3N8BA

Crystal structure of borrelia burgdorferi pur-alpha
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
75
structure length
75
Chain Sequence
ERGEVYSEKMFTESERTYFMNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENMNEFESNLLKAIAVIKQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Of bits and bugs--on the use of bioinformatics and a bacterial crystal structure to solve a eukaryotic repeat-protein structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Nucleic acid binding protein
molecule keywords Uncharacterized protein
total genus 14
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.700 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3n8bA00
5FGOA 3NM7A 3N8BA
chains in the Genus database with same CATH superfamily
2IUKA 2AAEA 1BGSA 3CPW2 1JRQA 3FH1A 2ZA4A 3WMDA 2W9QA 4N6NB 1DVCA 3EF8A 1E3RA 4KT3B 1FGRA 3URPA 1Q814 1RNTA 3MG1A 3T0UA 1Q864 4XM4A 2F99A 5AEUB 1YIJ3 1KD14 1Q40B 3N54B 3WOEB 5JPUA 3Q1CA 1RNBA 3AGOA 2Y74A 4FCMA 1FGQA 5KP4A 2Z76A 1KSIA 2KF6A 1BRGA 1N8QA 2IA7A 3D79A 3LXUX 3OWSA 1ROVA 4K61A 1OHSA 3OXAA 2R41A 2KF4A 2BIRA 4ZM8A 1U8CB 6STDA 1B2MA 2OOVC 1MWTA 1RHLA 4NPBA 3CCQ3 2IUJA 1BRHA 3MHEA 1GOYA 4CJNA 1YJW3 3FF0A 2C4BA 2GXFA 1AVLA 1LNIA 4HM6B 1W00A 3ECFA 1DETA 2CW9A 4KZ1A 1FGTA 3GZYB 5I97A 3CCS3 1O7MB 2O3OA 3TDGA 1I0VA 2WGQA 5IG0A 3WOFB 3SEDA 1GMRA 1MWUA 2PZVA 5LC7A 2IY2A 3DH2A 3NQZA 1AQZA 2P0MA 1LQGC 3G8ZA 4J9AA 4WFOA 1J2BA 3KCHA 3DGNA 3KZTA 1PY3A 2BU4A 3FCSB 4J5KA 3X3YA 1MWRA 3BB9A 3D3LA 2OWPA 2LQVA 4NHFA 1CH0A 1ULIB 2O9UX 1G96A 4N6LA 1A2KA 2WO0A 4RNZA 3EB8A 4BU4A 2CFLA 3HIGA 3L0RA 5AIFA 1EG9B 1RGHA 2CC3A 4HM0B 2KRTA 4PEJA 3X42A 5IG3A 1O7HB 3ZG5A 3F8HA 3GWRA 2RBIA 3X3ZA 1W2B2 1X1UA 3EBYA 4HBRA 1GMPA 1NWWA 1NO3A 4JRFA 4DKIA 4HZBB 5D82A 3WR2A 3CCR3 6RNTA 5AYRB 1ULJB 2D42A 1JB2A 1LVNA 1UGIA 3G6E3 3LOYA 1VQ43 2XFTA 3PGBA 2RNTA 2W9PA 3BNDA 1N5HA 1R4CA 5G1KA 5IENA 3F40A 1BSEA 7RNTA 4FMCA 4MJDA 3LMLA 2QEX3 1VQ83 3B4PA 3FKAA 3M8CA 4HJLB 2ML5A 4WP5A 3UNLA 4EYCA 1BUQA 1K9M4 5CXOA 1K28A 1SQWA 3CCU3 1IV9A 1UW1A 1OHOA 2E2TA 3SOYA 4L7KA 1JKGB 5M19A 2L4VA 3F8XA 3S5CA 5IERA 3BLZA 3BNCA 5JPPA 1IVXA 2C10A 3AGNA 2OCTA 3BU4A 3Q2PA 4XBTA 1RGGA 2W03A 1RDSA 2WOHA 5AYSC 1RGKA 2L1SA 1LOYA 5HOHA 1YHQ3 2CG1A 1YJN3 4LSOA 2D1WA 4WYKA 3KN4A 3CC73 2GU1A 3NX0A 3VSYA 1WNHA 3LZAA 4IPBA 1MNLA 4HZ9B 4BTWA 2ZDJA 5HGRA 4FCZA 1VZZA 2F98A 2XSOB 3NV0B 4JF8A 3S27A 5IW9A 1BRIA 4HM5B 3DGYA 1IDPA 3MYTA 1IK3A 4BIRA 1VQK3 1BAOA 4Q53A 2B1XB 1I2EA 2KCDA 2UX0A 4U13A 3UL5A 1OACA 2W6JH 1BRJA 1SJWA 4FCJA 4ILFA 1Q824 5IEPA 4WWUC 4XB5A 1LQMB 1B27A 2QIYA 1V74A 1UI7A 2HMLB 2OTL3 1RLSA 1JB5A 1EUIC 4X2OA 4XBXA 3MG3A 1K734 1I3IA 1VQ73 1FUSA 3WODG 2JQ5A 4EC6A 3EX9A 3F9SA 4EW5A 1GS3A 4GL6A 1UUGB 2CIUA 3HZPA 4LGQA 4STDA 3DGMA 1LNHA 1A2PA 3CME3 2LYXA 2UGIA 1NB3I 3U1WA 3EE1A 3RDEA 3SVAA 3Q3FA 3I553 3DMCA 1RCKA 2B24B 3PZWA 2CK3H 2HOHA 1RMSA 1TFOA 2XH9A 1Q7HA 2YFLB 1B21A 3JUMA 4OVMA 2KF3A 1IVWA 3S28A 1OH0A 1W6GA 2GBWB 3G16A 3JUNA 4O8SA 1X1YA 2CWUA 4TX4A 2MC8A 1JB4A 3N8BA 3JVCA 1LOWA 3F7SA 9RNTA 1BRKA 4EV5A 3T8UA 1RCLA 1V57A 2HMJB 5FW5A 1LOXA 3K7CA 3CU3A 1IU7A 4GSPA 1STDA 2P09A 2UUGC 5ELUA 3WHOA 2CFWA 1UDII 2YFIB 4HM7B 4R1KA 5BIRA 2MF7A 2GBXB 1FYSA 4WYKB 1NB5I 3UL6A 1W6CA 1I70A 3CC43 3JUOA 3I563 3IMAB 3EBTA 7STDA 1STFI 2R4IA 2F56A 3IPTA 1FGOA 1GSPA 2XR8B 5TGNA 1VQM3 4LMIA 3EJVA 3CCM3 4K1VA 2STDA 4CDLA 2PNCA 3D4AA 1RJOA 2BT3A 1UGHI 3QK9A 4BL3A 3RGRA 1FGMA 2CFKA 1BNJA 1B20A 3WDGB 1WTHA 1A2VA 2W2CA 3K0ZA 2KAAA 1DMMA 1BU4A 1W2ZA 2GEYA 2XSHB 4N6MA 2Z77A 3DGLA 5AI1A 1I0XA 1UUVB 3MPHA 3PS8A 1Q40A 3GZBA 1TTOA 4OK0A 4R4KA 4NREA 5KP1A 1B2XA 1OCVA 3CPOA 1VQ63 3X40A 4HM2B 1HYFA 2INXA 3AHSA 2OQEA 2RGQA 1LRAA 3JUQA 1M1K4 3FGYA 4H3UA 5IG5A 1ROAA 1I2GA 3ZFZA 1ASKA 3PXMA 1C7HA 3FG3A 5AIGA 4EV2A 3E99A 4L8PA 3CXC2 1W6YA 2GU3A 3GRDA 1ZGXA 5CLKA 2CFDA 1OPYA 1BSAA 1UCIA 1JBTA 3A5EA 1TP6A 1YI23 2YFJB 1YGWA 3EN1B 3NXJA 1HU9A 1VQO3 1RGAA 1DMNA 4HM3B 1IYYA 1EEJA 1IT7A 1FUWA 2CX0A 2RCDA 3KKGA 1FZUA 1NDOB 4BTXA 1OGXA 5EVHA 1X1XA 3HOHA 4HM1B 3FG1A 3KIIA 4N6V0 2QA43 3ROBA 5JBSA 1ZO2A 4KFEA 1BOXA 1UUWB 1F8NA 1OF5B 1PFPA 2FNQA 1W02A 1O7NB 3VGNA 1G02A 4HOHA 1DVDA 1I3FA 3EN8A 1A90A 1B2UA 5IEOA 1HKXA 4AKZA 1NU3A 3K9MC 3X41A 3N9HA 1O7GB 4BL2A 2F5MA 2CKFB 1JN5A 2I9WA 1AY7A 1HZ1A 1AR0A 1O7WB 3DXOA 1BANA 2KXGA 4L8OA 1TUHA 1BNRA 1SARA 1AV4A 1TRPA 4H61A 2H0IA 1EA2A 2F5WA 3RNTA 1OHPA 2RFRA 2W56B 2XGNA 5IF6A 4XBYA 1MGRA 3MSOA 1ZS7A 4KFFA 1W7CA 1BSCA 3CC23 1RTUA 2XEPA 4I5QA 3OW22 1QJGA 3CCV3 1Z1SA 3FSDA 4N6TA 5A0OB 3NBJA 1UI8A 1I8VA 4BTYA 1WQLB 1JJ22 1LXEA 5IG4A 1B2SA 2W0QA 2CH9A 1RN4A 1GY7A 5DREA 2E2VA 1SIHA 3U97A 2A15A 1BSBA 1QAKA 1YVBI 1GD3A 3BNEA 1KWIA 2IYJA 1BVIA 2FGTA 3LT8A 4G1MB 3S67A 3OX9A 2WOFA 1BIRA 4KVHA 2HMOB 3BIRA 3ER7A 2XRXB 1LOVA 1C54A 1RN1A 4KFDA 1FUTA 4R9KA 4HAAA 1QALA 3LYGA 4MMXB 3NBRA 4K1UA 3PCRA 4RBNA 3NHXA 2CHCA 3X3XA 1CQSA 4MMZB 5CK6A 1U5OA 3LTDA 1PYLA 1BRSA 3J7Yd 1SIIA 2H0HA 2Z7AA 2ZL8A 5BXQA 1IQXA 1YNVX 3PYJA 3SLUA 1RGEA 1IT8A 4O2HA 4XDVA 5M1AA 1AVKA 4N3VA 1MGWA 5STDA 3RGAA 1W4NA 5G1LA 3F14A 3FG4A 2QGUA 4R9LA 3G713 1K8A4 1QVF2 4N6UA 3D9RA 4EXRA 4CCVA 1K41A 3GSPA 5G2GA 2YX9A 1RN7A 5KP3A 1VQL3 2HMKB 1BNIA 1RGFA 1T2IA 4IIAA 3H3HA 2HMNB 5BVBA 1BNEA 1VQ53 3B8LA 3CNMA 1DE3A 4R80A 1TU5A 4FMDA 3CNXA 1PU4A 3BNBA 1BNGA 3DM8A 3OWUA 4O3VA 5FGOA 3UJMA 3ZG0A 1FW7A 1GMQA 3DUKA 1Q9EA 2W56A 1B3SA 1TFKA 3AHWA 2ZHXB 1N8R4 4FMBA 3STDA 3NBBA 4LYLB 3SXXA 4RNTA 1BRNL 3FF2A 4HYZA 1IV7A 3Q90A 1N9EA 1UCLA 3KFQC 3H51A 2W04A 5CF2A 3CCE3 1S5AA 1YVSA 5GSPA 3WA3A 4ORLA 1BSDA 2BHMA 2P0XA 4X2HA 2IMJA 1GD4A 2K54A 5LC6A 3CCL3 2XF3A 1KC84 4I4KA 1D6UA 3LH4A 2F86B 1NNVA 3K5TA 4J8TA 2H0GA 1JZOA 1X1WA 5D81A 3G0KA 2CX1A 1E97A 3V92A 2RSXA 1M904 4CPKA 5CF1A 1UCJA 2BMRB 4HKVB 2AADA 4O02B 3SYUA 4FMAA 1VQ93 1N5PA 1R4YA 4XDWA 1TRQA 2KF5A 2SARA 2Y73A 3FZWA 1US1A 3B4OA 4GHOA 1YJ93 3MKIA 3QRDA 3DY5A 3KE7A 1O7PB 1G0TA 2K0MA 3A76A 1OF5A 5AIIA 3GZRA 1TJDA 1Y4KA 3KSED 2HMMB 8CHOA 3T8NA 1D6ZA 1RRLA 3CMA3 1WMOA 1FA3A 2F4YA 1S723 1NJI4 1EKMA 1A67A 1MWSA 4LEHA 1CYVA 1GOVA 4GB5A 1UCKA 2C11A 4HM4B 1GYBA 3F7XA 4J5GA 1OGZA 2JDIH 4WHAA 5DRVA 3NUVA 8RNTA 3EHCA 4AKYA 7GSPA 1EQKA 1SPUA 1IQYA 1YGEA 2Q07A 3FLJA 6GSPA 1B2ZA 3NQYA 3CCJ3 3D5IA 1JBRA 3MWZA 1RRHA 1T5YA 3DGOA 2P05A 4K90B 1W01A 1VQN3 2XFSA 3LT9A 1DMQA 1GY5A 1T2HA 3O8YA 2BMQB 1M9GA 2ML6A 1QVG2 1JZDA 2M7OA 3LTBA 5EEOA 5BU4A 3MG2A 1BNSA 4HM8B 3ALAA 2CWTA 3IJEB 3LTCA 3G4S3 5AEWB 3S29A 2GSPA 1IQ8A 2FXTA 2XGLA 3PCSA 1JN5B 1I2FA 1IVVA 2K3DA 3B7CA 3GZXB 3NV0A 5EQLA 5D83A 3EC9A 3HI7A 4QWTA 3V98A 4LZIA 5RNTA 1CYUA 3AMOA 4RZMA 2OOVA 1ZX2A 2OQEC 4IT7A 1ISKA 1RGLA 5AIHA 3SOAA 2BO9B 1KQS2 3NM7A 1JNQA 1RKYA 1JV2B 3EQQB 3HIIA 1TIJA 1RGCA 3I0YA 3OV4A 4FR9A 2BMOB 3AMOB 2CFGA 1QMAA 1W5ZA 3WA2X 1QAFA 3D5GA 5ELJA 1V58A 3VF1A 3GAXA 4RNYA 1CEWI 2CG0A 3NM2A 3HX8A 4AEQA 3JUPA 1JBSA 2E2UA 5M18A 4MEIA 1N9JA 3KSPA 1IVUA 3V99A 1JKGA 1Q7Y4 2WGOA 1MOLA 1WMPA 3LTAA 4OUQA 2J8XB 1RSNA 1M1XB 2BNGA 2SBLA 3DZLA 4MMYB 3K63A 2GEXA 1D6YA 3HK4A 1VQQA 1BUJA 1OUNA 1WMNA 1YIT3 1GOUA 4N6OB 1BNFA 1E3VA 1L5GB 1Q42A 2P38A 4HVNA 3UB1A 2V1LA 2CWVA 4EBGA 3OWYA 1GY6A 2Z6BA 3SX1A 1VQP3 3CD63 1DYUA 2OTJ3 1T3BA
chains in the Genus database with same CATH topology
2IUKA 3CPW2 1JRQA 3FH1A 3WMDA 2W9QA 4N6NB 1DVCA 3EF8A 1E3RA 1FGRA 1Q814 3MG1A 3T0UA 1Q864 4XM4A 2F99A 5AEUB 1YIJ3 1KD14 1Q40B 3N54B 3WOEB 5JPUA 3Q1CA 2Y74A 4FCMA 1FGQA 5KP4A 2Z76A 1KSIA 3LXUX 1N8QA 2IA7A 3OWSA 1ROVA 4K61A 1OHSA 3OXAA 4ZM8A 1U8CB 6STDA 2OOVC 3CCQ3 2IUJA 3MHEA 1YJW3 3FF0A 2GXFA 1AVLA 4HM6B 1W00A 3ECFA 4KZ1A 2CW9A 1FGTA 3GZYB 5I97A 3CCS3 1O7MB 2O3OA 3TDGA 2WGQA 5IG0A 3WOFB 3SEDA 2PZVA 5LC7A 3NQZA 4WFOA 2P0MA 3G8ZA 4J9AA 1J2BA 3DGNA 3KZTA 3FCSB 3X3YA 3BB9A 3D3LA 2OWPA 2LQVA 4NHFA 1ULIB 2O9UX 1G96A 4N6LA 1A2KA 2WO0A 4RNZA 3EB8A 2CFLA 3HIGA 3L0RA 5AIFA 1EG9B 2CC3A 4HM0B 2KRTA 4PEJA 3X42A 5IG3A 1O7HB 3F8HA 3GWRA 3X3ZA 1W2B2 3EBYA 4HBRA 1NWWA 1NO3A 4JRFA 4HZBB 5D82A 3CCR3 5AYRB 1ULJB 2D42A 1JB2A 1LVNA 3G6E3 3LOYA 1VQ43 2XFTA 3PGBA 2W9PA 3BNDA 1N5HA 1R4CA 5IENA 3F40A 4FMCA 4MJDA 3LMLA 2QEX3 1VQ83 3B4PA 3FKAA 3M8CA 4HJLB 2ML5A 4WP5A 3UNLA 4EYCA 1BUQA 1K9M4 5CXOA 1K28A 1SQWA 3CCU3 1IV9A 1UW1A 1OHOA 2E2TA 3SOYA 4L7KA 1JKGB 2L4VA 3F8XA 3S5CA 5IERA 3BLZA 3BNCA 5JPPA 1IVXA 2C10A 4XBTA 2OCTA 3Q2PA 2W03A 5AYSC 2WOHA 1YHQ3 2CG1A 1YJN3 4LSOA 2D1WA 4WYKA 3KN4A 3CC73 2GU1A 3NX0A 3VSYA 1WNHA 3LZAA 4IPBA 1MNLA 4HZ9B 4BTWA 2ZDJA 5HGRA 4FCZA 1VZZA 2F98A 2XSOB 3NV0B 4JF8A 3S27A 5IW9A 4HM5B 1IDPA 3MYTA 1IK3A 1VQK3 4Q53A 4U13A 2B1XB 2KCDA 2UX0A 3UL5A 1OACA 2W6JH 1SJWA 4FCJA 1Q824 5IEPA 4WWUC 4XB5A 2QIYA 1V74A 1UI7A 2HMLB 2OTL3 1JB5A 4X2OA 4XBXA 3MG3A 1K734 1VQ73 3WODG 2JQ5A 4EC6A 3EX9A 3F9SA 1GS3A 4GL6A 4STDA 2CIUA 3HZPA 4LGQA 3DGMA 1LNHA 3CME3 2LYXA 1NB3I 3U1WA 3EE1A 3RDEA 3SVAA 3I553 3DMCA 2B24B 3PZWA 2CK3H 1TFOA 2XH9A 2YFLB 3JUMA 4OVMA 1IVWA 3S28A 1OH0A 1W6GA 2GBWB 3G16A 3JUNA 4O8SA 2CWUA 4TX4A 2MC8A 1JB4A 3N8BA 3JVCA 3F7SA 4EV5A 3T8UA 2HMJB 5FW5A 1LOXA 3K7CA 3CU3A 1IU7A 1STDA 2P09A 5ELUA 2CFWA 2YFIB 4HM7B 4R1KA 2MF7A 2GBXB 4WYKB 1NB5I 3UL6A 1W6CA 3CC43 3JUOA 3I563 3IMAB 3EBTA 1DYUA 7STDA 1STFI 2R4IA 3IPTA 1FGOA 2XR8B 5TGNA 1VQM3 4LMIA 3EJVA 3CCM3 4K1VA 2STDA 4CDLA 2PNCA 1RJOA 2BT3A 3QK9A 1FGMA 2CFKA 3WDGB 1WTHA 1A2VA 2W2CA 3K0ZA 1DMMA 1W2ZA 2GEYA 2XSHB 4N6MA 2Z77A 3DGLA 5AI1A 1UUVB 3PS8A 3MPHA 5KP1A 1Q40A 3GZBA 4OK0A 4R4KA 4NREA 1OCVA 3CPOA 1VQ63 3X40A 4HM2B 2INXA 2OQEA 2RGQA 3JUQA 1M1K4 3FGYA 4H3UA 5IG5A 1ROAA 1ASKA 3PXMA 1C7HA 3FG3A 5AIGA 4EV2A 3E99A 4L8PA 3CXC2 1W6YA 2GU3A 3GRDA 5CLKA 2CFDA 1OPYA 1TP6A 1YI23 2YFJB 3NXJA 3EN1B 1HU9A 1VQO3 1DMNA 4HM3B 1FUWA 1IT7A 2RCDA 3KKGA 1NDOB 4BTXA 1OGXA 5EVHA 4HM1B 3FG1A 3KIIA 4N6V0 2QA43 3ROBA 5JBSA 1ZO2A 4KFEA 1UUWB 1F8NA 1OF5B 1PFPA 2FNQA 1W02A 1O7NB 3VGNA 1DVDA 3EN8A 1A90A 5IEOA 1HKXA 4AKZA 1NU3A 3K9MC 3X41A 3N9HA 1O7GB 2CKFB 1JN5A 2I9WA 1AR0A 1O7WB 3DXOA 2KXGA 4L8OA 1TUHA 1AV4A 4H61A 1EA2A 1OHPA 2RFRA 2W56B 2XGNA 5IF6A 4XBYA 3MSOA 4KFFA 1W7CA 3CC23 2XEPA 3OW22 1QJGA 3CCV3 1Z1SA 3FSDA 4N6TA 5A0OB 3NBJA 1UI8A 4BTYA 1WQLB 1JJ22 1LXEA 5IG4A 2W0QA 2CH9A 1GY7A 5DREA 2E2VA 1SIHA 3U97A 2A15A 1QAKA 1YVBI 1GD3A 3BNEA 1KWIA 3LT8A 2FGTA 4G1MB 3S67A 3OX9A 2WOFA 4KVHA 2HMOB 3ER7A 2XRXB 4KFDA 4R9KA 1QALA 3LYGA 4MMXB 3NBRA 4K1UA 3PCRA 4RBNA 3NHXA 2CHCA 3X3XA 1CQSA 4MMZB 5CK6A 1U5OA 3LTDA 3J7Yd 1SIIA 2Z7AA 2ZL8A 5BXQA 1IQXA 3PYJA 3SLUA 1IT8A 4O2HA 4XDVA 1AVKA 4N3VA 5STDA 3RGAA 1W4NA 3F14A 3FG4A 2QGUA 4R9LA 3G713 1K8A4 1QVF2 4N6UA 3D9RA 4EXRA 4CCVA 1K41A 5G2GA 1VQL3 2YX9A 1RN7A 5KP3A 2HMKB 4IIAA 3H3HA 2HMNB 5BVBA 1VQ53 3B8LA 3CNMA 4R80A 1TU5A 4FMDA 3CNXA 1PU4A 3BNBA 4O3VA 3DM8A 3OWUA 5FGOA 3UJMA 3DUKA 2W56A 1TFKA 1N8R4 4FMBA 3STDA 3NBBA 3SXXA 3FF2A 4HYZA 1IV7A 3Q90A 1N9EA 3KFQC 3H51A 2W04A 5CF2A 3CCE3 1S5AA 3WA3A 4ORLA 2BHMA 2P0XA 4X2HA 2IMJA 1GD4A 2K54A 5LC6A 3CCL3 2XF3A 1KC84 4I4KA 1D6UA 3LH4A 2F86B 3K5TA 4J8TA 5D81A 3G0KA 1E97A 3V92A 1M904 5CF1A 2BMRB 4HKVB 4O02B 4FMAA 1VQ93 1N5PA 4XDWA 2Y73A 3FZWA 1US1A 3B4OA 1YJ93 3MKIA 3QRDA 3DY5A 3KE7A 1O7PB 2K0MA 3A76A 1OF5A 5AIIA 3GZRA 1Y4KA 3KSED 2HMMB 8CHOA 3T8NA 1D6ZA 1RRLA 3CMA3 1WMOA 1FA3A 1NJI4 1S723 1A67A 1EKMA 4LEHA 1CYVA 4GB5A 2C11A 4HM4B 1GYBA 3F7XA 1OGZA 2JDIH 4WHAA 5DRVA 3NUVA 3EHCA 4AKYA 1EQKA 1SPUA 1IQYA 1YGEA 2Q07A 3FLJA 3NQYA 3CCJ3 3MWZA 1RRHA 1T5YA 3DGOA 2P05A 4K90B 1W01A 1VQN3 2XFSA 3LT9A 1DMQA 1GY5A 3O8YA 2BMQB 1M9GA 2ML6A 1QVG2 2M7OA 3LTBA 5EEOA 3MG2A 4HM8B 3ALAA 2CWTA 3IJEB 3LTCA 3G4S3 5AEWB 3S29A 1IQ8A 2FXTA 2XGLA 3PCSA 1JN5B 3B7CA 1IVVA 3NV0A 3RGRA 3GZXB 5EQLA 5D83A 3EC9A 3HI7A 4QWTA 3V98A 4LZIA 1CYUA 3AMOA 4RZMA 2OOVA 1ZX2A 2OQEC 4IT7A 1ISKA 5AIHA 3SOAA 2BO9B 1KQS2 3NM7A 1JNQA 1RKYA 1JV2B 3EQQB 3HIIA 1TIJA 3I0YA 3OV4A 4FR9A 2BMOB 3AMOB 2CFGA 1QMAA 1W5ZA 3WA2X 1QAFA 5ELJA 3VF1A 3GAXA 4RNYA 1CEWI 2CG0A 3NM2A 3HX8A 4AEQA 3JUPA 2E2UA 4MEIA 1N9JA 3KSPA 1IVUA 3V99A 1JKGA 1Q7Y4 2WGOA 1MOLA 1WMPA 3LTAA 4OUQA 1M1XB 2BNGA 2SBLA 3DZLA 4MMYB 3K63A 2GEXA 1D6YA 3HK4A 1OUNA 1WMNA 1YIT3 4N6OB 1L5GB 1E3VA 1Q42A 2P38A 4HVNA 3UB1A 2V1LA 2CWVA 4EBGA 3OWYA 1GY6A 2Z6BA 3SX1A 1VQP3 3CD63 2RSXA 2OTJ3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FGO A;  3NM7 A;  3N8B A; 
#chains in the Genus database with same CATH topology
 2IUK A;  2AAE A;  1BGS A;  3CPW 2;  1JRQ A;  3FH1 A;  2ZA4 A;  3WMD A;  2W9Q A;  4N6N B;  1DVC A;  3EF8 A;  1E3R A;  4KT3 B;  1FGR A;  3URP A;  1Q81 4;  1RNT A;  3MG1 A;  3T0U A;  1Q86 4;  4XM4 A;  2F99 A;  5AEU B;  1YIJ 3;  1KD1 4;  1Q40 B;  3N54 B;  3WOE B;  5JPU A;  3Q1C A;  1RNB A;  3AGO A;  2Y74 A;  4FCM A;  1FGQ A;  5KP4 A;  2Z76 A;  1KSI A;  2KF6 A;  1BRG A;  1N8Q A;  2IA7 A;  3D79 A;  3LXU X;  3OWS A;  1ROV A;  4K61 A;  1OHS A;  3OXA A;  2R41 A;  2KF4 A;  2BIR A;  4ZM8 A;  1U8C B;  6STD A;  1B2M A;  2OOV C;  1MWT A;  1RHL A;  4NPB A;  3CCQ 3;  2IUJ A;  1BRH A;  3MHE A;  1GOY A;  4CJN A;  1YJW 3;  3FF0 A;  2C4B A;  2GXF A;  1AVL A;  1LNI A;  4HM6 B;  1W00 A;  3ECF A;  1DET A;  2CW9 A;  4KZ1 A;  1FGT A;  3GZY B;  5I97 A;  3CCS 3;  1O7M B;  2O3O A;  3TDG A;  1I0V A;  2WGQ A;  5IG0 A;  3WOF B;  3SED A;  1GMR A;  1MWU A;  2PZV A;  5LC7 A;  2IY2 A;  3DH2 A;  3NQZ A;  1AQZ A;  2P0M A;  1LQG C;  3G8Z A;  4J9A A;  4WFO A;  1J2B A;  3KCH A;  3DGN A;  3KZT A;  1PY3 A;  2BU4 A;  3FCS B;  4J5K A;  3X3Y A;  1MWR A;  3BB9 A;  3D3L A;  2OWP A;  2LQV A;  4NHF A;  1CH0 A;  1ULI B;  2O9U X;  1G96 A;  4N6L A;  1A2K A;  2WO0 A;  4RNZ A;  3EB8 A;  4BU4 A;  2CFL A;  3HIG A;  3L0R A;  5AIF A;  1EG9 B;  1RGH A;  2CC3 A;  4HM0 B;  2KRT A;  4PEJ A;  3X42 A;  5IG3 A;  1O7H B;  3ZG5 A;  3F8H A;  3GWR A;  2RBI A;  3X3Z A;  1W2B 2;  1X1U A;  3EBY A;  4HBR A;  1GMP A;  1NWW A;  1NO3 A;  4JRF A;  4DKI A;  4HZB B;  5D82 A;  3WR2 A;  3CCR 3;  6RNT A;  5AYR B;  1ULJ B;  2D42 A;  1JB2 A;  1LVN A;  1UGI A;  3G6E 3;  3LOY A;  1VQ4 3;  2XFT A;  3PGB A;  2RNT A;  2W9P A;  3BND A;  1N5H A;  1R4C A;  5G1K A;  5IEN A;  3F40 A;  1BSE A;  7RNT A;  4FMC A;  4MJD A;  3LML A;  2QEX 3;  1VQ8 3;  3B4P A;  3FKA A;  3M8C A;  4HJL B;  2ML5 A;  4WP5 A;  3UNL A;  4EYC A;  1BUQ A;  1K9M 4;  5CXO A;  1K28 A;  1SQW A;  3CCU 3;  1IV9 A;  1UW1 A;  1OHO A;  2E2T A;  3SOY A;  4L7K A;  1JKG B;  5M19 A;  2L4V A;  3F8X A;  3S5C A;  5IER A;  3BLZ A;  3BNC A;  5JPP A;  1IVX A;  2C10 A;  3AGN A;  2OCT A;  3BU4 A;  3Q2P A;  4XBT A;  1RGG A;  2W03 A;  1RDS A;  2WOH A;  5AYS C;  1RGK A;  2L1S A;  1LOY A;  5HOH A;  1YHQ 3;  2CG1 A;  1YJN 3;  4LSO A;  2D1W A;  4WYK A;  3KN4 A;  3CC7 3;  2GU1 A;  3NX0 A;  3VSY A;  1WNH A;  3LZA A;  4IPB A;  1MNL A;  4HZ9 B;  4BTW A;  2ZDJ A;  5HGR A;  4FCZ A;  1VZZ A;  2F98 A;  2XSO B;  3NV0 B;  4JF8 A;  3S27 A;  5IW9 A;  1BRI A;  4HM5 B;  3DGY A;  1IDP A;  3MYT A;  1IK3 A;  4BIR A;  1VQK 3;  1BAO A;  4Q53 A;  2B1X B;  1I2E A;  2KCD A;  2UX0 A;  4U13 A;  3UL5 A;  1OAC A;  2W6J H;  1BRJ A;  1SJW A;  4FCJ A;  4ILF A;  1Q82 4;  5IEP A;  4WWU C;  4XB5 A;  1LQM B;  1B27 A;  2QIY A;  1V74 A;  1UI7 A;  2HML B;  2OTL 3;  1RLS A;  1JB5 A;  1EUI C;  4X2O A;  4XBX A;  3MG3 A;  1K73 4;  1I3I A;  1VQ7 3;  1FUS A;  3WOD G;  2JQ5 A;  4EC6 A;  3EX9 A;  3F9S A;  4EW5 A;  1GS3 A;  4GL6 A;  1UUG B;  2CIU A;  3HZP A;  4LGQ A;  4STD A;  3DGM A;  1LNH A;  1A2P A;  3CME 3;  2LYX A;  2UGI A;  1NB3 I;  3U1W A;  3EE1 A;  3RDE A;  3SVA A;  3Q3F A;  3I55 3;  3DMC A;  1RCK A;  2B24 B;  3PZW A;  2CK3 H;  2HOH A;  1RMS A;  1TFO A;  2XH9 A;  1Q7H A;  2YFL B;  1B21 A;  3JUM A;  4OVM A;  2KF3 A;  1IVW A;  3S28 A;  1OH0 A;  1W6G A;  2GBW B;  3G16 A;  3JUN A;  4O8S A;  1X1Y A;  2CWU A;  4TX4 A;  2MC8 A;  1JB4 A;  3N8B A;  3JVC A;  1LOW A;  3F7S A;  9RNT A;  1BRK A;  4EV5 A;  3T8U A;  1RCL A;  1V57 A;  2HMJ B;  5FW5 A;  1LOX A;  3K7C A;  3CU3 A;  1IU7 A;  4GSP A;  1STD A;  2P09 A;  2UUG C;  5ELU A;  3WHO A;  2CFW A;  1UDI I;  2YFI B;  4HM7 B;  4R1K A;  5BIR A;  2MF7 A;  2GBX B;  1FYS A;  4WYK B;  1NB5 I;  3UL6 A;  1W6C A;  1I70 A;  3CC4 3;  3JUO A;  3I56 3;  3IMA B;  3EBT A;  7STD A;  1STF I;  2R4I A;  2F56 A;  3IPT A;  1FGO A;  1GSP A;  2XR8 B;  5TGN A;  1VQM 3;  4LMI A;  3EJV A;  3CCM 3;  4K1V A;  2STD A;  4CDL A;  2PNC A;  3D4A A;  1RJO A;  2BT3 A;  1UGH I;  3QK9 A;  4BL3 A;  3RGR A;  1FGM A;  2CFK A;  1BNJ A;  1B20 A;  3WDG B;  1WTH A;  1A2V A;  2W2C A;  3K0Z A;  2KAA A;  1DMM A;  1BU4 A;  1W2Z A;  2GEY A;  2XSH B;  4N6M A;  2Z77 A;  3DGL A;  5AI1 A;  1I0X A;  1UUV B;  3MPH A;  3PS8 A;  1Q40 A;  3GZB A;  1TTO A;  4OK0 A;  4R4K A;  4NRE A;  5KP1 A;  1B2X A;  1OCV A;  3CPO A;  1VQ6 3;  3X40 A;  4HM2 B;  1HYF A;  2INX A;  3AHS A;  2OQE A;  2RGQ A;  1LRA A;  3JUQ A;  1M1K 4;  3FGY A;  4H3U A;  5IG5 A;  1ROA A;  1I2G A;  3ZFZ A;  1ASK A;  3PXM A;  1C7H A;  3FG3 A;  5AIG A;  4EV2 A;  3E99 A;  4L8P A;  3CXC 2;  1W6Y A;  2GU3 A;  3GRD A;  1ZGX A;  5CLK A;  2CFD A;  1OPY A;  1BSA A;  1UCI A;  1JBT A;  3A5E A;  1TP6 A;  1YI2 3;  2YFJ B;  1YGW A;  3EN1 B;  3NXJ A;  1HU9 A;  1VQO 3;  1RGA A;  1DMN A;  4HM3 B;  1IYY A;  1EEJ A;  1IT7 A;  1FUW A;  2CX0 A;  2RCD A;  3KKG A;  1FZU A;  1NDO B;  4BTX A;  1OGX A;  5EVH A;  1X1X A;  3HOH A;  4HM1 B;  3FG1 A;  3KII A;  4N6V 0;  2QA4 3;  3ROB A;  5JBS A;  1ZO2 A;  4KFE A;  1BOX A;  1UUW B;  1F8N A;  1OF5 B;  1PFP A;  2FNQ A;  1W02 A;  1O7N B;  3VGN A;  1G02 A;  4HOH A;  1DVD A;  1I3F A;  3EN8 A;  1A90 A;  1B2U A;  5IEO A;  1HKX A;  4AKZ A;  1NU3 A;  3K9M C;  3X41 A;  3N9H A;  1O7G B;  4BL2 A;  2F5M A;  2CKF B;  1JN5 A;  2I9W A;  1AY7 A;  1HZ1 A;  1AR0 A;  1O7W B;  3DXO A;  1BAN A;  2KXG A;  4L8O A;  1TUH A;  1BNR A;  1SAR A;  1AV4 A;  1TRP A;  4H61 A;  2H0I A;  1EA2 A;  2F5W A;  3RNT A;  1OHP A;  2RFR A;  2W56 B;  2XGN A;  5IF6 A;  4XBY A;  1MGR A;  3MSO A;  1ZS7 A;  4KFF A;  1W7C A;  1BSC A;  3CC2 3;  1RTU A;  2XEP A;  4I5Q A;  3OW2 2;  1QJG A;  3CCV 3;  1Z1S A;  3FSD A;  4N6T A;  5A0O B;  3NBJ A;  1UI8 A;  1I8V A;  4BTY A;  1WQL B;  1JJ2 2;  1LXE A;  5IG4 A;  1B2S A;  2W0Q A;  2CH9 A;  1RN4 A;  1GY7 A;  5DRE A;  2E2V A;  1SIH A;  3U97 A;  2A15 A;  1BSB A;  1QAK A;  1YVB I;  1GD3 A;  3BNE A;  1KWI A;  2IYJ A;  1BVI A;  2FGT A;  3LT8 A;  4G1M B;  3S67 A;  3OX9 A;  2WOF A;  1BIR A;  4KVH A;  2HMO B;  3BIR A;  3ER7 A;  2XRX B;  1LOV A;  1C54 A;  1RN1 A;  4KFD A;  1FUT A;  4R9K A;  4HAA A;  1QAL A;  3LYG A;  4MMX B;  3NBR A;  4K1U A;  3PCR A;  4RBN A;  3NHX A;  2CHC A;  3X3X A;  1CQS A;  4MMZ B;  5CK6 A;  1U5O A;  3LTD A;  1PYL A;  1BRS A;  3J7Y d;  1SII A;  2H0H A;  2Z7A A;  2ZL8 A;  5BXQ A;  1IQX A;  1YNV X;  3PYJ A;  3SLU A;  1RGE A;  1IT8 A;  4O2H A;  4XDV A;  5M1A A;  1AVK A;  4N3V A;  1MGW A;  5STD A;  3RGA A;  1W4N A;  5G1L A;  3F14 A;  3FG4 A;  2QGU A;  4R9L A;  3G71 3;  1K8A 4;  1QVF 2;  4N6U A;  3D9R A;  4EXR A;  4CCV A;  1K41 A;  3GSP A;  5G2G A;  2YX9 A;  1RN7 A;  5KP3 A;  1VQL 3;  2HMK B;  1BNI A;  1RGF A;  1T2I A;  4IIA A;  3H3H A;  2HMN B;  5BVB A;  1BNE A;  1VQ5 3;  3B8L A;  3CNM A;  1DE3 A;  4R80 A;  1TU5 A;  4FMD A;  3CNX A;  1PU4 A;  3BNB A;  1BNG A;  3DM8 A;  3OWU A;  4O3V A;  5FGO A;  3UJM A;  3ZG0 A;  1FW7 A;  1GMQ A;  3DUK A;  1Q9E A;  2W56 A;  1B3S A;  1TFK A;  3AHW A;  2ZHX B;  1N8R 4;  4FMB A;  3STD A;  3NBB A;  4LYL B;  3SXX A;  4RNT A;  1BRN L;  3FF2 A;  4HYZ A;  1IV7 A;  3Q90 A;  1N9E A;  1UCL A;  3KFQ C;  3H51 A;  2W04 A;  5CF2 A;  3CCE 3;  1S5A A;  1YVS A;  5GSP A;  3WA3 A;  4ORL A;  1BSD A;  2BHM A;  2P0X A;  4X2H A;  2IMJ A;  1GD4 A;  2K54 A;  5LC6 A;  3CCL 3;  2XF3 A;  1KC8 4;  4I4K A;  1D6U A;  3LH4 A;  2F86 B;  1NNV A;  3K5T A;  4J8T A;  2H0G A;  1JZO A;  1X1W A;  5D81 A;  3G0K A;  2CX1 A;  1E97 A;  3V92 A;  2RSX A;  1M90 4;  4CPK A;  5CF1 A;  1UCJ A;  2BMR B;  4HKV B;  2AAD A;  4O02 B;  3SYU A;  4FMA A;  1VQ9 3;  1N5P A;  1R4Y A;  4XDW A;  1TRQ A;  2KF5 A;  2SAR A;  2Y73 A;  3FZW A;  1US1 A;  3B4O A;  4GHO A;  1YJ9 3;  3MKI A;  3QRD A;  3DY5 A;  3KE7 A;  1O7P B;  1G0T A;  2K0M A;  3A76 A;  1OF5 A;  5AII A;  3GZR A;  1TJD A;  1Y4K A;  3KSE D;  2HMM B;  8CHO A;  3T8N A;  1D6Z A;  1RRL A;  3CMA 3;  1WMO A;  1FA3 A;  2F4Y A;  1S72 3;  1NJI 4;  1EKM A;  1A67 A;  1MWS A;  4LEH A;  1CYV A;  1GOV A;  4GB5 A;  1UCK A;  2C11 A;  4HM4 B;  1GYB A;  3F7X A;  4J5G A;  1OGZ A;  2JDI H;  4WHA A;  5DRV A;  3NUV A;  8RNT A;  3EHC A;  4AKY A;  7GSP A;  1EQK A;  1SPU A;  1IQY A;  1YGE A;  2Q07 A;  3FLJ A;  6GSP A;  1B2Z A;  3NQY A;  3CCJ 3;  3D5I A;  1JBR A;  3MWZ A;  1RRH A;  1T5Y A;  3DGO A;  2P05 A;  4K90 B;  1W01 A;  1VQN 3;  2XFS A;  3LT9 A;  1DMQ A;  1GY5 A;  1T2H A;  3O8Y A;  2BMQ B;  1M9G A;  2ML6 A;  1QVG 2;  1JZD A;  2M7O A;  3LTB A;  5EEO A;  5BU4 A;  3MG2 A;  1BNS A;  4HM8 B;  3ALA A;  2CWT A;  3IJE B;  3LTC A;  3G4S 3;  5AEW B;  3S29 A;  2GSP A;  1IQ8 A;  2FXT A;  2XGL A;  3PCS A;  1JN5 B;  1I2F A;  1IVV A;  2K3D A;  3B7C A;  3GZX B;  3NV0 A;  5EQL A;  5D83 A;  3EC9 A;  3HI7 A;  4QWT A;  3V98 A;  4LZI A;  5RNT A;  1CYU A;  3AMO A;  4RZM A;  2OOV A;  1ZX2 A;  2OQE C;  4IT7 A;  1ISK A;  1RGL A;  5AIH A;  3SOA A;  2BO9 B;  1KQS 2;  3NM7 A;  1JNQ A;  1RKY A;  1JV2 B;  3EQQ B;  3HII A;  1TIJ A;  1RGC A;  3I0Y A;  3OV4 A;  4FR9 A;  2BMO B;  3AMO B;  2CFG A;  1QMA A;  1W5Z A;  3WA2 X;  1QAF A;  3D5G A;  5ELJ A;  1V58 A;  3VF1 A;  3GAX A;  4RNY A;  1CEW I;  2CG0 A;  3NM2 A;  3HX8 A;  4AEQ A;  3JUP A;  1JBS A;  2E2U A;  5M18 A;  4MEI A;  1N9J A;  3KSP A;  1IVU A;  3V99 A;  1JKG A;  1Q7Y 4;  2WGO A;  1MOL A;  1WMP A;  3LTA A;  4OUQ A;  2J8X B;  1RSN A;  1M1X B;  2BNG A;  2SBL A;  3DZL A;  4MMY B;  3K63 A;  2GEX A;  1D6Y A;  3HK4 A;  1VQQ A;  1BUJ A;  1OUN A;  1WMN A;  1YIT 3;  1GOU A;  4N6O B;  1BNF A;  1E3V A;  1L5G B;  1Q42 A;  2P38 A;  4HVN A;  3UB1 A;  2V1L A;  2CWV A;  4EBG A;  3OWY A;  1GY6 A;  2Z6B A;  3SX1 A;  1VQP 3;  3CD6 3;  1DYU A;  2OTJ 3;  1T3B A; 
#chains in the Genus database with same CATH homology
 2IUK A;  3CPW 2;  1JRQ A;  3FH1 A;  3WMD A;  2W9Q A;  4N6N B;  1DVC A;  3EF8 A;  1E3R A;  1FGR A;  1Q81 4;  3MG1 A;  3T0U A;  1Q86 4;  4XM4 A;  2F99 A;  5AEU B;  1YIJ 3;  1KD1 4;  1Q40 B;  3N54 B;  3WOE B;  5JPU A;  3Q1C A;  2Y74 A;  4FCM A;  1FGQ A;  5KP4 A;  2Z76 A;  1KSI A;  3LXU X;  1N8Q A;  2IA7 A;  3OWS A;  1ROV A;  4K61 A;  1OHS A;  3OXA A;  4ZM8 A;  1U8C B;  6STD A;  2OOV C;  3CCQ 3;  2IUJ A;  3MHE A;  1YJW 3;  3FF0 A;  2GXF A;  1AVL A;  4HM6 B;  1W00 A;  3ECF A;  4KZ1 A;  2CW9 A;  1FGT A;  3GZY B;  5I97 A;  3CCS 3;  1O7M B;  2O3O A;  3TDG A;  2WGQ A;  5IG0 A;  3WOF B;  3SED A;  2PZV A;  5LC7 A;  3NQZ A;  4WFO A;  2P0M A;  3G8Z A;  4J9A A;  1J2B A;  3DGN A;  3KZT A;  3FCS B;  3X3Y A;  3BB9 A;  3D3L A;  2OWP A;  2LQV A;  4NHF A;  1ULI B;  2O9U X;  1G96 A;  4N6L A;  1A2K A;  2WO0 A;  4RNZ A;  3EB8 A;  2CFL A;  3HIG A;  3L0R A;  5AIF A;  1EG9 B;  2CC3 A;  4HM0 B;  2KRT A;  4PEJ A;  3X42 A;  5IG3 A;  1O7H B;  3F8H A;  3GWR A;  3X3Z A;  1W2B 2;  3EBY A;  4HBR A;  1NWW A;  1NO3 A;  4JRF A;  4HZB B;  5D82 A;  3CCR 3;  5AYR B;  1ULJ B;  2D42 A;  1JB2 A;  1LVN A;  3G6E 3;  3LOY A;  1VQ4 3;  2XFT A;  3PGB A;  2W9P A;  3BND A;  1N5H A;  1R4C A;  5IEN A;  3F40 A;  4FMC A;  4MJD A;  3LML A;  2QEX 3;  1VQ8 3;  3B4P A;  3FKA A;  3M8C A;  4HJL B;  2ML5 A;  4WP5 A;  3UNL A;  4EYC A;  1BUQ A;  1K9M 4;  5CXO A;  1K28 A;  1SQW A;  3CCU 3;  1IV9 A;  1UW1 A;  1OHO A;  2E2T A;  3SOY A;  4L7K A;  1JKG B;  2L4V A;  3F8X A;  3S5C A;  5IER A;  3BLZ A;  3BNC A;  5JPP A;  1IVX A;  2C10 A;  4XBT A;  2OCT A;  3Q2P A;  2W03 A;  5AYS C;  2WOH A;  1YHQ 3;  2CG1 A;  1YJN 3;  4LSO A;  2D1W A;  4WYK A;  3KN4 A;  3CC7 3;  2GU1 A;  3NX0 A;  3VSY A;  1WNH A;  3LZA A;  4IPB A;  1MNL A;  4HZ9 B;  4BTW A;  2ZDJ A;  5HGR A;  4FCZ A;  1VZZ A;  2F98 A;  2XSO B;  3NV0 B;  4JF8 A;  3S27 A;  5IW9 A;  4HM5 B;  1IDP A;  3MYT A;  1IK3 A;  1VQK 3;  4Q53 A;  4U13 A;  2B1X B;  2KCD A;  2UX0 A;  3UL5 A;  1OAC A;  2W6J H;  1SJW A;  4FCJ A;  1Q82 4;  5IEP A;  4WWU C;  4XB5 A;  2QIY A;  1V74 A;  1UI7 A;  2HML B;  2OTL 3;  1JB5 A;  4X2O A;  4XBX A;  3MG3 A;  1K73 4;  1VQ7 3;  3WOD G;  2JQ5 A;  4EC6 A;  3EX9 A;  3F9S A;  1GS3 A;  4GL6 A;  4STD A;  2CIU A;  3HZP A;  4LGQ A;  3DGM A;  1LNH A;  3CME 3;  2LYX A;  1NB3 I;  3U1W A;  3EE1 A;  3RDE A;  3SVA A;  3I55 3;  3DMC A;  2B24 B;  3PZW A;  2CK3 H;  1TFO A;  2XH9 A;  2YFL B;  3JUM A;  4OVM A;  1IVW A;  3S28 A;  1OH0 A;  1W6G A;  2GBW B;  3G16 A;  3JUN A;  4O8S A;  2CWU A;  4TX4 A;  2MC8 A;  1JB4 A;  3N8B A;  3JVC A;  3F7S A;  4EV5 A;  3T8U A;  2HMJ B;  5FW5 A;  1LOX A;  3K7C A;  3CU3 A;  1IU7 A;  1STD A;  2P09 A;  5ELU A;  2CFW A;  2YFI B;  4HM7 B;  4R1K A;  2MF7 A;  2GBX B;  4WYK B;  1NB5 I;  3UL6 A;  1W6C A;  3CC4 3;  3JUO A;  3I56 3;  3IMA B;  3EBT A;  1DYU A;  7STD A;  1STF I;  2R4I A;  3IPT A;  1FGO A;  2XR8 B;  5TGN A;  1VQM 3;  4LMI A;  3EJV A;  3CCM 3;  4K1V A;  2STD A;  4CDL A;  2PNC A;  1RJO A;  2BT3 A;  3QK9 A;  1FGM A;  2CFK A;  3WDG B;  1WTH A;  1A2V A;  2W2C A;  3K0Z A;  1DMM A;  1W2Z A;  2GEY A;  2XSH B;  4N6M A;  2Z77 A;  3DGL A;  5AI1 A;  1UUV B;  3PS8 A;  3MPH A;  5KP1 A;  1Q40 A;  3GZB A;  4OK0 A;  4R4K A;  4NRE A;  1OCV A;  3CPO A;  1VQ6 3;  3X40 A;  4HM2 B;  2INX A;  2OQE A;  2RGQ A;  3JUQ A;  1M1K 4;  3FGY A;  4H3U A;  5IG5 A;  1ROA A;  1ASK A;  3PXM A;  1C7H A;  3FG3 A;  5AIG A;  4EV2 A;  3E99 A;  4L8P A;  3CXC 2;  1W6Y A;  2GU3 A;  3GRD A;  5CLK A;  2CFD A;  1OPY A;  1TP6 A;  1YI2 3;  2YFJ B;  3NXJ A;  3EN1 B;  1HU9 A;  1VQO 3;  1DMN A;  4HM3 B;  1FUW A;  1IT7 A;  2RCD A;  3KKG A;  1NDO B;  4BTX A;  1OGX A;  5EVH A;  4HM1 B;  3FG1 A;  3KII A;  4N6V 0;  2QA4 3;  3ROB A;  5JBS A;  1ZO2 A;  4KFE A;  1UUW B;  1F8N A;  1OF5 B;  1PFP A;  2FNQ A;  1W02 A;  1O7N B;  3VGN A;  1DVD A;  3EN8 A;  1A90 A;  5IEO A;  1HKX A;  4AKZ A;  1NU3 A;  3K9M C;  3X41 A;  3N9H A;  1O7G B;  2CKF B;  1JN5 A;  2I9W A;  1AR0 A;  1O7W B;  3DXO A;  2KXG A;  4L8O A;  1TUH A;  1AV4 A;  4H61 A;  1EA2 A;  1OHP A;  2RFR A;  2W56 B;  2XGN A;  5IF6 A;  4XBY A;  3MSO A;  4KFF A;  1W7C A;  3CC2 3;  2XEP A;  3OW2 2;  1QJG A;  3CCV 3;  1Z1S A;  3FSD A;  4N6T A;  5A0O B;  3NBJ A;  1UI8 A;  4BTY A;  1WQL B;  1JJ2 2;  1LXE A;  5IG4 A;  2W0Q A;  2CH9 A;  1GY7 A;  5DRE A;  2E2V A;  1SIH A;  3U97 A;  2A15 A;  1QAK A;  1YVB I;  1GD3 A;  3BNE A;  1KWI A;  3LT8 A;  2FGT A;  4G1M B;  3S67 A;  3OX9 A;  2WOF A;  4KVH A;  2HMO B;  3ER7 A;  2XRX B;  4KFD A;  4R9K A;  1QAL A;  3LYG A;  4MMX B;  3NBR A;  4K1U A;  3PCR A;  4RBN A;  3NHX A;  2CHC A;  3X3X A;  1CQS A;  4MMZ B;  5CK6 A;  1U5O A;  3LTD A;  3J7Y d;  1SII A;  2Z7A A;  2ZL8 A;  5BXQ A;  1IQX A;  3PYJ A;  3SLU A;  1IT8 A;  4O2H A;  4XDV A;  1AVK A;  4N3V A;  5STD A;  3RGA A;  1W4N A;  3F14 A;  3FG4 A;  2QGU A;  4R9L A;  3G71 3;  1K8A 4;  1QVF 2;  4N6U A;  3D9R A;  4EXR A;  4CCV A;  1K41 A;  5G2G A;  1VQL 3;  2YX9 A;  1RN7 A;  5KP3 A;  2HMK B;  4IIA A;  3H3H A;  2HMN B;  5BVB A;  1VQ5 3;  3B8L A;  3CNM A;  4R80 A;  1TU5 A;  4FMD A;  3CNX A;  1PU4 A;  3BNB A;  4O3V A;  3DM8 A;  3OWU A;  5FGO A;  3UJM A;  3DUK A;  2W56 A;  1TFK A;  1N8R 4;  4FMB A;  3STD A;  3NBB A;  3SXX A;  3FF2 A;  4HYZ A;  1IV7 A;  3Q90 A;  1N9E A;  3KFQ C;  3H51 A;  2W04 A;  5CF2 A;  3CCE 3;  1S5A A;  3WA3 A;  4ORL A;  2BHM A;  2P0X A;  4X2H A;  2IMJ A;  1GD4 A;  2K54 A;  5LC6 A;  3CCL 3;  2XF3 A;  1KC8 4;  4I4K A;  1D6U A;  3LH4 A;  2F86 B;  3K5T A;  4J8T A;  5D81 A;  3G0K A;  1E97 A;  3V92 A;  1M90 4;  5CF1 A;  2BMR B;  4HKV B;  4O02 B;  4FMA A;  1VQ9 3;  1N5P A;  4XDW A;  2Y73 A;  3FZW A;  1US1 A;  3B4O A;  1YJ9 3;  3MKI A;  3QRD A;  3DY5 A;  3KE7 A;  1O7P B;  2K0M A;  3A76 A;  1OF5 A;  5AII A;  3GZR A;  1Y4K A;  3KSE D;  2HMM B;  8CHO A;  3T8N A;  1D6Z A;  1RRL A;  3CMA 3;  1WMO A;  1FA3 A;  1NJI 4;  1S72 3;  1A67 A;  1EKM A;  4LEH A;  1CYV A;  4GB5 A;  2C11 A;  4HM4 B;  1GYB A;  3F7X A;  1OGZ A;  2JDI H;  4WHA A;  5DRV A;  3NUV A;  3EHC A;  4AKY A;  1EQK A;  1SPU A;  1IQY A;  1YGE A;  2Q07 A;  3FLJ A;  3NQY A;  3CCJ 3;  3MWZ A;  1RRH A;  1T5Y A;  3DGO A;  2P05 A;  4K90 B;  1W01 A;  1VQN 3;  2XFS A;  3LT9 A;  1DMQ A;  1GY5 A;  3O8Y A;  2BMQ B;  1M9G A;  2ML6 A;  1QVG 2;  2M7O A;  3LTB A;  5EEO A;  3MG2 A;  4HM8 B;  3ALA A;  2CWT A;  3IJE B;  3LTC A;  3G4S 3;  5AEW B;  3S29 A;  1IQ8 A;  2FXT A;  2XGL A;  3PCS A;  1JN5 B;  3B7C A;  1IVV A;  3NV0 A;  3RGR A;  3GZX B;  5EQL A;  5D83 A;  3EC9 A;  3HI7 A;  4QWT A;  3V98 A;  4LZI A;  1CYU A;  3AMO A;  4RZM A;  2OOV A;  1ZX2 A;  2OQE C;  4IT7 A;  1ISK A;  5AIH A;  3SOA A;  2BO9 B;  1KQS 2;  3NM7 A;  1JNQ A;  1RKY A;  1JV2 B;  3EQQ B;  3HII A;  1TIJ A;  3I0Y A;  3OV4 A;  4FR9 A;  2BMO B;  3AMO B;  2CFG A;  1QMA A;  1W5Z A;  3WA2 X;  1QAF A;  5ELJ A;  3VF1 A;  3GAX A;  4RNY A;  1CEW I;  2CG0 A;  3NM2 A;  3HX8 A;  4AEQ A;  3JUP A;  2E2U A;  4MEI A;  1N9J A;  3KSP A;  1IVU A;  3V99 A;  1JKG A;  1Q7Y 4;  2WGO A;  1MOL A;  1WMP A;  3LTA A;  4OUQ A;  1M1X B;  2BNG A;  2SBL A;  3DZL A;  4MMY B;  3K63 A;  2GEX A;  1D6Y A;  3HK4 A;  1OUN A;  1WMN A;  1YIT 3;  4N6O B;  1L5G B;  1E3V A;  1Q42 A;  2P38 A;  4HVN A;  3UB1 A;  2V1L A;  2CWV A;  4EBG A;  3OWY A;  1GY6 A;  2Z6B A;  3SX1 A;  1VQP 3;  3CD6 3;  2RSX A;  2OTJ 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...