3N8BA

Crystal structure of borrelia burgdorferi pur-alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
ERGEVYSEKMFTESERTYFMNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENMNEFESNLLKAIAVIKQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Of bits and bugs--on the use of bioinformatics and a bacterial crystal structure to solve a eukaryotic repeat-protein structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Nucleic acid binding protein
total genus 14
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3n8bA00
5FGOA 3NM7A 3N8BA
chains in the Genus database with same CATH superfamily
1D6ZA 1X1YA 5IF6A 5LC7A 3SOAA 4O3VA 2KF3A 3LMLA 4K1UA 3AGNA 5FGOA 1GS3A 1BRNL 2QA43 3SOYA 4QWTA 2SARA 1RCKA 3HIIA 4ORLA 1SQWA 1A2KA 4RNZA 1LOWA 2CFGA 2ML5A 1LOYA 1PY3A 3WMDA 1NB5I 4J9AA 4LMIA 1BRKA 2KF5A 2MC8A 1CYUA 2PZVA 3BNCA 1IQYA 1MGRA 3LT8A 2D42A 3S27A 1GOYA 2P05A 3KIIA 1V57A 1A90A 5HOHA 2XF3A 2XSOB 1TFOA 1W01A 4HM8B 3OWUA 1LXEA 5CXOA 3S5CA 2OTL3 1JNQA 2CFKA 3RNTA 1OF5A 1Q9EA 1IVUA 2P0MA 3MG3A 4HM1B 2HMLB 3HIGA 1E3VA 1IK3A 1S723 2H0HA 3Q2PA 2B1XB 4GSPA 1TRQA 3UNLA 1KD14 2KCDA 1MOLA 3D4AA 1VQK3 3OWYA 1I0XA 4CCVA 3LH4A 5EVHA 3S29A 1KQS2 1NWWA 3FKAA 1DMNA 3HX8A 1EUIC 1W02A 1JV2B 4RNYA 1JBTA 1IT8A 2CIUA 2V1LA 3GSPA 5CLKA 3X42A 3NBJA 1YJW3 1LOXA 4H61A 1IDPA 4TX4A 3RGAA 1W6GA 1FGOA 1SJWA 1W6CA 4WYKB 3QRDA 1I8VA 1F8NA 1GOUA 1O7NB 2RSXA 2WGQA 3NBBA 3FG3A 3KFQC 5D81A 1BUQA 5IEPA 4N6MA 1BNGA 3HZPA 1YVBI 1B2UA 5BIRA 3N9HA 3D5GA 3QK9A 2IUKA 4DKIA 3Q3FA 4XBYA 5FW5A 1KC84 1FYSA 2FGTA 3DM8A 1QVF2 3NV0A 1DMQA 2XEPA 1GMQA 4HM4B 1K9M4 3JUNA 2H0GA 1SIHA 1GOVA 3ZFZA 3E99A 2CG0A 6RNTA 4HM6B 5CK6A 1O7WB 5AIIA 1ZX2A 3URPA 1UCIA 1WTHA 1W2ZA 3DGYA 1M904 5TGNA 1UUWB 1ZO2A 1JN5A 3O8YA 3SYUA 1AR0A 1FUWA 1OH0A 4FCJA 4HBRA 2FNQA 3D5IA 4KFEA 4N6NB 4O2HA 2HMKB 3LZAA 4GHOA 2SBLA 4AKYA 1YIT3 1B2SA 1EA2A 2STDA 3KCHA 1TJDA 1E3RA 2CK3H 1B27A 3F7XA 1N8R4 2Q07A 2HMMB 5G2GA 1CQSA 2YFJB 1N8QA 2ZL8A 3JUMA 5AIHA 2XR8B 1RNTA 1RTUA 3GZYB 1G96A 2C11A 3I553 1ASKA 3G6E3 1A2PA 1FA3A 3FG1A 3F14A 3CCS3 2BMQB 3PCSA 3TDGA 4MEIA 1KWIA 1VQ83 1FW7A 1EKMA 1A67A 3OWSA 3AMOA 3EN1B 1PYLA 2IUJA 1YGEA 2E2TA 4FMDA 4RZMA 1O7GB 3K7CA 3EHCA 2PNCA 4N6TA 4BU4A 3WA3A 5RNTA 1BVIA 2YFIB 4EW5A 3NX0A 2E2UA 3KZTA 2GU1A 3PXMA 3N54B 4OUQA 1I3FA 3WDGB 1CH0A 1OHPA 1TIJA 2CWTA 1D6UA 4H3UA 1VQ93 3CPW2 1G0TA 2XGNA 3LTBA 4EXRA 3UL5A 2WOHA 3ECFA 5A0OB 1RGGA 3V92A 3CCL3 1LQGC 1B21A 3UJMA 1GYBA 1B2MA 4R80A 3B4PA 2L1SA 1RN7A 3MSOA 3DMCA 3DGLA 2OWPA 4HM2B 3WR2A 3WA2X 1Q824 4BTXA 5JBSA 2W6JH 3KN4A 3FGYA 1OHOA 4BTWA 5BU4A 1RCLA 1TU5A 2FXTA 1IV9A 2CX1A 2BMOB 2BT3A 2K0MA 1JB2A 1N9EA 2BO9B 3F40A 3X3ZA 2UUGC 3CD63 1RRHA 8RNTA 1FGTA 2A15A 1RNBA 1TP6A 2OTJ3 1FUTA 1RN1A 4MMXB 3STDA 3CC73 1J2BA 1RMSA 1S5AA 3ALAA 3B4OA 5IG5A 5EEOA 1W4NA 4STDA 2K54A 1N5HA 1UCLA 1JKGA 2B24B 4AEQA 3FH1A 1OHSA 1V74A 3BLZA 5D82A 3IPTA 2KRTA 5STDA 1QAFA 4GB5A 3G4S3 4OK0A 1IQXA 2RGQA 2Z7AA 2XRXB 3I563 1W00A 2GSPA 3MG1A 3ZG5A 3RDEA 1ISKA 2J8XB 5AIGA 1IU7A 3JUOA 3CCQ3 5DRVA 3FLJA 3K5TA 3D79A 3T0UA 1MWRA 4L8OA 2HMJB 3UL6A 3V98A 2L4VA 3WOEB 4FCZA 2JQ5A 3U97A 4BIRA 1D6YA 3H3HA 2QGUA 1Q40B 3A5EA 3SEDA 4EV5A 8CHOA 5CF1A 1GY6A 3OX9A 2IY2A 1W7CA 2ZDJA 4WWUC 2AAEA 1NO3A 4CPKA 1X1UA 3CCU3 1R4CA 1M1K4 2MF7A 1DVDA 1UI8A 5AYSC 3EB8A 3WHOA 1YJ93 1Q7Y4 1NU3A 4XBTA 1VQO3 4MJDA 1W2B2 5JPUA 1BIRA 3K63A 3DH2A 3KSED 3DGMA 2W56A 5G1KA 1QAKA 5M1AA 2QIYA 5G1LA 1BRIA 2CG1A 3OXAA 3S67A 3LTAA 1GMPA 1MWSA 3F9SA 4WFOA 5LC6A 4L8PA 4KZ1A 1VQM3 5BVBA 3A76A 3G713 1JZDA 3VSYA 1O7PB 1QMAA 3JVCA 1M1XB 5IG0A 1Q814 2W04A 4HM3B 4XM4A 1OGZA 5JPPA 2F4YA 1RHLA 4O8SA 3G16A 2GXFA 1BNIA 2BHMA 2OOVA 2BMRB 2H0IA 1RGEA 4N6UA 1MWUA 1GD4A 2CFWA 3EBYA 7STDA 1BUJA 2GBWB 4IT7A 1TTOA 2CWVA 2F5WA 2Y74A 3CPOA 1FGMA 3CCE3 5IW9A 2GEXA 1OGXA 4J8TA 1T5YA 3AHSA 5DREA 2OQEA 4R1KA 1JRQA 1GSPA 1W5ZA 1DMMA 3H51A 4R9KA 4IPBA 2BIRA 2P0XA 1RGHA 4G1MB 5KP1A 5AYRB 1GY5A 3DUKA 5ELJA 1LQMB 3VGNA 2KXGA 3VF1A 4R9LA 4N6V0 1O7MB 3CCJ3 1PFPA 1BRHA 1KSIA 3IJEB 1PU4A 4FR9A 4HZ9B 1DETA 3NUVA 2M7OA 1UDII 2RCDA 1IV7A 3K0ZA 3EX9A 4EC6A 3X40A 1I2FA 1YHQ3 2YFLB 1K28A 3CC23 3CNXA 4EV2A 3JUQA 2RNTA 2CWUA 1JJ22 3PZWA 1V58A 6GSPA 1AVKA 2BNGA 1EG9B 2QEX3 3CME3 1N9JA 6STDA 1OF5B 4LZIA 1DE3A 3X41A 3MG2A 4HYZA 5AEWB 3EN8A 4FMAA 1STDA 2BU4A 4GL6A 1BOXA 5AI1A 1WQLB 1IQ8A 2HOHA 2CW9A 4X2OA 5I97A 1HKXA 4WYKA 1BSCA 2GBXB 3EQQB 3NHXA 1GD3A 1JBSA 1EQKA 3CNMA 2WOFA 1M9GA 1C7HA 1WMPA 3F7SA 3JUPA 3NBRA 3Q1CA 4N6OB 4XDWA 3CCR3 3G0KA 1UUGB 4JF8A 4ZM8A 3DXOA 4NHFA 1UGHI 2O9UX 5IEOA 1FZUA 5M19A 1B20A 1WMOA 2Z77A 3PYJA 3Q90A 4BTYA 3EJVA 4WHAA 1R4YA 2O3OA 2CFLA 3ER7A 1IVWA 3EC9A 2XFTA 4HAAA 1BSEA 3FF2A 2Z6BA 1T3BA 3MYTA 2W9QA 3OW22 2GU3A 4KFFA 3F8XA 2P38A 1VQ63 1N5PA 1A2VA 7RNTA 5KP4A 4NPBA 1Q42A 1OUNA 4BL2A 1E97A 4HM0B 3ROBA 3FZWA 4XBXA 4HKVB 1QALA 4BL3A 1VZZA 1OACA 3DZLA 4CDLA 3CCV3 1ULIB 5GSPA 2D1WA 3G8ZA 5KP3A 3NV0B 2CFDA 1B3SA 1YNVX 3D9RA 4KVHA 1GY7A 2R4IA 2JDIH 3GZBA 1BSDA 3BNDA 3FCSB 3X3XA 4HM7B 3S28A 3CC43 4OVMA 1MNLA 4EYCA 1RN4A 2W0QA 4NREA 3B7CA 3KSPA 1O7HB 3CMA3 1JN5B 3BNBA 4AKZA 3GZXB 3LYGA 2F99A 5HGRA 1FGQA 1I70A 1VQ43 2W9PA 3UB1A 2F56A 1CEWI 1I0VA 1BU4A 1FUSA 1LRAA 3OV4A 1I3IA 4O02B 1IYYA 1B2ZA 3BIRA 1RDSA 1TUHA 4FCMA 1NJI4 2I9WA 4KT3B 1LNIA 1MGWA 2E2VA 3RGRA 1SARA 4RNTA 1BNRA 4LGQA 2HMOB 1ULJB 2XGLA 3D3LA 3FF0A 3MKIA 3AGOA 3AMOB 1TRPA 1I2GA 1VQQA 2OOVC 3BB9A 4Q53A 2UGIA 3FG4A 3F8HA 2AADA 3GAXA 2K3DA 4JRFA 2F86B 1BAOA 3BNEA 3LXUX 2C10A 1Y4KA 1NB3I 2XH9A 1YJN3 1IVXA 1RKYA 3T8UA 2OQEC 1ROAA 4EBGA 2UX0A 1LOVA 1X1XA 1UCKA 3M8CA 4RBNA 3SX1A 4HVNA 3SXXA 2OCTA 1QJGA 4WP5A 1CYVA 1UI7A 1T2HA 4J5GA 4MMZB 4I5QA 1BNFA 3PGBA 3DY5A 4J5KA 1STFI 1YVSA 4K61A 2IYJA 3LTCA 1BRSA 3MHEA 3IMAB 3GWRA 1VQN3 3WOFB 4KFDA 1MWTA 1RGCA 2YX9A 3PS8A 2KF6A 7GSPA 3NXJA 1VQ53 4XB5A 1DVCA 2P09A 3K9MC 1JB5A 2F98A 1RSNA 3HI7A 1UCJA 1AV4A 2IMJA 3DGNA 5IERA 3WODG 1HYFA 1K8A4 4HM5B 5IG3A 3L0RA 3J7Yd 1B2XA 1K41A 1RGLA 1AVLA 4HJLB 4LSOA 1HU9A 1WMNA 3AHWA 2INXA 4LEHA 4MMYB 2LYXA 1ROVA 3PCRA 1RGFA 3EBTA 2CKFB 2RFRA 2ZHXB 3MPHA 1BGSA 3GRDA 1RRLA 2HMNB 4K1VA 4K90B 4N3VA 3N8BA 4U13A 3NQYA 3SVAA 4CJNA 1SPUA 1AY7A 2CC3A 3BU4A 2CH9A 2ZA4A 1VQP3 4HZBB 1JKGB 1VQ73 3LT9A 5EQLA 1OPYA 1RGAA 1Q7HA 3EF8A 3LTDA 2XSHB 3NQZA 4L7KA 1IT7A 1NNVA 1US1A 1U5OA 1LVNA 1RJOA 1OCVA 1JBRA 5D83A 1BSBA 1Q40A 1DYUA 1U8CB 1BRGA 3U1WA 2IA7A 4I4KA 2CX0A 3SLUA 5BXQA 3EE1A 5M18A 3NM2A 3NM7A 1AQZA 1VQL3 3MWZA 1LNHA 1BNJA 1TFKA 4XDVA 5CF2A 1UW1A 2F5MA 3T8NA 1QVG2 1BSAA 3LOYA 1RLSA 9RNTA 4X2HA 1BNEA 1T2IA 1W6YA 4FMCA 1YIJ3 2Y73A 2XFSA 1BRJA 3KE7A 3DGOA 1Z1SA 1C54A 1ZGXA 4N6LA 5AIFA 1Q864 1BANA 2C4BA 2Z76A 1FGRA 2W03A 2GEYA 1RGKA 4ILFA 2KAAA 3X3YA 3KKGA 3B8LA 1L5GB 3CU3A 3FSDA 4LYLB 2WO0A 2LQVA 3ZG0A 1BNSA 5AEUB 4FMBA 1GMRA 1NDOB 1UGIA 1ZS7A 2KF4A 2WGOA 5ELUA 1YGWA 2W56B 3CXC2 1X1WA 1I2EA 2R41A 4IIAA 1EEJA 5IG4A 3V99A 1IVVA 1G02A 2W2CA 3GZRA 3CCM3 3HOHA 1K734 1SIIA 1WNHA 1UUVB 3I0YA 1HZ1A 4PEJA 3HK4A 4R4KA 1YI23 1JB4A 1JZOA 2CHCA 4HOHA 5IENA 2ML6A 2RBIA
chains in the Genus database with same CATH topology
1D6ZA 5IF6A 5LC7A 3SOAA 4O3VA 3LMLA 4K1UA 5FGOA 1GS3A 2QA43 3SOYA 4QWTA 3HIIA 3SX1A 4ORLA 1SQWA 1A2KA 4RNZA 2CFGA 2ML5A 3WMDA 1NB5I 4J9AA 4LMIA 2MC8A 1CYUA 2PZVA 3BNCA 1IQYA 3LT8A 2D42A 3S27A 2P05A 3KIIA 1A90A 2XF3A 2XSOB 1TFOA 1W01A 4HM8B 3OWUA 1LXEA 5CXOA 3S5CA 2OTL3 1JNQA 2CFKA 1OF5A 1IVUA 2P0MA 3MG3A 4HM1B 2HMLB 3HIGA 1E3VA 1IK3A 1S723 3Q2PA 2B1XB 3UNLA 1KD14 2KCDA 1MOLA 1VQK3 3OWYA 4CCVA 3LH4A 5EVHA 3S29A 1KQS2 1NWWA 3FKAA 1DMNA 3HX8A 4RNYA 1W02A 1JV2B 1IT8A 2CIUA 2V1LA 5CLKA 3X42A 3NBJA 1YJW3 1LOXA 4H61A 1IDPA 4TX4A 3RGAA 1W6GA 1FGOA 1SJWA 1W6CA 4WYKB 3QRDA 1F8NA 2RSXA 1O7NB 3NBBA 2WGQA 5D81A 3FG3A 3KFQC 1BUQA 5IEPA 4N6MA 3HZPA 1YVBI 3N9HA 3QK9A 2IUKA 4XBYA 5FW5A 1KC84 2FGTA 3DM8A 1QVF2 3NV0A 1DMQA 2XEPA 4HM4B 1K9M4 3JUNA 1SIHA 3E99A 2CG0A 4HM6B 5CK6A 1O7WB 5AIIA 1ZX2A 1WTHA 1W2ZA 1M904 5TGNA 1UUWB 1ZO2A 1JN5A 3O8YA 1AR0A 1FUWA 1OH0A 4FCJA 4HBRA 2FNQA 4KFEA 4N6NB 4O2HA 2HMKB 3LZAA 2SBLA 4AKYA 1YIT3 1EA2A 2STDA 1VQ93 1N8R4 2CK3H 1E3RA 3F7XA 2Q07A 2HMMB 5G2GA 1CQSA 2YFJB 1N8QA 2ZL8A 3JUMA 5AIHA 2XR8B 3GZYB 1G96A 2C11A 3I553 1ASKA 3G6E3 1FA3A 3FG1A 3F14A 3CCS3 2BMQB 3PCSA 3TDGA 4MEIA 1KWIA 1VQ83 1EKMA 1A67A 3OWSA 3AMOA 3EN1B 2IUJA 1YGEA 2E2TA 4FMDA 4RZMA 1O7GB 3K7CA 3EHCA 2PNCA 4N6TA 3WA3A 2YFIB 3NX0A 2E2UA 3KZTA 2GU1A 3PXMA 3N54B 4OUQA 3WDGB 1OHPA 1TIJA 2CWTA 1D6UA 4H3UA 3CPW2 2XGNA 3LTBA 4EXRA 3UL5A 2WOHA 3ECFA 5A0OB 3V92A 3CCL3 3UJMA 1GYBA 4R80A 3B4PA 1RN7A 3MSOA 3DMCA 3DGLA 2OWPA 4HM2B 1Q824 3WA2X 4BTXA 5JBSA 2W6JH 3KN4A 3FGYA 1OHOA 4BTWA 1TU5A 2FXTA 1IV9A 2BMOB 2BT3A 2K0MA 1JB2A 1N9EA 2BO9B 3F40A 3X3ZA 3CD63 1RRHA 1FGTA 2A15A 2OTJ3 1TP6A 4MMXB 3STDA 3CC73 1J2BA 3B4OA 1S5AA 3ALAA 5IG5A 5EEOA 1W4NA 4STDA 2K54A 1N5HA 1JKGA 2B24B 4AEQA 3FH1A 1OHSA 1V74A 3BLZA 5D82A 3IPTA 2KRTA 5STDA 1QAFA 4GB5A 3G4S3 4OK0A 1IQXA 2RGQA 2Z7AA 2XRXB 3I563 1W00A 3MG1A 1ISKA 3RDEA 5AIGA 1IU7A 3JUOA 3CCQ3 5DRVA 3FLJA 3K5TA 3T0UA 4L8OA 2HMJB 3UL6A 3V98A 2L4VA 3WOEB 4FCZA 2JQ5A 3U97A 1D6YA 3H3HA 2QGUA 1Q40B 3SEDA 4EV5A 8CHOA 5CF1A 1GY6A 3OX9A 1W7CA 2ZDJA 4WWUC 1NO3A 3CCU3 1R4CA 1M1K4 2MF7A 1DVDA 1UI8A 5AYSC 3EB8A 1YJ93 1Q7Y4 1NU3A 4XBTA 1VQO3 4MJDA 1W2B2 5JPUA 3K63A 3KSED 3DGMA 2W56A 1QAKA 2QIYA 2CG1A 3S67A 3OXAA 3LTAA 3F9SA 4WFOA 5LC6A 4L8PA 4KZ1A 1VQM3 5BVBA 3A76A 3G713 3VSYA 1O7PB 1QMAA 3JVCA 1M1XB 5IG0A 1Q814 2W04A 4HM3B 4XM4A 1OGZA 5JPPA 4O8SA 3G16A 2GXFA 2BHMA 2OOVA 2BMRB 4N6UA 1GD4A 2CFWA 3EBYA 7STDA 2GBWB 4IT7A 2CWVA 2Y74A 3CPOA 1FGMA 3CCE3 5IW9A 2GEXA 1OGXA 4J8TA 1T5YA 5DREA 2OQEA 4R1KA 1JRQA 4R9KA 1W5ZA 1DMMA 3H51A 5KP1A 4IPBA 2P0XA 4G1MB 5AYRB 1GY5A 3DUKA 5ELJA 3VGNA 2KXGA 3VF1A 4R9LA 4N6V0 1O7MB 3CCJ3 1PFPA 1KSIA 3IJEB 1PU4A 4FR9A 4HZ9B 3NUVA 2M7OA 2RCDA 1IV7A 3K0ZA 3EX9A 4EC6A 3X40A 1YHQ3 2YFLB 1K28A 3CC23 3CNXA 4EV2A 3JUQA 2CWUA 1JJ22 3PZWA 1AVKA 2BNGA 1EG9B 2QEX3 3CME3 1N9JA 6STDA 1OF5B 4LZIA 3X41A 3MG2A 4HYZA 5AEWB 3EN8A 4FMAA 1STDA 4GL6A 5AI1A 1WQLB 1IQ8A 2CW9A 4X2OA 5I97A 1HKXA 4WYKA 2GBXB 3EQQB 3NHXA 1GD3A 1EQKA 3CNMA 2WOFA 1M9GA 1C7HA 1WMPA 3F7SA 3JUPA 3NBRA 3Q1CA 4N6OB 4XDWA 3CCR3 3G0KA 4JF8A 4ZM8A 3DXOA 4NHFA 2O9UX 5IEOA 2Z77A 1WMOA 3PYJA 3Q90A 4BTYA 3EJVA 4WHAA 2O3OA 2CFLA 3ER7A 1IVWA 3EC9A 2XFTA 3FF2A 2Z6BA 3MYTA 2W9QA 3OW22 2GU3A 4KFFA 3F8XA 2P38A 1VQ63 1N5PA 1A2VA 5KP4A 1Q42A 1OUNA 1E97A 4HM0B 3ROBA 3FZWA 4XBXA 4HKVB 1QALA 1VZZA 1OACA 3DZLA 4CDLA 3CCV3 1ULIB 2D1WA 3G8ZA 5KP3A 3NV0B 2CFDA 3D9RA 4KVHA 1GY7A 2R4IA 2JDIH 3GZBA 3BNDA 3FCSB 3X3XA 4HM7B 3S28A 3CC43 4OVMA 1MNLA 4EYCA 2W0QA 4NREA 3B7CA 3KSPA 1O7HB 3CMA3 1JN5B 3BNBA 4AKZA 3GZXB 3LYGA 2F99A 5HGRA 1FGQA 1VQ43 2W9PA 3UB1A 1CEWI 3OV4A 4O02B 1TUHA 4FCMA 1NJI4 2I9WA 2E2VA 3RGRA 4LGQA 2HMOB 1ULJB 2XGLA 3D3LA 3FF0A 3MKIA 3AMOB 2OOVC 3BB9A 4Q53A 3FG4A 3F8HA 3GAXA 4JRFA 2F86B 3BNEA 3LXUX 2C10A 1Y4KA 1NB3I 2XH9A 1YJN3 1IVXA 1RKYA 3T8UA 2OQEC 1ROAA 4EBGA 2UX0A 3M8CA 4RBNA 3SXXA 4HVNA 2OCTA 1QJGA 4WP5A 1CYVA 1UI7A 4MMZB 3PGBA 3DY5A 1STFI 4K61A 3LTCA 3MHEA 3IMAB 3GWRA 3WOFB 4KFDA 2YX9A 3PS8A 3NXJA 1VQ53 4XB5A 1DVCA 2P09A 3K9MC 1JB5A 2F98A 3HI7A 1AV4A 2IMJA 3DGNA 5IERA 3WODG 1K8A4 4HM5B 5IG3A 3L0RA 3J7Yd 1K41A 4HJLB 1AVLA 4LSOA 1HU9A 1WMNA 2INXA 4LEHA 4MMYB 2LYXA 1ROVA 3PCRA 3EBTA 2CKFB 2RFRA 3MPHA 3GRDA 1RRLA 2HMNB 4K1VA 4K90B 4N3VA 3N8BA 4U13A 3NQYA 3SVAA 1SPUA 2CC3A 2CH9A 1VQP3 4HZBB 1JKGB 1VQ73 3LT9A 5EQLA 1OPYA 3EF8A 3LTDA 2XSHB 3NQZA 4L7KA 1IT7A 1US1A 1U5OA 1LVNA 1RJOA 1OCVA 5D83A 1Q40A 1DYUA 1U8CB 3U1WA 2IA7A 4I4KA 3SLUA 5BXQA 3EE1A 3NM2A 3NM7A 1VQL3 3MWZA 1LNHA 1TFKA 4XDVA 5CF2A 1UW1A 3T8NA 1QVG2 3LOYA 4X2HA 1W6YA 4FMCA 1YIJ3 2Y73A 2XFSA 3KE7A 3DGOA 1Z1SA 4N6LA 5AIFA 1Q864 2Z76A 1FGRA 2W03A 2GEYA 3X3YA 3KKGA 3B8LA 1L5GB 3CU3A 3FSDA 2WO0A 2LQVA 5AEUB 4FMBA 1NDOB 2WGOA 5ELUA 2W56B 3CXC2 4IIAA 1VQN3 5IG4A 3V99A 1IVVA 2W2CA 3GZRA 1K734 3CCM3 1SIIA 1WNHA 1UUVB 3I0YA 4PEJA 1YI23 3HK4A 4R4KA 1JB4A 2CHCA 5IENA 2ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FGO A;  3NM7 A;  3N8B A; 
#chains in the Genus database with same CATH topology
 1D6Z A;  1X1Y A;  5IF6 A;  5LC7 A;  3SOA A;  4O3V A;  2KF3 A;  3LML A;  4K1U A;  3AGN A;  5FGO A;  1GS3 A;  1BRN L;  2QA4 3;  3SOY A;  4QWT A;  2SAR A;  1RCK A;  3HII A;  4ORL A;  1SQW A;  1A2K A;  4RNZ A;  1LOW A;  2CFG A;  2ML5 A;  1LOY A;  1PY3 A;  3WMD A;  1NB5 I;  4J9A A;  4LMI A;  1BRK A;  2KF5 A;  2MC8 A;  1CYU A;  2PZV A;  3BNC A;  1IQY A;  1MGR A;  3LT8 A;  2D42 A;  3S27 A;  1GOY A;  2P05 A;  3KII A;  1V57 A;  1A90 A;  5HOH A;  2XF3 A;  2XSO B;  1TFO A;  1W01 A;  4HM8 B;  3OWU A;  1LXE A;  5CXO A;  3S5C A;  2OTL 3;  1JNQ A;  2CFK A;  3RNT A;  1OF5 A;  1Q9E A;  1IVU A;  2P0M A;  3MG3 A;  4HM1 B;  2HML B;  3HIG A;  1E3V A;  1IK3 A;  1S72 3;  2H0H A;  3Q2P A;  2B1X B;  4GSP A;  1TRQ A;  3UNL A;  1KD1 4;  2KCD A;  1MOL A;  3D4A A;  1VQK 3;  3OWY A;  1I0X A;  4CCV A;  3LH4 A;  5EVH A;  3S29 A;  1KQS 2;  1NWW A;  3FKA A;  1DMN A;  3HX8 A;  1EUI C;  1W02 A;  1JV2 B;  4RNY A;  1JBT A;  1IT8 A;  2CIU A;  2V1L A;  3GSP A;  5CLK A;  3X42 A;  3NBJ A;  1YJW 3;  1LOX A;  4H61 A;  1IDP A;  4TX4 A;  3RGA A;  1W6G A;  1FGO A;  1SJW A;  1W6C A;  4WYK B;  3QRD A;  1I8V A;  1F8N A;  1GOU A;  1O7N B;  2RSX A;  2WGQ A;  3NBB A;  3FG3 A;  3KFQ C;  5D81 A;  1BUQ A;  5IEP A;  4N6M A;  1BNG A;  3HZP A;  1YVB I;  1B2U A;  5BIR A;  3N9H A;  3D5G A;  3QK9 A;  2IUK A;  4DKI A;  3Q3F A;  4XBY A;  5FW5 A;  1KC8 4;  1FYS A;  2FGT A;  3DM8 A;  1QVF 2;  3NV0 A;  1DMQ A;  2XEP A;  1GMQ A;  4HM4 B;  1K9M 4;  3JUN A;  2H0G A;  1SIH A;  1GOV A;  3ZFZ A;  3E99 A;  2CG0 A;  6RNT A;  4HM6 B;  5CK6 A;  1O7W B;  5AII A;  1ZX2 A;  3URP A;  1UCI A;  1WTH A;  1W2Z A;  3DGY A;  1M90 4;  5TGN A;  1UUW B;  1ZO2 A;  1JN5 A;  3O8Y A;  3SYU A;  1AR0 A;  1FUW A;  1OH0 A;  4FCJ A;  4HBR A;  2FNQ A;  3D5I A;  4KFE A;  4N6N B;  4O2H A;  2HMK B;  3LZA A;  4GHO A;  2SBL A;  4AKY A;  1YIT 3;  1B2S A;  1EA2 A;  2STD A;  3KCH A;  1TJD A;  1E3R A;  2CK3 H;  1B27 A;  3F7X A;  1N8R 4;  2Q07 A;  2HMM B;  5G2G A;  1CQS A;  2YFJ B;  1N8Q A;  2ZL8 A;  3JUM A;  5AIH A;  2XR8 B;  1RNT A;  1RTU A;  3GZY B;  1G96 A;  2C11 A;  3I55 3;  1ASK A;  3G6E 3;  1A2P A;  1FA3 A;  3FG1 A;  3F14 A;  3CCS 3;  2BMQ B;  3PCS A;  3TDG A;  4MEI A;  1KWI A;  1VQ8 3;  1FW7 A;  1EKM A;  1A67 A;  3OWS A;  3AMO A;  3EN1 B;  1PYL A;  2IUJ A;  1YGE A;  2E2T A;  4FMD A;  4RZM A;  1O7G B;  3K7C A;  3EHC A;  2PNC A;  4N6T A;  4BU4 A;  3WA3 A;  5RNT A;  1BVI A;  2YFI B;  4EW5 A;  3NX0 A;  2E2U A;  3KZT A;  2GU1 A;  3PXM A;  3N54 B;  4OUQ A;  1I3F A;  3WDG B;  1CH0 A;  1OHP A;  1TIJ A;  2CWT A;  1D6U A;  4H3U A;  1VQ9 3;  3CPW 2;  1G0T A;  2XGN A;  3LTB A;  4EXR A;  3UL5 A;  2WOH A;  3ECF A;  5A0O B;  1RGG A;  3V92 A;  3CCL 3;  1LQG C;  1B21 A;  3UJM A;  1GYB A;  1B2M A;  4R80 A;  3B4P A;  2L1S A;  1RN7 A;  3MSO A;  3DMC A;  3DGL A;  2OWP A;  4HM2 B;  3WR2 A;  3WA2 X;  1Q82 4;  4BTX A;  5JBS A;  2W6J H;  3KN4 A;  3FGY A;  1OHO A;  4BTW A;  5BU4 A;  1RCL A;  1TU5 A;  2FXT A;  1IV9 A;  2CX1 A;  2BMO B;  2BT3 A;  2K0M A;  1JB2 A;  1N9E A;  2BO9 B;  3F40 A;  3X3Z A;  2UUG C;  3CD6 3;  1RRH A;  8RNT A;  1FGT A;  2A15 A;  1RNB A;  1TP6 A;  2OTJ 3;  1FUT A;  1RN1 A;  4MMX B;  3STD A;  3CC7 3;  1J2B A;  1RMS A;  1S5A A;  3ALA A;  3B4O A;  5IG5 A;  5EEO A;  1W4N A;  4STD A;  2K54 A;  1N5H A;  1UCL A;  1JKG A;  2B24 B;  4AEQ A;  3FH1 A;  1OHS A;  1V74 A;  3BLZ A;  5D82 A;  3IPT A;  2KRT A;  5STD A;  1QAF A;  4GB5 A;  3G4S 3;  4OK0 A;  1IQX A;  2RGQ A;  2Z7A A;  2XRX B;  3I56 3;  1W00 A;  2GSP A;  3MG1 A;  3ZG5 A;  3RDE A;  1ISK A;  2J8X B;  5AIG A;  1IU7 A;  3JUO A;  3CCQ 3;  5DRV A;  3FLJ A;  3K5T A;  3D79 A;  3T0U A;  1MWR A;  4L8O A;  2HMJ B;  3UL6 A;  3V98 A;  2L4V A;  3WOE B;  4FCZ A;  2JQ5 A;  3U97 A;  4BIR A;  1D6Y A;  3H3H A;  2QGU A;  1Q40 B;  3A5E A;  3SED A;  4EV5 A;  8CHO A;  5CF1 A;  1GY6 A;  3OX9 A;  2IY2 A;  1W7C A;  2ZDJ A;  4WWU C;  2AAE A;  1NO3 A;  4CPK A;  1X1U A;  3CCU 3;  1R4C A;  1M1K 4;  2MF7 A;  1DVD A;  1UI8 A;  5AYS C;  3EB8 A;  3WHO A;  1YJ9 3;  1Q7Y 4;  1NU3 A;  4XBT A;  1VQO 3;  4MJD A;  1W2B 2;  5JPU A;  1BIR A;  3K63 A;  3DH2 A;  3KSE D;  3DGM A;  2W56 A;  5G1K A;  1QAK A;  5M1A A;  2QIY A;  5G1L A;  1BRI A;  2CG1 A;  3OXA A;  3S67 A;  3LTA A;  1GMP A;  1MWS A;  3F9S A;  4WFO A;  5LC6 A;  4L8P A;  4KZ1 A;  1VQM 3;  5BVB A;  3A76 A;  3G71 3;  1JZD A;  3VSY A;  1O7P B;  1QMA A;  3JVC A;  1M1X B;  5IG0 A;  1Q81 4;  2W04 A;  4HM3 B;  4XM4 A;  1OGZ A;  5JPP A;  2F4Y A;  1RHL A;  4O8S A;  3G16 A;  2GXF A;  1BNI A;  2BHM A;  2OOV A;  2BMR B;  2H0I A;  1RGE A;  4N6U A;  1MWU A;  1GD4 A;  2CFW A;  3EBY A;  7STD A;  1BUJ A;  2GBW B;  4IT7 A;  1TTO A;  2CWV A;  2F5W A;  2Y74 A;  3CPO A;  1FGM A;  3CCE 3;  5IW9 A;  2GEX A;  1OGX A;  4J8T A;  1T5Y A;  3AHS A;  5DRE A;  2OQE A;  4R1K A;  1JRQ A;  1GSP A;  1W5Z A;  1DMM A;  3H51 A;  4R9K A;  4IPB A;  2BIR A;  2P0X A;  1RGH A;  4G1M B;  5KP1 A;  5AYR B;  1GY5 A;  3DUK A;  5ELJ A;  1LQM B;  3VGN A;  2KXG A;  3VF1 A;  4R9L A;  4N6V 0;  1O7M B;  3CCJ 3;  1PFP A;  1BRH A;  1KSI A;  3IJE B;  1PU4 A;  4FR9 A;  4HZ9 B;  1DET A;  3NUV A;  2M7O A;  1UDI I;  2RCD A;  1IV7 A;  3K0Z A;  3EX9 A;  4EC6 A;  3X40 A;  1I2F A;  1YHQ 3;  2YFL B;  1K28 A;  3CC2 3;  3CNX A;  4EV2 A;  3JUQ A;  2RNT A;  2CWU A;  1JJ2 2;  3PZW A;  1V58 A;  6GSP A;  1AVK A;  2BNG A;  1EG9 B;  2QEX 3;  3CME 3;  1N9J A;  6STD A;  1OF5 B;  4LZI A;  1DE3 A;  3X41 A;  3MG2 A;  4HYZ A;  5AEW B;  3EN8 A;  4FMA A;  1STD A;  2BU4 A;  4GL6 A;  1BOX A;  5AI1 A;  1WQL B;  1IQ8 A;  2HOH A;  2CW9 A;  4X2O A;  5I97 A;  1HKX A;  4WYK A;  1BSC A;  2GBX B;  3EQQ B;  3NHX A;  1GD3 A;  1JBS A;  1EQK A;  3CNM A;  2WOF A;  1M9G A;  1C7H A;  1WMP A;  3F7S A;  3JUP A;  3NBR A;  3Q1C A;  4N6O B;  4XDW A;  3CCR 3;  3G0K A;  1UUG B;  4JF8 A;  4ZM8 A;  3DXO A;  4NHF A;  1UGH I;  2O9U X;  5IEO A;  1FZU A;  5M19 A;  1B20 A;  1WMO A;  2Z77 A;  3PYJ A;  3Q90 A;  4BTY A;  3EJV A;  4WHA A;  1R4Y A;  2O3O A;  2CFL A;  3ER7 A;  1IVW A;  3EC9 A;  2XFT A;  4HAA A;  1BSE A;  3FF2 A;  2Z6B A;  1T3B A;  3MYT A;  2W9Q A;  3OW2 2;  2GU3 A;  4KFF A;  3F8X A;  2P38 A;  1VQ6 3;  1N5P A;  1A2V A;  7RNT A;  5KP4 A;  4NPB A;  1Q42 A;  1OUN A;  4BL2 A;  1E97 A;  4HM0 B;  3ROB A;  3FZW A;  4XBX A;  4HKV B;  1QAL A;  4BL3 A;  1VZZ A;  1OAC A;  3DZL A;  4CDL A;  3CCV 3;  1ULI B;  5GSP A;  2D1W A;  3G8Z A;  5KP3 A;  3NV0 B;  2CFD A;  1B3S A;  1YNV X;  3D9R A;  4KVH A;  1GY7 A;  2R4I A;  2JDI H;  3GZB A;  1BSD A;  3BND A;  3FCS B;  3X3X A;  4HM7 B;  3S28 A;  3CC4 3;  4OVM A;  1MNL A;  4EYC A;  1RN4 A;  2W0Q A;  4NRE A;  3B7C A;  3KSP A;  1O7H B;  3CMA 3;  1JN5 B;  3BNB A;  4AKZ A;  3GZX B;  3LYG A;  2F99 A;  5HGR A;  1FGQ A;  1I70 A;  1VQ4 3;  2W9P A;  3UB1 A;  2F56 A;  1CEW I;  1I0V A;  1BU4 A;  1FUS A;  1LRA A;  3OV4 A;  1I3I A;  4O02 B;  1IYY A;  1B2Z A;  3BIR A;  1RDS A;  1TUH A;  4FCM A;  1NJI 4;  2I9W A;  4KT3 B;  1LNI A;  1MGW A;  2E2V A;  3RGR A;  1SAR A;  4RNT A;  1BNR A;  4LGQ A;  2HMO B;  1ULJ B;  2XGL A;  3D3L A;  3FF0 A;  3MKI A;  3AGO A;  3AMO B;  1TRP A;  1I2G A;  1VQQ A;  2OOV C;  3BB9 A;  4Q53 A;  2UGI A;  3FG4 A;  3F8H A;  2AAD A;  3GAX A;  2K3D A;  4JRF A;  2F86 B;  1BAO A;  3BNE A;  3LXU X;  2C10 A;  1Y4K A;  1NB3 I;  2XH9 A;  1YJN 3;  1IVX A;  1RKY A;  3T8U A;  2OQE C;  1ROA A;  4EBG A;  2UX0 A;  1LOV A;  1X1X A;  1UCK A;  3M8C A;  4RBN A;  3SX1 A;  4HVN A;  3SXX A;  2OCT A;  1QJG A;  4WP5 A;  1CYV A;  1UI7 A;  1T2H A;  4J5G A;  4MMZ B;  4I5Q A;  1BNF A;  3PGB A;  3DY5 A;  4J5K A;  1STF I;  1YVS A;  4K61 A;  2IYJ A;  3LTC A;  1BRS A;  3MHE A;  3IMA B;  3GWR A;  1VQN 3;  3WOF B;  4KFD A;  1MWT A;  1RGC A;  2YX9 A;  3PS8 A;  2KF6 A;  7GSP A;  3NXJ A;  1VQ5 3;  4XB5 A;  1DVC A;  2P09 A;  3K9M C;  1JB5 A;  2F98 A;  1RSN A;  3HI7 A;  1UCJ A;  1AV4 A;  2IMJ A;  3DGN A;  5IER A;  3WOD G;  1HYF A;  1K8A 4;  4HM5 B;  5IG3 A;  3L0R A;  3J7Y d;  1B2X A;  1K41 A;  1RGL A;  1AVL A;  4HJL B;  4LSO A;  1HU9 A;  1WMN A;  3AHW A;  2INX A;  4LEH A;  4MMY B;  2LYX A;  1ROV A;  3PCR A;  1RGF A;  3EBT A;  2CKF B;  2RFR A;  2ZHX B;  3MPH A;  1BGS A;  3GRD A;  1RRL A;  2HMN B;  4K1V A;  4K90 B;  4N3V A;  3N8B A;  4U13 A;  3NQY A;  3SVA A;  4CJN A;  1SPU A;  1AY7 A;  2CC3 A;  3BU4 A;  2CH9 A;  2ZA4 A;  1VQP 3;  4HZB B;  1JKG B;  1VQ7 3;  3LT9 A;  5EQL A;  1OPY A;  1RGA A;  1Q7H A;  3EF8 A;  3LTD A;  2XSH B;  3NQZ A;  4L7K A;  1IT7 A;  1NNV A;  1US1 A;  1U5O A;  1LVN A;  1RJO A;  1OCV A;  1JBR A;  5D83 A;  1BSB A;  1Q40 A;  1DYU A;  1U8C B;  1BRG A;  3U1W A;  2IA7 A;  4I4K A;  2CX0 A;  3SLU A;  5BXQ A;  3EE1 A;  5M18 A;  3NM2 A;  3NM7 A;  1AQZ A;  1VQL 3;  3MWZ A;  1LNH A;  1BNJ A;  1TFK A;  4XDV A;  5CF2 A;  1UW1 A;  2F5M A;  3T8N A;  1QVG 2;  1BSA A;  3LOY A;  1RLS A;  9RNT A;  4X2H A;  1BNE A;  1T2I A;  1W6Y A;  4FMC A;  1YIJ 3;  2Y73 A;  2XFS A;  1BRJ A;  3KE7 A;  3DGO A;  1Z1S A;  1C54 A;  1ZGX A;  4N6L A;  5AIF A;  1Q86 4;  1BAN A;  2C4B A;  2Z76 A;  1FGR A;  2W03 A;  2GEY A;  1RGK A;  4ILF A;  2KAA A;  3X3Y A;  3KKG A;  3B8L A;  1L5G B;  3CU3 A;  3FSD A;  4LYL B;  2WO0 A;  2LQV A;  3ZG0 A;  1BNS A;  5AEU B;  4FMB A;  1GMR A;  1NDO B;  1UGI A;  1ZS7 A;  2KF4 A;  2WGO A;  5ELU A;  1YGW A;  2W56 B;  3CXC 2;  1X1W A;  1I2E A;  2R41 A;  4IIA A;  1EEJ A;  5IG4 A;  3V99 A;  1IVV A;  1G02 A;  2W2C A;  3GZR A;  3CCM 3;  3HOH A;  1K73 4;  1SII A;  1WNH A;  1UUV B;  3I0Y A;  1HZ1 A;  4PEJ A;  3HK4 A;  4R4K A;  1YI2 3;  1JB4 A;  1JZO A;  2CHC A;  4HOH A;  5IEN A;  2ML6 A;  2RBI A; 
#chains in the Genus database with same CATH homology
 1D6Z A;  5IF6 A;  5LC7 A;  3SOA A;  4O3V A;  3LML A;  4K1U A;  5FGO A;  1GS3 A;  2QA4 3;  3SOY A;  4QWT A;  3HII A;  3SX1 A;  4ORL A;  1SQW A;  1A2K A;  4RNZ A;  2CFG A;  2ML5 A;  3WMD A;  1NB5 I;  4J9A A;  4LMI A;  2MC8 A;  1CYU A;  2PZV A;  3BNC A;  1IQY A;  3LT8 A;  2D42 A;  3S27 A;  2P05 A;  3KII A;  1A90 A;  2XF3 A;  2XSO B;  1TFO A;  1W01 A;  4HM8 B;  3OWU A;  1LXE A;  5CXO A;  3S5C A;  2OTL 3;  1JNQ A;  2CFK A;  1OF5 A;  1IVU A;  2P0M A;  3MG3 A;  4HM1 B;  2HML B;  3HIG A;  1E3V A;  1IK3 A;  1S72 3;  3Q2P A;  2B1X B;  3UNL A;  1KD1 4;  2KCD A;  1MOL A;  1VQK 3;  3OWY A;  4CCV A;  3LH4 A;  5EVH A;  3S29 A;  1KQS 2;  1NWW A;  3FKA A;  1DMN A;  3HX8 A;  4RNY A;  1W02 A;  1JV2 B;  1IT8 A;  2CIU A;  2V1L A;  5CLK A;  3X42 A;  3NBJ A;  1YJW 3;  1LOX A;  4H61 A;  1IDP A;  4TX4 A;  3RGA A;  1W6G A;  1FGO A;  1SJW A;  1W6C A;  4WYK B;  3QRD A;  1F8N A;  2RSX A;  1O7N B;  3NBB A;  2WGQ A;  5D81 A;  3FG3 A;  3KFQ C;  1BUQ A;  5IEP A;  4N6M A;  3HZP A;  1YVB I;  3N9H A;  3QK9 A;  2IUK A;  4XBY A;  5FW5 A;  1KC8 4;  2FGT A;  3DM8 A;  1QVF 2;  3NV0 A;  1DMQ A;  2XEP A;  4HM4 B;  1K9M 4;  3JUN A;  1SIH A;  3E99 A;  2CG0 A;  4HM6 B;  5CK6 A;  1O7W B;  5AII A;  1ZX2 A;  1WTH A;  1W2Z A;  1M90 4;  5TGN A;  1UUW B;  1ZO2 A;  1JN5 A;  3O8Y A;  1AR0 A;  1FUW A;  1OH0 A;  4FCJ A;  4HBR A;  2FNQ A;  4KFE A;  4N6N B;  4O2H A;  2HMK B;  3LZA A;  2SBL A;  4AKY A;  1YIT 3;  1EA2 A;  2STD A;  1VQ9 3;  1N8R 4;  2CK3 H;  1E3R A;  3F7X A;  2Q07 A;  2HMM B;  5G2G A;  1CQS A;  2YFJ B;  1N8Q A;  2ZL8 A;  3JUM A;  5AIH A;  2XR8 B;  3GZY B;  1G96 A;  2C11 A;  3I55 3;  1ASK A;  3G6E 3;  1FA3 A;  3FG1 A;  3F14 A;  3CCS 3;  2BMQ B;  3PCS A;  3TDG A;  4MEI A;  1KWI A;  1VQ8 3;  1EKM A;  1A67 A;  3OWS A;  3AMO A;  3EN1 B;  2IUJ A;  1YGE A;  2E2T A;  4FMD A;  4RZM A;  1O7G B;  3K7C A;  3EHC A;  2PNC A;  4N6T A;  3WA3 A;  2YFI B;  3NX0 A;  2E2U A;  3KZT A;  2GU1 A;  3PXM A;  3N54 B;  4OUQ A;  3WDG B;  1OHP A;  1TIJ A;  2CWT A;  1D6U A;  4H3U A;  3CPW 2;  2XGN A;  3LTB A;  4EXR A;  3UL5 A;  2WOH A;  3ECF A;  5A0O B;  3V92 A;  3CCL 3;  3UJM A;  1GYB A;  4R80 A;  3B4P A;  1RN7 A;  3MSO A;  3DMC A;  3DGL A;  2OWP A;  4HM2 B;  1Q82 4;  3WA2 X;  4BTX A;  5JBS A;  2W6J H;  3KN4 A;  3FGY A;  1OHO A;  4BTW A;  1TU5 A;  2FXT A;  1IV9 A;  2BMO B;  2BT3 A;  2K0M A;  1JB2 A;  1N9E A;  2BO9 B;  3F40 A;  3X3Z A;  3CD6 3;  1RRH A;  1FGT A;  2A15 A;  2OTJ 3;  1TP6 A;  4MMX B;  3STD A;  3CC7 3;  1J2B A;  3B4O A;  1S5A A;  3ALA A;  5IG5 A;  5EEO A;  1W4N A;  4STD A;  2K54 A;  1N5H A;  1JKG A;  2B24 B;  4AEQ A;  3FH1 A;  1OHS A;  1V74 A;  3BLZ A;  5D82 A;  3IPT A;  2KRT A;  5STD A;  1QAF A;  4GB5 A;  3G4S 3;  4OK0 A;  1IQX A;  2RGQ A;  2Z7A A;  2XRX B;  3I56 3;  1W00 A;  3MG1 A;  1ISK A;  3RDE A;  5AIG A;  1IU7 A;  3JUO A;  3CCQ 3;  5DRV A;  3FLJ A;  3K5T A;  3T0U A;  4L8O A;  2HMJ B;  3UL6 A;  3V98 A;  2L4V A;  3WOE B;  4FCZ A;  2JQ5 A;  3U97 A;  1D6Y A;  3H3H A;  2QGU A;  1Q40 B;  3SED A;  4EV5 A;  8CHO A;  5CF1 A;  1GY6 A;  3OX9 A;  1W7C A;  2ZDJ A;  4WWU C;  1NO3 A;  3CCU 3;  1R4C A;  1M1K 4;  2MF7 A;  1DVD A;  1UI8 A;  5AYS C;  3EB8 A;  1YJ9 3;  1Q7Y 4;  1NU3 A;  4XBT A;  1VQO 3;  4MJD A;  1W2B 2;  5JPU A;  3K63 A;  3KSE D;  3DGM A;  2W56 A;  1QAK A;  2QIY A;  2CG1 A;  3S67 A;  3OXA A;  3LTA A;  3F9S A;  4WFO A;  5LC6 A;  4L8P A;  4KZ1 A;  1VQM 3;  5BVB A;  3A76 A;  3G71 3;  3VSY A;  1O7P B;  1QMA A;  3JVC A;  1M1X B;  5IG0 A;  1Q81 4;  2W04 A;  4HM3 B;  4XM4 A;  1OGZ A;  5JPP A;  4O8S A;  3G16 A;  2GXF A;  2BHM A;  2OOV A;  2BMR B;  4N6U A;  1GD4 A;  2CFW A;  3EBY A;  7STD A;  2GBW B;  4IT7 A;  2CWV A;  2Y74 A;  3CPO A;  1FGM A;  3CCE 3;  5IW9 A;  2GEX A;  1OGX A;  4J8T A;  1T5Y A;  5DRE A;  2OQE A;  4R1K A;  1JRQ A;  4R9K A;  1W5Z A;  1DMM A;  3H51 A;  5KP1 A;  4IPB A;  2P0X A;  4G1M B;  5AYR B;  1GY5 A;  3DUK A;  5ELJ A;  3VGN A;  2KXG A;  3VF1 A;  4R9L A;  4N6V 0;  1O7M B;  3CCJ 3;  1PFP A;  1KSI A;  3IJE B;  1PU4 A;  4FR9 A;  4HZ9 B;  3NUV A;  2M7O A;  2RCD A;  1IV7 A;  3K0Z A;  3EX9 A;  4EC6 A;  3X40 A;  1YHQ 3;  2YFL B;  1K28 A;  3CC2 3;  3CNX A;  4EV2 A;  3JUQ A;  2CWU A;  1JJ2 2;  3PZW A;  1AVK A;  2BNG A;  1EG9 B;  2QEX 3;  3CME 3;  1N9J A;  6STD A;  1OF5 B;  4LZI A;  3X41 A;  3MG2 A;  4HYZ A;  5AEW B;  3EN8 A;  4FMA A;  1STD A;  4GL6 A;  5AI1 A;  1WQL B;  1IQ8 A;  2CW9 A;  4X2O A;  5I97 A;  1HKX A;  4WYK A;  2GBX B;  3EQQ B;  3NHX A;  1GD3 A;  1EQK A;  3CNM A;  2WOF A;  1M9G A;  1C7H A;  1WMP A;  3F7S A;  3JUP A;  3NBR A;  3Q1C A;  4N6O B;  4XDW A;  3CCR 3;  3G0K A;  4JF8 A;  4ZM8 A;  3DXO A;  4NHF A;  2O9U X;  5IEO A;  2Z77 A;  1WMO A;  3PYJ A;  3Q90 A;  4BTY A;  3EJV A;  4WHA A;  2O3O A;  2CFL A;  3ER7 A;  1IVW A;  3EC9 A;  2XFT A;  3FF2 A;  2Z6B A;  3MYT A;  2W9Q A;  3OW2 2;  2GU3 A;  4KFF A;  3F8X A;  2P38 A;  1VQ6 3;  1N5P A;  1A2V A;  5KP4 A;  1Q42 A;  1OUN A;  1E97 A;  4HM0 B;  3ROB A;  3FZW A;  4XBX A;  4HKV B;  1QAL A;  1VZZ A;  1OAC A;  3DZL A;  4CDL A;  3CCV 3;  1ULI B;  2D1W A;  3G8Z A;  5KP3 A;  3NV0 B;  2CFD A;  3D9R A;  4KVH A;  1GY7 A;  2R4I A;  2JDI H;  3GZB A;  3BND A;  3FCS B;  3X3X A;  4HM7 B;  3S28 A;  3CC4 3;  4OVM A;  1MNL A;  4EYC A;  2W0Q A;  4NRE A;  3B7C A;  3KSP A;  1O7H B;  3CMA 3;  1JN5 B;  3BNB A;  4AKZ A;  3GZX B;  3LYG A;  2F99 A;  5HGR A;  1FGQ A;  1VQ4 3;  2W9P A;  3UB1 A;  1CEW I;  3OV4 A;  4O02 B;  1TUH A;  4FCM A;  1NJI 4;  2I9W A;  2E2V A;  3RGR A;  4LGQ A;  2HMO B;  1ULJ B;  2XGL A;  3D3L A;  3FF0 A;  3MKI A;  3AMO B;  2OOV C;  3BB9 A;  4Q53 A;  3FG4 A;  3F8H A;  3GAX A;  4JRF A;  2F86 B;  3BNE A;  3LXU X;  2C10 A;  1Y4K A;  1NB3 I;  2XH9 A;  1YJN 3;  1IVX A;  1RKY A;  3T8U A;  2OQE C;  1ROA A;  4EBG A;  2UX0 A;  3M8C A;  4RBN A;  3SXX A;  4HVN A;  2OCT A;  1QJG A;  4WP5 A;  1CYV A;  1UI7 A;  4MMZ B;  3PGB A;  3DY5 A;  1STF I;  4K61 A;  3LTC A;  3MHE A;  3IMA B;  3GWR A;  3WOF B;  4KFD A;  2YX9 A;  3PS8 A;  3NXJ A;  1VQ5 3;  4XB5 A;  1DVC A;  2P09 A;  3K9M C;  1JB5 A;  2F98 A;  3HI7 A;  1AV4 A;  2IMJ A;  3DGN A;  5IER A;  3WOD G;  1K8A 4;  4HM5 B;  5IG3 A;  3L0R A;  3J7Y d;  1K41 A;  4HJL B;  1AVL A;  4LSO A;  1HU9 A;  1WMN A;  2INX A;  4LEH A;  4MMY B;  2LYX A;  1ROV A;  3PCR A;  3EBT A;  2CKF B;  2RFR A;  3MPH A;  3GRD A;  1RRL A;  2HMN B;  4K1V A;  4K90 B;  4N3V A;  3N8B A;  4U13 A;  3NQY A;  3SVA A;  1SPU A;  2CC3 A;  2CH9 A;  1VQP 3;  4HZB B;  1JKG B;  1VQ7 3;  3LT9 A;  5EQL A;  1OPY A;  3EF8 A;  3LTD A;  2XSH B;  3NQZ A;  4L7K A;  1IT7 A;  1US1 A;  1U5O A;  1LVN A;  1RJO A;  1OCV A;  5D83 A;  1Q40 A;  1DYU A;  1U8C B;  3U1W A;  2IA7 A;  4I4K A;  3SLU A;  5BXQ A;  3EE1 A;  3NM2 A;  3NM7 A;  1VQL 3;  3MWZ A;  1LNH A;  1TFK A;  4XDV A;  5CF2 A;  1UW1 A;  3T8N A;  1QVG 2;  3LOY A;  4X2H A;  1W6Y A;  4FMC A;  1YIJ 3;  2Y73 A;  2XFS A;  3KE7 A;  3DGO A;  1Z1S A;  4N6L A;  5AIF A;  1Q86 4;  2Z76 A;  1FGR A;  2W03 A;  2GEY A;  3X3Y A;  3KKG A;  3B8L A;  1L5G B;  3CU3 A;  3FSD A;  2WO0 A;  2LQV A;  5AEU B;  4FMB A;  1NDO B;  2WGO A;  5ELU A;  2W56 B;  3CXC 2;  4IIA A;  1VQN 3;  5IG4 A;  3V99 A;  1IVV A;  2W2C A;  3GZR A;  1K73 4;  3CCM 3;  1SII A;  1WNH A;  1UUV B;  3I0Y A;  4PEJ A;  1YI2 3;  3HK4 A;  4R4K A;  1JB4 A;  2CHC A;  5IEN A;  2ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...