3N8BA

Crystal structure of borrelia burgdorferi pur-alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
ERGEVYSEKMFTESERTYFMNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENMNEFESNLLKAIAVIKQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleic acid binding protein
molecule keywords Uncharacterized protein
publication title Of bits and bugs--on the use of bioinformatics and a bacterial crystal structure to solve a eukaryotic repeat-protein structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 14
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3n8bA00
3N8BA 3NM7A 5FGOA
chains in the Genus database with same CATH superfamily
1JBRA 2W6JH 3EHCA 4FMBA 1UI8A 4IIAA 1OH0A 1LRAA 1RCLA 2RGQA 1KSIA 4HKVB 3CPOA 4HBRA 5AIIA 1YNVX 1YVSA 3EJVA 4L8PA 4EC6A 1KC84 4R80A 1M1K4 3Q90A 1T2HA 2CG0A 3CC23 3PCRA 4N6LA 4RZMA 4XDVA 4AKYA 1TRQA 1BNIA 1VQM3 1UDII 1FUSA 2CX0A 1DE3A 3KKGA 4N6NB 3LT8A 7RNTA 1BSBA 1YHQ3 4HM3B 3D9RA 5CXOA 1OF5A 9RNTA 1JZOA 1DMNA 2CWUA 3LTDA 1N9EA 1X1XA 3X41A 1FGMA 3SXXA 1BNGA 1JN5B 1OACA 3URPA 1IV7A 1RGGA 2W04A 3F9SA 3LZAA 2HMKB 4I5QA 1IQ8A 2GEYA 3HI7A 3FLJA 1AV4A 1UCJA 4KFFA 1C7HA 2IMJA 3KSPA 4HZBB 3AMOA 4RBNA 1WQLB 4N6OB 1QALA 1WMPA 5TGNA 2W9PA 2XFTA 4FCMA 1GMQA 2IUKA 1PFPA 3DH2A 1G96A 2R41A 3NV0B 4R1KA 2CFWA 1Q40A 4MMYB 3L0RA 2R4IA 5GSPA 5M18A 2W03A 1B27A 5AEUB 3UNLA 3BB9A 1EA2A 2BT3A 3HIGA 1VQK3 1Q824 3VSYA 1VQQA 4XB5A 5JPPA 6RNTA 1BNEA 2GU3A 5AIGA 1O7WB 2BNGA 1B20A 2F99A 5KP3A 3D5IA 3SEDA 1RJOA 1V74A 1BRGA 1IU7A 1GD4A 1O7HB 2XFSA 2Y74A 3KSED 1RN7A 4IT7A 1ISKA 1DETA 2CIUA 2LQVA 1E97A 1Q42A 3K63A 4WYKA 1UUVB 1RGHA 4G1MB 1BAOA 2PZVA 1YVBI 5BXQA 2HMNB 3MG2A 1MWRA 3U97A 5RNTA 2GEXA 1X1UA 1FGRA 3KIIA 1T3BA 3CNMA 4HZ9B 2K0MA 1VQ73 1OGZA 1Z1SA 2WGOA 4ORLA 3FG1A 1LOYA 3DGOA 1Q7HA 1DVCA 2CX1A 3VF1A 1AQZA 1RHLA 1BIRA 3MKIA 4WWUC 3SX1A 1YJW3 1IV9A 2OOVC 3SOAA 1TP6A 5DRVA 1JZDA 2ZDJA 1G02A 4KFEA 1JV2B 3V92A 4K90B 3AGOA 1O7NB 1W02A 3DGLA 3CCL3 1BSEA 4BTWA 4JRFA 4X2OA 1IT7A 7GSPA 4EBGA 3AHWA 3X42A 3DZLA 1WTHA 2QGUA 3G16A 3FKAA 1N8R4 3JUMA 3D5GA 1SQWA 1NJI4 1BNSA 1E3RA 4XBYA 3WOEB 8RNTA 1VQ93 3LTCA 3DGNA 3JVCA 1CYUA 2RSXA 1PU4A 4J8TA 2KAAA 4HM8B 3SYUA 3K7CA 3JUNA 4HM1B 2FXTA 3CD63 2M7OA 1FA3A 1U8CB 2W56B 2ZL8A 3KZTA 3WHOA 1EUIC 3DUKA 1B3SA 1K41A 5D82A 1FGTA 1AVLA 4NHFA 3NXJA 1NB5I 1YJ93 3G8ZA 2KF4A 2KF5A 1LOXA 1T5YA 3N8BA 2WOFA 4KFDA 3CCV3 5IEPA 2L1SA 2YFLB 1JBSA 1JNQA 5FW5A 3A5EA 4EV5A 5HOHA 4HM5B 5IG5A 2GSPA 1NO3A 5IG3A 4HOHA 1BSCA 5CF1A 1WNHA 3MSOA 2F5MA 2XEPA 1JRQA 4OVMA 4XBXA 1A2VA 1GOVA 3K0ZA 1LVNA 2L4VA 2Z6BA 3CCU3 3BIRA 1CYVA 1F8NA 1RDSA 1S5AA 1CQSA 3CCR3 1NWWA 1OF5B 1W2B2 1RGLA 2XRXB 3JUPA 4CJNA 2HMOB 1VQ63 1AR0A 2CKFB 2INXA 2YX9A 2H0IA 1I0VA 2OOVA 5AIFA 3EC9A 3GSPA 3LT9A 1Q9EA 2QIYA 2Z76A 3DXOA 4X2HA 1I2EA 3EF8A 2MC8A 1BRHA 3IJEB 4EYCA 3AMOB 5G2GA 1EKMA 5AI1A 4FMAA 1WMNA 3AHSA 1OUNA 1V57A 3GRDA 4RNTA 3EBYA 3SLUA 1LNHA 1GOYA 1Q40B 3SVAA 1BSAA 1W5ZA 3ALAA 3ROBA 5AEWB 4BTXA 1YJN3 1N9JA 4GSPA 1HU9A 1MWSA 2BMRB 2O9UX 1KWIA 2HMLB 3F8HA 3JUOA 3M8CA 1BRNL 1Q7Y4 3MHEA 1HZ1A 2XF3A 3EB8A 3FSDA 1EG9B 3PGBA 1FW7A 4WYKB 5AIHA 1GY6A 4ILFA 1RLSA 1GYBA 4N6TA 2GU1A 4KT3B 1NB3I 1IT8A 2F5WA 3F7XA 1UCLA 3E99A 2RNTA 4LYLB 2FGTA 3EX9A 1JKGA 4K1VA 3T8NA 1QAKA 1MOLA 1UGHI 1ROAA 5CF2A 3X3YA 1RGEA 1C54A 1YGWA 2H0GA 1ASKA 1W01A 1RKYA 2IY2A 1E3VA 3NHXA 4BL2A 5ELUA 5HGRA 1OPYA 5M1AA 2IA7A 4DKIA 3DMCA 2UUGC 1GY7A 1LOVA 4CDLA 3BNCA 5STDA 4XBTA 2CC3A 1BRSA 1UCKA 1SPUA 3UL6A 2QA43 1GD3A 3PYJA 1W7CA 3V98A 1A90A 1ULJB 1W2ZA 1US1A 1MNLA 5EEOA 1B2SA 6STDA 3PXMA 5BVBA 1TU5A 1BANA 1VZZA 1VQL3 1W6YA 1IVXA 2KRTA 3DGMA 4R9KA 4HM2B 3S28A 1VQN3 4XM4A 3F14A 1GMRA 2ZHXB 2V1LA 3LYGA 2CG1A 4L7KA 4JF8A 5JPUA 2SARA 2BHMA 4K1UA 1BSDA 2HOHA 3EQQB 4O3VA 1UW1A 4CCVA 1G0TA 3I563 3F7SA 3MG3A 3D3LA 1SJWA 1BNFA 1BRKA 1A2PA 2F56A 2W9QA 3RDEA 4K61A 1I2FA 3MG1A 3T0UA 3NBBA 4N6MA 4HVNA 1BGSA 2XGLA 1GY5A 1I8VA 1QJGA 1RTUA 2FNQA 3V99A 3FF0A 3G713 4LEHA 3O8YA 1K8A4 1VQ43 4EV2A 5JBSA 1X1YA 3HOHA 1TUHA 3LOYA 4FCZA 5IEOA 1IVWA 1IQYA 1SARA 4WHAA 1BOXA 3LMLA 4U13A 1DYUA 2H0HA 3OXAA 2IUJA 2WOHA 2KF6A 3GZRA 1VQ53 3N9HA 4N6UA 3WDGB 1WMOA 1JB2A 4J5KA 2OCTA 2CH9A 2BU4A 3OWUA 1U5OA 3VGNA 3EN8A 1PY3A 3LTBA 1K28A 5FGOA 3H51A 4LGQA 3FG3A 2CWTA 3X40A 4STDA 4BTYA 2OTJ3 2P0XA 1UI7A 3FG4A 2D42A 3RGAA 3KE7A 2P09A 2E2TA 4TX4A 2ML6A 2Y73A 2F98A 4ZM8A 1CEWI 2F4YA 3KCHA 3ZG0A 2J8XB 1FYSA 3SOYA 1V58A 5DREA 2RBIA 1W6CA 3RGRA 1RGCA 1UCIA 1UUWB 2LYXA 4FR9A 2CK3H 2CWVA 5IG4A 3GWRA 3FF2A 2AADA 2Z7AA 3NM7A 1JB4A 2OQEC 2XSHB 3NUVA 3B4PA 1HKXA 3PCSA 4RNYA 1RGKA 2OTL3 2CFKA 1LNIA 1Y4KA 2KF3A 3ER7A 3IPTA 4WP5A 1CH0A 3I0YA 1RN4A 3CC43 2XH9A 1RGAA 4HYZA 1I70A 3OW22 2YFIB 2YFJB 1N5PA 2HMJB 2PNCA 1J2BA 1AY7A 2K54A 2GXFA 4O8SA 5IERA 2STDA 1VQP3 3MWZA 1N8QA 2A15A 1VQO3 3ZG5A 1K9M4 2GBXB 4H61A 3TDGA 1I0XA 3X3XA 4N3VA 5G1KA 3WA2X 2B1XB 1RSNA 3WODG 1IVUA 1FUTA 1JB5A 2JQ5A 4R9LA 5G1LA 2KXGA 2P0MA 4BU4A 2E2VA 3CMA3 4HM6B 1JKGB 3HX8A 1UGIA 1ZS7A 1TRPA 1MWTA 1GOUA 1D6YA 1RN1A 2KCDA 3WMDA 2GBWB 3GZBA 1A2KA 3NBJA 4LMIA 1MGRA 2BO9B 4GB5A 4AEQA 1RNBA 3Q2PA 3IMAB 1YI23 2XR8B 3CCQ3 1RRHA 1D6ZA 3K5TA 2BMQB 2P05A 4AKZA 3UL5A 4GL6A 3MPHA 2AAEA 3J7Yd 1BNRA 1GS3A 2MF7A 3NX0A 3K9MC 3PS8A 2RFRA 1KD14 3MYTA 3WOFB 1BRJA 1BVIA 3CC73 5D83A 1S723 4IPBA 1MWUA 1RCKA 1W4NA 3CNXA 1ZO2A 4J9AA 2K3DA 1YGEA 3G6E3 1EEJA 1QAFA 2Z77A 2CFGA 5A0OB 1DVDA 3FH1A 1MGWA 4RNZA 4EXRA 3HZPA 4HJLB 1JBTA 1TFKA 5IF6A 1QMAA 2WGQA 4L8OA 3EN1B 4KVHA 3U1WA 2IYJA 1OHOA 1BNJA 2OQEA 1M904 3ECFA 4HM0B 1AVKA 3A76A 1OCVA 4OK0A 1I2GA 3JUQA 4QWTA 5LC7A 1IQXA 1GMPA 4EW5A 4WFOA 5EVHA 5ELJA 1FUWA 1TTOA 1A67A 2SBLA 3S27A 1LXEA 2UX0A 2P38A 1STFI 2CFDA 2HMMB 3CPW2 3OV4A 5IG0A 3PZWA 2XSOB 3NBRA 3FCSB 1O7GB 1PYLA 2XGNA 3N54B 3ZFZA 1DMQA 1W6GA 1ULIB 1O7MB 4MMXB 3LH4A 5KP1A 1NU3A 4HM4B 3DGYA 1Q864 5AYSC 5IENA 4LSOA 3CCM3 3BU4A 3NM2A 3UB1A 1B2MA 1JN5A 1ROVA 5EQLA 4J5GA 2O3OA 3QRDA 3S5CA 3STDA 3LTAA 5IW9A 1TIJA 3HK4A 7STDA 3UJMA 3AGNA 2C10A 5M19A 3CCS3 1RMSA 1O7PB 1I3FA 5BIRA 3OWYA 4CPKA 2ZA4A 4BIRA 2QEX3 3NV0A 3T8UA 5LC6A 1D6UA 4MMZB 1QVG2 1OHSA 4MJDA 2Q07A 4HAAA 2B24B 1M1XB 2D1WA 3GAXA 1BUJA 3I553 1OHPA 3OWSA 5AYRB 5CK6A 2C11A 3B7CA 2WO0A 1R4CA 1B2UA 1ZGXA 1W00A 4R4KA 3NQZA 3CXC2 1B2XA 2BMOB 2W0QA 1RRLA 3QK9A 4N6V0 4OUQA 4O02B 4MEIA 3F40A 3EBTA 4NPBA 4NREA 4PEJA 3CME3 1R4YA 4H3UA 3F8XA 2W2CA 1NDOB 1OGXA 3RNTA 1FZUA 1N5HA 3BNDA 4GHOA 6GSPA 3BNEA 1UUGB 4I4KA 4FCJA 1SIIA 3S29A 3DY5A 1I3IA 5I97A 1YIJ3 1IYYA 3NQYA 1YIT3 2OWPA 3FGYA 3G0KA 3KFQC 2CFLA 3D79A 1IDPA 1GSPA 4FMCA 2E2UA 3CCE3 1FGOA 1RNTA 5KP4A 1IK3A 3HIIA 4XDWA 3X3ZA 3GZYB 1QVF2 1B2ZA 1ZX2A 1BU4A 3GZXB 1NNVA 3S67A 3D4AA 2BIRA 3DM8A 3B4OA 3WR2A 1JJ22 1BRIA 2UGIA 1FGQA 1T2IA 3Q1CA 4HM7B 2F86B 4Q53A 5CLKA 3CU3A 1B21A 4FMDA 2C4BA 2I9WA 4BL3A 3LXUX 1VQ83 1Q814 1K734 2CHCA 1LOWA 3BLZA 5BU4A 5D81A 3BNBA 4LZIA 2ML5A 1KQS2 3EE1A 1TJDA 1EQKA 3G4S3 1HYFA 1LQGC 1M9GA 3CCJ3 1STDA 1TFOA 2W56A 8CHOA 1IVVA 4KZ1A 3Q3FA 4O2HA 2RCDA 3WA3A 3OX9A 2CW9A 1SIHA 3H3HA 2JDIH 1BUQA 3KN4A 1L5GB 3B8LA 1DMMA 3FZWA 1LQMB 1RGFA 1X1WA
chains in the Genus database with same CATH topology
2W6JH 3EHCA 4FMBA 1UI8A 4IIAA 1OH0A 2RGQA 1KSIA 4HKVB 3CPOA 4HBRA 5AIIA 3EJVA 4L8PA 4EC6A 1KC84 1M1K4 4R80A 3Q90A 3CC23 2CG0A 3PCRA 4N6LA 4RZMA 4XDVA 4AKYA 1VQM3 3KKGA 4N6NB 3LT8A 1YHQ3 4HM3B 3D9RA 5CXOA 1OF5A 1DMNA 2CWUA 3LTDA 1N9EA 3X41A 1FGMA 3SXXA 1OACA 1JN5B 1IV7A 3LZAA 2W04A 3F9SA 2HMKB 1IQ8A 2GEYA 3HI7A 3FLJA 1AV4A 4KFFA 1C7HA 2IMJA 3KSPA 4HZBB 3AMOA 4RBNA 1WQLB 4N6OB 1QALA 1WMPA 5TGNA 2W9PA 2XFTA 4FCMA 2IUKA 1PFPA 1G96A 3NV0B 4R1KA 2CFWA 1Q40A 4MMYB 3L0RA 2R4IA 2W03A 5AEUB 3UNLA 3BB9A 1EA2A 2BT3A 3HIGA 1VQK3 1Q824 3VSYA 4XB5A 5JPPA 2GU3A 5AIGA 1O7WB 2BNGA 2F99A 5KP3A 3SEDA 1RJOA 1V74A 1IU7A 1GD4A 1O7HB 2XFSA 2Y74A 3KSED 1RN7A 4IT7A 1ISKA 2CIUA 2LQVA 1E97A 1Q42A 3K63A 4WYKA 1UUVB 4G1MB 2PZVA 1YVBI 5BXQA 2HMNB 3MG2A 3U97A 2GEXA 1FGRA 3KIIA 4HZ9B 3CNMA 2K0MA 1VQ73 1OGZA 1Z1SA 2WGOA 4ORLA 3FG1A 3DGOA 3VF1A 1DVCA 3MKIA 3SX1A 4WWUC 1YJW3 1IV9A 2OOVC 3SOAA 1TP6A 5DRVA 2ZDJA 4KFEA 1JV2B 3V92A 4K90B 1O7NB 1W02A 3DGLA 3CCL3 4BTWA 4JRFA 4X2OA 1IT7A 4EBGA 3X42A 3DZLA 1WTHA 2QGUA 3G16A 3FKAA 1N8R4 3JUMA 1SQWA 1NJI4 4XBYA 1E3RA 3WOEB 1VQ93 3LTCA 3DGNA 3JVCA 1CYUA 2RSXA 1PU4A 4J8TA 4HM8B 3K7CA 3JUNA 4HM1B 2FXTA 3CD63 2M7OA 1FA3A 1U8CB 2W56B 2ZL8A 3KZTA 3DUKA 1K41A 5D82A 1FGTA 1AVLA 4NHFA 3NXJA 1NB5I 1YJ93 3G8ZA 1LOXA 1T5YA 3N8BA 2WOFA 4KFDA 3CCV3 5IEPA 2YFLB 1JNQA 5FW5A 4EV5A 4HM5B 5IG5A 1NO3A 5IG3A 5CF1A 1WNHA 3MSOA 2XEPA 1JRQA 4OVMA 4XBXA 1A2VA 3K0ZA 1LVNA 2L4VA 2Z6BA 3CCU3 1CYVA 1F8NA 1S5AA 1CQSA 3CCR3 1NWWA 1OF5B 1W2B2 2XRXB 3JUPA 2HMOB 1VQ63 1AR0A 2CKFB 2INXA 2YX9A 2OOVA 5AIFA 3EC9A 3LT9A 2QIYA 3DXOA 2Z76A 4X2HA 3EF8A 2MC8A 3IJEB 4EYCA 3AMOB 5G2GA 1EKMA 5AI1A 4FMAA 1WMNA 1OUNA 3GRDA 3SLUA 3EBYA 1LNHA 3SVAA 1Q40B 1W5ZA 3ALAA 3ROBA 5AEWB 4BTXA 1YJN3 1N9JA 1HU9A 2BMRB 2O9UX 1KWIA 2HMLB 3F8HA 3JUOA 3M8CA 1Q7Y4 3MHEA 2XF3A 3EB8A 3FSDA 1EG9B 3PGBA 4WYKB 5AIHA 1GY6A 1GYBA 4N6TA 2GU1A 1NB3I 1IT8A 3F7XA 3E99A 3EX9A 1JKGA 4K1VA 3T8NA 1QAKA 1MOLA 1ROAA 5CF2A 3X3YA 1ASKA 1W01A 1RKYA 1E3VA 3NHXA 5ELUA 5HGRA 1OPYA 2IA7A 3DMCA 1GY7A 4CDLA 3BNCA 5STDA 4XBTA 2CC3A 1SPUA 3UL6A 2QA43 1GD3A 3PYJA 1W7CA 3V98A 1A90A 1ULJB 1W2ZA 1US1A 1MNLA 5EEOA 6STDA 3PXMA 5BVBA 1TU5A 1VZZA 1VQL3 1W6YA 1IVXA 2KRTA 3DGMA 4R9KA 4HM2B 3S28A 1VQN3 4XM4A 3F14A 2V1LA 3LYGA 2CG1A 4L7KA 4JF8A 5JPUA 2BHMA 4K1UA 3I563 4O3VA 3EQQB 4CCVA 1UW1A 3F7SA 3MG3A 3D3LA 1SJWA 2W9QA 3RDEA 4K61A 3MG1A 3T0UA 3NBBA 4N6MA 4HVNA 2XGLA 1GY5A 1QJGA 2FNQA 3V99A 3FF0A 3G713 4LEHA 3O8YA 1K8A4 1VQ43 4EV2A 5JBSA 1TUHA 3LOYA 4FCZA 5IEOA 1IVWA 1IQYA 4WHAA 3LMLA 4U13A 1DYUA 3OXAA 2IUJA 2WOHA 3GZRA 1VQ53 3N9HA 4N6UA 3WDGB 1WMOA 1JB2A 2OCTA 2CH9A 3OWUA 1U5OA 3VGNA 3EN8A 3LTBA 1K28A 5FGOA 3H51A 4LGQA 3FG3A 2CWTA 3X40A 4STDA 4BTYA 2OTJ3 2P0XA 1UI7A 3FG4A 2D42A 3RGAA 3KE7A 2P09A 2E2TA 4TX4A 2ML6A 2Y73A 2F98A 4ZM8A 1CEWI 3SOYA 5DREA 1W6CA 3RGRA 1UUWB 2LYXA 4FR9A 2CK3H 2CWVA 5IG4A 3GWRA 3FF2A 2Z7AA 3NM7A 1JB4A 2OQEC 2XSHB 3NUVA 3B4PA 1HKXA 3PCSA 4RNYA 2OTL3 2CFKA 1Y4KA 3ER7A 3IPTA 4WP5A 3I0YA 3CC43 2XH9A 4HYZA 3OW22 2YFIB 2YFJB 1N5PA 2HMJB 2PNCA 1J2BA 5IERA 2K54A 2GXFA 4O8SA 2STDA 1VQP3 3MWZA 1N8QA 2A15A 1VQO3 1K9M4 2GBXB 4H61A 3TDGA 3X3XA 4N3VA 3WA2X 2B1XB 3WODG 1IVUA 1JB5A 2JQ5A 4R9LA 2KXGA 2P0MA 2E2VA 3CMA3 4HM6B 1JKGB 3HX8A 1D6YA 2KCDA 3WMDA 2GBWB 3GZBA 1A2KA 3NBJA 4LMIA 2BO9B 4GB5A 4AEQA 3Q2PA 3IMAB 1YI23 2XR8B 3CCQ3 1RRHA 1D6ZA 3K5TA 2BMQB 2P05A 4AKZA 3UL5A 4GL6A 3MPHA 3J7Yd 1GS3A 2MF7A 3NX0A 3K9MC 3PS8A 2RFRA 1KD14 3MYTA 3WOFB 3CC73 5D83A 1S723 4IPBA 1W4NA 3CNXA 1ZO2A 4J9AA 1YGEA 3G6E3 1QAFA 2Z77A 2CFGA 5A0OB 1DVDA 3FH1A 4RNZA 4EXRA 3HZPA 4HJLB 1TFKA 5IF6A 1QMAA 2WGQA 4L8OA 3EN1B 4KVHA 3U1WA 1OHOA 2OQEA 1M904 3ECFA 4HM0B 1AVKA 3A76A 1OCVA 4OK0A 3JUQA 4QWTA 5LC7A 1IQXA 4WFOA 5EVHA 5ELJA 1FUWA 1A67A 2SBLA 3S27A 1LXEA 2UX0A 2P38A 1STFI 2CFDA 2HMMB 3CPW2 3OV4A 5IG0A 3PZWA 2XSOB 3NBRA 3FCSB 1O7GB 2XGNA 3N54B 1DMQA 1W6GA 1ULIB 1O7MB 4MMXB 3LH4A 5KP1A 1NU3A 4HM4B 1Q864 5AYSC 5IENA 4LSOA 3CCM3 3NM2A 3UB1A 1JN5A 1ROVA 5EQLA 2O3OA 3QRDA 3S5CA 3STDA 3LTAA 5IW9A 1TIJA 3HK4A 7STDA 3UJMA 2C10A 3CCS3 1O7PB 3OWYA 2QEX3 3NV0A 3T8UA 5LC6A 1D6UA 4MMZB 1QVG2 1OHSA 4MJDA 2Q07A 2B24B 1M1XB 2D1WA 3GAXA 3I553 1OHPA 3OWSA 5AYRB 5CK6A 2C11A 3B7CA 2WO0A 1R4CA 1W00A 4R4KA 3NQZA 3CXC2 2BMOB 2W0QA 1RRLA 3QK9A 4N6V0 4OUQA 4O02B 4MEIA 3F40A 3EBTA 4NREA 4PEJA 3CME3 4H3UA 3F8XA 2W2CA 1NDOB 1OGXA 1N5HA 3BNDA 3BNEA 4I4KA 1SIIA 3S29A 3DY5A 1YIJ3 5I97A 3NQYA 1YIT3 2OWPA 3FGYA 3G0KA 3KFQC 2CFLA 1IDPA 4FMCA 2E2UA 3CCE3 1FGOA 5KP4A 1IK3A 3HIIA 4XDWA 3X3ZA 3GZYB 1QVF2 1ZX2A 3GZXB 3S67A 3DM8A 3B4OA 1JJ22 3Q1CA 1FGQA 4HM7B 5CLKA 2F86B 4Q53A 3CU3A 4FMDA 2I9WA 3LXUX 1VQ83 1Q814 1K734 2CHCA 3BLZA 5D81A 3BNBA 4LZIA 2ML5A 1KQS2 3EE1A 1EQKA 3G4S3 1M9GA 3CCJ3 1STDA 1TFOA 2W56A 8CHOA 1IVVA 4KZ1A 4O2HA 2RCDA 3WA3A 3OX9A 2CW9A 1SIHA 3H3HA 2JDIH 1BUQA 3KN4A 1L5GB 3B8LA 1DMMA 3FZWA 2FGTA 4FCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8B A;  3NM7 A;  5FGO A; 
#chains in the Genus database with same CATH topology
 1JBR A;  2W6J H;  3EHC A;  4FMB A;  1UI8 A;  4IIA A;  1OH0 A;  1LRA A;  1RCL A;  2RGQ A;  1KSI A;  4HKV B;  3CPO A;  4HBR A;  5AII A;  1YNV X;  1YVS A;  3EJV A;  4L8P A;  4EC6 A;  1KC8 4;  4R80 A;  1M1K 4;  3Q90 A;  1T2H A;  2CG0 A;  3CC2 3;  3PCR A;  4N6L A;  4RZM A;  4XDV A;  4AKY A;  1TRQ A;  1BNI A;  1VQM 3;  1UDI I;  1FUS A;  2CX0 A;  1DE3 A;  3KKG A;  4N6N B;  3LT8 A;  7RNT A;  1BSB A;  1YHQ 3;  4HM3 B;  3D9R A;  5CXO A;  1OF5 A;  9RNT A;  1JZO A;  1DMN A;  2CWU A;  3LTD A;  1N9E A;  1X1X A;  3X41 A;  1FGM A;  3SXX A;  1BNG A;  1JN5 B;  1OAC A;  3URP A;  1IV7 A;  1RGG A;  2W04 A;  3F9S A;  3LZA A;  2HMK B;  4I5Q A;  1IQ8 A;  2GEY A;  3HI7 A;  3FLJ A;  1AV4 A;  1UCJ A;  4KFF A;  1C7H A;  2IMJ A;  3KSP A;  4HZB B;  3AMO A;  4RBN A;  1WQL B;  4N6O B;  1QAL A;  1WMP A;  5TGN A;  2W9P A;  2XFT A;  4FCM A;  1GMQ A;  2IUK A;  1PFP A;  3DH2 A;  1G96 A;  2R41 A;  3NV0 B;  4R1K A;  2CFW A;  1Q40 A;  4MMY B;  3L0R A;  2R4I A;  5GSP A;  5M18 A;  2W03 A;  1B27 A;  5AEU B;  3UNL A;  3BB9 A;  1EA2 A;  2BT3 A;  3HIG A;  1VQK 3;  1Q82 4;  3VSY A;  1VQQ A;  4XB5 A;  5JPP A;  6RNT A;  1BNE A;  2GU3 A;  5AIG A;  1O7W B;  2BNG A;  1B20 A;  2F99 A;  5KP3 A;  3D5I A;  3SED A;  1RJO A;  1V74 A;  1BRG A;  1IU7 A;  1GD4 A;  1O7H B;  2XFS A;  2Y74 A;  3KSE D;  1RN7 A;  4IT7 A;  1ISK A;  1DET A;  2CIU A;  2LQV A;  1E97 A;  1Q42 A;  3K63 A;  4WYK A;  1UUV B;  1RGH A;  4G1M B;  1BAO A;  2PZV A;  1YVB I;  5BXQ A;  2HMN B;  3MG2 A;  1MWR A;  3U97 A;  5RNT A;  2GEX A;  1X1U A;  1FGR A;  3KII A;  1T3B A;  3CNM A;  4HZ9 B;  2K0M A;  1VQ7 3;  1OGZ A;  1Z1S A;  2WGO A;  4ORL A;  3FG1 A;  1LOY A;  3DGO A;  1Q7H A;  1DVC A;  2CX1 A;  3VF1 A;  1AQZ A;  1RHL A;  1BIR A;  3MKI A;  4WWU C;  3SX1 A;  1YJW 3;  1IV9 A;  2OOV C;  3SOA A;  1TP6 A;  5DRV A;  1JZD A;  2ZDJ A;  1G02 A;  4KFE A;  1JV2 B;  3V92 A;  4K90 B;  3AGO A;  1O7N B;  1W02 A;  3DGL A;  3CCL 3;  1BSE A;  4BTW A;  4JRF A;  4X2O A;  1IT7 A;  7GSP A;  4EBG A;  3AHW A;  3X42 A;  3DZL A;  1WTH A;  2QGU A;  3G16 A;  3FKA A;  1N8R 4;  3JUM A;  3D5G A;  1SQW A;  1NJI 4;  1BNS A;  1E3R A;  4XBY A;  3WOE B;  8RNT A;  1VQ9 3;  3LTC A;  3DGN A;  3JVC A;  1CYU A;  2RSX A;  1PU4 A;  4J8T A;  2KAA A;  4HM8 B;  3SYU A;  3K7C A;  3JUN A;  4HM1 B;  2FXT A;  3CD6 3;  2M7O A;  1FA3 A;  1U8C B;  2W56 B;  2ZL8 A;  3KZT A;  3WHO A;  1EUI C;  3DUK A;  1B3S A;  1K41 A;  5D82 A;  1FGT A;  1AVL A;  4NHF A;  3NXJ A;  1NB5 I;  1YJ9 3;  3G8Z A;  2KF4 A;  2KF5 A;  1LOX A;  1T5Y A;  3N8B A;  2WOF A;  4KFD A;  3CCV 3;  5IEP A;  2L1S A;  2YFL B;  1JBS A;  1JNQ A;  5FW5 A;  3A5E A;  4EV5 A;  5HOH A;  4HM5 B;  5IG5 A;  2GSP A;  1NO3 A;  5IG3 A;  4HOH A;  1BSC A;  5CF1 A;  1WNH A;  3MSO A;  2F5M A;  2XEP A;  1JRQ A;  4OVM A;  4XBX A;  1A2V A;  1GOV A;  3K0Z A;  1LVN A;  2L4V A;  2Z6B A;  3CCU 3;  3BIR A;  1CYV A;  1F8N A;  1RDS A;  1S5A A;  1CQS A;  3CCR 3;  1NWW A;  1OF5 B;  1W2B 2;  1RGL A;  2XRX B;  3JUP A;  4CJN A;  2HMO B;  1VQ6 3;  1AR0 A;  2CKF B;  2INX A;  2YX9 A;  2H0I A;  1I0V A;  2OOV A;  5AIF A;  3EC9 A;  3GSP A;  3LT9 A;  1Q9E A;  2QIY A;  2Z76 A;  3DXO A;  4X2H A;  1I2E A;  3EF8 A;  2MC8 A;  1BRH A;  3IJE B;  4EYC A;  3AMO B;  5G2G A;  1EKM A;  5AI1 A;  4FMA A;  1WMN A;  3AHS A;  1OUN A;  1V57 A;  3GRD A;  4RNT A;  3EBY A;  3SLU A;  1LNH A;  1GOY A;  1Q40 B;  3SVA A;  1BSA A;  1W5Z A;  3ALA A;  3ROB A;  5AEW B;  4BTX A;  1YJN 3;  1N9J A;  4GSP A;  1HU9 A;  1MWS A;  2BMR B;  2O9U X;  1KWI A;  2HML B;  3F8H A;  3JUO A;  3M8C A;  1BRN L;  1Q7Y 4;  3MHE A;  1HZ1 A;  2XF3 A;  3EB8 A;  3FSD A;  1EG9 B;  3PGB A;  1FW7 A;  4WYK B;  5AIH A;  1GY6 A;  4ILF A;  1RLS A;  1GYB A;  4N6T A;  2GU1 A;  4KT3 B;  1NB3 I;  1IT8 A;  2F5W A;  3F7X A;  1UCL A;  3E99 A;  2RNT A;  4LYL B;  2FGT A;  3EX9 A;  1JKG A;  4K1V A;  3T8N A;  1QAK A;  1MOL A;  1UGH I;  1ROA A;  5CF2 A;  3X3Y A;  1RGE A;  1C54 A;  1YGW A;  2H0G A;  1ASK A;  1W01 A;  1RKY A;  2IY2 A;  1E3V A;  3NHX A;  4BL2 A;  5ELU A;  5HGR A;  1OPY A;  5M1A A;  2IA7 A;  4DKI A;  3DMC A;  2UUG C;  1GY7 A;  1LOV A;  4CDL A;  3BNC A;  5STD A;  4XBT A;  2CC3 A;  1BRS A;  1UCK A;  1SPU A;  3UL6 A;  2QA4 3;  1GD3 A;  3PYJ A;  1W7C A;  3V98 A;  1A90 A;  1ULJ B;  1W2Z A;  1US1 A;  1MNL A;  5EEO A;  1B2S A;  6STD A;  3PXM A;  5BVB A;  1TU5 A;  1BAN A;  1VZZ A;  1VQL 3;  1W6Y A;  1IVX A;  2KRT A;  3DGM A;  4R9K A;  4HM2 B;  3S28 A;  1VQN 3;  4XM4 A;  3F14 A;  1GMR A;  2ZHX B;  2V1L A;  3LYG A;  2CG1 A;  4L7K A;  4JF8 A;  5JPU A;  2SAR A;  2BHM A;  4K1U A;  1BSD A;  2HOH A;  3EQQ B;  4O3V A;  1UW1 A;  4CCV A;  1G0T A;  3I56 3;  3F7S A;  3MG3 A;  3D3L A;  1SJW A;  1BNF A;  1BRK A;  1A2P A;  2F56 A;  2W9Q A;  3RDE A;  4K61 A;  1I2F A;  3MG1 A;  3T0U A;  3NBB A;  4N6M A;  4HVN A;  1BGS A;  2XGL A;  1GY5 A;  1I8V A;  1QJG A;  1RTU A;  2FNQ A;  3V99 A;  3FF0 A;  3G71 3;  4LEH A;  3O8Y A;  1K8A 4;  1VQ4 3;  4EV2 A;  5JBS A;  1X1Y A;  3HOH A;  1TUH A;  3LOY A;  4FCZ A;  5IEO A;  1IVW A;  1IQY A;  1SAR A;  4WHA A;  1BOX A;  3LML A;  4U13 A;  1DYU A;  2H0H A;  3OXA A;  2IUJ A;  2WOH A;  2KF6 A;  3GZR A;  1VQ5 3;  3N9H A;  4N6U A;  3WDG B;  1WMO A;  1JB2 A;  4J5K A;  2OCT A;  2CH9 A;  2BU4 A;  3OWU A;  1U5O A;  3VGN A;  3EN8 A;  1PY3 A;  3LTB A;  1K28 A;  5FGO A;  3H51 A;  4LGQ A;  3FG3 A;  2CWT A;  3X40 A;  4STD A;  4BTY A;  2OTJ 3;  2P0X A;  1UI7 A;  3FG4 A;  2D42 A;  3RGA A;  3KE7 A;  2P09 A;  2E2T A;  4TX4 A;  2ML6 A;  2Y73 A;  2F98 A;  4ZM8 A;  1CEW I;  2F4Y A;  3KCH A;  3ZG0 A;  2J8X B;  1FYS A;  3SOY A;  1V58 A;  5DRE A;  2RBI A;  1W6C A;  3RGR A;  1RGC A;  1UCI A;  1UUW B;  2LYX A;  4FR9 A;  2CK3 H;  2CWV A;  5IG4 A;  3GWR A;  3FF2 A;  2AAD A;  2Z7A A;  3NM7 A;  1JB4 A;  2OQE C;  2XSH B;  3NUV A;  3B4P A;  1HKX A;  3PCS A;  4RNY A;  1RGK A;  2OTL 3;  2CFK A;  1LNI A;  1Y4K A;  2KF3 A;  3ER7 A;  3IPT A;  4WP5 A;  1CH0 A;  3I0Y A;  1RN4 A;  3CC4 3;  2XH9 A;  1RGA A;  4HYZ A;  1I70 A;  3OW2 2;  2YFI B;  2YFJ B;  1N5P A;  2HMJ B;  2PNC A;  1J2B A;  1AY7 A;  2K54 A;  2GXF A;  4O8S A;  5IER A;  2STD A;  1VQP 3;  3MWZ A;  1N8Q A;  2A15 A;  1VQO 3;  3ZG5 A;  1K9M 4;  2GBX B;  4H61 A;  3TDG A;  1I0X A;  3X3X A;  4N3V A;  5G1K A;  3WA2 X;  2B1X B;  1RSN A;  3WOD G;  1IVU A;  1FUT A;  1JB5 A;  2JQ5 A;  4R9L A;  5G1L A;  2KXG A;  2P0M A;  4BU4 A;  2E2V A;  3CMA 3;  4HM6 B;  1JKG B;  3HX8 A;  1UGI A;  1ZS7 A;  1TRP A;  1MWT A;  1GOU A;  1D6Y A;  1RN1 A;  2KCD A;  3WMD A;  2GBW B;  3GZB A;  1A2K A;  3NBJ A;  4LMI A;  1MGR A;  2BO9 B;  4GB5 A;  4AEQ A;  1RNB A;  3Q2P A;  3IMA B;  1YI2 3;  2XR8 B;  3CCQ 3;  1RRH A;  1D6Z A;  3K5T A;  2BMQ B;  2P05 A;  4AKZ A;  3UL5 A;  4GL6 A;  3MPH A;  2AAE A;  3J7Y d;  1BNR A;  1GS3 A;  2MF7 A;  3NX0 A;  3K9M C;  3PS8 A;  2RFR A;  1KD1 4;  3MYT A;  3WOF B;  1BRJ A;  1BVI A;  3CC7 3;  5D83 A;  1S72 3;  4IPB A;  1MWU A;  1RCK A;  1W4N A;  3CNX A;  1ZO2 A;  4J9A A;  2K3D A;  1YGE A;  3G6E 3;  1EEJ A;  1QAF A;  2Z77 A;  2CFG A;  5A0O B;  1DVD A;  3FH1 A;  1MGW A;  4RNZ A;  4EXR A;  3HZP A;  4HJL B;  1JBT A;  1TFK A;  5IF6 A;  1QMA A;  2WGQ A;  4L8O A;  3EN1 B;  4KVH A;  3U1W A;  2IYJ A;  1OHO A;  1BNJ A;  2OQE A;  1M90 4;  3ECF A;  4HM0 B;  1AVK A;  3A76 A;  1OCV A;  4OK0 A;  1I2G A;  3JUQ A;  4QWT A;  5LC7 A;  1IQX A;  1GMP A;  4EW5 A;  4WFO A;  5EVH A;  5ELJ A;  1FUW A;  1TTO A;  1A67 A;  2SBL A;  3S27 A;  1LXE A;  2UX0 A;  2P38 A;  1STF I;  2CFD A;  2HMM B;  3CPW 2;  3OV4 A;  5IG0 A;  3PZW A;  2XSO B;  3NBR A;  3FCS B;  1O7G B;  1PYL A;  2XGN A;  3N54 B;  3ZFZ A;  1DMQ A;  1W6G A;  1ULI B;  1O7M B;  4MMX B;  3LH4 A;  5KP1 A;  1NU3 A;  4HM4 B;  3DGY A;  1Q86 4;  5AYS C;  5IEN A;  4LSO A;  3CCM 3;  3BU4 A;  3NM2 A;  3UB1 A;  1B2M A;  1JN5 A;  1ROV A;  5EQL A;  4J5G A;  2O3O A;  3QRD A;  3S5C A;  3STD A;  3LTA A;  5IW9 A;  1TIJ A;  3HK4 A;  7STD A;  3UJM A;  3AGN A;  2C10 A;  5M19 A;  3CCS 3;  1RMS A;  1O7P B;  1I3F A;  5BIR A;  3OWY A;  4CPK A;  2ZA4 A;  4BIR A;  2QEX 3;  3NV0 A;  3T8U A;  5LC6 A;  1D6U A;  4MMZ B;  1QVG 2;  1OHS A;  4MJD A;  2Q07 A;  4HAA A;  2B24 B;  1M1X B;  2D1W A;  3GAX A;  1BUJ A;  3I55 3;  1OHP A;  3OWS A;  5AYR B;  5CK6 A;  2C11 A;  3B7C A;  2WO0 A;  1R4C A;  1B2U A;  1ZGX A;  1W00 A;  4R4K A;  3NQZ A;  3CXC 2;  1B2X A;  2BMO B;  2W0Q A;  1RRL A;  3QK9 A;  4N6V 0;  4OUQ A;  4O02 B;  4MEI A;  3F40 A;  3EBT A;  4NPB A;  4NRE A;  4PEJ A;  3CME 3;  1R4Y A;  4H3U A;  3F8X A;  2W2C A;  1NDO B;  1OGX A;  3RNT A;  1FZU A;  1N5H A;  3BND A;  4GHO A;  6GSP A;  3BNE A;  1UUG B;  4I4K A;  4FCJ A;  1SII A;  3S29 A;  3DY5 A;  1I3I A;  5I97 A;  1YIJ 3;  1IYY A;  3NQY A;  1YIT 3;  2OWP A;  3FGY A;  3G0K A;  3KFQ C;  2CFL A;  3D79 A;  1IDP A;  1GSP A;  4FMC A;  2E2U A;  3CCE 3;  1FGO A;  1RNT A;  5KP4 A;  1IK3 A;  3HII A;  4XDW A;  3X3Z A;  3GZY B;  1QVF 2;  1B2Z A;  1ZX2 A;  1BU4 A;  3GZX B;  1NNV A;  3S67 A;  3D4A A;  2BIR A;  3DM8 A;  3B4O A;  3WR2 A;  1JJ2 2;  1BRI A;  2UGI A;  1FGQ A;  1T2I A;  3Q1C A;  4HM7 B;  2F86 B;  4Q53 A;  5CLK A;  3CU3 A;  1B21 A;  4FMD A;  2C4B A;  2I9W A;  4BL3 A;  3LXU X;  1VQ8 3;  1Q81 4;  1K73 4;  2CHC A;  1LOW A;  3BLZ A;  5BU4 A;  5D81 A;  3BNB A;  4LZI A;  2ML5 A;  1KQS 2;  3EE1 A;  1TJD A;  1EQK A;  3G4S 3;  1HYF A;  1LQG C;  1M9G A;  3CCJ 3;  1STD A;  1TFO A;  2W56 A;  8CHO A;  1IVV A;  4KZ1 A;  3Q3F A;  4O2H A;  2RCD A;  3WA3 A;  3OX9 A;  2CW9 A;  1SIH A;  3H3H A;  2JDI H;  1BUQ A;  3KN4 A;  1L5G B;  3B8L A;  1DMM A;  3FZW A;  1LQM B;  1RGF A;  1X1W A; 
#chains in the Genus database with same CATH homology
 2W6J H;  3EHC A;  4FMB A;  1UI8 A;  4IIA A;  1OH0 A;  2RGQ A;  1KSI A;  4HKV B;  3CPO A;  4HBR A;  5AII A;  3EJV A;  4L8P A;  4EC6 A;  1KC8 4;  1M1K 4;  4R80 A;  3Q90 A;  3CC2 3;  2CG0 A;  3PCR A;  4N6L A;  4RZM A;  4XDV A;  4AKY A;  1VQM 3;  3KKG A;  4N6N B;  3LT8 A;  1YHQ 3;  4HM3 B;  3D9R A;  5CXO A;  1OF5 A;  1DMN A;  2CWU A;  3LTD A;  1N9E A;  3X41 A;  1FGM A;  3SXX A;  1OAC A;  1JN5 B;  1IV7 A;  3LZA A;  2W04 A;  3F9S A;  2HMK B;  1IQ8 A;  2GEY A;  3HI7 A;  3FLJ A;  1AV4 A;  4KFF A;  1C7H A;  2IMJ A;  3KSP A;  4HZB B;  3AMO A;  4RBN A;  1WQL B;  4N6O B;  1QAL A;  1WMP A;  5TGN A;  2W9P A;  2XFT A;  4FCM A;  2IUK A;  1PFP A;  1G96 A;  3NV0 B;  4R1K A;  2CFW A;  1Q40 A;  4MMY B;  3L0R A;  2R4I A;  2W03 A;  5AEU B;  3UNL A;  3BB9 A;  1EA2 A;  2BT3 A;  3HIG A;  1VQK 3;  1Q82 4;  3VSY A;  4XB5 A;  5JPP A;  2GU3 A;  5AIG A;  1O7W B;  2BNG A;  2F99 A;  5KP3 A;  3SED A;  1RJO A;  1V74 A;  1IU7 A;  1GD4 A;  1O7H B;  2XFS A;  2Y74 A;  3KSE D;  1RN7 A;  4IT7 A;  1ISK A;  2CIU A;  2LQV A;  1E97 A;  1Q42 A;  3K63 A;  4WYK A;  1UUV B;  4G1M B;  2PZV A;  1YVB I;  5BXQ A;  2HMN B;  3MG2 A;  3U97 A;  2GEX A;  1FGR A;  3KII A;  4HZ9 B;  3CNM A;  2K0M A;  1VQ7 3;  1OGZ A;  1Z1S A;  2WGO A;  4ORL A;  3FG1 A;  3DGO A;  3VF1 A;  1DVC A;  3MKI A;  3SX1 A;  4WWU C;  1YJW 3;  1IV9 A;  2OOV C;  3SOA A;  1TP6 A;  5DRV A;  2ZDJ A;  4KFE A;  1JV2 B;  3V92 A;  4K90 B;  1O7N B;  1W02 A;  3DGL A;  3CCL 3;  4BTW A;  4JRF A;  4X2O A;  1IT7 A;  4EBG A;  3X42 A;  3DZL A;  1WTH A;  2QGU A;  3G16 A;  3FKA A;  1N8R 4;  3JUM A;  1SQW A;  1NJI 4;  4XBY A;  1E3R A;  3WOE B;  1VQ9 3;  3LTC A;  3DGN A;  3JVC A;  1CYU A;  2RSX A;  1PU4 A;  4J8T A;  4HM8 B;  3K7C A;  3JUN A;  4HM1 B;  2FXT A;  3CD6 3;  2M7O A;  1FA3 A;  1U8C B;  2W56 B;  2ZL8 A;  3KZT A;  3DUK A;  1K41 A;  5D82 A;  1FGT A;  1AVL A;  4NHF A;  3NXJ A;  1NB5 I;  1YJ9 3;  3G8Z A;  1LOX A;  1T5Y A;  3N8B A;  2WOF A;  4KFD A;  3CCV 3;  5IEP A;  2YFL B;  1JNQ A;  5FW5 A;  4EV5 A;  4HM5 B;  5IG5 A;  1NO3 A;  5IG3 A;  5CF1 A;  1WNH A;  3MSO A;  2XEP A;  1JRQ A;  4OVM A;  4XBX A;  1A2V A;  3K0Z A;  1LVN A;  2L4V A;  2Z6B A;  3CCU 3;  1CYV A;  1F8N A;  1S5A A;  1CQS A;  3CCR 3;  1NWW A;  1OF5 B;  1W2B 2;  2XRX B;  3JUP A;  2HMO B;  1VQ6 3;  1AR0 A;  2CKF B;  2INX A;  2YX9 A;  2OOV A;  5AIF A;  3EC9 A;  3LT9 A;  2QIY A;  3DXO A;  2Z76 A;  4X2H A;  3EF8 A;  2MC8 A;  3IJE B;  4EYC A;  3AMO B;  5G2G A;  1EKM A;  5AI1 A;  4FMA A;  1WMN A;  1OUN A;  3GRD A;  3SLU A;  3EBY A;  1LNH A;  3SVA A;  1Q40 B;  1W5Z A;  3ALA A;  3ROB A;  5AEW B;  4BTX A;  1YJN 3;  1N9J A;  1HU9 A;  2BMR B;  2O9U X;  1KWI A;  2HML B;  3F8H A;  3JUO A;  3M8C A;  1Q7Y 4;  3MHE A;  2XF3 A;  3EB8 A;  3FSD A;  1EG9 B;  3PGB A;  4WYK B;  5AIH A;  1GY6 A;  1GYB A;  4N6T A;  2GU1 A;  1NB3 I;  1IT8 A;  3F7X A;  3E99 A;  3EX9 A;  1JKG A;  4K1V A;  3T8N A;  1QAK A;  1MOL A;  1ROA A;  5CF2 A;  3X3Y A;  1ASK A;  1W01 A;  1RKY A;  1E3V A;  3NHX A;  5ELU A;  5HGR A;  1OPY A;  2IA7 A;  3DMC A;  1GY7 A;  4CDL A;  3BNC A;  5STD A;  4XBT A;  2CC3 A;  1SPU A;  3UL6 A;  2QA4 3;  1GD3 A;  3PYJ A;  1W7C A;  3V98 A;  1A90 A;  1ULJ B;  1W2Z A;  1US1 A;  1MNL A;  5EEO A;  6STD A;  3PXM A;  5BVB A;  1TU5 A;  1VZZ A;  1VQL 3;  1W6Y A;  1IVX A;  2KRT A;  3DGM A;  4R9K A;  4HM2 B;  3S28 A;  1VQN 3;  4XM4 A;  3F14 A;  2V1L A;  3LYG A;  2CG1 A;  4L7K A;  4JF8 A;  5JPU A;  2BHM A;  4K1U A;  3I56 3;  4O3V A;  3EQQ B;  4CCV A;  1UW1 A;  3F7S A;  3MG3 A;  3D3L A;  1SJW A;  2W9Q A;  3RDE A;  4K61 A;  3MG1 A;  3T0U A;  3NBB A;  4N6M A;  4HVN A;  2XGL A;  1GY5 A;  1QJG A;  2FNQ A;  3V99 A;  3FF0 A;  3G71 3;  4LEH A;  3O8Y A;  1K8A 4;  1VQ4 3;  4EV2 A;  5JBS A;  1TUH A;  3LOY A;  4FCZ A;  5IEO A;  1IVW A;  1IQY A;  4WHA A;  3LML A;  4U13 A;  1DYU A;  3OXA A;  2IUJ A;  2WOH A;  3GZR A;  1VQ5 3;  3N9H A;  4N6U A;  3WDG B;  1WMO A;  1JB2 A;  2OCT A;  2CH9 A;  3OWU A;  1U5O A;  3VGN A;  3EN8 A;  3LTB A;  1K28 A;  5FGO A;  3H51 A;  4LGQ A;  3FG3 A;  2CWT A;  3X40 A;  4STD A;  4BTY A;  2OTJ 3;  2P0X A;  1UI7 A;  3FG4 A;  2D42 A;  3RGA A;  3KE7 A;  2P09 A;  2E2T A;  4TX4 A;  2ML6 A;  2Y73 A;  2F98 A;  4ZM8 A;  1CEW I;  3SOY A;  5DRE A;  1W6C A;  3RGR A;  1UUW B;  2LYX A;  4FR9 A;  2CK3 H;  2CWV A;  5IG4 A;  3GWR A;  3FF2 A;  2Z7A A;  3NM7 A;  1JB4 A;  2OQE C;  2XSH B;  3NUV A;  3B4P A;  1HKX A;  3PCS A;  4RNY A;  2OTL 3;  2CFK A;  1Y4K A;  3ER7 A;  3IPT A;  4WP5 A;  3I0Y A;  3CC4 3;  2XH9 A;  4HYZ A;  3OW2 2;  2YFI B;  2YFJ B;  1N5P A;  2HMJ B;  2PNC A;  1J2B A;  5IER A;  2K54 A;  2GXF A;  4O8S A;  2STD A;  1VQP 3;  3MWZ A;  1N8Q A;  2A15 A;  1VQO 3;  1K9M 4;  2GBX B;  4H61 A;  3TDG A;  3X3X A;  4N3V A;  3WA2 X;  2B1X B;  3WOD G;  1IVU A;  1JB5 A;  2JQ5 A;  4R9L A;  2KXG A;  2P0M A;  2E2V A;  3CMA 3;  4HM6 B;  1JKG B;  3HX8 A;  1D6Y A;  2KCD A;  3WMD A;  2GBW B;  3GZB A;  1A2K A;  3NBJ A;  4LMI A;  2BO9 B;  4GB5 A;  4AEQ A;  3Q2P A;  3IMA B;  1YI2 3;  2XR8 B;  3CCQ 3;  1RRH A;  1D6Z A;  3K5T A;  2BMQ B;  2P05 A;  4AKZ A;  3UL5 A;  4GL6 A;  3MPH A;  3J7Y d;  1GS3 A;  2MF7 A;  3NX0 A;  3K9M C;  3PS8 A;  2RFR A;  1KD1 4;  3MYT A;  3WOF B;  3CC7 3;  5D83 A;  1S72 3;  4IPB A;  1W4N A;  3CNX A;  1ZO2 A;  4J9A A;  1YGE A;  3G6E 3;  1QAF A;  2Z77 A;  2CFG A;  5A0O B;  1DVD A;  3FH1 A;  4RNZ A;  4EXR A;  3HZP A;  4HJL B;  1TFK A;  5IF6 A;  1QMA A;  2WGQ A;  4L8O A;  3EN1 B;  4KVH A;  3U1W A;  1OHO A;  2OQE A;  1M90 4;  3ECF A;  4HM0 B;  1AVK A;  3A76 A;  1OCV A;  4OK0 A;  3JUQ A;  4QWT A;  5LC7 A;  1IQX A;  4WFO A;  5EVH A;  5ELJ A;  1FUW A;  1A67 A;  2SBL A;  3S27 A;  1LXE A;  2UX0 A;  2P38 A;  1STF I;  2CFD A;  2HMM B;  3CPW 2;  3OV4 A;  5IG0 A;  3PZW A;  2XSO B;  3NBR A;  3FCS B;  1O7G B;  2XGN A;  3N54 B;  1DMQ A;  1W6G A;  1ULI B;  1O7M B;  4MMX B;  3LH4 A;  5KP1 A;  1NU3 A;  4HM4 B;  1Q86 4;  5AYS C;  5IEN A;  4LSO A;  3CCM 3;  3NM2 A;  3UB1 A;  1JN5 A;  1ROV A;  5EQL A;  2O3O A;  3QRD A;  3S5C A;  3STD A;  3LTA A;  5IW9 A;  1TIJ A;  3HK4 A;  7STD A;  3UJM A;  2C10 A;  3CCS 3;  1O7P B;  3OWY A;  2QEX 3;  3NV0 A;  3T8U A;  5LC6 A;  1D6U A;  4MMZ B;  1QVG 2;  1OHS A;  4MJD A;  2Q07 A;  2B24 B;  1M1X B;  2D1W A;  3GAX A;  3I55 3;  1OHP A;  3OWS A;  5AYR B;  5CK6 A;  2C11 A;  3B7C A;  2WO0 A;  1R4C A;  1W00 A;  4R4K A;  3NQZ A;  3CXC 2;  2BMO B;  2W0Q A;  1RRL A;  3QK9 A;  4N6V 0;  4OUQ A;  4O02 B;  4MEI A;  3F40 A;  3EBT A;  4NRE A;  4PEJ A;  3CME 3;  4H3U A;  3F8X A;  2W2C A;  1NDO B;  1OGX A;  1N5H A;  3BND A;  3BNE A;  4I4K A;  1SII A;  3S29 A;  3DY5 A;  1YIJ 3;  5I97 A;  3NQY A;  1YIT 3;  2OWP A;  3FGY A;  3G0K A;  3KFQ C;  2CFL A;  1IDP A;  4FMC A;  2E2U A;  3CCE 3;  1FGO A;  5KP4 A;  1IK3 A;  3HII A;  4XDW A;  3X3Z A;  3GZY B;  1QVF 2;  1ZX2 A;  3GZX B;  3S67 A;  3DM8 A;  3B4O A;  1JJ2 2;  3Q1C A;  1FGQ A;  4HM7 B;  5CLK A;  2F86 B;  4Q53 A;  3CU3 A;  4FMD A;  2I9W A;  3LXU X;  1VQ8 3;  1Q81 4;  1K73 4;  2CHC A;  3BLZ A;  5D81 A;  3BNB A;  4LZI A;  2ML5 A;  1KQS 2;  3EE1 A;  1EQK A;  3G4S 3;  1M9G A;  3CCJ 3;  1STD A;  1TFO A;  2W56 A;  8CHO A;  1IVV A;  4KZ1 A;  4O2H A;  2RCD A;  3WA3 A;  3OX9 A;  2CW9 A;  1SIH A;  3H3H A;  2JDI H;  1BUQ A;  3KN4 A;  1L5G B;  3B8L A;  1DMM A;  3FZW A;  2FGT A;  4FCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...