3N8BA

Crystal structure of borrelia burgdorferi pur-alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
b'ERGEVYSEKMFTESERTYFMNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENMNEFESNLLKAIAVIKQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Of bits and bugs--on the use of bioinformatics and a bacterial crystal structure to solve a eukaryotic repeat-protein structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Nucleic acid binding protein
total genus 14
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3n8bA00
3N8BA 3NM7A 5FGOA
chains in the Genus database with same CATH superfamily
2GBXB 2C10A 1U8CB 3FLJA 1ROVA 1SPUA 2CKFB 1UCJA 3K0ZA 1MNLA 4RZMA 5A0OB 4K61A 1BSCA 4J5GA 4LGQA 1ZX2A 6RNTA 1OUNA 1UUGB 3DXOA 5M1AA 1Z1SA 4L8OA 1BNRA 1CH0A 1RGEA 3UNLA 2K54A 2GU1A 2XF3A 3ER7A 4CDLA 2F4YA 1M1K4 3X40A 1QALA 3S67A 1FUSA 2QIYA 1US1A 1NB3I 5AIFA 1LRAA 3MWZA 3ALAA 3O8YA 3D4AA 1YIT3 1GOVA 4BTYA 3PCSA 2JQ5A 1Q814 3NQZA 1D6YA 2JDIH 1GD4A 4U13A 1I0XA 1SIIA 1VQQA 7STDA 1JB2A 1SARA 1CYUA 1N5PA 2UGIA 4HBRA 5AI1A 3V98A 1IVUA 3SEDA 1JKGA 2OWPA 1FA3A 2IA7A 3OWYA 1ULIB 1B3SA 1N9EA 3X42A 1STFI 4N6OB 1NNVA 4HM1B 1BUJA 1UGIA 1RGCA 3PS8A 2YFJB 3JUOA 3K63A 1M904 1KWIA 1N5HA 2CFDA 2WOHA 2Y73A 3KN4A 4QWTA 4N6UA 2CWTA 2Z77A 1LQGC 4EXRA 1GSPA 2HMMB 1RTUA 1RGFA 2CIUA 3LTAA 1TUHA 1YJ93 1AQZA 2XSHB 3KIIA 1O7MB 3HK4A 3CNMA 1I8VA 3KFQC 4FMAA 2KCDA 4MMZB 2F86B 2W56B 1C7HA 5IF6A 4OK0A 1Q7Y4 2XGNA 5IEOA 1BNGA 1O7PB 3FF0A 1UDII 2GBWB 5D82A 1UCLA 5LC6A 3CCL3 2OTJ3 4N6NB 3DZLA 2FNQA 4R9KA 3CCJ3 3CCQ3 2CG1A 1DE3A 1VQK3 1TU5A 1EQKA 4RNYA 1BSEA 4STDA 1RGAA 5BXQA 1MWUA 1RN1A 2HMLB 1RMSA 3OW22 1RGLA 1I2EA 2BHMA 3F7XA 3MG3A 4FMDA 2OTL3 3VF1A 3JUMA 3EF8A 4MEIA 2CC3A 3S29A 1FGOA 4JRFA 2WO0A 3FSDA 1TRQA 1Q42A 2LQVA 3KSPA 1NDOB 1RNTA 3BLZA 1GD3A 2FGTA 3F9SA 3VGNA 2RNTA 5JPUA 3EC9A 4J9AA 5IG0A 1TFOA 1BRHA 4CCVA 2PZVA 3MPHA 4X2HA 3G4S3 1DMQA 5AIIA 3NM7A 4R4KA 2SBLA 2ZHXB 1IK3A 2CHCA 1CEWI 3N54B 1VQ63 1YIJ3 1IVWA 2E2UA 5CK6A 3SX1A 1A90A 1W6YA 3LTBA 5CF2A 3CPW2 2YFLB 5STDA 1IYYA 1OF5A 1QAFA 1X1WA 1EUIC 1RLSA 1MGRA 3AMOB 2LYXA 3DGMA 3RGRA 3G16A 3NBJA 2KF4A 3AGNA 3MHEA 1KD14 1N9JA 2YFIB 1RJOA 4KT3B 3WODG 1T3BA 1A67A 2AADA 2OQEC 3CCR3 4I5QA 1G0TA 3EE1A 1FGTA 4WHAA 1VQN3 3S28A 1IT7A 1LOXA 5LC7A 5BU4A 1BNIA 1K41A 1ULJB 3WHOA 4ZM8A 1IVXA 1K734 1YJN3 1BNEA 1I70A 1W01A 1D6UA 3CPOA 1IDPA 3SVAA 1AVKA 1PYLA 3FGYA 3CD63 1W6CA 2L4VA 2E2VA 1JZDA 4GB5A 3TDGA 3CC23 2XRXB 2GXFA 3AHWA 5EEOA 1QVF2 3G713 1JRQA 3CC43 1W5ZA 3LYGA 4H61A 3G6E3 1BRKA 1OGZA 1JN5B 2SARA 3N8BA 5G1LA 3GZYB 3LTDA 4OVMA 2F98A 3AHSA 1JJ22 1UUVB 3IPTA 3MG1A 3DGLA 1OACA 3S5CA 1I2FA 1B2ZA 2CG0A 3OV4A 3FH1A 2WOFA 1RHLA 4HOHA 1GYBA 1HKXA 3FG3A 2RSXA 3U97A 1OH0A 2CH9A 3N9HA 1A2KA 3HOHA 1UGHI 1W2ZA 3CME3 1YVBI 1Y4KA 1LOVA 1TIJA 4GL6A 3WA2X 2Z76A 3FF2A 1I3FA 4EV5A 4HZ9B 3CCV3 3A76A 3BU4A 2F5WA 1NO3A 8RNTA 4X2OA 3B4OA 1GOUA 1V57A 3HIGA 4O3VA 5AIGA 3ZFZA 2BMRB 3CCU3 4N6LA 1Q9EA 4EW5A 1LOWA 1FYSA 3B7CA 4HYZA 9RNTA 3B4PA 1W4NA 3A5EA 4XBXA 2GU3A 4LYLB 2W6JH 4FMCA 3VSYA 1GY5A 1BVIA 4XDVA 3EBYA 1OPYA 4R80A 3DUKA 4H3UA 4N6MA 1K28A 4LMIA 3SOAA 3NX0A 2UX0A 1B2MA 2Z7AA 5EQLA 2W56A 5EVHA 2QA43 4HM3B 6GSPA 1EG9B 1BGSA 2Q07A 1W00A 1CYVA 4PEJA 3ZG5A 4Q53A 4FMBA 2BU4A 1FGQA 2GEXA 4GHOA 3BB9A 4N3VA 1X1UA 3V92A 1X1YA 2I9WA 1T2IA 1Q824 5KP4A 1K9M4 1VQ53 1RGKA 1NWWA 1OGXA 2CW9A 5M19A 1Q864 4BL3A 2OOVA 1DMMA 1R4YA 1GMQA 1O7HB 1UI7A 1A2PA 5BVBA 5IG3A 4CPKA 2F5MA 3QK9A 2D1WA 3LTCA 2CX0A 4NPBA 1QVG2 2XSOB 3KKGA 5D81A 5IW9A 3DY5A 1ZGXA 1JB4A 4RBNA 1BNJA 1LOYA 2C11A 4IIAA 2IYJA 4XBTA 3SOYA 5G2GA 2IUKA 2BMQB 3SXXA 1GS3A 2BNGA 3MYTA 1IV9A 1NU3A 2HOHA 4HKVB 3CCS3 2W0QA 2CX1A 3CNXA 1BSBA 2WGQA 1JBSA 2GEYA 1OHOA 3L0RA 3WMDA 1EKMA 3EN8A 5RNTA 3Q1CA 3J7Yd 1GY7A 4HM4B 2W9QA 1MGWA 3EBTA 2KF5A 4HM0B 1RN4A 3KE7A 4WFOA 3D3LA 4BL2A 2RCDA 1ASKA 1RSNA 2RFRA 3IMAB 1A2VA 1S723 4CJNA 1FW7A 3ECFA 1OHSA 3H3HA 2W04A 1VQ93 4MMYB 3Q90A 3I0YA 5AIHA 5DRVA 1OHPA 4J8TA 1PFPA 4MMXB 1E97A 1HU9A 4JF8A 2IUJA 4AEQA 3DM8A 3DMCA 4WYKA 2XFSA 5JPPA 1UW1A 3UJMA 3F7SA 3F40A 2W2CA 1IQ8A 2P0MA 3KCHA 1BU4A 3IJEB 3K7CA 1BRSA 4HZBB 3S27A 1Q40B 1CQSA 3NV0A 3OWUA 1B2UA 4N6TA 1O7NB 4LEHA 1GOYA 1PY3A 2H0IA 1BRGA 2KXGA 5FGOA 4BIRA 4HM6B 3MKIA 3LH4A 2M7OA 1W2B2 4HAAA 3STDA 1YHQ3 3RGAA 1VQP3 2CFLA 3OWSA 2CWUA 1IVVA 3GAXA 4RNZA 1O7GB 3DGYA 1RRHA 2XR8B 3MSOA 3KSED 2CFKA 4WWUC 3PGBA 1T5YA 1FUTA 3G8ZA 3URPA 1G96A 1BUQA 4HM7B 2QGUA 2UUGC 1IQXA 1C54A 5DREA 4BTWA 5HGRA 4KFDA 3FG1A 4K1VA 2KF3A 3I563 4HM5B 1KSIA 2L1SA 3WR2A 5JBSA 5G1KA 3F8XA 5IG4A 1BOXA 4EYCA 3BIRA 4KFFA 3BNCA 1DETA 3EQQB 2K3DA 4KVHA 3X3YA 2F99A 2HMNB 2H0HA 1LXEA 3CC73 1QMAA 1RCLA 3F14A 1S5AA 3LZAA 1YI23 3QRDA 5IG5A 5IENA 1ZS7A 2P05A 2Z6BA 1LVNA 4LSOA 1K8A4 2ML5A 2K0MA 1B27A 4AKYA 2OCTA 5ELUA 3CMA3 7GSPA 3DGNA 3D79A 4J5KA 3FKAA 4HM8B 1M9GA 2RGQA 1JV2B 2HMKB 3WA3A 1WMNA 3G0KA 3NBBA 4XDWA 3WDGB 2E2TA 3HX8A 2J8XB 4BTXA 1TFKA 1TJDA 3NBRA 2O9UX 1W7CA 1UI8A 2AAEA 1WTHA 3FG4A 3H51A 2P09A 2Y74A 3OX9A 4O02B 5CLKA 4EBGA 1AV4A 2XEPA 3RDEA 4O2HA 2D42A 1DYUA 3HI7A 1UCIA 1W02A 1WMOA 4XB5A 4NREA 2C4BA 4HM2B 3T8UA 1T2HA 1EEJA 3MG2A 4R9LA 3PZWA 1VQ83 2ML6A 5GSPA 5AEUB 1FGRA 2RBIA 3AGOA 3PYJA 3HZPA 5HOHA 5AEWB 3EHCA 1DVDA 2R41A 1RCKA 3EX9A 1GMPA 3LT8A 1ISKA 3JUPA 4IT7A 3NUVA 1MWTA 1BNFA 3KZTA 1AY7A 3U1WA 3FZWA 6STDA 2V1LA 3CCM3 1VQM3 1VQO3 4MJDA 3D5GA 3D9RA 4G1MB 1L5GB 1JBRA 1RKYA 2INXA 3SYUA 3LOYA 1EA2A 1YGEA 1BIRA 3F8HA 2QEX3 2OOVC 1BRJA 2FXTA 1AVLA 1IV7A 1LNIA 3GZXB 5KP3A 1D6ZA 5KP1A 5ELJA 4EV2A 1JNQA 1I0VA 2P0XA 1HYFA 3T0UA 1SJWA 4R1KA 1O7WB 5BIRA 3M8CA 2XH9A 4K90B 1J2BA 2KAAA 1BSDA 4EC6A 3GZBA 3UL5A 1W6GA 2H0GA 2HMJB 4KZ1A 1IT8A 4FCMA 4LZIA 1IQYA 1FGMA 5TGNA 4L8PA 8CHOA 1I3IA 4N6V0 2BT3A 3NXJA 5CXOA 3EN1B 1HZ1A 3AMOA 5AYSC 1R4CA 1BSAA 1BRIA 1DVCA 2KF6A 4HJLB 1MWRA 4KFEA 3BNEA 2XGLA 1FZUA 3EJVA 1B21A 1LQMB 1JKGB 4WP5A 3Q3FA 1BRNL 1ZO2A 1JZOA 1NB5I 1BANA 2STDA 4XBYA 1Q40A 3SLUA 4FCZA 3ROBA 3JUQA 1KQS2 3X3ZA 2MF7A 1MWSA 1E3VA 1YVSA 2WGOA 4ORLA 7RNTA 3PXMA 1PU4A 3JVCA 3ZG0A 3GRDA 3JUNA 4TX4A 4BU4A 1B20A 3DGOA 3X41A 1V74A 3T8NA 2O3OA 2CFGA 4XM4A 3LT9A 4GSPA 2CK3H 3V99A 3CXC2 1SQWA 3K5TA 2B24B 1RNBA 1G02A 1MOLA 3BNDA 3GWRA 1JN5A 1OCVA 1ROAA 4L7KA 3UL6A 2KRTA 4NHFA 2W9PA 2YX9A 1LNHA 5CF1A 1IU7A 1UUWB 1B2SA 3Q2PA 1WMPA 5IERA 5M18A 3K9MC 3UB1A 3RNTA 1N8QA 1RN7A 3D5IA 1VQ73 4OUQA 1JBTA 1TTOA 3EB8A 1N8R4 2W03A 3BNBA 3DH2A 4AKZA 1Q7HA 5FW5A 1QAKA 3GSPA 2F56A 3CCE3 1JB5A 3FCSB 5D83A 1QJGA 2BMOB 1RRLA 3OXAA 3PCRA 2IMJA 2ZA4A 2ZL8A 1UCKA 1M1XB 2IY2A 3I553 1V58A 3WOFB 1I2GA 1NJI4 1X1XA 2GSPA 1TRPA 4K1UA 1B2XA 3NM2A 4FCJA 2MC8A 2R4IA 4I4KA 2OQEA 2CFWA 1TP6A 3GZRA 1AR0A 1OF5B 4FR9A 4DKIA 1YJW3 1STDA 4WYKB 1RDSA 1KC84 4HVNA 2BO9B 2XFTA 4RNTA 2ZDJA 1FUWA 3HIIA 3E99A 5I97A 5IEPA 1E3RA 1VQL3 2A15A 1RGHA 1GY6A 3NHXA 3NV0B 1VQ43 1WQLB 2P38A 1GMRA 2BIRA 3NQYA 3LMLA 1U5OA 1YNVX 2HMOB 3X3XA 1BNSA 2CWVA 3CU3A 1F8NA 2B1XB 3LXUX 1BAOA 3WOEB 1DMNA 3B8LA 1SIHA 4O8SA 4IPBA 5AYRB 1WNHA 1YGWA 1VZZA 2PNCA 4ILFA 1RGGA
chains in the Genus database with same CATH topology
2GBXB 2C10A 1U8CB 3FLJA 1ROVA 1SPUA 2CKFB 3K0ZA 1MNLA 4RZMA 5A0OB 4K61A 4LGQA 1ZX2A 1OUNA 3DXOA 1Z1SA 4L8OA 3UNLA 2K54A 2GU1A 2XF3A 3ER7A 4CDLA 1M1K4 3X40A 1QALA 2QIYA 1US1A 1NB3I 5AIFA 3MWZA 3ALAA 3O8YA 1YIT3 4BTYA 3PCSA 2JQ5A 1Q814 3NQZA 1D6YA 2JDIH 1GD4A 4U13A 1SIIA 7STDA 1JB2A 1CYUA 1N5PA 4HBRA 5AI1A 3V98A 1IVUA 3SEDA 1JKGA 2OWPA 1FA3A 2IA7A 3OWYA 1ULIB 1N9EA 3X42A 1STFI 4N6OB 4HM1B 3PS8A 2YFJB 3JUOA 3K63A 1M904 1KWIA 1N5HA 2CFDA 2WOHA 2Y73A 3KN4A 4QWTA 4N6UA 2CWTA 2Z77A 4EXRA 2HMMB 2CIUA 3LTAA 1TUHA 1YJ93 2XSHB 3KIIA 1O7MB 3HK4A 3CNMA 3KFQC 4FMAA 2KCDA 4MMZB 2F86B 2W56B 1C7HA 5IF6A 4OK0A 1Q7Y4 2XGNA 5IEOA 1O7PB 3FF0A 2GBWB 5D82A 5LC6A 3CCL3 2OTJ3 4N6NB 3DZLA 2FNQA 4R9KA 3CCJ3 3CCQ3 2CG1A 1VQK3 1TU5A 1EQKA 4RNYA 4STDA 5BXQA 3OW22 2HMLB 2OTL3 3F7XA 2BHMA 3MG3A 4FMDA 3VF1A 3JUMA 3EF8A 4MEIA 2CC3A 3S29A 1FGOA 4JRFA 2WO0A 3FSDA 1Q42A 2LQVA 3KSPA 1NDOB 3BLZA 1GD3A 2FGTA 3F9SA 3VGNA 5JPUA 3EC9A 4J9AA 5IG0A 1TFOA 4CCVA 2PZVA 3MPHA 4X2HA 3G4S3 1DMQA 5AIIA 3NM7A 4R4KA 2SBLA 1IK3A 2CHCA 1CEWI 3N54B 1VQ63 1YIJ3 1IVWA 2E2UA 5CK6A 3SX1A 1A90A 1W6YA 3LTBA 5CF2A 3CPW2 2YFLB 5STDA 1OF5A 1QAFA 3AMOB 3RGRA 2LYXA 3DGMA 3G16A 3NBJA 3MHEA 1KD14 1N9JA 2YFIB 1RJOA 3WODG 1A67A 2OQEC 3CCR3 3EE1A 4WHAA 1FGTA 1VQN3 3S28A 1IT7A 1LOXA 5LC7A 1K41A 1ULJB 4ZM8A 1IVXA 1K734 1YJN3 1W01A 1D6UA 3CPOA 1IDPA 3SVAA 1AVKA 3FGYA 3CD63 1W6CA 2L4VA 2E2VA 4GB5A 3TDGA 3CC23 1QVF2 2XRXB 2GXFA 5EEOA 3G713 1JRQA 3CC43 1W5ZA 3LYGA 4H61A 3G6E3 1OGZA 1JN5B 3N8BA 3GZYB 3LTDA 4OVMA 2F98A 1JJ22 1UUVB 3IPTA 3MG1A 3DGLA 1OACA 3S5CA 2CG0A 3OV4A 3FH1A 2WOFA 1HKXA 1GYBA 3FG3A 2RSXA 3U97A 1OH0A 2CH9A 3N9HA 1A2KA 1W2ZA 3CME3 1YVBI 1Y4KA 1TIJA 3WA2X 4GL6A 2Z76A 3FF2A 4EV5A 4HZ9B 3CCV3 3A76A 1NO3A 4X2OA 3B4OA 3HIGA 4O3VA 5AIGA 3CCU3 2BMRB 4N6LA 3B7CA 4HYZA 3B4PA 1W4NA 4XBXA 2GU3A 2W6JH 4FMCA 3VSYA 1GY5A 4XDVA 3EBYA 1OPYA 4R80A 3DUKA 4H3UA 4N6MA 1K28A 4LMIA 3SOAA 3NX0A 2UX0A 2Z7AA 5EQLA 2W56A 5EVHA 2QA43 4HM3B 1EG9B 2Q07A 1W00A 1CYVA 4PEJA 4Q53A 4FMBA 1FGQA 2GEXA 3BB9A 4N3VA 3V92A 2I9WA 1Q824 5KP4A 1K9M4 1VQ53 1NWWA 1OGXA 2CW9A 1Q864 2OOVA 1DMMA 1O7HB 1UI7A 5BVBA 5IG3A 3QK9A 2D1WA 3LTCA 1QVG2 2XSOB 3KKGA 5D81A 5IW9A 3DY5A 1JB4A 4RBNA 4XBTA 4IIAA 2C11A 3SOYA 5G2GA 2IUKA 2BMQB 3SXXA 1GS3A 2BNGA 3MYTA 1IV9A 1NU3A 4HKVB 3CCS3 2W0QA 3CNXA 2WGQA 2GEYA 1OHOA 3L0RA 3WMDA 1EKMA 3EN8A 3Q1CA 3J7Yd 1GY7A 4HM4B 2W9QA 3EBTA 4HM0B 4WFOA 3KE7A 3D3LA 2RCDA 1ASKA 2RFRA 3IMAB 1A2VA 1S723 3ECFA 1OHSA 3H3HA 2W04A 1VQ93 4MMYB 3Q90A 3I0YA 5AIHA 5DRVA 1OHPA 4J8TA 1PFPA 4MMXB 1E97A 1HU9A 4JF8A 2IUJA 4AEQA 3DM8A 3DMCA 4WYKA 2XFSA 5JPPA 1UW1A 3UJMA 3F7SA 3F40A 2W2CA 1IQ8A 2P0MA 3IJEB 3K7CA 4HZBB 3S27A 1Q40B 1CQSA 3NV0A 3OWUA 4N6TA 1O7NB 4LEHA 2KXGA 5FGOA 4HM6B 3MKIA 3LH4A 2M7OA 1W2B2 3STDA 1YHQ3 3RGAA 1VQP3 2CFLA 3OWSA 2CWUA 1IVVA 3GAXA 4RNZA 1O7GB 1RRHA 2XR8B 3MSOA 3KSED 2CFKA 4WWUC 3PGBA 1T5YA 3G8ZA 1G96A 1BUQA 4HM7B 2QGUA 1IQXA 5DREA 4BTWA 5HGRA 4KFDA 3FG1A 4K1VA 3I563 4HM5B 1KSIA 5JBSA 3F8XA 5IG4A 4EYCA 4KFFA 3BNCA 3EQQB 3X3YA 4KVHA 2F99A 2HMNB 1YI23 1LXEA 3CC73 1QMAA 3F14A 3LZAA 1S5AA 3QRDA 5IG5A 5IENA 2P05A 2Z6BA 1LVNA 4LSOA 1K8A4 2ML5A 2K0MA 4AKYA 2OCTA 5ELUA 3CMA3 3DGNA 3FKAA 4HM8B 1M9GA 1JV2B 2HMKB 3WA3A 1WMNA 3G0KA 3NBBA 4XDWA 3WDGB 2E2TA 3HX8A 4BTXA 1TFKA 3NBRA 2O9UX 1W7CA 1UI8A 1WTHA 3FG4A 3H51A 2P09A 2Y74A 3OX9A 4O02B 5CLKA 4EBGA 1AV4A 2XEPA 3RDEA 4O2HA 2D42A 1DYUA 3HI7A 1W02A 1WMOA 4XB5A 4NREA 4HM2B 3T8UA 3MG2A 4R9LA 3PZWA 1VQ83 2ML6A 5AEUB 1FGRA 3PYJA 3HZPA 5AEWB 3EHCA 1DVDA 3EX9A 1ISKA 3LT8A 3JUPA 4IT7A 3NUVA 1VQM3 3KZTA 3U1WA 3CCM3 3FZWA 6STDA 2V1LA 1VQO3 4MJDA 3D9RA 4G1MB 1L5GB 1RKYA 2INXA 3LOYA 1EA2A 1YGEA 3F8HA 2QEX3 2OOVC 2FXTA 1AVLA 1IV7A 3GZXB 5KP3A 1D6ZA 5KP1A 5ELJA 4EV2A 1JNQA 2P0XA 3T0UA 1SJWA 4R1KA 1O7WB 3M8CA 2XH9A 4K90B 1J2BA 4EC6A 3GZBA 3UL5A 1W6GA 4KZ1A 2HMJB 1IT8A 4FCMA 4LZIA 1IQYA 1FGMA 5TGNA 4L8PA 8CHOA 4N6V0 2BT3A 3NXJA 5CXOA 3EN1B 3AMOA 5AYSC 1R4CA 4KFEA 1DVCA 4HJLB 3BNEA 2XGLA 3EJVA 1JKGB 4WP5A 1ZO2A 1NB5I 2STDA 4XBYA 1Q40A 3SLUA 4FCZA 3ROBA 3JUQA 1KQS2 3X3ZA 2MF7A 4ORLA 1E3VA 2WGOA 3PXMA 1PU4A 3JVCA 3GRDA 3JUNA 4TX4A 3DGOA 3X41A 1V74A 3T8NA 2O3OA 2CFGA 4XM4A 3LT9A 2CK3H 3V99A 3CXC2 1SQWA 3K5TA 2B24B 1MOLA 3BNDA 3GWRA 1JN5A 1OCVA 1ROAA 4L7KA 3UL6A 2KRTA 4NHFA 2W9PA 2YX9A 1LNHA 5CF1A 1IU7A 1UUWB 3Q2PA 1WMPA 5IERA 3K9MC 3UB1A 1N8QA 1RN7A 1VQ73 4OUQA 3EB8A 1N8R4 2W03A 3BNBA 4AKZA 5FW5A 1QAKA 3CCE3 1JB5A 3FCSB 5D83A 1QJGA 2BMOB 1RRLA 3OXAA 3PCRA 2IMJA 2ZL8A 1M1XB 3I553 3WOFB 1NJI4 4K1UA 3NM2A 4FCJA 2MC8A 2R4IA 4I4KA 2OQEA 2CFWA 1TP6A 3GZRA 1AR0A 1OF5B 4FR9A 1YJW3 1STDA 4WYKB 1KC84 4HVNA 2BO9B 2XFTA 2ZDJA 1FUWA 3HIIA 3E99A 5I97A 5IEPA 1E3RA 1VQL3 2A15A 1VQ43 1GY6A 3NHXA 3NV0B 1WQLB 2P38A 3NQYA 3LMLA 1U5OA 2HMOB 3X3XA 2CWVA 3CU3A 1F8NA 2B1XB 3LXUX 3WOEB 1DMNA 3B8LA 1SIHA 4O8SA 4IPBA 5AYRB 1WNHA 1VZZA 2PNCA 3S67A 2RGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8B A;  3NM7 A;  5FGO A; 
#chains in the Genus database with same CATH topology
 2GBX B;  2C10 A;  1U8C B;  3FLJ A;  1ROV A;  1SPU A;  2CKF B;  1UCJ A;  3K0Z A;  1MNL A;  4RZM A;  5A0O B;  4K61 A;  1BSC A;  4J5G A;  4LGQ A;  1ZX2 A;  6RNT A;  1OUN A;  1UUG B;  3DXO A;  5M1A A;  1Z1S A;  4L8O A;  1BNR A;  1CH0 A;  1RGE A;  3UNL A;  2K54 A;  2GU1 A;  2XF3 A;  3ER7 A;  4CDL A;  2F4Y A;  1M1K 4;  3X40 A;  1QAL A;  3S67 A;  1FUS A;  2QIY A;  1US1 A;  1NB3 I;  5AIF A;  1LRA A;  3MWZ A;  3ALA A;  3O8Y A;  3D4A A;  1YIT 3;  1GOV A;  4BTY A;  3PCS A;  2JQ5 A;  1Q81 4;  3NQZ A;  1D6Y A;  2JDI H;  1GD4 A;  4U13 A;  1I0X A;  1SII A;  1VQQ A;  7STD A;  1JB2 A;  1SAR A;  1CYU A;  1N5P A;  2UGI A;  4HBR A;  5AI1 A;  3V98 A;  1IVU A;  3SED A;  1JKG A;  2OWP A;  1FA3 A;  2IA7 A;  3OWY A;  1ULI B;  1B3S A;  1N9E A;  3X42 A;  1STF I;  4N6O B;  1NNV A;  4HM1 B;  1BUJ A;  1UGI A;  1RGC A;  3PS8 A;  2YFJ B;  3JUO A;  3K63 A;  1M90 4;  1KWI A;  1N5H A;  2CFD A;  2WOH A;  2Y73 A;  3KN4 A;  4QWT A;  4N6U A;  2CWT A;  2Z77 A;  1LQG C;  4EXR A;  1GSP A;  2HMM B;  1RTU A;  1RGF A;  2CIU A;  3LTA A;  1TUH A;  1YJ9 3;  1AQZ A;  2XSH B;  3KII A;  1O7M B;  3HK4 A;  3CNM A;  1I8V A;  3KFQ C;  4FMA A;  2KCD A;  4MMZ B;  2F86 B;  2W56 B;  1C7H A;  5IF6 A;  4OK0 A;  1Q7Y 4;  2XGN A;  5IEO A;  1BNG A;  1O7P B;  3FF0 A;  1UDI I;  2GBW B;  5D82 A;  1UCL A;  5LC6 A;  3CCL 3;  2OTJ 3;  4N6N B;  3DZL A;  2FNQ A;  4R9K A;  3CCJ 3;  3CCQ 3;  2CG1 A;  1DE3 A;  1VQK 3;  1TU5 A;  1EQK A;  4RNY A;  1BSE A;  4STD A;  1RGA A;  5BXQ A;  1MWU A;  1RN1 A;  2HML B;  1RMS A;  3OW2 2;  1RGL A;  1I2E A;  2BHM A;  3F7X A;  3MG3 A;  4FMD A;  2OTL 3;  3VF1 A;  3JUM A;  3EF8 A;  4MEI A;  2CC3 A;  3S29 A;  1FGO A;  4JRF A;  2WO0 A;  3FSD A;  1TRQ A;  1Q42 A;  2LQV A;  3KSP A;  1NDO B;  1RNT A;  3BLZ A;  1GD3 A;  2FGT A;  3F9S A;  3VGN A;  2RNT A;  5JPU A;  3EC9 A;  4J9A A;  5IG0 A;  1TFO A;  1BRH A;  4CCV A;  2PZV A;  3MPH A;  4X2H A;  3G4S 3;  1DMQ A;  5AII A;  3NM7 A;  4R4K A;  2SBL A;  2ZHX B;  1IK3 A;  2CHC A;  1CEW I;  3N54 B;  1VQ6 3;  1YIJ 3;  1IVW A;  2E2U A;  5CK6 A;  3SX1 A;  1A90 A;  1W6Y A;  3LTB A;  5CF2 A;  3CPW 2;  2YFL B;  5STD A;  1IYY A;  1OF5 A;  1QAF A;  1X1W A;  1EUI C;  1RLS A;  1MGR A;  3AMO B;  2LYX A;  3DGM A;  3RGR A;  3G16 A;  3NBJ A;  2KF4 A;  3AGN A;  3MHE A;  1KD1 4;  1N9J A;  2YFI B;  1RJO A;  4KT3 B;  3WOD G;  1T3B A;  1A67 A;  2AAD A;  2OQE C;  3CCR 3;  4I5Q A;  1G0T A;  3EE1 A;  1FGT A;  4WHA A;  1VQN 3;  3S28 A;  1IT7 A;  1LOX A;  5LC7 A;  5BU4 A;  1BNI A;  1K41 A;  1ULJ B;  3WHO A;  4ZM8 A;  1IVX A;  1K73 4;  1YJN 3;  1BNE A;  1I70 A;  1W01 A;  1D6U A;  3CPO A;  1IDP A;  3SVA A;  1AVK A;  1PYL A;  3FGY A;  3CD6 3;  1W6C A;  2L4V A;  2E2V A;  1JZD A;  4GB5 A;  3TDG A;  3CC2 3;  2XRX B;  2GXF A;  3AHW A;  5EEO A;  1QVF 2;  3G71 3;  1JRQ A;  3CC4 3;  1W5Z A;  3LYG A;  4H61 A;  3G6E 3;  1BRK A;  1OGZ A;  1JN5 B;  2SAR A;  3N8B A;  5G1L A;  3GZY B;  3LTD A;  4OVM A;  2F98 A;  3AHS A;  1JJ2 2;  1UUV B;  3IPT A;  3MG1 A;  3DGL A;  1OAC A;  3S5C A;  1I2F A;  1B2Z A;  2CG0 A;  3OV4 A;  3FH1 A;  2WOF A;  1RHL A;  4HOH A;  1GYB A;  1HKX A;  3FG3 A;  2RSX A;  3U97 A;  1OH0 A;  2CH9 A;  3N9H A;  1A2K A;  3HOH A;  1UGH I;  1W2Z A;  3CME 3;  1YVB I;  1Y4K A;  1LOV A;  1TIJ A;  4GL6 A;  3WA2 X;  2Z76 A;  3FF2 A;  1I3F A;  4EV5 A;  4HZ9 B;  3CCV 3;  3A76 A;  3BU4 A;  2F5W A;  1NO3 A;  8RNT A;  4X2O A;  3B4O A;  1GOU A;  1V57 A;  3HIG A;  4O3V A;  5AIG A;  3ZFZ A;  2BMR B;  3CCU 3;  4N6L A;  1Q9E A;  4EW5 A;  1LOW A;  1FYS A;  3B7C A;  4HYZ A;  9RNT A;  3B4P A;  1W4N A;  3A5E A;  4XBX A;  2GU3 A;  4LYL B;  2W6J H;  4FMC A;  3VSY A;  1GY5 A;  1BVI A;  4XDV A;  3EBY A;  1OPY A;  4R80 A;  3DUK A;  4H3U A;  4N6M A;  1K28 A;  4LMI A;  3SOA A;  3NX0 A;  2UX0 A;  1B2M A;  2Z7A A;  5EQL A;  2W56 A;  5EVH A;  2QA4 3;  4HM3 B;  6GSP A;  1EG9 B;  1BGS A;  2Q07 A;  1W00 A;  1CYV A;  4PEJ A;  3ZG5 A;  4Q53 A;  4FMB A;  2BU4 A;  1FGQ A;  2GEX A;  4GHO A;  3BB9 A;  4N3V A;  1X1U A;  3V92 A;  1X1Y A;  2I9W A;  1T2I A;  1Q82 4;  5KP4 A;  1K9M 4;  1VQ5 3;  1RGK A;  1NWW A;  1OGX A;  2CW9 A;  5M19 A;  1Q86 4;  4BL3 A;  2OOV A;  1DMM A;  1R4Y A;  1GMQ A;  1O7H B;  1UI7 A;  1A2P A;  5BVB A;  5IG3 A;  4CPK A;  2F5M A;  3QK9 A;  2D1W A;  3LTC A;  2CX0 A;  4NPB A;  1QVG 2;  2XSO B;  3KKG A;  5D81 A;  5IW9 A;  3DY5 A;  1ZGX A;  1JB4 A;  4RBN A;  1BNJ A;  1LOY A;  2C11 A;  4IIA A;  2IYJ A;  4XBT A;  3SOY A;  5G2G A;  2IUK A;  2BMQ B;  3SXX A;  1GS3 A;  2BNG A;  3MYT A;  1IV9 A;  1NU3 A;  2HOH A;  4HKV B;  3CCS 3;  2W0Q A;  2CX1 A;  3CNX A;  1BSB A;  2WGQ A;  1JBS A;  2GEY A;  1OHO A;  3L0R A;  3WMD A;  1EKM A;  3EN8 A;  5RNT A;  3Q1C A;  3J7Y d;  1GY7 A;  4HM4 B;  2W9Q A;  1MGW A;  3EBT A;  2KF5 A;  4HM0 B;  1RN4 A;  3KE7 A;  4WFO A;  3D3L A;  4BL2 A;  2RCD A;  1ASK A;  1RSN A;  2RFR A;  3IMA B;  1A2V A;  1S72 3;  4CJN A;  1FW7 A;  3ECF A;  1OHS A;  3H3H A;  2W04 A;  1VQ9 3;  4MMY B;  3Q90 A;  3I0Y A;  5AIH A;  5DRV A;  1OHP A;  4J8T A;  1PFP A;  4MMX B;  1E97 A;  1HU9 A;  4JF8 A;  2IUJ A;  4AEQ A;  3DM8 A;  3DMC A;  4WYK A;  2XFS A;  5JPP A;  1UW1 A;  3UJM A;  3F7S A;  3F40 A;  2W2C A;  1IQ8 A;  2P0M A;  3KCH A;  1BU4 A;  3IJE B;  3K7C A;  1BRS A;  4HZB B;  3S27 A;  1Q40 B;  1CQS A;  3NV0 A;  3OWU A;  1B2U A;  4N6T A;  1O7N B;  4LEH A;  1GOY A;  1PY3 A;  2H0I A;  1BRG A;  2KXG A;  5FGO A;  4BIR A;  4HM6 B;  3MKI A;  3LH4 A;  2M7O A;  1W2B 2;  4HAA A;  3STD A;  1YHQ 3;  3RGA A;  1VQP 3;  2CFL A;  3OWS A;  2CWU A;  1IVV A;  3GAX A;  4RNZ A;  1O7G B;  3DGY A;  1RRH A;  2XR8 B;  3MSO A;  3KSE D;  2CFK A;  4WWU C;  3PGB A;  1T5Y A;  1FUT A;  3G8Z A;  3URP A;  1G96 A;  1BUQ A;  4HM7 B;  2QGU A;  2UUG C;  1IQX A;  1C54 A;  5DRE A;  4BTW A;  5HGR A;  4KFD A;  3FG1 A;  4K1V A;  2KF3 A;  3I56 3;  4HM5 B;  1KSI A;  2L1S A;  3WR2 A;  5JBS A;  5G1K A;  3F8X A;  5IG4 A;  1BOX A;  4EYC A;  3BIR A;  4KFF A;  3BNC A;  1DET A;  3EQQ B;  2K3D A;  4KVH A;  3X3Y A;  2F99 A;  2HMN B;  2H0H A;  1LXE A;  3CC7 3;  1QMA A;  1RCL A;  3F14 A;  1S5A A;  3LZA A;  1YI2 3;  3QRD A;  5IG5 A;  5IEN A;  1ZS7 A;  2P05 A;  2Z6B A;  1LVN A;  4LSO A;  1K8A 4;  2ML5 A;  2K0M A;  1B27 A;  4AKY A;  2OCT A;  5ELU A;  3CMA 3;  7GSP A;  3DGN A;  3D79 A;  4J5K A;  3FKA A;  4HM8 B;  1M9G A;  2RGQ A;  1JV2 B;  2HMK B;  3WA3 A;  1WMN A;  3G0K A;  3NBB A;  4XDW A;  3WDG B;  2E2T A;  3HX8 A;  2J8X B;  4BTX A;  1TFK A;  1TJD A;  3NBR A;  2O9U X;  1W7C A;  1UI8 A;  2AAE A;  1WTH A;  3FG4 A;  3H51 A;  2P09 A;  2Y74 A;  3OX9 A;  4O02 B;  5CLK A;  4EBG A;  1AV4 A;  2XEP A;  3RDE A;  4O2H A;  2D42 A;  1DYU A;  3HI7 A;  1UCI A;  1W02 A;  1WMO A;  4XB5 A;  4NRE A;  2C4B A;  4HM2 B;  3T8U A;  1T2H A;  1EEJ A;  3MG2 A;  4R9L A;  3PZW A;  1VQ8 3;  2ML6 A;  5GSP A;  5AEU B;  1FGR A;  2RBI A;  3AGO A;  3PYJ A;  3HZP A;  5HOH A;  5AEW B;  3EHC A;  1DVD A;  2R41 A;  1RCK A;  3EX9 A;  1GMP A;  3LT8 A;  1ISK A;  3JUP A;  4IT7 A;  3NUV A;  1MWT A;  1BNF A;  3KZT A;  1AY7 A;  3U1W A;  3FZW A;  6STD A;  2V1L A;  3CCM 3;  1VQM 3;  1VQO 3;  4MJD A;  3D5G A;  3D9R A;  4G1M B;  1L5G B;  1JBR A;  1RKY A;  2INX A;  3SYU A;  3LOY A;  1EA2 A;  1YGE A;  1BIR A;  3F8H A;  2QEX 3;  2OOV C;  1BRJ A;  2FXT A;  1AVL A;  1IV7 A;  1LNI A;  3GZX B;  5KP3 A;  1D6Z A;  5KP1 A;  5ELJ A;  4EV2 A;  1JNQ A;  1I0V A;  2P0X A;  1HYF A;  3T0U A;  1SJW A;  4R1K A;  1O7W B;  5BIR A;  3M8C A;  2XH9 A;  4K90 B;  1J2B A;  2KAA A;  1BSD A;  4EC6 A;  3GZB A;  3UL5 A;  1W6G A;  2H0G A;  2HMJ B;  4KZ1 A;  1IT8 A;  4FCM A;  4LZI A;  1IQY A;  1FGM A;  5TGN A;  4L8P A;  8CHO A;  1I3I A;  4N6V 0;  2BT3 A;  3NXJ A;  5CXO A;  3EN1 B;  1HZ1 A;  3AMO A;  5AYS C;  1R4C A;  1BSA A;  1BRI A;  1DVC A;  2KF6 A;  4HJL B;  1MWR A;  4KFE A;  3BNE A;  2XGL A;  1FZU A;  3EJV A;  1B21 A;  1LQM B;  1JKG B;  4WP5 A;  3Q3F A;  1BRN L;  1ZO2 A;  1JZO A;  1NB5 I;  1BAN A;  2STD A;  4XBY A;  1Q40 A;  3SLU A;  4FCZ A;  3ROB A;  3JUQ A;  1KQS 2;  3X3Z A;  2MF7 A;  1MWS A;  1E3V A;  1YVS A;  2WGO A;  4ORL A;  7RNT A;  3PXM A;  1PU4 A;  3JVC A;  3ZG0 A;  3GRD A;  3JUN A;  4TX4 A;  4BU4 A;  1B20 A;  3DGO A;  3X41 A;  1V74 A;  3T8N A;  2O3O A;  2CFG A;  4XM4 A;  3LT9 A;  4GSP A;  2CK3 H;  3V99 A;  3CXC 2;  1SQW A;  3K5T A;  2B24 B;  1RNB A;  1G02 A;  1MOL A;  3BND A;  3GWR A;  1JN5 A;  1OCV A;  1ROA A;  4L7K A;  3UL6 A;  2KRT A;  4NHF A;  2W9P A;  2YX9 A;  1LNH A;  5CF1 A;  1IU7 A;  1UUW B;  1B2S A;  3Q2P A;  1WMP A;  5IER A;  5M18 A;  3K9M C;  3UB1 A;  3RNT A;  1N8Q A;  1RN7 A;  3D5I A;  1VQ7 3;  4OUQ A;  1JBT A;  1TTO A;  3EB8 A;  1N8R 4;  2W03 A;  3BNB A;  3DH2 A;  4AKZ A;  1Q7H A;  5FW5 A;  1QAK A;  3GSP A;  2F56 A;  3CCE 3;  1JB5 A;  3FCS B;  5D83 A;  1QJG A;  2BMO B;  1RRL A;  3OXA A;  3PCR A;  2IMJ A;  2ZA4 A;  2ZL8 A;  1UCK A;  1M1X B;  2IY2 A;  3I55 3;  1V58 A;  3WOF B;  1I2G A;  1NJI 4;  1X1X A;  2GSP A;  1TRP A;  4K1U A;  1B2X A;  3NM2 A;  4FCJ A;  2MC8 A;  2R4I A;  4I4K A;  2OQE A;  2CFW A;  1TP6 A;  3GZR A;  1AR0 A;  1OF5 B;  4FR9 A;  4DKI A;  1YJW 3;  1STD A;  4WYK B;  1RDS A;  1KC8 4;  4HVN A;  2BO9 B;  2XFT A;  4RNT A;  2ZDJ A;  1FUW A;  3HII A;  3E99 A;  5I97 A;  5IEP A;  1E3R A;  1VQL 3;  2A15 A;  1RGH A;  1GY6 A;  3NHX A;  3NV0 B;  1VQ4 3;  1WQL B;  2P38 A;  1GMR A;  2BIR A;  3NQY A;  3LML A;  1U5O A;  1YNV X;  2HMO B;  3X3X A;  1BNS A;  2CWV A;  3CU3 A;  1F8N A;  2B1X B;  3LXU X;  1BAO A;  3WOE B;  1DMN A;  3B8L A;  1SIH A;  4O8S A;  4IPB A;  5AYR B;  1WNH A;  1YGW A;  1VZZ A;  2PNC A;  4ILF A;  1RGG A; 
#chains in the Genus database with same CATH homology
 2GBX B;  2C10 A;  1U8C B;  3FLJ A;  1ROV A;  1SPU A;  2CKF B;  3K0Z A;  1MNL A;  4RZM A;  5A0O B;  4K61 A;  4LGQ A;  1ZX2 A;  1OUN A;  3DXO A;  1Z1S A;  4L8O A;  3UNL A;  2K54 A;  2GU1 A;  2XF3 A;  3ER7 A;  4CDL A;  1M1K 4;  3X40 A;  1QAL A;  2QIY A;  1US1 A;  1NB3 I;  5AIF A;  3MWZ A;  3ALA A;  3O8Y A;  1YIT 3;  4BTY A;  3PCS A;  2JQ5 A;  1Q81 4;  3NQZ A;  1D6Y A;  2JDI H;  1GD4 A;  4U13 A;  1SII A;  7STD A;  1JB2 A;  1CYU A;  1N5P A;  4HBR A;  5AI1 A;  3V98 A;  1IVU A;  3SED A;  1JKG A;  2OWP A;  1FA3 A;  2IA7 A;  3OWY A;  1ULI B;  1N9E A;  3X42 A;  1STF I;  4N6O B;  4HM1 B;  3PS8 A;  2YFJ B;  3JUO A;  3K63 A;  1M90 4;  1KWI A;  1N5H A;  2CFD A;  2WOH A;  2Y73 A;  3KN4 A;  4QWT A;  4N6U A;  2CWT A;  2Z77 A;  4EXR A;  2HMM B;  2CIU A;  3LTA A;  1TUH A;  1YJ9 3;  2XSH B;  3KII A;  1O7M B;  3HK4 A;  3CNM A;  3KFQ C;  4FMA A;  2KCD A;  4MMZ B;  2F86 B;  2W56 B;  1C7H A;  5IF6 A;  4OK0 A;  1Q7Y 4;  2XGN A;  5IEO A;  1O7P B;  3FF0 A;  2GBW B;  5D82 A;  5LC6 A;  3CCL 3;  2OTJ 3;  4N6N B;  3DZL A;  2FNQ A;  4R9K A;  3CCJ 3;  3CCQ 3;  2CG1 A;  1VQK 3;  1TU5 A;  1EQK A;  4RNY A;  4STD A;  5BXQ A;  3OW2 2;  2HML B;  2OTL 3;  3F7X A;  2BHM A;  3MG3 A;  4FMD A;  3VF1 A;  3JUM A;  3EF8 A;  4MEI A;  2CC3 A;  3S29 A;  1FGO A;  4JRF A;  2WO0 A;  3FSD A;  1Q42 A;  2LQV A;  3KSP A;  1NDO B;  3BLZ A;  1GD3 A;  2FGT A;  3F9S A;  3VGN A;  5JPU A;  3EC9 A;  4J9A A;  5IG0 A;  1TFO A;  4CCV A;  2PZV A;  3MPH A;  4X2H A;  3G4S 3;  1DMQ A;  5AII A;  3NM7 A;  4R4K A;  2SBL A;  1IK3 A;  2CHC A;  1CEW I;  3N54 B;  1VQ6 3;  1YIJ 3;  1IVW A;  2E2U A;  5CK6 A;  3SX1 A;  1A90 A;  1W6Y A;  3LTB A;  5CF2 A;  3CPW 2;  2YFL B;  5STD A;  1OF5 A;  1QAF A;  3AMO B;  3RGR A;  2LYX A;  3DGM A;  3G16 A;  3NBJ A;  3MHE A;  1KD1 4;  1N9J A;  2YFI B;  1RJO A;  3WOD G;  1A67 A;  2OQE C;  3CCR 3;  3EE1 A;  4WHA A;  1FGT A;  1VQN 3;  3S28 A;  1IT7 A;  1LOX A;  5LC7 A;  1K41 A;  1ULJ B;  4ZM8 A;  1IVX A;  1K73 4;  1YJN 3;  1W01 A;  1D6U A;  3CPO A;  1IDP A;  3SVA A;  1AVK A;  3FGY A;  3CD6 3;  1W6C A;  2L4V A;  2E2V A;  4GB5 A;  3TDG A;  3CC2 3;  1QVF 2;  2XRX B;  2GXF A;  5EEO A;  3G71 3;  1JRQ A;  3CC4 3;  1W5Z A;  3LYG A;  4H61 A;  3G6E 3;  1OGZ A;  1JN5 B;  3N8B A;  3GZY B;  3LTD A;  4OVM A;  2F98 A;  1JJ2 2;  1UUV B;  3IPT A;  3MG1 A;  3DGL A;  1OAC A;  3S5C A;  2CG0 A;  3OV4 A;  3FH1 A;  2WOF A;  1HKX A;  1GYB A;  3FG3 A;  2RSX A;  3U97 A;  1OH0 A;  2CH9 A;  3N9H A;  1A2K A;  1W2Z A;  3CME 3;  1YVB I;  1Y4K A;  1TIJ A;  3WA2 X;  4GL6 A;  2Z76 A;  3FF2 A;  4EV5 A;  4HZ9 B;  3CCV 3;  3A76 A;  1NO3 A;  4X2O A;  3B4O A;  3HIG A;  4O3V A;  5AIG A;  3CCU 3;  2BMR B;  4N6L A;  3B7C A;  4HYZ A;  3B4P A;  1W4N A;  4XBX A;  2GU3 A;  2W6J H;  4FMC A;  3VSY A;  1GY5 A;  4XDV A;  3EBY A;  1OPY A;  4R80 A;  3DUK A;  4H3U A;  4N6M A;  1K28 A;  4LMI A;  3SOA A;  3NX0 A;  2UX0 A;  2Z7A A;  5EQL A;  2W56 A;  5EVH A;  2QA4 3;  4HM3 B;  1EG9 B;  2Q07 A;  1W00 A;  1CYV A;  4PEJ A;  4Q53 A;  4FMB A;  1FGQ A;  2GEX A;  3BB9 A;  4N3V A;  3V92 A;  2I9W A;  1Q82 4;  5KP4 A;  1K9M 4;  1VQ5 3;  1NWW A;  1OGX A;  2CW9 A;  1Q86 4;  2OOV A;  1DMM A;  1O7H B;  1UI7 A;  5BVB A;  5IG3 A;  3QK9 A;  2D1W A;  3LTC A;  1QVG 2;  2XSO B;  3KKG A;  5D81 A;  5IW9 A;  3DY5 A;  1JB4 A;  4RBN A;  4XBT A;  4IIA A;  2C11 A;  3SOY A;  5G2G A;  2IUK A;  2BMQ B;  3SXX A;  1GS3 A;  2BNG A;  3MYT A;  1IV9 A;  1NU3 A;  4HKV B;  3CCS 3;  2W0Q A;  3CNX A;  2WGQ A;  2GEY A;  1OHO A;  3L0R A;  3WMD A;  1EKM A;  3EN8 A;  3Q1C A;  3J7Y d;  1GY7 A;  4HM4 B;  2W9Q A;  3EBT A;  4HM0 B;  4WFO A;  3KE7 A;  3D3L A;  2RCD A;  1ASK A;  2RFR A;  3IMA B;  1A2V A;  1S72 3;  3ECF A;  1OHS A;  3H3H A;  2W04 A;  1VQ9 3;  4MMY B;  3Q90 A;  3I0Y A;  5AIH A;  5DRV A;  1OHP A;  4J8T A;  1PFP A;  4MMX B;  1E97 A;  1HU9 A;  4JF8 A;  2IUJ A;  4AEQ A;  3DM8 A;  3DMC A;  4WYK A;  2XFS A;  5JPP A;  1UW1 A;  3UJM A;  3F7S A;  3F40 A;  2W2C A;  1IQ8 A;  2P0M A;  3IJE B;  3K7C A;  4HZB B;  3S27 A;  1Q40 B;  1CQS A;  3NV0 A;  3OWU A;  4N6T A;  1O7N B;  4LEH A;  2KXG A;  5FGO A;  4HM6 B;  3MKI A;  3LH4 A;  2M7O A;  1W2B 2;  3STD A;  1YHQ 3;  3RGA A;  1VQP 3;  2CFL A;  3OWS A;  2CWU A;  1IVV A;  3GAX A;  4RNZ A;  1O7G B;  1RRH A;  2XR8 B;  3MSO A;  3KSE D;  2CFK A;  4WWU C;  3PGB A;  1T5Y A;  3G8Z A;  1G96 A;  1BUQ A;  4HM7 B;  2QGU A;  1IQX A;  5DRE A;  4BTW A;  5HGR A;  4KFD A;  3FG1 A;  4K1V A;  3I56 3;  4HM5 B;  1KSI A;  5JBS A;  3F8X A;  5IG4 A;  4EYC A;  4KFF A;  3BNC A;  3EQQ B;  3X3Y A;  4KVH A;  2F99 A;  2HMN B;  1YI2 3;  1LXE A;  3CC7 3;  1QMA A;  3F14 A;  3LZA A;  1S5A A;  3QRD A;  5IG5 A;  5IEN A;  2P05 A;  2Z6B A;  1LVN A;  4LSO A;  1K8A 4;  2ML5 A;  2K0M A;  4AKY A;  2OCT A;  5ELU A;  3CMA 3;  3DGN A;  3FKA A;  4HM8 B;  1M9G A;  1JV2 B;  2HMK B;  3WA3 A;  1WMN A;  3G0K A;  3NBB A;  4XDW A;  3WDG B;  2E2T A;  3HX8 A;  4BTX A;  1TFK A;  3NBR A;  2O9U X;  1W7C A;  1UI8 A;  1WTH A;  3FG4 A;  3H51 A;  2P09 A;  2Y74 A;  3OX9 A;  4O02 B;  5CLK A;  4EBG A;  1AV4 A;  2XEP A;  3RDE A;  4O2H A;  2D42 A;  1DYU A;  3HI7 A;  1W02 A;  1WMO A;  4XB5 A;  4NRE A;  4HM2 B;  3T8U A;  3MG2 A;  4R9L A;  3PZW A;  1VQ8 3;  2ML6 A;  5AEU B;  1FGR A;  3PYJ A;  3HZP A;  5AEW B;  3EHC A;  1DVD A;  3EX9 A;  1ISK A;  3LT8 A;  3JUP A;  4IT7 A;  3NUV A;  1VQM 3;  3KZT A;  3U1W A;  3CCM 3;  3FZW A;  6STD A;  2V1L A;  1VQO 3;  4MJD A;  3D9R A;  4G1M B;  1L5G B;  1RKY A;  2INX A;  3LOY A;  1EA2 A;  1YGE A;  3F8H A;  2QEX 3;  2OOV C;  2FXT A;  1AVL A;  1IV7 A;  3GZX B;  5KP3 A;  1D6Z A;  5KP1 A;  5ELJ A;  4EV2 A;  1JNQ A;  2P0X A;  3T0U A;  1SJW A;  4R1K A;  1O7W B;  3M8C A;  2XH9 A;  4K90 B;  1J2B A;  4EC6 A;  3GZB A;  3UL5 A;  1W6G A;  4KZ1 A;  2HMJ B;  1IT8 A;  4FCM A;  4LZI A;  1IQY A;  1FGM A;  5TGN A;  4L8P A;  8CHO A;  4N6V 0;  2BT3 A;  3NXJ A;  5CXO A;  3EN1 B;  3AMO A;  5AYS C;  1R4C A;  4KFE A;  1DVC A;  4HJL B;  3BNE A;  2XGL A;  3EJV A;  1JKG B;  4WP5 A;  1ZO2 A;  1NB5 I;  2STD A;  4XBY A;  1Q40 A;  3SLU A;  4FCZ A;  3ROB A;  3JUQ A;  1KQS 2;  3X3Z A;  2MF7 A;  4ORL A;  1E3V A;  2WGO A;  3PXM A;  1PU4 A;  3JVC A;  3GRD A;  3JUN A;  4TX4 A;  3DGO A;  3X41 A;  1V74 A;  3T8N A;  2O3O A;  2CFG A;  4XM4 A;  3LT9 A;  2CK3 H;  3V99 A;  3CXC 2;  1SQW A;  3K5T A;  2B24 B;  1MOL A;  3BND A;  3GWR A;  1JN5 A;  1OCV A;  1ROA A;  4L7K A;  3UL6 A;  2KRT A;  4NHF A;  2W9P A;  2YX9 A;  1LNH A;  5CF1 A;  1IU7 A;  1UUW B;  3Q2P A;  1WMP A;  5IER A;  3K9M C;  3UB1 A;  1N8Q A;  1RN7 A;  1VQ7 3;  4OUQ A;  3EB8 A;  1N8R 4;  2W03 A;  3BNB A;  4AKZ A;  5FW5 A;  1QAK A;  3CCE 3;  1JB5 A;  3FCS B;  5D83 A;  1QJG A;  2BMO B;  1RRL A;  3OXA A;  3PCR A;  2IMJ A;  2ZL8 A;  1M1X B;  3I55 3;  3WOF B;  1NJI 4;  4K1U A;  3NM2 A;  4FCJ A;  2MC8 A;  2R4I A;  4I4K A;  2OQE A;  2CFW A;  1TP6 A;  3GZR A;  1AR0 A;  1OF5 B;  4FR9 A;  1YJW 3;  1STD A;  4WYK B;  1KC8 4;  4HVN A;  2BO9 B;  2XFT A;  2ZDJ A;  1FUW A;  3HII A;  3E99 A;  5I97 A;  5IEP A;  1E3R A;  1VQL 3;  2A15 A;  1VQ4 3;  1GY6 A;  3NHX A;  3NV0 B;  1WQL B;  2P38 A;  3NQY A;  3LML A;  1U5O A;  2HMO B;  3X3X A;  2CWV A;  3CU3 A;  1F8N A;  2B1X B;  3LXU X;  3WOE B;  1DMN A;  3B8L A;  1SIH A;  4O8S A;  4IPB A;  5AYR B;  1WNH A;  1VZZ A;  2PNC A;  3S67 A;  2RGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...