5IENA

Structure of cdl2.2, a computationally designed vitamin-d3 binder
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
129
Chain Sequence
QSAKEAIEAALADFVKAYNSKDAAGVASKYMDDAAIFPLDMARVDGRQNIQKLWQGLMDMGVSEPKLTTLDVQESGDFAFESGSISLKGPGKDSKLVDIAGKYVEVWRKGQDGGWKLYRTIANLDPAEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords CDL2.2
publication title Structure of CDL2.2, a computationally designed Vitamin-D3 binder
rcsb
source organism Synthetic construct
total genus 36
structure length 129
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ienA00
3G8ZA 2CHCA 2BMQB 3M8CA 4HM4B 1GY6A 5AI1A 1IDPA 5KP3A 3S5CA 3FSDA 2RCDA 1EG9B 3GRDA 4HM8B 3CNMA 1OGZA 2XRXB 8CHOA 2B1XB 4HM0B 1Q42A 4HM5B 1UUWB 3DUKA 4HM3B 3H3HA 1GS3A 3MG3A 3GWRA 1Q40A 4OUQA 1ZO2A 1OGXA 1AR0A 4R1KA 3EN8A 1O7GB 3STDA 2BMRB 2XSOB 4H3UA 4L7KA 1QMAA 5HGRA 3B4PA 4XBTA 5IG3A 3D9RA 2GEYA 3NM2A 4XDVA 2CKFB 1CQSA 5JPUA 1W02A 5KP4A 3A76A 1SJWA 3NXJA 1NWWA 5D83A 5CXOA 3B8LA 3GZRA 2HMMB 5D82A 2Z77A 5TGNA 3DM8A 4OVMA 1S5AA 3ECFA 4STDA 3MSOA 4XBXA 1QJGA 2YFJB 4N3VA 1JN5B 1ULIB 3CNXA 7STDA 1VZZA 3EHCA 1E3RA 3OWSA 1OCVA 2QIYA 1W00A 1JB5A 4FCMA 2STDA 1EA2A 5CF2A 3JUPA 5IEOA 1JB2A 1E97A 1OH0A 3B7CA 5AEWB 2HMLB 3F8XA 3FLJA 1OPYA 1O7PB 3G0KA 3BB9A 3T8NA 1JN5A 1WQLB 5EVHA 3FGYA 3FZWA 3WMDA 5AIIA 3T8UA 2IMJA 2RGQA 3EJVA 2W2CA 3GZXB 2Z7AA 4LEHA 3OWYA 1O7HB 2INXA 1O7WB 1OUNA 4R9KA 5IERA 1TP6A 2HMJB 1Z1SA 3KKGA 3EC9A 5CK6A 1OHOA 3EX9A 3CU3A 5AEUB 2HMOB 3F14A 3GZBA 3IPTA 4R9LA 5AIHA 4WWUC 1A2KA 4GB5A 3SEDA 3ER7A 3JUNA 2HMKB 2XR8B 1K41A 5DRVA 2JQ5A 4KVHA 4J8TA 4HZBB 3FF2A 1GY5A 4L8PA 4HZ9B 3JUQA 5G2GA 3NHXA 1JB4A 5IG5A 4ORLA 4FCJA 4LMIA 4HM6B 3H51A 4XM4A 5BVBA 1ULJB 1DMMA 3NBRA 2I9WA 5CF1A 1O7MB 4LGQA 3OXAA 3RGAA 3EN1B 3RGRA 4IIAA 3OV4A 5IEPA 3UJMA 3K0ZA 3K7CA 1C7HA 1W6YA 4WP5A 2F86B 3DXOA 1DMQA 2YFLB 1HKXA 5IENA 3HX8A 3MG2A 3EBTA 3SOAA 5AIGA 2GBWB 4I4KA 2BNGA 5DREA 3MYTA 1TUHA 2RFRA 5BXQA 3I0YA 1OHSA 2R4IA 1NDOB 3MKIA 4L8OA 1JKGB 5IG0A 1GY7A 2XSHB 4RZMA 6STDA 2A15A 3KZTA 3KE7A 2B24B 3KSPA 3F9SA 4X2OA 4XB5A 1OHPA 3DZLA 3E99A 1JKGA 3LZAA 5JPPA 4HM7B 4HJLB 1O7NB 4J9AA 3ROBA 4Q53A 1DMNA 3F40A 4U13A 3F8HA 3JUOA 2YFIB 2OWPA 3HZPA 3NV0B 2Z76A 5STDA 2HMNB 1NU3A 3G16A 4HVNA 1STDA 2BMOB 3EBYA 1BUQA 3Q90A 4WYKB 5KP1A 3FF0A 4MJDA 2GXFA 3GZYB 4K1VA 5IG4A 5IF6A 3BLZA 2PZVA 3VGNA 3VSYA 3NV0A 4X2HA 3DMCA 4PEJA 1ISKA 2GEXA 3EF8A 3EQQB 3CPOA 5FW5A 4WYKA 3JUMA 4XBYA 1U5OA 4HM2B 1OF5B 3LYGA 5CLKA 1E3VA 2K54A 2GBXB 1UUVB 2UX0A 1ASKA 3UNLA 4CDLA 3FH1A 3B4OA 3MG1A 4K1UA 3F7XA 4HKVB 3OX9A 4HM1B 4XDWA 3F7SA 5D81A 1OF5A 1W01A 3HK4A 3MHEA 1GYBA 2F98A 2F99A 2QGUA 5AIFA 3OWUA 1Q40B 3FKAA 1ZX2A 3SOYA 3NUVA
chains in the Genus database with same CATH superfamily
2W9PA 3NQYA 1VQO3 4HAAA 1DETA 3G8ZA 1TRPA 2P38A 4EXRA 2CHCA 1N5HA 2BMQB 1AY7A 1RN7A 3M8CA 4HM4B 1GY6A 3DGNA 5AI1A 1I3FA 1IDPA 2HOHA 3X3XA 4I5QA 5KP3A 3S5CA 1ROAA 3FSDA 2RCDA 1RHLA 4EBGA 4AKYA 3HIGA 2CFLA 1EG9B 2CX1A 1CYVA 1YI23 3GRDA 3KCHA 4HM8B 3CNMA 3KSED 3BNEA 2F5MA 1D6UA 1OGZA 2CFWA 2XFTA 2XRXB 4IT7A 8CHOA 1BRIA 1BU4A 2B1XB 1TTOA 4HM0B 1Q42A 3Q3FA 5AYRB 4HM5B 1UUWB 1IVWA 3DUKA 1ROVA 2RBIA 4HM3B 3H3HA 3CPW2 1GS3A 3MG3A 4OK0A 1BSEA 3GWRA 3JVCA 2C11A 3CCV3 5LC6A 1Q40A 4OUQA 4QWTA 2XGNA 1ZO2A 1OGXA 1PFPA 1AR0A 2LYXA 2W04A 1S723 1IU7A 2KF6A 3UL6A 3UL5A 1A67A 1YIT3 4R1KA 3EN8A 1KQS2 4CJNA 3LH4A 4FMBA 1TU5A 1O7GB 1I8VA 3STDA 2BMRB 2XSOB 4H3UA 1V58A 4L7KA 2GU1A 1QMAA 1TFKA 1FGQA 5HGRA 3B4PA 4XBTA 3SLUA 3DGYA 3LTDA 2OOVC 5IG3A 1MWRA 1CEWI 7GSPA 1VQ43 4BTWA 3D9RA 4FMDA 2CWTA 4N6UA 2GEYA 2KRTA 3QK9A 1YJW3 1FGRA 1FGTA 2CW9A 1W6GA 4TX4A 2UUGC 3O8YA 1LNIA 2OCTA 3NM2A 4WFOA 1QAFA 3WDGB 4XDVA 1EKMA 1G96A 2GU3A 2CKFB 1PU4A 1CQSA 4R80A 3DH2A 1SQWA 5M19A 1D6YA 5JBSA 2W56B 5JPUA 1W02A 5KP4A 3A76A 3LTCA 1SJWA 1HU9A 4CCVA 2RSXA 1K8A4 3NXJA 3G6E3 1NWWA 1BSAA 5D83A 5CXOA 4KT3B 3B8LA 3GZRA 2HMMB 4NREA 5D82A 2L1SA 2Z77A 3L0RA 3LTBA 5M1AA 1N9EA 2KF3A 4MMZB 5TGNA 4WHAA 3ZG5A 3X3ZA 2CG1A 5FGOA 4LZIA 1BUJA 3DM8A 4OVMA 2BT3A 1Q7HA 1I70A 1S5AA 3ECFA 4STDA 3CCM3 1BANA 1LNHA 3MSOA 3J7Yd 1Y4KA 1B2ZA 4XBXA 1IV9A 1NO3A 3SYUA 1LOYA 1QJGA 2YFJB 1IT8A 4N3VA 1LRAA 1DYUA 1I2FA 2E2UA 1JN5B 3ALAA 1ULIB 3CNXA 7STDA 1VZZA 3AMOB 2FNQA 2FGTA 2W56A 1IVUA 3EHCA 2YX9A 1E3RA 2CFDA 3OWSA 1OCVA 2QIYA 1BSDA 1KC84 1YHQ3 1W00A 1JB5A 2XGLA 4FCMA 1NJI4 1JBTA 1YVSA 3S67A 2BIRA 1TRQA 1RDSA 3S28A 2STDA 3X42A 1EA2A 2LQVA 5CF2A 5HOHA 1SARA 3JUPA 2WGOA 5IEOA 1JB2A 1E97A 1OH0A 1U8CB 2CWUA 3B7CA 3MPHA 5G1LA 3RDEA 3VF1A 4BU4A 3FG4A 5AEWB 2Y74A 3X40A 2ZHXB 2HMLB 1BOXA 3F8XA 3FLJA 4J5KA 1Q824 3PCRA 1FZUA 2ML6A 1OPYA 1O7PB 3CC23 3G0KA 1MNLA 2H0IA 3BB9A 1JNQA 1JN5A 3T8NA 1I0XA 1WQLB 1RCKA 5EVHA 1M1XB 3FGYA 1IK3A 1UCLA 3AMOA 3FZWA 2CG0A 4GHOA 1RMSA 1RGFA 4K90B 4ZM8A 3WMDA 1I0VA 4BIRA 3PYJA 3SX1A 1A2PA 1UUGB 2P0XA 2ML5A 1BNRA 2C4BA 5AIIA 3T8UA 5I97A 2IMJA 2W0QA 2RGQA 3EJVA 2W2CA 1NNVA 3GZXB 3WA2X 2Z7AA 4LEHA 1X1XA 1PYLA 3OWYA 3BNBA 1O7HB 3T0UA 3BIRA 2INXA 3ZFZA 1JBRA 1T3BA 1O7WB 1QAKA 4KZ1A 1VQM3 5A0OB 4DKIA 1OUNA 1BNFA 2P05A 2XEPA 4R9KA 1L5GB 5IERA 4N6V0 3D3LA 1BNSA 1TP6A 2HMJB 2E2TA 3RNTA 1W2B2 1WMPA 1Z1SA 3WODG 5BIRA 1UI8A 1YIJ3 3KIIA 3KKGA 1Q9EA 1TFOA 1STFI 1FA3A 1VQP3 3EC9A 1RGEA 3WHOA 1RCLA 1MWSA 5CK6A 1OHOA 3EX9A 2IYJA 4EV5A 1GOVA 3CU3A 5AEUB 1ZS7A 3EE1A 3Q1CA 3DY5A 2HMOB 3N8BA 1HZ1A 3F14A 1QVF2 1TJDA 1B21A 3GZBA 3IPTA 3QRDA 4R9LA 1VQ83 5AIHA 1YGEA 3IMAB 3NBBA 2W9QA 4N6OB 3WR2A 5IW9A 4ILFA 3CMA3 4WWUC 3D79A 3X3YA 1A2KA 1RLSA 2CX0A 4R4KA 1OACA 3D5GA 3CCL3 1LOWA 4GB5A 4N6TA 1T2IA 2P09A 4KFDA 4FMCA 1N9JA 4RBNA 3SEDA 3CC73 1BNJA 3WOFB 3ER7A 3X41A 1VQK3 2OQEA 3JUNA 2IY2A 1DE3A 1T2HA 2HMKB 2WOFA 2XR8B 2KAAA 1K41A 1GOUA 3AHSA 3IJEB 3NX0A 1MGWA 5DRVA 1M1K4 5ELUA 3U97A 2JQ5A 4KVHA 1CYUA 4J8TA 2AADA 4HZBB 1VQ93 3I553 2UGIA 4KFEA 2AAEA 3FF2A 4JRFA 3PS8A 1BNIA 1GY5A 1RRHA 1Q864 3AGNA 1F8NA 1TIJA 1X1WA 1IVVA 1JV2B 4L8PA 4HZ9B 3JUQA 5G2GA 3NHXA 3HOHA 1US1A 4MEIA 4BTXA 1JB4A 1RKYA 3BU4A 3ZG0A 1RGHA 3GAXA 1DVCA 3S27A 1AQZA 4FR9A 1IQ8A 2KF4A 5IG5A 3FG3A 2ZDJA 4ORLA 1X1UA 4FCJA 4LMIA 1GD3A 4O02B 4HM6B 3H51A 2W03A 4XM4A 5BVBA 1ULJB 1DMMA 3N54B 3NBRA 3G713 4O8SA 2CK3H 2I9WA 3D5IA 3HIIA 3D4AA 2V1LA 5CF1A 1O7MB 3NM7A 1LXEA 1MWTA 4MMYB 4LGQA 1FUTA 1N8QA 3OXAA 1YVBI 1UI7A 3EN1B 3DGLA 3RGAA 3RGRA 1BVIA 4IIAA 1PY3A 1UDII 3UB1A 2QA43 3OV4A 2M7OA 5IEPA 1RGKA 3UJMA 1GMRA 3K0ZA 4EYCA 1VQQA 3V92A 3K7CA 4IPBA 1W7CA 1C7HA 3CC43 1DVDA 1W6YA 2CC3A 2SBLA 4WP5A 2F86B 3AGOA 4GSPA 3DXOA 1JJ22 3NBJA 1DMQA 1FGMA 1YJ93 1I2GA 2YFLB 2H0GA 2KCDA 1HKXA 1IVXA 3I563 2L4VA 3LMLA 5LC7A 5IENA 1EQKA 3HX8A 3MG2A 1WNHA 3EBTA 3SOAA 4FCZA 1W4NA 2PNCA 5AIGA 4RNTA 5BU4A 1HYFA 2GBWB 1K9M4 2XFSA 4I4KA 2BNGA 5DREA 2Y73A 3PZWA 3MYTA 1TUHA 2RFRA 4AEQA 1BAOA 5BXQA 1MWUA 3I0YA 1LQGC 1OHSA 1RJOA 1YGWA 3KN4A 1JZDA 3PGBA 1VQ63 2R4IA 1SIHA 3CCQ3 1NDOB 2CWVA 3MKIA 2Z6BA 4KFFA 1NB5I 1NB3I 3CME3 2F56A 4L8OA 1GMQA 4LYLB 1JKGB 5IG0A 2R41A 4BL2A 5GSPA 1GY7A 1A2VA 1BRHA 1RRLA 1N5PA 2XSHB 1GD4A 2WOHA 4GL6A 4RZMA 1B2XA 1RGLA 1G0TA 2CFGA 1R4CA 4LSOA 2CIUA 1B20A 1AVLA 3G4S3 1A90A 1RNTA 2OTJ3 6STDA 4BL3A 3PXMA 1LOVA 3GSPA 1B2MA 2D42A 2A15A 2MF7A 3KZTA 2XH9A 2OOVA 1YJN3 2RNTA 1IQYA 3KE7A 4FMAA 2B24B 3KSPA 3F9SA 2C10A 4X2OA 1BNGA 1FUWA 2BO9B 1LOXA 1SIIA 4XB5A 1OHPA 1X1YA 1IT7A 3DZLA 1VQL3 3E99A 2O9UX 1T5YA 1JKGA 3CD63 3LZAA 5AYSC 2XF3A 5JPPA 4HM7B 2SARA 4HJLB 3TDGA 1O7NB 4J9AA 3ROBA 1WMOA 4Q53A 1DMNA 3F40A 1V74A 1W5ZA 4U13A 1UCKA 3F8HA 3MWZA 1B2SA 3JUOA 3K63A 1RNBA 2YFIB 4NPBA 1WTHA 1VQ73 3V98A 2OWPA 3HZPA 3NV0B 4G1MB 3WA3A 3N9HA 5M18A 4HYZA 1BGSA 4EC6A 1LVNA 1SPUA 1UCIA 2WO0A 2Z76A 5STDA 2QEX3 4JF8A 1VQN3 2HMNB 1MGRA 1NU3A 3Q2PA 4MMXB 3G16A 4HVNA 1K28A 1STDA 1R4YA 1BRGA 1WMNA 2BMOB 1BSBA 1UGHI 1W6CA 3BNDA 2F5WA 2K3DA 3EBYA 3WOEB 1BUQA 3Q90A 3NQZA 4WYKB 3OW22 1RGGA 2O3OA 2Q07A 5KP1A 1FYSA 5EQLA 3CXC2 3FF0A 1CH0A 1FUSA 1KD14 3DGMA 1UW1A 1B27A 2P0MA 4MJDA 1IV7A 2GXFA 2E2VA 3GZYB 4AKZA 4K61A 1AVKA 1BRNL 1G02A 4J5GA 2CH9A 4K1VA 1JRQA 5IG4A 5IF6A 1BRJA 1B3SA 3DGOA 2D1WA 4H61A 2ZA4A 3BLZA 1MOLA 2F4YA 2BHMA 2IUKA 2PZVA 3KFQC 3NV0A 1RTUA 3VGNA 4X2HA 3VSYA 3DMCA 3LT8A 4RNZA 7RNTA 1UCJA 4HBRA 4PEJA 4N6MA 2JDIH 2OTL3 1BRSA 1ISKA 2GEXA 2OQEC 1JZOA 1YNVX 3EB8A 1IQXA 3EF8A 3SVAA 4BTYA 3EQQB 2KF5A 3CCJ3 3CPOA 2FXTA 2H0HA 1RSNA 9RNTA 4O3VA 3S29A 1RGCA 5FW5A 8RNTA 4WYKA 1KSIA 1V57A 1BNEA 1I3IA 1VQ53 1D6ZA 2IUJA 3JUMA 5EEOA 1KWIA 3K5TA 4HOHA 4XBYA 1U5OA 4HM2B 1OF5B 2WGQA 3SXXA 3LYGA 5CLKA 1E3VA 3U1WA 3CCU3 1UGIA 2K54A 2GBXB 3LOYA 2MC8A 1QVG2 1GOYA 1UUVB 1K734 4CPKA 1RGAA 3PCSA 4NHFA 2UX0A 1Q814 4EW5A 3K9MC 1ASKA 3UNLA 2CFKA 3V99A 2BU4A 1W2ZA 6RNTA 2ZL8A 1RN1A 2IA7A 4CDLA 1AV4A 1BSCA 2W6JH 3FH1A 3HI7A 1Q7Y4 1FGOA 3LXUX 3B4OA 3MG1A 3BNCA 4K1UA 3FG1A 3AHWA 2J8XB 3F7XA 4HKVB 3CCE3 1LQMB 3LT9A 3OX9A 4N6NB 4HM1B 1QALA 1EUIC 4RNYA 1M9GA 4XDWA 4EV2A 3CCS3 4O2HA 3F7SA 5G1KA 1GSPA 1N8R4 5D81A 1FW7A 1I2EA 1B2UA 1OF5A 1W01A 1EEJA 3HK4A 1BIRA 5RNTA 1IYYA 2GSPA 1GYBA 3MHEA 3LTAA 4N6LA 5ELJA 3URPA 6GSPA 2KXGA 1RN4A 1J2BA 1GMPA 2F98A 1M904 1C54A 2K0MA 1BRKA 2F99A 3A5EA 3CCR3 2QGUA 5AIFA 3FCSB 3OWUA 1Q40B 3FKAA 1ZX2A 3SOYA 1ZGXA 1JBSA 3NUVA
chains in the Genus database with same CATH topology
2W9PA 3NQYA 1VQO3 3G8ZA 2P38A 4EXRA 2CHCA 1N5HA 2BMQB 1RN7A 3M8CA 4HM4B 1GY6A 3DGNA 5AI1A 1IDPA 3X3XA 5KP3A 3S5CA 1ROAA 3FSDA 2RCDA 4EBGA 4AKYA 3HIGA 2CFLA 1EG9B 1CYVA 1YI23 3GRDA 4HM8B 3CNMA 3KSED 3BNEA 1D6UA 1OGZA 2CFWA 2XFTA 2XRXB 4IT7A 8CHOA 2B1XB 4HM0B 1Q42A 5AYRB 4HM5B 1UUWB 1IVWA 3DUKA 1ROVA 4HM3B 3H3HA 3CPW2 1GS3A 3MG3A 4OK0A 3JVCA 3GWRA 3CCV3 2C11A 5LC6A 1Q40A 4OUQA 4QWTA 2XGNA 1ZO2A 1OGXA 2W04A 1AR0A 1PFPA 2LYXA 1S723 1IU7A 3UL6A 3UL5A 1A67A 1YIT3 4R1KA 3EN8A 1KQS2 3LH4A 4FMBA 1TU5A 1O7GB 3STDA 2BMRB 2XSOB 4H3UA 4L7KA 2GU1A 1QMAA 1TFKA 1FGQA 5HGRA 3B4PA 4XBTA 3SLUA 3LTDA 5IG3A 2OOVC 1CEWI 1VQ43 4BTWA 3D9RA 4FMDA 2CWTA 4N6UA 2GEYA 2KRTA 3QK9A 1YJW3 1FGRA 1FGTA 2CW9A 1W6GA 4TX4A 3O8YA 3WDGB 2OCTA 3NM2A 4WFOA 1QAFA 4XDVA 1EKMA 1G96A 2GU3A 2CKFB 1PU4A 1CQSA 4R80A 1SQWA 1D6YA 5JBSA 2W56B 5JPUA 1W02A 5KP4A 3A76A 3LTCA 1SJWA 1HU9A 4CCVA 2RSXA 1K8A4 3NXJA 3G6E3 1NWWA 5D83A 5CXOA 3B8LA 3GZRA 2HMMB 4NREA 5D82A 3L0RA 2Z77A 3LTBA 1N9EA 4MMZB 5TGNA 4WHAA 3X3ZA 2CG1A 5FGOA 4LZIA 3DM8A 4OVMA 2BT3A 1S5AA 3ECFA 4STDA 3CCM3 3J7Yd 1LNHA 3MSOA 1Y4KA 4XBXA 1IV9A 1NO3A 1QJGA 2YFJB 1IT8A 4N3VA 1DYUA 2E2UA 1JN5B 3ALAA 1ULIB 3CNXA 7STDA 1VZZA 3AMOB 2FNQA 2FGTA 2W56A 1IVUA 3EHCA 2YX9A 1E3RA 2CFDA 3OWSA 1OCVA 2QIYA 1KC84 1YHQ3 1W00A 1JB5A 2XGLA 4FCMA 1NJI4 3S67A 3S28A 3X42A 2STDA 1EA2A 2LQVA 5CF2A 3JUPA 2WGOA 5IEOA 1JB2A 1E97A 1OH0A 1U8CB 2CWUA 3B7CA 3MPHA 3RDEA 3VF1A 5AEWB 3FG4A 2Y74A 3X40A 2HMLB 3F8XA 3FLJA 1Q824 3PCRA 2ML6A 1OPYA 1O7PB 3CC23 3G0KA 1MNLA 3BB9A 1JNQA 1JN5A 3T8NA 1WQLB 5EVHA 1IK3A 1M1XB 3FGYA 3AMOA 3FZWA 2CG0A 4K90B 4ZM8A 3WMDA 3PYJA 3SX1A 2P0XA 2ML5A 5AIIA 3T8UA 5I97A 2IMJA 2W0QA 2RGQA 3EJVA 2W2CA 3WA2X 3GZXB 2Z7AA 4LEHA 3OWYA 3BNBA 1O7HB 3T0UA 2INXA 1O7WB 1QAKA 4KZ1A 1VQM3 5A0OB 1OUNA 2XEPA 2P05A 4R9KA 1L5GB 5IERA 4N6V0 3D3LA 1TP6A 2HMJB 2E2TA 1W2B2 1WMPA 1Z1SA 3WODG 1UI8A 1YIJ3 3KIIA 3KKGA 1TFOA 1STFI 1FA3A 1VQP3 3EC9A 5CK6A 1OHOA 3EX9A 4EV5A 3CU3A 5AEUB 3EE1A 3Q1CA 3DY5A 2HMOB 3N8BA 3F14A 1QVF2 3GZBA 3IPTA 3QRDA 4R9LA 1VQ83 5AIHA 1YGEA 3IMAB 3NBBA 2W9QA 4N6OB 5IW9A 3CMA3 4WWUC 3X3YA 1A2KA 4R4KA 1OACA 3CCL3 4GB5A 4N6TA 2P09A 4KFDA 4FMCA 1N9JA 4RBNA 3SEDA 3CC73 3WOFB 3ER7A 3X41A 1VQK3 2OQEA 3JUNA 2HMKB 2WOFA 2XR8B 1K41A 3IJEB 3NX0A 5DRVA 1M1K4 5ELUA 3U97A 2JQ5A 4KVHA 1CYUA 4J8TA 4HZBB 1VQ93 3I553 4KFEA 3FF2A 4JRFA 3PS8A 1GY5A 1RRHA 1Q864 1F8NA 1TIJA 1IVVA 1JV2B 4L8PA 4HZ9B 3JUQA 5G2GA 3NHXA 1US1A 4MEIA 4BTXA 1JB4A 1RKYA 3S27A 3GAXA 1DVCA 4FR9A 1IQ8A 5IG5A 3FG3A 2ZDJA 4ORLA 4FCJA 4LMIA 1GD3A 4O02B 4HM6B 3H51A 2W03A 4XM4A 5BVBA 1ULJB 1DMMA 3N54B 3NBRA 3G713 4O8SA 2CK3H 2I9WA 3HIIA 2V1LA 5CF1A 1O7MB 3NM7A 1LXEA 4MMYB 4LGQA 1N8QA 3OXAA 1YVBI 1UI7A 3EN1B 3DGLA 3RGAA 3RGRA 4IIAA 3UB1A 2QA43 3OV4A 2M7OA 5IEPA 3UJMA 4EYCA 3K0ZA 3V92A 3K7CA 4IPBA 1W7CA 1C7HA 3CC43 1DVDA 1W6YA 2CC3A 2SBLA 4WP5A 2F86B 3DXOA 1JJ22 3NBJA 1DMQA 1FGMA 1YJ93 2YFLB 2KCDA 1HKXA 1IVXA 3I563 2L4VA 3LMLA 5LC7A 5IENA 1EQKA 3HX8A 3MG2A 1WNHA 3EBTA 3SOAA 4FCZA 1W4NA 2PNCA 5AIGA 2GBWB 1K9M4 2XFSA 4I4KA 2BNGA 5DREA 2Y73A 3PZWA 3MYTA 1TUHA 2RFRA 4AEQA 5BXQA 3I0YA 1OHSA 1RJOA 3KN4A 3PGBA 1VQ63 2R4IA 1SIHA 3CCQ3 1NDOB 2CWVA 3MKIA 2Z6BA 4KFFA 1NB5I 1NB3I 3CME3 4L8OA 1JKGB 5IG0A 1GY7A 1A2VA 1RRLA 1N5PA 2XSHB 1GD4A 2WOHA 4GL6A 4RZMA 2CFGA 1R4CA 4LSOA 2CIUA 1AVLA 3G4S3 1A90A 2OTJ3 6STDA 3PXMA 2D42A 2A15A 2MF7A 3KZTA 2XH9A 2OOVA 1YJN3 1IQYA 3KE7A 4FMAA 2B24B 3KSPA 3F9SA 2C10A 4X2OA 1FUWA 2BO9B 1LOXA 1SIIA 4XB5A 1OHPA 1IT7A 3DZLA 1VQL3 3E99A 2O9UX 1T5YA 1JKGA 3CD63 3LZAA 5AYSC 2XF3A 5JPPA 4HM7B 4HJLB 3TDGA 1O7NB 4J9AA 3ROBA 1WMOA 4Q53A 1DMNA 3F40A 1V74A 1W5ZA 4U13A 3F8HA 3MWZA 3JUOA 3K63A 2YFIB 1WTHA 1VQ73 3V98A 2OWPA 3HZPA 3NV0B 4G1MB 3WA3A 3N9HA 4HYZA 4EC6A 1LVNA 1SPUA 2WO0A 2Z76A 5STDA 2QEX3 4JF8A 1VQN3 2HMNB 3Q2PA 1NU3A 4MMXB 3G16A 4HVNA 1K28A 1STDA 1WMNA 2BMOB 1W6CA 3BNDA 3EBYA 1BUQA 3WOEB 3Q90A 3NQZA 4WYKB 3OW22 2O3OA 2Q07A 5KP1A 5EQLA 3CXC2 3FF0A 1KD14 3DGMA 1UW1A 2P0MA 4MJDA 1IV7A 2GXFA 2E2VA 3GZYB 4AKZA 4K61A 1AVKA 4K1VA 2CH9A 1JRQA 5IG4A 5IF6A 3DGOA 2D1WA 4H61A 3BLZA 1MOLA 2IUKA 2BHMA 2PZVA 3KFQC 3NV0A 3VGNA 3VSYA 4X2HA 3DMCA 3LT8A 4RNZA 4HBRA 4PEJA 4N6MA 2JDIH 2OTL3 1ISKA 2GEXA 2OQEC 3EF8A 4BTYA 3EB8A 1IQXA 3SVAA 3EQQB 3CCJ3 3CPOA 2FXTA 4O3VA 3S29A 5FW5A 4WYKA 1KSIA 1VQ53 1D6ZA 2IUJA 3JUMA 5EEOA 1KWIA 3K5TA 4XBYA 1U5OA 4HM2B 1OF5B 2WGQA 3SXXA 3LYGA 5CLKA 1E3VA 3U1WA 3CCU3 2K54A 2GBXB 3LOYA 2MC8A 1QVG2 1UUVB 1K734 3PCSA 4NHFA 2UX0A 1Q814 3K9MC 1ASKA 3UNLA 2CFKA 3V99A 1W2ZA 2ZL8A 2IA7A 4CDLA 1AV4A 2W6JH 3FH1A 3HI7A 1Q7Y4 1FGOA 3LXUX 3B4OA 3MG1A 3BNCA 4K1UA 3FG1A 3F7XA 4HKVB 3CCE3 3LT9A 3OX9A 4N6NB 4HM1B 1QALA 4XDWA 4RNYA 1M9GA 4EV2A 3CCS3 4O2HA 3F7SA 1N8R4 5D81A 1OF5A 1W01A 3HK4A 3MHEA 1GYBA 5ELJA 3LTAA 4N6LA 2KXGA 1J2BA 2F98A 1M904 2K0MA 2F99A 3CCR3 2QGUA 5AIFA 3FCSB 3OWUA 1Q40B 3FKAA 1ZX2A 3SOYA 3NUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G8Z A;  2CHC A;  2BMQ B;  3M8C A;  4HM4 B;  1GY6 A;  5AI1 A;  1IDP A;  5KP3 A;  3S5C A;  3FSD A;  2RCD A;  1EG9 B;  3GRD A;  4HM8 B;  3CNM A;  1OGZ A;  2XRX B;  8CHO A;  2B1X B;  4HM0 B;  1Q42 A;  4HM5 B;  1UUW B;  3DUK A;  4HM3 B;  3H3H A;  1GS3 A;  3MG3 A;  3GWR A;  1Q40 A;  4OUQ A;  1ZO2 A;  1OGX A;  1AR0 A;  4R1K A;  3EN8 A;  1O7G B;  3STD A;  2BMR B;  2XSO B;  4H3U A;  4L7K A;  1QMA A;  5HGR A;  3B4P A;  4XBT A;  5IG3 A;  3D9R A;  2GEY A;  3NM2 A;  4XDV A;  2CKF B;  1CQS A;  5JPU A;  1W02 A;  5KP4 A;  3A76 A;  1SJW A;  3NXJ A;  1NWW A;  5D83 A;  5CXO A;  3B8L A;  3GZR A;  2HMM B;  5D82 A;  2Z77 A;  5TGN A;  3DM8 A;  4OVM A;  1S5A A;  3ECF A;  4STD A;  3MSO A;  4XBX A;  1QJG A;  2YFJ B;  4N3V A;  1JN5 B;  1ULI B;  3CNX A;  7STD A;  1VZZ A;  3EHC A;  1E3R A;  3OWS A;  1OCV A;  2QIY A;  1W00 A;  1JB5 A;  4FCM A;  2STD A;  1EA2 A;  5CF2 A;  3JUP A;  5IEO A;  1JB2 A;  1E97 A;  1OH0 A;  3B7C A;  5AEW B;  2HML B;  3F8X A;  3FLJ A;  1OPY A;  1O7P B;  3G0K A;  3BB9 A;  3T8N A;  1JN5 A;  1WQL B;  5EVH A;  3FGY A;  3FZW A;  3WMD A;  5AII A;  3T8U A;  2IMJ A;  2RGQ A;  3EJV A;  2W2C A;  3GZX B;  2Z7A A;  4LEH A;  3OWY A;  1O7H B;  2INX A;  1O7W B;  1OUN A;  4R9K A;  5IER A;  1TP6 A;  2HMJ B;  1Z1S A;  3KKG A;  3EC9 A;  5CK6 A;  1OHO A;  3EX9 A;  3CU3 A;  5AEU B;  2HMO B;  3F14 A;  3GZB A;  3IPT A;  4R9L A;  5AIH A;  4WWU C;  1A2K A;  4GB5 A;  3SED A;  3ER7 A;  3JUN A;  2HMK B;  2XR8 B;  1K41 A;  5DRV A;  2JQ5 A;  4KVH A;  4J8T A;  4HZB B;  3FF2 A;  1GY5 A;  4L8P A;  4HZ9 B;  3JUQ A;  5G2G A;  3NHX A;  1JB4 A;  5IG5 A;  4ORL A;  4FCJ A;  4LMI A;  4HM6 B;  3H51 A;  4XM4 A;  5BVB A;  1ULJ B;  1DMM A;  3NBR A;  2I9W A;  5CF1 A;  1O7M B;  4LGQ A;  3OXA A;  3RGA A;  3EN1 B;  3RGR A;  4IIA A;  3OV4 A;  5IEP A;  3UJM A;  3K0Z A;  3K7C A;  1C7H A;  1W6Y A;  4WP5 A;  2F86 B;  3DXO A;  1DMQ A;  2YFL B;  1HKX A;  5IEN A;  3HX8 A;  3MG2 A;  3EBT A;  3SOA A;  5AIG A;  2GBW B;  4I4K A;  2BNG A;  5DRE A;  3MYT A;  1TUH A;  2RFR A;  5BXQ A;  3I0Y A;  1OHS A;  2R4I A;  1NDO B;  3MKI A;  4L8O A;  1JKG B;  5IG0 A;  1GY7 A;  2XSH B;  4RZM A;  6STD A;  2A15 A;  3KZT A;  3KE7 A;  2B24 B;  3KSP A;  3F9S A;  4X2O A;  4XB5 A;  1OHP A;  3DZL A;  3E99 A;  1JKG A;  3LZA A;  5JPP A;  4HM7 B;  4HJL B;  1O7N B;  4J9A A;  3ROB A;  4Q53 A;  1DMN A;  3F40 A;  4U13 A;  3F8H A;  3JUO A;  2YFI B;  2OWP A;  3HZP A;  3NV0 B;  2Z76 A;  5STD A;  2HMN B;  1NU3 A;  3G16 A;  4HVN A;  1STD A;  2BMO B;  3EBY A;  1BUQ A;  3Q90 A;  4WYK B;  5KP1 A;  3FF0 A;  4MJD A;  2GXF A;  3GZY B;  4K1V A;  5IG4 A;  5IF6 A;  3BLZ A;  2PZV A;  3VGN A;  3VSY A;  3NV0 A;  4X2H A;  3DMC A;  4PEJ A;  1ISK A;  2GEX A;  3EF8 A;  3EQQ B;  3CPO A;  5FW5 A;  4WYK A;  3JUM A;  4XBY A;  1U5O A;  4HM2 B;  1OF5 B;  3LYG A;  5CLK A;  1E3V A;  2K54 A;  2GBX B;  1UUV B;  2UX0 A;  1ASK A;  3UNL A;  4CDL A;  3FH1 A;  3B4O A;  3MG1 A;  4K1U A;  3F7X A;  4HKV B;  3OX9 A;  4HM1 B;  4XDW A;  3F7S A;  5D81 A;  1OF5 A;  1W01 A;  3HK4 A;  3MHE A;  1GYB A;  2F98 A;  2F99 A;  2QGU A;  5AIF A;  3OWU A;  1Q40 B;  3FKA A;  1ZX2 A;  3SOY A;  3NUV A; 
#chains in the Genus database with same CATH topology
 2W9P A;  3NQY A;  1VQO 3;  4HAA A;  1DET A;  3G8Z A;  1TRP A;  2P38 A;  4EXR A;  2CHC A;  1N5H A;  2BMQ B;  1AY7 A;  1RN7 A;  3M8C A;  4HM4 B;  1GY6 A;  3DGN A;  5AI1 A;  1I3F A;  1IDP A;  2HOH A;  3X3X A;  4I5Q A;  5KP3 A;  3S5C A;  1ROA A;  3FSD A;  2RCD A;  1RHL A;  4EBG A;  4AKY A;  3HIG A;  2CFL A;  1EG9 B;  2CX1 A;  1CYV A;  1YI2 3;  3GRD A;  3KCH A;  4HM8 B;  3CNM A;  3KSE D;  3BNE A;  2F5M A;  1D6U A;  1OGZ A;  2CFW A;  2XFT A;  2XRX B;  4IT7 A;  8CHO A;  1BRI A;  1BU4 A;  2B1X B;  1TTO A;  4HM0 B;  1Q42 A;  3Q3F A;  5AYR B;  4HM5 B;  1UUW B;  1IVW A;  3DUK A;  1ROV A;  2RBI A;  4HM3 B;  3H3H A;  3CPW 2;  1GS3 A;  3MG3 A;  4OK0 A;  1BSE A;  3GWR A;  3JVC A;  2C11 A;  3CCV 3;  5LC6 A;  1Q40 A;  4OUQ A;  4QWT A;  2XGN A;  1ZO2 A;  1OGX A;  1PFP A;  1AR0 A;  2LYX A;  2W04 A;  1S72 3;  1IU7 A;  2KF6 A;  3UL6 A;  3UL5 A;  1A67 A;  1YIT 3;  4R1K A;  3EN8 A;  1KQS 2;  4CJN A;  3LH4 A;  4FMB A;  1TU5 A;  1O7G B;  1I8V A;  3STD A;  2BMR B;  2XSO B;  4H3U A;  1V58 A;  4L7K A;  2GU1 A;  1QMA A;  1TFK A;  1FGQ A;  5HGR A;  3B4P A;  4XBT A;  3SLU A;  3DGY A;  3LTD A;  2OOV C;  5IG3 A;  1MWR A;  1CEW I;  7GSP A;  1VQ4 3;  4BTW A;  3D9R A;  4FMD A;  2CWT A;  4N6U A;  2GEY A;  2KRT A;  3QK9 A;  1YJW 3;  1FGR A;  1FGT A;  2CW9 A;  1W6G A;  4TX4 A;  2UUG C;  3O8Y A;  1LNI A;  2OCT A;  3NM2 A;  4WFO A;  1QAF A;  3WDG B;  4XDV A;  1EKM A;  1G96 A;  2GU3 A;  2CKF B;  1PU4 A;  1CQS A;  4R80 A;  3DH2 A;  1SQW A;  5M19 A;  1D6Y A;  5JBS A;  2W56 B;  5JPU A;  1W02 A;  5KP4 A;  3A76 A;  3LTC A;  1SJW A;  1HU9 A;  4CCV A;  2RSX A;  1K8A 4;  3NXJ A;  3G6E 3;  1NWW A;  1BSA A;  5D83 A;  5CXO A;  4KT3 B;  3B8L A;  3GZR A;  2HMM B;  4NRE A;  5D82 A;  2L1S A;  2Z77 A;  3L0R A;  3LTB A;  5M1A A;  1N9E A;  2KF3 A;  4MMZ B;  5TGN A;  4WHA A;  3ZG5 A;  3X3Z A;  2CG1 A;  5FGO A;  4LZI A;  1BUJ A;  3DM8 A;  4OVM A;  2BT3 A;  1Q7H A;  1I70 A;  1S5A A;  3ECF A;  4STD A;  3CCM 3;  1BAN A;  1LNH A;  3MSO A;  3J7Y d;  1Y4K A;  1B2Z A;  4XBX A;  1IV9 A;  1NO3 A;  3SYU A;  1LOY A;  1QJG A;  2YFJ B;  1IT8 A;  4N3V A;  1LRA A;  1DYU A;  1I2F A;  2E2U A;  1JN5 B;  3ALA A;  1ULI B;  3CNX A;  7STD A;  1VZZ A;  3AMO B;  2FNQ A;  2FGT A;  2W56 A;  1IVU A;  3EHC A;  2YX9 A;  1E3R A;  2CFD A;  3OWS A;  1OCV A;  2QIY A;  1BSD A;  1KC8 4;  1YHQ 3;  1W00 A;  1JB5 A;  2XGL A;  4FCM A;  1NJI 4;  1JBT A;  1YVS A;  3S67 A;  2BIR A;  1TRQ A;  1RDS A;  3S28 A;  2STD A;  3X42 A;  1EA2 A;  2LQV A;  5CF2 A;  5HOH A;  1SAR A;  3JUP A;  2WGO A;  5IEO A;  1JB2 A;  1E97 A;  1OH0 A;  1U8C B;  2CWU A;  3B7C A;  3MPH A;  5G1L A;  3RDE A;  3VF1 A;  4BU4 A;  3FG4 A;  5AEW B;  2Y74 A;  3X40 A;  2ZHX B;  2HML B;  1BOX A;  3F8X A;  3FLJ A;  4J5K A;  1Q82 4;  3PCR A;  1FZU A;  2ML6 A;  1OPY A;  1O7P B;  3CC2 3;  3G0K A;  1MNL A;  2H0I A;  3BB9 A;  1JNQ A;  1JN5 A;  3T8N A;  1I0X A;  1WQL B;  1RCK A;  5EVH A;  1M1X B;  3FGY A;  1IK3 A;  1UCL A;  3AMO A;  3FZW A;  2CG0 A;  4GHO A;  1RMS A;  1RGF A;  4K90 B;  4ZM8 A;  3WMD A;  1I0V A;  4BIR A;  3PYJ A;  3SX1 A;  1A2P A;  1UUG B;  2P0X A;  2ML5 A;  1BNR A;  2C4B A;  5AII A;  3T8U A;  5I97 A;  2IMJ A;  2W0Q A;  2RGQ A;  3EJV A;  2W2C A;  1NNV A;  3GZX B;  3WA2 X;  2Z7A A;  4LEH A;  1X1X A;  1PYL A;  3OWY A;  3BNB A;  1O7H B;  3T0U A;  3BIR A;  2INX A;  3ZFZ A;  1JBR A;  1T3B A;  1O7W B;  1QAK A;  4KZ1 A;  1VQM 3;  5A0O B;  4DKI A;  1OUN A;  1BNF A;  2P05 A;  2XEP A;  4R9K A;  1L5G B;  5IER A;  4N6V 0;  3D3L A;  1BNS A;  1TP6 A;  2HMJ B;  2E2T A;  3RNT A;  1W2B 2;  1WMP A;  1Z1S A;  3WOD G;  5BIR A;  1UI8 A;  1YIJ 3;  3KII A;  3KKG A;  1Q9E A;  1TFO A;  1STF I;  1FA3 A;  1VQP 3;  3EC9 A;  1RGE A;  3WHO A;  1RCL A;  1MWS A;  5CK6 A;  1OHO A;  3EX9 A;  2IYJ A;  4EV5 A;  1GOV A;  3CU3 A;  5AEU B;  1ZS7 A;  3EE1 A;  3Q1C A;  3DY5 A;  2HMO B;  3N8B A;  1HZ1 A;  3F14 A;  1QVF 2;  1TJD A;  1B21 A;  3GZB A;  3IPT A;  3QRD A;  4R9L A;  1VQ8 3;  5AIH A;  1YGE A;  3IMA B;  3NBB A;  2W9Q A;  4N6O B;  3WR2 A;  5IW9 A;  4ILF A;  3CMA 3;  4WWU C;  3D79 A;  3X3Y A;  1A2K A;  1RLS A;  2CX0 A;  4R4K A;  1OAC A;  3D5G A;  3CCL 3;  1LOW A;  4GB5 A;  4N6T A;  1T2I A;  2P09 A;  4KFD A;  4FMC A;  1N9J A;  4RBN A;  3SED A;  3CC7 3;  1BNJ A;  3WOF B;  3ER7 A;  3X41 A;  1VQK 3;  2OQE A;  3JUN A;  2IY2 A;  1DE3 A;  1T2H A;  2HMK B;  2WOF A;  2XR8 B;  2KAA A;  1K41 A;  1GOU A;  3AHS A;  3IJE B;  3NX0 A;  1MGW A;  5DRV A;  1M1K 4;  5ELU A;  3U97 A;  2JQ5 A;  4KVH A;  1CYU A;  4J8T A;  2AAD A;  4HZB B;  1VQ9 3;  3I55 3;  2UGI A;  4KFE A;  2AAE A;  3FF2 A;  4JRF A;  3PS8 A;  1BNI A;  1GY5 A;  1RRH A;  1Q86 4;  3AGN A;  1F8N A;  1TIJ A;  1X1W A;  1IVV A;  1JV2 B;  4L8P A;  4HZ9 B;  3JUQ A;  5G2G A;  3NHX A;  3HOH A;  1US1 A;  4MEI A;  4BTX A;  1JB4 A;  1RKY A;  3BU4 A;  3ZG0 A;  1RGH A;  3GAX A;  1DVC A;  3S27 A;  1AQZ A;  4FR9 A;  1IQ8 A;  2KF4 A;  5IG5 A;  3FG3 A;  2ZDJ A;  4ORL A;  1X1U A;  4FCJ A;  4LMI A;  1GD3 A;  4O02 B;  4HM6 B;  3H51 A;  2W03 A;  4XM4 A;  5BVB A;  1ULJ B;  1DMM A;  3N54 B;  3NBR A;  3G71 3;  4O8S A;  2CK3 H;  2I9W A;  3D5I A;  3HII A;  3D4A A;  2V1L A;  5CF1 A;  1O7M B;  3NM7 A;  1LXE A;  1MWT A;  4MMY B;  4LGQ A;  1FUT A;  1N8Q A;  3OXA A;  1YVB I;  1UI7 A;  3EN1 B;  3DGL A;  3RGA A;  3RGR A;  1BVI A;  4IIA A;  1PY3 A;  1UDI I;  3UB1 A;  2QA4 3;  3OV4 A;  2M7O A;  5IEP A;  1RGK A;  3UJM A;  1GMR A;  3K0Z A;  4EYC A;  1VQQ A;  3V92 A;  3K7C A;  4IPB A;  1W7C A;  1C7H A;  3CC4 3;  1DVD A;  1W6Y A;  2CC3 A;  2SBL A;  4WP5 A;  2F86 B;  3AGO A;  4GSP A;  3DXO A;  1JJ2 2;  3NBJ A;  1DMQ A;  1FGM A;  1YJ9 3;  1I2G A;  2YFL B;  2H0G A;  2KCD A;  1HKX A;  1IVX A;  3I56 3;  2L4V A;  3LML A;  5LC7 A;  5IEN A;  1EQK A;  3HX8 A;  3MG2 A;  1WNH A;  3EBT A;  3SOA A;  4FCZ A;  1W4N A;  2PNC A;  5AIG A;  4RNT A;  5BU4 A;  1HYF A;  2GBW B;  1K9M 4;  2XFS A;  4I4K A;  2BNG A;  5DRE A;  2Y73 A;  3PZW A;  3MYT A;  1TUH A;  2RFR A;  4AEQ A;  1BAO A;  5BXQ A;  1MWU A;  3I0Y A;  1LQG C;  1OHS A;  1RJO A;  1YGW A;  3KN4 A;  1JZD A;  3PGB A;  1VQ6 3;  2R4I A;  1SIH A;  3CCQ 3;  1NDO B;  2CWV A;  3MKI A;  2Z6B A;  4KFF A;  1NB5 I;  1NB3 I;  3CME 3;  2F56 A;  4L8O A;  1GMQ A;  4LYL B;  1JKG B;  5IG0 A;  2R41 A;  4BL2 A;  5GSP A;  1GY7 A;  1A2V A;  1BRH A;  1RRL A;  1N5P A;  2XSH B;  1GD4 A;  2WOH A;  4GL6 A;  4RZM A;  1B2X A;  1RGL A;  1G0T A;  2CFG A;  1R4C A;  4LSO A;  2CIU A;  1B20 A;  1AVL A;  3G4S 3;  1A90 A;  1RNT A;  2OTJ 3;  6STD A;  4BL3 A;  3PXM A;  1LOV A;  3GSP A;  1B2M A;  2D42 A;  2A15 A;  2MF7 A;  3KZT A;  2XH9 A;  2OOV A;  1YJN 3;  2RNT A;  1IQY A;  3KE7 A;  4FMA A;  2B24 B;  3KSP A;  3F9S A;  2C10 A;  4X2O A;  1BNG A;  1FUW A;  2BO9 B;  1LOX A;  1SII A;  4XB5 A;  1OHP A;  1X1Y A;  1IT7 A;  3DZL A;  1VQL 3;  3E99 A;  2O9U X;  1T5Y A;  1JKG A;  3CD6 3;  3LZA A;  5AYS C;  2XF3 A;  5JPP A;  4HM7 B;  2SAR A;  4HJL B;  3TDG A;  1O7N B;  4J9A A;  3ROB A;  1WMO A;  4Q53 A;  1DMN A;  3F40 A;  1V74 A;  1W5Z A;  4U13 A;  1UCK A;  3F8H A;  3MWZ A;  1B2S A;  3JUO A;  3K63 A;  1RNB A;  2YFI B;  4NPB A;  1WTH A;  1VQ7 3;  3V98 A;  2OWP A;  3HZP A;  3NV0 B;  4G1M B;  3WA3 A;  3N9H A;  5M18 A;  4HYZ A;  1BGS A;  4EC6 A;  1LVN A;  1SPU A;  1UCI A;  2WO0 A;  2Z76 A;  5STD A;  2QEX 3;  4JF8 A;  1VQN 3;  2HMN B;  1MGR A;  1NU3 A;  3Q2P A;  4MMX B;  3G16 A;  4HVN A;  1K28 A;  1STD A;  1R4Y A;  1BRG A;  1WMN A;  2BMO B;  1BSB A;  1UGH I;  1W6C A;  3BND A;  2F5W A;  2K3D A;  3EBY A;  3WOE B;  1BUQ A;  3Q90 A;  3NQZ A;  4WYK B;  3OW2 2;  1RGG A;  2O3O A;  2Q07 A;  5KP1 A;  1FYS A;  5EQL A;  3CXC 2;  3FF0 A;  1CH0 A;  1FUS A;  1KD1 4;  3DGM A;  1UW1 A;  1B27 A;  2P0M A;  4MJD A;  1IV7 A;  2GXF A;  2E2V A;  3GZY B;  4AKZ A;  4K61 A;  1AVK A;  1BRN L;  1G02 A;  4J5G A;  2CH9 A;  4K1V A;  1JRQ A;  5IG4 A;  5IF6 A;  1BRJ A;  1B3S A;  3DGO A;  2D1W A;  4H61 A;  2ZA4 A;  3BLZ A;  1MOL A;  2F4Y A;  2BHM A;  2IUK A;  2PZV A;  3KFQ C;  3NV0 A;  1RTU A;  3VGN A;  4X2H A;  3VSY A;  3DMC A;  3LT8 A;  4RNZ A;  7RNT A;  1UCJ A;  4HBR A;  4PEJ A;  4N6M A;  2JDI H;  2OTL 3;  1BRS A;  1ISK A;  2GEX A;  2OQE C;  1JZO A;  1YNV X;  3EB8 A;  1IQX A;  3EF8 A;  3SVA A;  4BTY A;  3EQQ B;  2KF5 A;  3CCJ 3;  3CPO A;  2FXT A;  2H0H A;  1RSN A;  9RNT A;  4O3V A;  3S29 A;  1RGC A;  5FW5 A;  8RNT A;  4WYK A;  1KSI A;  1V57 A;  1BNE A;  1I3I A;  1VQ5 3;  1D6Z A;  2IUJ A;  3JUM A;  5EEO A;  1KWI A;  3K5T A;  4HOH A;  4XBY A;  1U5O A;  4HM2 B;  1OF5 B;  2WGQ A;  3SXX A;  3LYG A;  5CLK A;  1E3V A;  3U1W A;  3CCU 3;  1UGI A;  2K54 A;  2GBX B;  3LOY A;  2MC8 A;  1QVG 2;  1GOY A;  1UUV B;  1K73 4;  4CPK A;  1RGA A;  3PCS A;  4NHF A;  2UX0 A;  1Q81 4;  4EW5 A;  3K9M C;  1ASK A;  3UNL A;  2CFK A;  3V99 A;  2BU4 A;  1W2Z A;  6RNT A;  2ZL8 A;  1RN1 A;  2IA7 A;  4CDL A;  1AV4 A;  1BSC A;  2W6J H;  3FH1 A;  3HI7 A;  1Q7Y 4;  1FGO A;  3LXU X;  3B4O A;  3MG1 A;  3BNC A;  4K1U A;  3FG1 A;  3AHW A;  2J8X B;  3F7X A;  4HKV B;  3CCE 3;  1LQM B;  3LT9 A;  3OX9 A;  4N6N B;  4HM1 B;  1QAL A;  1EUI C;  4RNY A;  1M9G A;  4XDW A;  4EV2 A;  3CCS 3;  4O2H A;  3F7S A;  5G1K A;  1GSP A;  1N8R 4;  5D81 A;  1FW7 A;  1I2E A;  1B2U A;  1OF5 A;  1W01 A;  1EEJ A;  3HK4 A;  1BIR A;  5RNT A;  1IYY A;  2GSP A;  1GYB A;  3MHE A;  3LTA A;  4N6L A;  5ELJ A;  3URP A;  6GSP A;  2KXG A;  1RN4 A;  1J2B A;  1GMP A;  2F98 A;  1M90 4;  1C54 A;  2K0M A;  1BRK A;  2F99 A;  3A5E A;  3CCR 3;  2QGU A;  5AIF A;  3FCS B;  3OWU A;  1Q40 B;  3FKA A;  1ZX2 A;  3SOY A;  1ZGX A;  1JBS A;  3NUV A; 
#chains in the Genus database with same CATH homology
 2W9P A;  3NQY A;  1VQO 3;  3G8Z A;  2P38 A;  4EXR A;  2CHC A;  1N5H A;  2BMQ B;  1RN7 A;  3M8C A;  4HM4 B;  1GY6 A;  3DGN A;  5AI1 A;  1IDP A;  3X3X A;  5KP3 A;  3S5C A;  1ROA A;  3FSD A;  2RCD A;  4EBG A;  4AKY A;  3HIG A;  2CFL A;  1EG9 B;  1CYV A;  1YI2 3;  3GRD A;  4HM8 B;  3CNM A;  3KSE D;  3BNE A;  1D6U A;  1OGZ A;  2CFW A;  2XFT A;  2XRX B;  4IT7 A;  8CHO A;  2B1X B;  4HM0 B;  1Q42 A;  5AYR B;  4HM5 B;  1UUW B;  1IVW A;  3DUK A;  1ROV A;  4HM3 B;  3H3H A;  3CPW 2;  1GS3 A;  3MG3 A;  4OK0 A;  3JVC A;  3GWR A;  3CCV 3;  2C11 A;  5LC6 A;  1Q40 A;  4OUQ A;  4QWT A;  2XGN A;  1ZO2 A;  1OGX A;  2W04 A;  1AR0 A;  1PFP A;  2LYX A;  1S72 3;  1IU7 A;  3UL6 A;  3UL5 A;  1A67 A;  1YIT 3;  4R1K A;  3EN8 A;  1KQS 2;  3LH4 A;  4FMB A;  1TU5 A;  1O7G B;  3STD A;  2BMR B;  2XSO B;  4H3U A;  4L7K A;  2GU1 A;  1QMA A;  1TFK A;  1FGQ A;  5HGR A;  3B4P A;  4XBT A;  3SLU A;  3LTD A;  5IG3 A;  2OOV C;  1CEW I;  1VQ4 3;  4BTW A;  3D9R A;  4FMD A;  2CWT A;  4N6U A;  2GEY A;  2KRT A;  3QK9 A;  1YJW 3;  1FGR A;  1FGT A;  2CW9 A;  1W6G A;  4TX4 A;  3O8Y A;  3WDG B;  2OCT A;  3NM2 A;  4WFO A;  1QAF A;  4XDV A;  1EKM A;  1G96 A;  2GU3 A;  2CKF B;  1PU4 A;  1CQS A;  4R80 A;  1SQW A;  1D6Y A;  5JBS A;  2W56 B;  5JPU A;  1W02 A;  5KP4 A;  3A76 A;  3LTC A;  1SJW A;  1HU9 A;  4CCV A;  2RSX A;  1K8A 4;  3NXJ A;  3G6E 3;  1NWW A;  5D83 A;  5CXO A;  3B8L A;  3GZR A;  2HMM B;  4NRE A;  5D82 A;  3L0R A;  2Z77 A;  3LTB A;  1N9E A;  4MMZ B;  5TGN A;  4WHA A;  3X3Z A;  2CG1 A;  5FGO A;  4LZI A;  3DM8 A;  4OVM A;  2BT3 A;  1S5A A;  3ECF A;  4STD A;  3CCM 3;  3J7Y d;  1LNH A;  3MSO A;  1Y4K A;  4XBX A;  1IV9 A;  1NO3 A;  1QJG A;  2YFJ B;  1IT8 A;  4N3V A;  1DYU A;  2E2U A;  1JN5 B;  3ALA A;  1ULI B;  3CNX A;  7STD A;  1VZZ A;  3AMO B;  2FNQ A;  2FGT A;  2W56 A;  1IVU A;  3EHC A;  2YX9 A;  1E3R A;  2CFD A;  3OWS A;  1OCV A;  2QIY A;  1KC8 4;  1YHQ 3;  1W00 A;  1JB5 A;  2XGL A;  4FCM A;  1NJI 4;  3S67 A;  3S28 A;  3X42 A;  2STD A;  1EA2 A;  2LQV A;  5CF2 A;  3JUP A;  2WGO A;  5IEO A;  1JB2 A;  1E97 A;  1OH0 A;  1U8C B;  2CWU A;  3B7C A;  3MPH A;  3RDE A;  3VF1 A;  5AEW B;  3FG4 A;  2Y74 A;  3X40 A;  2HML B;  3F8X A;  3FLJ A;  1Q82 4;  3PCR A;  2ML6 A;  1OPY A;  1O7P B;  3CC2 3;  3G0K A;  1MNL A;  3BB9 A;  1JNQ A;  1JN5 A;  3T8N A;  1WQL B;  5EVH A;  1IK3 A;  1M1X B;  3FGY A;  3AMO A;  3FZW A;  2CG0 A;  4K90 B;  4ZM8 A;  3WMD A;  3PYJ A;  3SX1 A;  2P0X A;  2ML5 A;  5AII A;  3T8U A;  5I97 A;  2IMJ A;  2W0Q A;  2RGQ A;  3EJV A;  2W2C A;  3WA2 X;  3GZX B;  2Z7A A;  4LEH A;  3OWY A;  3BNB A;  1O7H B;  3T0U A;  2INX A;  1O7W B;  1QAK A;  4KZ1 A;  1VQM 3;  5A0O B;  1OUN A;  2XEP A;  2P05 A;  4R9K A;  1L5G B;  5IER A;  4N6V 0;  3D3L A;  1TP6 A;  2HMJ B;  2E2T A;  1W2B 2;  1WMP A;  1Z1S A;  3WOD G;  1UI8 A;  1YIJ 3;  3KII A;  3KKG A;  1TFO A;  1STF I;  1FA3 A;  1VQP 3;  3EC9 A;  5CK6 A;  1OHO A;  3EX9 A;  4EV5 A;  3CU3 A;  5AEU B;  3EE1 A;  3Q1C A;  3DY5 A;  2HMO B;  3N8B A;  3F14 A;  1QVF 2;  3GZB A;  3IPT A;  3QRD A;  4R9L A;  1VQ8 3;  5AIH A;  1YGE A;  3IMA B;  3NBB A;  2W9Q A;  4N6O B;  5IW9 A;  3CMA 3;  4WWU C;  3X3Y A;  1A2K A;  4R4K A;  1OAC A;  3CCL 3;  4GB5 A;  4N6T A;  2P09 A;  4KFD A;  4FMC A;  1N9J A;  4RBN A;  3SED A;  3CC7 3;  3WOF B;  3ER7 A;  3X41 A;  1VQK 3;  2OQE A;  3JUN A;  2HMK B;  2WOF A;  2XR8 B;  1K41 A;  3IJE B;  3NX0 A;  5DRV A;  1M1K 4;  5ELU A;  3U97 A;  2JQ5 A;  4KVH A;  1CYU A;  4J8T A;  4HZB B;  1VQ9 3;  3I55 3;  4KFE A;  3FF2 A;  4JRF A;  3PS8 A;  1GY5 A;  1RRH A;  1Q86 4;  1F8N A;  1TIJ A;  1IVV A;  1JV2 B;  4L8P A;  4HZ9 B;  3JUQ A;  5G2G A;  3NHX A;  1US1 A;  4MEI A;  4BTX A;  1JB4 A;  1RKY A;  3S27 A;  3GAX A;  1DVC A;  4FR9 A;  1IQ8 A;  5IG5 A;  3FG3 A;  2ZDJ A;  4ORL A;  4FCJ A;  4LMI A;  1GD3 A;  4O02 B;  4HM6 B;  3H51 A;  2W03 A;  4XM4 A;  5BVB A;  1ULJ B;  1DMM A;  3N54 B;  3NBR A;  3G71 3;  4O8S A;  2CK3 H;  2I9W A;  3HII A;  2V1L A;  5CF1 A;  1O7M B;  3NM7 A;  1LXE A;  4MMY B;  4LGQ A;  1N8Q A;  3OXA A;  1YVB I;  1UI7 A;  3EN1 B;  3DGL A;  3RGA A;  3RGR A;  4IIA A;  3UB1 A;  2QA4 3;  3OV4 A;  2M7O A;  5IEP A;  3UJM A;  4EYC A;  3K0Z A;  3V92 A;  3K7C A;  4IPB A;  1W7C A;  1C7H A;  3CC4 3;  1DVD A;  1W6Y A;  2CC3 A;  2SBL A;  4WP5 A;  2F86 B;  3DXO A;  1JJ2 2;  3NBJ A;  1DMQ A;  1FGM A;  1YJ9 3;  2YFL B;  2KCD A;  1HKX A;  1IVX A;  3I56 3;  2L4V A;  3LML A;  5LC7 A;  5IEN A;  1EQK A;  3HX8 A;  3MG2 A;  1WNH A;  3EBT A;  3SOA A;  4FCZ A;  1W4N A;  2PNC A;  5AIG A;  2GBW B;  1K9M 4;  2XFS A;  4I4K A;  2BNG A;  5DRE A;  2Y73 A;  3PZW A;  3MYT A;  1TUH A;  2RFR A;  4AEQ A;  5BXQ A;  3I0Y A;  1OHS A;  1RJO A;  3KN4 A;  3PGB A;  1VQ6 3;  2R4I A;  1SIH A;  3CCQ 3;  1NDO B;  2CWV A;  3MKI A;  2Z6B A;  4KFF A;  1NB5 I;  1NB3 I;  3CME 3;  4L8O A;  1JKG B;  5IG0 A;  1GY7 A;  1A2V A;  1RRL A;  1N5P A;  2XSH B;  1GD4 A;  2WOH A;  4GL6 A;  4RZM A;  2CFG A;  1R4C A;  4LSO A;  2CIU A;  1AVL A;  3G4S 3;  1A90 A;  2OTJ 3;  6STD A;  3PXM A;  2D42 A;  2A15 A;  2MF7 A;  3KZT A;  2XH9 A;  2OOV A;  1YJN 3;  1IQY A;  3KE7 A;  4FMA A;  2B24 B;  3KSP A;  3F9S A;  2C10 A;  4X2O A;  1FUW A;  2BO9 B;  1LOX A;  1SII A;  4XB5 A;  1OHP A;  1IT7 A;  3DZL A;  1VQL 3;  3E99 A;  2O9U X;  1T5Y A;  1JKG A;  3CD6 3;  3LZA A;  5AYS C;  2XF3 A;  5JPP A;  4HM7 B;  4HJL B;  3TDG A;  1O7N B;  4J9A A;  3ROB A;  1WMO A;  4Q53 A;  1DMN A;  3F40 A;  1V74 A;  1W5Z A;  4U13 A;  3F8H A;  3MWZ A;  3JUO A;  3K63 A;  2YFI B;  1WTH A;  1VQ7 3;  3V98 A;  2OWP A;  3HZP A;  3NV0 B;  4G1M B;  3WA3 A;  3N9H A;  4HYZ A;  4EC6 A;  1LVN A;  1SPU A;  2WO0 A;  2Z76 A;  5STD A;  2QEX 3;  4JF8 A;  1VQN 3;  2HMN B;  3Q2P A;  1NU3 A;  4MMX B;  3G16 A;  4HVN A;  1K28 A;  1STD A;  1WMN A;  2BMO B;  1W6C A;  3BND A;  3EBY A;  1BUQ A;  3WOE B;  3Q90 A;  3NQZ A;  4WYK B;  3OW2 2;  2O3O A;  2Q07 A;  5KP1 A;  5EQL A;  3CXC 2;  3FF0 A;  1KD1 4;  3DGM A;  1UW1 A;  2P0M A;  4MJD A;  1IV7 A;  2GXF A;  2E2V A;  3GZY B;  4AKZ A;  4K61 A;  1AVK A;  4K1V A;  2CH9 A;  1JRQ A;  5IG4 A;  5IF6 A;  3DGO A;  2D1W A;  4H61 A;  3BLZ A;  1MOL A;  2IUK A;  2BHM A;  2PZV A;  3KFQ C;  3NV0 A;  3VGN A;  3VSY A;  4X2H A;  3DMC A;  3LT8 A;  4RNZ A;  4HBR A;  4PEJ A;  4N6M A;  2JDI H;  2OTL 3;  1ISK A;  2GEX A;  2OQE C;  3EF8 A;  4BTY A;  3EB8 A;  1IQX A;  3SVA A;  3EQQ B;  3CCJ 3;  3CPO A;  2FXT A;  4O3V A;  3S29 A;  5FW5 A;  4WYK A;  1KSI A;  1VQ5 3;  1D6Z A;  2IUJ A;  3JUM A;  5EEO A;  1KWI A;  3K5T A;  4XBY A;  1U5O A;  4HM2 B;  1OF5 B;  2WGQ A;  3SXX A;  3LYG A;  5CLK A;  1E3V A;  3U1W A;  3CCU 3;  2K54 A;  2GBX B;  3LOY A;  2MC8 A;  1QVG 2;  1UUV B;  1K73 4;  3PCS A;  4NHF A;  2UX0 A;  1Q81 4;  3K9M C;  1ASK A;  3UNL A;  2CFK A;  3V99 A;  1W2Z A;  2ZL8 A;  2IA7 A;  4CDL A;  1AV4 A;  2W6J H;  3FH1 A;  3HI7 A;  1Q7Y 4;  1FGO A;  3LXU X;  3B4O A;  3MG1 A;  3BNC A;  4K1U A;  3FG1 A;  3F7X A;  4HKV B;  3CCE 3;  3LT9 A;  3OX9 A;  4N6N B;  4HM1 B;  1QAL A;  4XDW A;  4RNY A;  1M9G A;  4EV2 A;  3CCS 3;  4O2H A;  3F7S A;  1N8R 4;  5D81 A;  1OF5 A;  1W01 A;  3HK4 A;  3MHE A;  1GYB A;  5ELJ A;  3LTA A;  4N6L A;  2KXG A;  1J2B A;  2F98 A;  1M90 4;  2K0M A;  2F99 A;  3CCR 3;  2QGU A;  5AIF A;  3FCS B;  3OWU A;  1Q40 B;  3FKA A;  1ZX2 A;  3SOY A;  3NUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...