1Q40 A;  1Y4K A;  2E2T A;  3MYT A;  5DRE A;  4HM1 B;  4ORL A;  1MNL A;  2CWU A;  2CFD A;  4HM6 B;  5CF2 A;  3S28 A;  3B8L A;  1JJ2 2;  3NHX A;  2KXG A;  1VQK 3;  5BVB A;  3EC9 A;  3GWR A;  4XBX A;  4NRE A;  3SOY A;  1DYU A;  3GZR A;  4HBR A;  3FCS B;  1WMP A;  1OHS A;  3CMA 3;  3KSE D;  2XF3 A;  4RNZ A;  3F7S A;  1RRH A;  5IF6 A;  3K63 A;  3NM7 A;  3PS8 A;  3LT9 A;  4L8P A;  2ML6 A;  2XSH B;  3LTB A;  3FKA A;  4O3V A;  1ROV A;  4LSO A;  5AYS C;  1S5A A;  4J9A A;  2ZDJ A;  3LML A;  4AKY A;  5IG5 A;  5JPU A;  3CCS 3;  3VGN A;  2OOV A;  1SQW A;  4BTX A;  3QK9 A;  6STD A;  4FMD A;  1IVV A;  3X41 A;  1KSI A;  2YFI B;  4MEI A;  1US1 A;  2E2V A;  3BLZ A;  3X3Z A;  2Z7A A;  1DVD A;  4MJD A;  4HZB B;  4EXR A;  3U1W A;  1JN5 B;  4JRF A;  3HIG A;  3VF1 A;  3CXC 2;  1QAL A;  2WO0 A;  4MMZ B;  4K1V A;  3K9M C;  5G2G A;  3F7X A;  4HM3 B;  3F14 A;  1ULJ B;  4HM0 B;  3T8N A;  4XM4 A;  4WFO A;  4N6L A;  1HKX A;  1JB4 A;  2W6J H;  3CC2 3;  1W4N A;  1GD3 A;  1IV7 A;  2L4V A;  2GBX B;  2OOV C;  5JPP A;  2CKF B;  1NJI 4;  2W56 B;  1JNQ A;  1YJW 3;  1E3R A;  4KZ1 A;  3CNM A;  1GY7 A;  3WDG B;  2CFL A;  4FMB A;  2KCD A;  3DUK A;  3CC4 3;  1IT8 A;  1WMN A;  4N6T A;  2BT3 A;  1IVX A;  4WHA A;  3EN8 A;  4N6V 0;  1EKM A;  2CIU A;  3NM2 A;  2JQ5 A;  3LYG A;  5HGR A;  3NBB A;  1O7P B;  3LOY A;  5CF1 A;  2BMR B;  3I55 3;  5A0O B;  3DGN A;  5AEW B;  2Z6B A;  3K5T A;  1W2B 2;  1FGT A;  1JKG A;  3T0U A;  3HK4 A;  1A2V A;  2P0X A;  1D6Z A;  2D1W A;  2ZL8 A;  3MKI A;  2CHC A;  3UL6 A;  1NB5 I;  1Q7Y 4;  1VQM 3;  1QMA A;  2IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...