2KCDA

Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SSP0047
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2kcdA00
5AYSC 5AYRB 2KCDA 3WDGB
chains in the Genus database with same CATH superfamily
2OTL3 5EVHA 2WO0A 1I0VA 3UJMA 3WODG 2XEPA 3NQZA 3MYTA 4WFOA 5M18A 1U8CB 1UUWB 3IJEB 1RRLA 2GEXA 1D6YA 5AIGA 3AHWA 1RGGA 3KCHA 1TU5A 1E3RA 1O7WB 3ZG0A 3EBYA 3F7XA 1K734 2OQEC 1B27A 2Z6BA 1W6CA 1G0TA 1A2KA 3DGMA 2F86B 1PYLA 2CK3H 4HM7B 1SIHA 4HZBB 4X2OA 5IG5A 1GD3A 1BNSA 1QJGA 3FCSB 1KQS2 2RCDA 1VQM3 2MC8A 4HM4B 1BSBA 3OW22 1CYUA 1NNVA 3DUKA 3KE7A 3BU4A 2WGQA 2KRTA 1PY3A 3ZFZA 1N9JA 4J8TA 2H0GA 2W04A 2JDIH 1I2FA 1IK3A 4GB5A 3NV0B 3LZAA 1W02A 3I0YA 3X42A 5BXQA 1DMNA 3MHEA 2W9PA 3LT9A 5ELJA 1O7HB 2CW9A 3CPOA 1WTHA 3V98A 2H0HA 1NO3A 1GS3A 2MF7A 4IPBA 4HM8B 4MEIA 3DY5A 4FMAA 3X40A 2M7OA 1STFI 1ULIB 5IW9A 1YVSA 1JKGA 3ECFA 3UL5A 3VF1A 3UNLA 1OH0A 2P0XA 1OPYA 3LTCA 3T8UA 2FNQA 3GRDA 5D83A 2B24B 3WA2X 1SJWA 2ML5A 1VQP3 3PS8A 2BMQB 4RNYA 1JNQA 2JQ5A 5LC6A 3S28A 1BNGA 4LGQA 3JUMA 3FF0A 5IERA 3SYUA 1YI23 1Q7Y4 1N8R4 3K7CA 2AADA 4WYKB 5I97A 2CH9A 2A15A 2C10A 1N5HA 1UCKA 1V57A 1ZS7A 4N6MA 5JBSA 1JBSA 3V99A 1RDSA 1VQ53 3DGLA 4HJLB 1T2HA 3OXAA 6STDA 2KXGA 3BLZA 1I2GA 1MOLA 1RN1A 1OHPA 3CU3A 2FGTA 3WA3A 1ASKA 2H0IA 1RGCA 3HX8A 4N6UA 5AIFA 1NJI4 3WOEB 1WQLB 4RZMA 1A90A 2ZDJA 2CWVA 4EV5A 2D1WA 2R41A 4MJDA 3GZRA 4STDA 4HM1B 2RNTA 2XR8B 1UI7A 1IV9A 1BRNL 1OGXA 4KFFA 2CG1A 4EW5A 1Q7HA 1PFPA 5CF1A 2E2VA 1VQL3 1UGHI 1FGMA 2QGUA 3URPA 1RRHA 1W2ZA 1VQN3 8RNTA 1YJW3 1GMPA 4K90B 2P0MA 1S723 3K63A 3AMOB 1M1XB 5ELUA 1VQ93 1Q40B 3KIIA 1JKGB 2INXA 1W6GA 3RGRA 3UB1A 3G713 2YX9A 3DGYA 3IPTA 4QWTA 3X3ZA 4NHFA 3PXMA 1ROVA 1W2B2 3KZTA 1UI8A 2BHMA 3KSPA 5BVBA 1QMAA 1JB4A 4EBGA 3CNXA 1HKXA 2XFSA 2BNGA 3Q1CA 2CG0A 3G4S3 1Q40A 7STDA 3LYGA 3DMCA 1IDPA 1RHLA 5CF2A 2K54A 3HIGA 3LMLA 1LOXA 1US1A 1NDOB 3MSOA 3M8CA 1BGSA 5AIHA 3SOAA 1LNHA 3X41A 1UW1A 1B2MA 3SLUA 2GU1A 1VQ43 1SARA 1RNTA 4N6V0 4X2HA 3KFQC 2O9UX 4BL2A 2XSHB 1GMQA 2W2CA 2W6JH 7RNTA 1BNEA 2BMRB 1MWRA 4EV2A 1R4CA 3NUVA 1A2VA 1KD14 3VSYA 4HZ9B 1YGWA 1VQ73 1YHQ3 1DYUA 1BSAA 2XF3A 1TFOA 1HZ1A 2L1SA 3BNBA 3CNMA 3MG3A 5HGRA 1EQKA 1NB3I 1X1XA 4J9AA 1CH0A 2RFRA 5IEPA 2IUKA 5AEUB 1LVNA 2IMJA 2CHCA 3FG1A 3KKGA 3GZYB 3AGNA 4MMYB 1D6ZA 3PCSA 5LC7A 3J7Yd 3E99A 1W4NA 3MG1A 1AV4A 1FA3A 3FG4A 4EC6A 3FLJA 5EQLA 4RNZA 6GSPA 4HM0B 4AKYA 2HMOB 5AEWB 4HBRA 1N9EA 3B8LA 3X3XA 1K8A4 3HOHA 3NV0A 1VQQA 4JF8A 4LSOA 4OUQA 1FGOA 3FG3A 1FGQA 5G1LA 3OWSA 3TDGA 3V92A 2W9QA 3S67A 2ZHXB 3L0RA 1G96A 3MPHA 1GD4A 4GSPA 1UCIA 2SARA 2IA7A 4KZ1A 2CFGA 2CC3A 1U5OA 1YIT3 3CPW2 3D9RA 1RLSA 1BNRA 1FUSA 4XBTA 4BTWA 3G8ZA 1W00A 1RCLA 3EN8A 4N6TA 3T0UA 3U1WA 1B3SA 2F4YA 3ER7A 3JUNA 3Q2PA 2HOHA 3EX9A 1TP6A 2O3OA 3SVAA 4XBYA 1FGRA 4HAAA 3LTBA 3WDGB 1ROAA 1E3VA 1FW7A 4HM6B 3X3YA 3CCL3 4BL3A 3MG2A 1W01A 3DM8A 3UL6A 3DGNA 4IT7A 3D5GA 3BB9A 2W03A 3DXOA 5G1KA 1BRHA 2HMNB 2OCTA 3D4AA 4G1MB 1W6YA 4R80A 1MWTA 2HMMB 2B1XB 3DZLA 3HIIA 1LOYA 1IT8A 1FYSA 1OHOA 2AAEA 4LMIA 2FXTA 3I563 3S5CA 5BU4A 3SXXA 4CJNA 5JPPA 1IU7A 3NX0A 1OCVA 1EG9B 2HMKB 1F8NA 1BUQA 1I2EA 4O8SA 1FGTA 4HM3B 4ILFA 3WMDA 5AYRB 1M1K4 2CWUA 1IQ8A 2IY2A 1D6UA 3KN4A 3LTAA 5IG4A 2Z77A 1ZO2A 3PCRA 4WWUC 4IIAA 1T3BA 5CK6A 1RN4A 5DRVA 3CXC2 2LYXA 2RGQA 3HI7A 4KFDA 4WP5A 3G0KA 1UCJA 4BTXA 5KP1A 3ROBA 4KFEA 3A76A 3CC43 2WGOA 4FCMA 2CX1A 1VQ83 3AMOA 3EN1B 3H3HA 3FKAA 1IYYA 1IVUA 1Q9EA 1QVG2 2OOVC 5BIRA 3B4OA 2OTJ3 3SX1A 1RMSA 1BNFA 3NM7A 2ML6A 2GXFA 1GOYA 3EF8A 1IQXA 1EKMA 3BNEA 3IMAB 4GL6A 1BAOA 1IV7A 1QAFA 1PU4A 3CCS3 1J2BA 1Q42A 4LEHA 3SOYA 3CD63 1SQWA 2RSXA 4XBXA 2CX0A 4DKIA 2QIYA 1RGFA 4CCVA 4HM5B 2XH9A 1GYBA 2SBLA 4HVNA 1JRQA 3JUPA 3NM2A 1A67A 4XM4A 1IQYA 1M9GA 1B2XA 1KWIA 3F8XA 1DVCA 1CQSA 2XFTA 4FR9A 2KF4A 1JB2A 3RNTA 3PZWA 4XDWA 1K41A 1GOUA 1TJDA 1JZDA 3G6E3 1K28A 3I553 1B2UA 1T5YA 1AR0A 2D42A 4CDLA 1OACA 1I3FA 3HZPA 3LXUX 4N3VA 3MWZA 2K3DA 3D5IA 2GBWB 1W5ZA 4LYLB 1AQZA 3B4PA 1B2ZA 3N8BA 4WHAA 1BSCA 1C54A 1VQK3 2C4BA 1N5PA 2E2UA 5RNTA 2ZA4A 4RNTA 1BOXA 2BT3A 1BNJA 1MGWA 2STDA 4KT3B 2I9WA 5IG0A 2QEX3 3CCQ3 1DE3A 3STDA 4HOHA 2LQVA 4R9LA 1O7NB 1RKYA 1MNLA 1A2PA 1YIJ3 1QALA 2R4IA 2UUGC 1HYFA 3NBJA 3H51A 2PZVA 3GSPA 8CHOA 1BIRA 3CCR3 1VQO3 4FCZA 1LQGC 3D79A 3PGBA 3BNDA 3Q3FA 1BNIA 3GWRA 2V1LA 3SEDA 3LTDA 4O02B 3DH2A 3K9MC 1SIIA 1UGIA 1SPUA 2WOFA 4O2HA 3BNCA 1RTUA 1ZX2A 5AI1A 2P38A 1X1YA 2E2TA 3K0ZA 5IENA 1BSEA 4I5QA 2CFKA 1WNHA 1O7MB 1UCLA 5D82A 5GSPA 1OGZA 7GSPA 1TFKA 1I70A 2BMOB 3EC9A 3EB8A 1ISKA 1TTOA 4BTYA 4CPKA 1GY7A 1JB5A 1CYVA 3LT8A 2GSPA 1RN7A 2Z7AA 3NQYA 2F98A 1ULJB 2W56A 4L8OA 4MMXB 3CCE3 1GMRA 1K9M4 4L8PA 1BSDA 2YFJB 1I0XA 2OOVA 4L7KA 5M1AA 1FUWA 4H61A 1DVDA 1BU4A 4GHOA 1C7HA 4FCJA 1EEJA 1O7GB 3PYJA 1LOVA 1QAKA 3JUOA 2Y73A 4JRFA 2GU3A 1YNVX 1YVBI 2HMLB 2WOHA 2IYJA 3WOFB 3FH1A 3EBTA 2OWPA 2Z76A 4XB5A 1JBTA 1EUIC 1FZUA 2Y74A 3S27A 1TIJA 4J5KA 5FW5A 2J8XB 3RGAA 1OHSA 1BUJA 2CFDA 2KCDA 4K61A 4HKVB 1AVLA 1BRKA 2CFWA 4R1KA 5STDA 1WMNA 3OWYA 2CIUA 5AIIA 2BO9B 5KP3A 4K1VA 2CFLA 3OWUA 5DREA 1Q864 1OF5A 6RNTA 1V74A 2UX0A 2XGNA 2BIRA 2CWTA 1R4YA 4ZM8A 1CEWI 1OUNA 1I8VA 1QVF2 1B21A 3F9SA 3WR2A 1YJN3 4RBNA 2F5WA 3JUQA 4LZIA 2HMJB 3DGOA 1RGHA 4ORLA 5G2GA 1UDII 4I4KA 4K1UA 1IVVA 1TRPA 1UUGB 1EA2A 2P09A 2F56A 1BANA 3N54B 2F99A 3QRDA 5TGNA 4AKZA 1RNBA 1JV2B 2W56B 4NPBA 1O7PB 5JPUA 1RGAA 1HU9A 3ZG5A 3CME3 3K5TA 3OX9A 3CCV3 1MGRA 2KF3A 1IVXA 2C11A 1BRSA 1JZOA 1LRAA 1NU3A 1B20A 3EQQB 4J5GA 2IUJA 2YFLB 3CC73 3F14A 3F7SA 4N6LA 1GOVA 3MKIA 5D81A 3NBRA 1GY5A 3EE1A 5FGOA 3U97A 2GBXB 5CLKA 1JJ22 3ALAA 4FMBA 2QA43 1RGEA 3CCM3 2PNCA 1BRJA 4H3UA 1G02A 3T8NA 1BRIA 1LOWA 1VQ63 4AEQA 4NREA 4WYKA 2YFIB 3NBBA 2OQEA 3VGNA 1I3IA 4FMCA 1AVKA 4Q53A 3OV4A 1MWSA 2P05A 2XRXB 1X1UA 3AHSA 1BRGA 3FGYA 3KSED 4R4KA 4XDVA 3WHOA 3S29A 1LXEA 5IEOA 3B7CA 3CMA3 4EXRA 2KF6A 2W0QA 2KF5A 1IVWA 2L4VA 3RDEA 1Q824 1NWWA 1Y4KA 3NHXA 1DETA 1KC84 1GSPA 4BIRA 2Q07A 5IG3A 3CC23 3CCJ3 1V58A 3O8YA 4HM2B 1MWUA 1X1WA 4N6OB 1N8QA 4BU4A 5HOHA 2F5MA 2XGLA 1TRQA 1YJ93 1IT7A 4MMZB 4OK0A 1T2IA 1RJOA 2ZL8A 3GAXA 1UUVB 2KAAA 4PEJA 3FSDA 3QK9A 1KSIA 1JN5A 1STDA 1LQMB 1E97A 1GY6A 1YGEA 3JVCA 1LNIA 2K0MA 2BU4A 1Z1SA 4FMDA 4O3VA 2GEYA 1RSNA 5CXOA 1OF5B 4R9KA 4EYCA 9RNTA 5KP4A 1B2SA 3LOYA 3D3LA 3BIRA 3HK4A 1FUTA 4TX4A 3LH4A 2RBIA 1RGLA 1ZGXA 3N9HA 4KVHA 4U13A 1JN5B 5M19A 1VZZA 1DMQA 3F8HA 1BVIA 1TUHA 3EJVA 1WMPA 3G16A 3GZXB 3F40A 3AGOA 3CCU3 4OVMA 1NB5I 1JBRA 3EHCA 1WMOA 5EEOA 1W7CA 1DMMA 4HYZA 3A5EA 5AYSC 5IF6A 1RCKA 3GZBA 1S5AA 1Q814 2UGIA 2XSOB 5A0OB 2CKFB 4N6NB 1RGKA 3NXJA 3FZWA 3FF2A 1L5GB 3Q90A 1M904 1AY7A
chains in the Genus database with same CATH topology
2OTL3 5EVHA 2WO0A 3UJMA 3WODG 2XEPA 3NQZA 3MYTA 4WFOA 1U8CB 1UUWB 3IJEB 1RRLA 2GEXA 1D6YA 5AIGA 1TU5A 1E3RA 1O7WB 3EBYA 3F7XA 1K734 2OQEC 2Z6BA 1W6CA 1A2KA 3DGMA 2F86B 2CK3H 4HM7B 4HZBB 1SIHA 4X2OA 5IG5A 1GD3A 1QJGA 3FCSB 1KQS2 2RCDA 2MC8A 4HM4B 3OW22 1CYUA 3DUKA 3KE7A 2WGQA 2KRTA 1N9JA 4J8TA 2W04A 2JDIH 1IK3A 4GB5A 3NV0B 3LZAA 1W02A 3I0YA 3X42A 5BXQA 1DMNA 3MHEA 2W9PA 3LT9A 5ELJA 1O7HB 2CW9A 3CPOA 1WTHA 3V98A 1NO3A 1GS3A 2MF7A 4IPBA 4HM8B 4MEIA 3DY5A 4FMAA 3X40A 2M7OA 1STFI 1ULIB 5IW9A 1JKGA 3ECFA 3UL5A 3VF1A 3UNLA 1OH0A 2P0XA 1OPYA 3LTCA 3T8UA 2FNQA 3GRDA 5D83A 2B24B 3WA2X 1SJWA 2ML5A 1VQP3 3PS8A 2BMQB 4RNYA 1JNQA 2JQ5A 5LC6A 3S28A 4LGQA 3JUMA 3FF0A 5IERA 1YI23 1Q7Y4 1N8R4 3K7CA 4WYKB 5I97A 2CH9A 2A15A 2C10A 1N5HA 4N6MA 5JBSA 3V99A 1VQ53 3DGLA 4HJLB 3OXAA 6STDA 2KXGA 3BLZA 1MOLA 1OHPA 3CU3A 2FGTA 3WA3A 1ASKA 3HX8A 4N6UA 5AIFA 1NJI4 3WOEB 1WQLB 1A90A 2ZDJA 2CWVA 4EV5A 2D1WA 4MJDA 3GZRA 4STDA 4HM1B 2XR8B 1UI7A 1IV9A 1OGXA 4KFFA 2CG1A 5CF1A 1PFPA 2E2VA 1VQL3 1FGMA 2QGUA 1RRHA 1W2ZA 1VQN3 1YJW3 4K90B 2P0MA 1S723 3K63A 3AMOB 1M1XB 5ELUA 1VQ93 1Q40B 3KIIA 1JKGB 2INXA 1W6GA 3RGRA 3UB1A 3G713 2YX9A 3IPTA 4QWTA 3X3ZA 4NHFA 3PXMA 1ROVA 1W2B2 3KZTA 1UI8A 2BHMA 3KSPA 5BVBA 1QMAA 1JB4A 4EBGA 3CNXA 1HKXA 2XFSA 2BNGA 3Q1CA 2CG0A 3G4S3 1Q40A 7STDA 3LYGA 3DMCA 1IDPA 5CF2A 2K54A 3HIGA 3LMLA 1LOXA 1US1A 1NDOB 3MSOA 3M8CA 5AIHA 3SOAA 1LNHA 3X41A 1UW1A 3SLUA 2GU1A 1VQ43 4N6V0 4X2HA 3KFQC 2O9UX 2XSHB 2W2CA 2W6JH 2BMRB 4EV2A 1R4CA 3NUVA 1A2VA 1KD14 3VSYA 4HZ9B 1VQ73 1YHQ3 1DYUA 2XF3A 3BNBA 1TFOA 3CNMA 3MG3A 5HGRA 1EQKA 1NB3I 4J9AA 2RFRA 5IEPA 2IUKA 5AEUB 1LVNA 2IMJA 2CHCA 3FG1A 3KKGA 3GZYB 4MMYB 1D6ZA 3PCSA 5LC7A 3J7Yd 3E99A 1W4NA 3MG1A 1AV4A 1FA3A 3FG4A 4EC6A 3FLJA 5EQLA 4RNZA 4HM0B 4AKYA 2HMOB 5AEWB 4HBRA 1N9EA 3B8LA 3X3XA 1K8A4 3NV0A 4JF8A 4LSOA 4OUQA 1FGOA 3FG3A 1FGQA 3OWSA 3TDGA 3V92A 2W9QA 3S67A 3L0RA 1G96A 3MPHA 1GD4A 2IA7A 4KZ1A 2CFGA 2CC3A 1U5OA 1YIT3 3CPW2 3D9RA 4XBTA 4BTWA 3G8ZA 1W00A 3EN8A 3U1WA 4N6TA 3T0UA 3ER7A 3JUNA 3Q2PA 3EX9A 1TP6A 2O3OA 3SVAA 4XBYA 1FGRA 3WDGB 3LTBA 1ROAA 1E3VA 4HM6B 3X3YA 3CCL3 3MG2A 1W01A 3DM8A 3UL6A 3DGNA 4IT7A 3BB9A 2W03A 3DXOA 2HMNB 2OCTA 4G1MB 1W6YA 4R80A 2HMMB 2B1XB 3DZLA 3HIIA 1OHOA 4LMIA 2FXTA 3I563 3S5CA 3SXXA 5JPPA 1IU7A 3NX0A 1OCVA 1EG9B 2HMKB 1F8NA 1BUQA 4O8SA 1FGTA 4HM3B 3WMDA 5AYRB 1M1K4 2CWUA 1IQ8A 1D6UA 3KN4A 3LTAA 5IG4A 2Z77A 1ZO2A 3PCRA 4WWUC 4IIAA 5CK6A 3CXC2 5DRVA 2LYXA 2RGQA 3HI7A 4KFDA 4WP5A 3G0KA 5KP1A 4BTXA 3ROBA 4KFEA 3A76A 3CC43 2WGOA 4FCMA 1VQ83 3AMOA 3EN1B 3H3HA 3FKAA 1IVUA 1QVG2 2OOVC 2OTJ3 3B4OA 3SX1A 3NM7A 2ML6A 2GXFA 3EF8A 4RZMA 1IQXA 1EKMA 3BNEA 3IMAB 4GL6A 1IV7A 1QAFA 1PU4A 3CCS3 1J2BA 1Q42A 4LEHA 3SOYA 3CD63 1SQWA 2RSXA 4XBXA 2QIYA 4CCVA 4HM5B 2XH9A 1GYBA 2SBLA 4HVNA 1JRQA 3JUPA 3NM2A 1A67A 4XM4A 1IQYA 1M9GA 1KWIA 3F8XA 1DVCA 1CQSA 2XFTA 4FR9A 1JB2A 3PZWA 4XDWA 1K41A 3G6E3 1K28A 3I553 1T5YA 1AR0A 2D42A 4CDLA 1OACA 3HZPA 3LXUX 4N3VA 3MWZA 1VQM3 2GBWB 1W5ZA 4WHAA 3B4PA 3N8BA 1VQK3 1N5PA 2E2UA 2QEX3 2BT3A 3CCQ3 2STDA 5IG0A 2I9WA 3STDA 2LQVA 4R9LA 1O7NB 1RKYA 1MNLA 1YIJ3 1QALA 2R4IA 3NBJA 3H51A 2PZVA 1VQO3 8CHOA 3CCR3 4FCZA 3PGBA 3BNDA 3GWRA 2V1LA 3SEDA 3LTDA 4O02B 3K9MC 1SIIA 1SPUA 2WOFA 4O2HA 3BNCA 1ZX2A 5AI1A 2P38A 2E2TA 3K0ZA 5IENA 2CFKA 1WNHA 1O7MB 5D82A 1OGZA 1TFKA 2BMOB 3EB8A 3EC9A 1ISKA 4BTYA 1GY7A 1JB5A 1CYVA 3LT8A 1RN7A 2Z7AA 3NQYA 2F98A 1ULJB 2W56A 4L8OA 4MMXB 3CCE3 1K9M4 4L8PA 2YFJB 2OOVA 4L7KA 1FUWA 4H61A 1DVDA 1C7HA 4FCJA 1O7GB 3PYJA 1QAKA 3JUOA 2Y73A 4JRFA 2GU3A 2HMLB 1YVBI 2WOHA 3WOFB 3FH1A 3EBTA 2OWPA 2Z76A 4XB5A 2Y74A 3S27A 1TIJA 5FW5A 3RGAA 1OHSA 2CFDA 2KCDA 4K61A 4HKVB 1AVLA 2CFWA 4R1KA 5STDA 1WMNA 3OWYA 2CIUA 5AIIA 2BO9B 5KP3A 4K1VA 2CFLA 3OWUA 5DREA 1Q864 1OF5A 1V74A 2UX0A 2XGNA 2CWTA 4ZM8A 1CEWI 1OUNA 1QVF2 3F9SA 1YJN3 4RBNA 3JUQA 4LZIA 2HMJB 3DGOA 4ORLA 5G2GA 4I4KA 4K1UA 1IVVA 2P09A 1EA2A 3N54B 5TGNA 2F99A 3QRDA 4AKZA 1JV2B 2W56B 1O7PB 5JPUA 3CME3 1HU9A 3K5TA 3OX9A 3CCV3 1IVXA 2C11A 1NU3A 3EQQB 2IUJA 2YFLB 3CC73 3F14A 3F7SA 4N6LA 3MKIA 5D81A 3NBRA 1GY5A 3EE1A 5FGOA 3U97A 2GBXB 5CLKA 1JJ22 3ALAA 4FMBA 2QA43 3CCM3 2PNCA 4H3UA 3T8NA 1VQ63 4AEQA 4NREA 4WYKA 2YFIB 3NBBA 2OQEA 3VGNA 4FMCA 4Q53A 1AVKA 3OV4A 2P05A 4R4KA 2XRXB 4XDVA 3FGYA 3KSED 3S29A 1LXEA 5IEOA 3B7CA 3CMA3 4EXRA 2W0QA 1IVWA 2L4VA 3RDEA 1Q824 1NWWA 1Y4KA 3NHXA 1KC84 2Q07A 5IG3A 3CC23 3CCJ3 3O8YA 4HM2B 4N6OB 1N8QA 2XGLA 1YJ93 1IT7A 4MMZB 4OK0A 1RJOA 2ZL8A 3GAXA 1UUVB 4PEJA 3FSDA 3QK9A 1KSIA 1JN5A 1STDA 1E97A 1GY6A 1YGEA 3JVCA 2K0MA 1Z1SA 4FMDA 4O3VA 2GEYA 5CXOA 1OF5B 4R9KA 4EYCA 5KP4A 3LOYA 3D3LA 3HK4A 4TX4A 3LH4A 3N9HA 4KVHA 4U13A 1JN5B 1VZZA 1DMQA 3F8HA 3EJVA 1TUHA 3G16A 1WMPA 3GZXB 3CCU3 3F40A 4OVMA 1NB5I 3EHCA 1WMOA 5EEOA 1W7CA 1DMMA 4HYZA 5AYSC 5IF6A 3GZBA 1S5AA 1Q814 2XSOB 5A0OB 2CKFB 4N6NB 3NXJA 3FZWA 3FF2A 1L5GB 3Q90A 1M904 1IT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYS C;  5AYR B;  2KCD A;  3WDG B; 
#chains in the Genus database with same CATH topology
 2OTL 3;  5EVH A;  2WO0 A;  1I0V A;  3UJM A;  3WOD G;  2XEP A;  3NQZ A;  3MYT A;  4WFO A;  5M18 A;  1U8C B;  1UUW B;  3IJE B;  1RRL A;  2GEX A;  1D6Y A;  5AIG A;  3AHW A;  1RGG A;  3KCH A;  1TU5 A;  1E3R A;  1O7W B;  3ZG0 A;  3EBY A;  3F7X A;  1K73 4;  2OQE C;  1B27 A;  2Z6B A;  1W6C A;  1G0T A;  1A2K A;  3DGM A;  2F86 B;  1PYL A;  2CK3 H;  4HM7 B;  1SIH A;  4HZB B;  4X2O A;  5IG5 A;  1GD3 A;  1BNS A;  1QJG A;  3FCS B;  1KQS 2;  2RCD A;  1VQM 3;  2MC8 A;  4HM4 B;  1BSB A;  3OW2 2;  1CYU A;  1NNV A;  3DUK A;  3KE7 A;  3BU4 A;  2WGQ A;  2KRT A;  1PY3 A;  3ZFZ A;  1N9J A;  4J8T A;  2H0G A;  2W04 A;  2JDI H;  1I2F A;  1IK3 A;  4GB5 A;  3NV0 B;  3LZA A;  1W02 A;  3I0Y A;  3X42 A;  5BXQ A;  1DMN A;  3MHE A;  2W9P A;  3LT9 A;  5ELJ A;  1O7H B;  2CW9 A;  3CPO A;  1WTH A;  3V98 A;  2H0H A;  1NO3 A;  1GS3 A;  2MF7 A;  4IPB A;  4HM8 B;  4MEI A;  3DY5 A;  4FMA A;  3X40 A;  2M7O A;  1STF I;  1ULI B;  5IW9 A;  1YVS A;  1JKG A;  3ECF A;  3UL5 A;  3VF1 A;  3UNL A;  1OH0 A;  2P0X A;  1OPY A;  3LTC A;  3T8U A;  2FNQ A;  3GRD A;  5D83 A;  2B24 B;  3WA2 X;  1SJW A;  2ML5 A;  1VQP 3;  3PS8 A;  2BMQ B;  4RNY A;  1JNQ A;  2JQ5 A;  5LC6 A;  3S28 A;  1BNG A;  4LGQ A;  3JUM A;  3FF0 A;  5IER A;  3SYU A;  1YI2 3;  1Q7Y 4;  1N8R 4;  3K7C A;  2AAD A;  4WYK B;  5I97 A;  2CH9 A;  2A15 A;  2C10 A;  1N5H A;  1UCK A;  1V57 A;  1ZS7 A;  4N6M A;  5JBS A;  1JBS A;  3V99 A;  1RDS A;  1VQ5 3;  3DGL A;  4HJL B;  1T2H A;  3OXA A;  6STD A;  2KXG A;  3BLZ A;  1I2G A;  1MOL A;  1RN1 A;  1OHP A;  3CU3 A;  2FGT A;  3WA3 A;  1ASK A;  2H0I A;  1RGC A;  3HX8 A;  4N6U A;  5AIF A;  1NJI 4;  3WOE B;  1WQL B;  4RZM A;  1A90 A;  2ZDJ A;  2CWV A;  4EV5 A;  2D1W A;  2R41 A;  4MJD A;  3GZR A;  4STD A;  4HM1 B;  2RNT A;  2XR8 B;  1UI7 A;  1IV9 A;  1BRN L;  1OGX A;  4KFF A;  2CG1 A;  4EW5 A;  1Q7H A;  1PFP A;  5CF1 A;  2E2V A;  1VQL 3;  1UGH I;  1FGM A;  2QGU A;  3URP A;  1RRH A;  1W2Z A;  1VQN 3;  8RNT A;  1YJW 3;  1GMP A;  4K90 B;  2P0M A;  1S72 3;  3K63 A;  3AMO B;  1M1X B;  5ELU A;  1VQ9 3;  1Q40 B;  3KII A;  1JKG B;  2INX A;  1W6G A;  3RGR A;  3UB1 A;  3G71 3;  2YX9 A;  3DGY A;  3IPT A;  4QWT A;  3X3Z A;  4NHF A;  3PXM A;  1ROV A;  1W2B 2;  3KZT A;  1UI8 A;  2BHM A;  3KSP A;  5BVB A;  1QMA A;  1JB4 A;  4EBG A;  3CNX A;  1HKX A;  2XFS A;  2BNG A;  3Q1C A;  2CG0 A;  3G4S 3;  1Q40 A;  7STD A;  3LYG A;  3DMC A;  1IDP A;  1RHL A;  5CF2 A;  2K54 A;  3HIG A;  3LML A;  1LOX A;  1US1 A;  1NDO B;  3MSO A;  3M8C A;  1BGS A;  5AIH A;  3SOA A;  1LNH A;  3X41 A;  1UW1 A;  1B2M A;  3SLU A;  2GU1 A;  1VQ4 3;  1SAR A;  1RNT A;  4N6V 0;  4X2H A;  3KFQ C;  2O9U X;  4BL2 A;  2XSH B;  1GMQ A;  2W2C A;  2W6J H;  7RNT A;  1BNE A;  2BMR B;  1MWR A;  4EV2 A;  1R4C A;  3NUV A;  1A2V A;  1KD1 4;  3VSY A;  4HZ9 B;  1YGW A;  1VQ7 3;  1YHQ 3;  1DYU A;  1BSA A;  2XF3 A;  1TFO A;  1HZ1 A;  2L1S A;  3BNB A;  3CNM A;  3MG3 A;  5HGR A;  1EQK A;  1NB3 I;  1X1X A;  4J9A A;  1CH0 A;  2RFR A;  5IEP A;  2IUK A;  5AEU B;  1LVN A;  2IMJ A;  2CHC A;  3FG1 A;  3KKG A;  3GZY B;  3AGN A;  4MMY B;  1D6Z A;  3PCS A;  5LC7 A;  3J7Y d;  3E99 A;  1W4N A;  3MG1 A;  1AV4 A;  1FA3 A;  3FG4 A;  4EC6 A;  3FLJ A;  5EQL A;  4RNZ A;  6GSP A;  4HM0 B;  4AKY A;  2HMO B;  5AEW B;  4HBR A;  1N9E A;  3B8L A;  3X3X A;  1K8A 4;  3HOH A;  3NV0 A;  1VQQ A;  4JF8 A;  4LSO A;  4OUQ A;  1FGO A;  3FG3 A;  1FGQ A;  5G1L A;  3OWS A;  3TDG A;  3V92 A;  2W9Q A;  3S67 A;  2ZHX B;  3L0R A;  1G96 A;  3MPH A;  1GD4 A;  4GSP A;  1UCI A;  2SAR A;  2IA7 A;  4KZ1 A;  2CFG A;  2CC3 A;  1U5O A;  1YIT 3;  3CPW 2;  3D9R A;  1RLS A;  1BNR A;  1FUS A;  4XBT A;  4BTW A;  3G8Z A;  1W00 A;  1RCL A;  3EN8 A;  4N6T A;  3T0U A;  3U1W A;  1B3S A;  2F4Y A;  3ER7 A;  3JUN A;  3Q2P A;  2HOH A;  3EX9 A;  1TP6 A;  2O3O A;  3SVA A;  4XBY A;  1FGR A;  4HAA A;  3LTB A;  3WDG B;  1ROA A;  1E3V A;  1FW7 A;  4HM6 B;  3X3Y A;  3CCL 3;  4BL3 A;  3MG2 A;  1W01 A;  3DM8 A;  3UL6 A;  3DGN A;  4IT7 A;  3D5G A;  3BB9 A;  2W03 A;  3DXO A;  5G1K A;  1BRH A;  2HMN B;  2OCT A;  3D4A A;  4G1M B;  1W6Y A;  4R80 A;  1MWT A;  2HMM B;  2B1X B;  3DZL A;  3HII A;  1LOY A;  1IT8 A;  1FYS A;  1OHO A;  2AAE A;  4LMI A;  2FXT A;  3I56 3;  3S5C A;  5BU4 A;  3SXX A;  4CJN A;  5JPP A;  1IU7 A;  3NX0 A;  1OCV A;  1EG9 B;  2HMK B;  1F8N A;  1BUQ A;  1I2E A;  4O8S A;  1FGT A;  4HM3 B;  4ILF A;  3WMD A;  5AYR B;  1M1K 4;  2CWU A;  1IQ8 A;  2IY2 A;  1D6U A;  3KN4 A;  3LTA A;  5IG4 A;  2Z77 A;  1ZO2 A;  3PCR A;  4WWU C;  4IIA A;  1T3B A;  5CK6 A;  1RN4 A;  5DRV A;  3CXC 2;  2LYX A;  2RGQ A;  3HI7 A;  4KFD A;  4WP5 A;  3G0K A;  1UCJ A;  4BTX A;  5KP1 A;  3ROB A;  4KFE A;  3A76 A;  3CC4 3;  2WGO A;  4FCM A;  2CX1 A;  1VQ8 3;  3AMO A;  3EN1 B;  3H3H A;  3FKA A;  1IYY A;  1IVU A;  1Q9E A;  1QVG 2;  2OOV C;  5BIR A;  3B4O A;  2OTJ 3;  3SX1 A;  1RMS A;  1BNF A;  3NM7 A;  2ML6 A;  2GXF A;  1GOY A;  3EF8 A;  1IQX A;  1EKM A;  3BNE A;  3IMA B;  4GL6 A;  1BAO A;  1IV7 A;  1QAF A;  1PU4 A;  3CCS 3;  1J2B A;  1Q42 A;  4LEH A;  3SOY A;  3CD6 3;  1SQW A;  2RSX A;  4XBX A;  2CX0 A;  4DKI A;  2QIY A;  1RGF A;  4CCV A;  4HM5 B;  2XH9 A;  1GYB A;  2SBL A;  4HVN A;  1JRQ A;  3JUP A;  3NM2 A;  1A67 A;  4XM4 A;  1IQY A;  1M9G A;  1B2X A;  1KWI A;  3F8X A;  1DVC A;  1CQS A;  2XFT A;  4FR9 A;  2KF4 A;  1JB2 A;  3RNT A;  3PZW A;  4XDW A;  1K41 A;  1GOU A;  1TJD A;  1JZD A;  3G6E 3;  1K28 A;  3I55 3;  1B2U A;  1T5Y A;  1AR0 A;  2D42 A;  4CDL A;  1OAC A;  1I3F A;  3HZP A;  3LXU X;  4N3V A;  3MWZ A;  2K3D A;  3D5I A;  2GBW B;  1W5Z A;  4LYL B;  1AQZ A;  3B4P A;  1B2Z A;  3N8B A;  4WHA A;  1BSC A;  1C54 A;  1VQK 3;  2C4B A;  1N5P A;  2E2U A;  5RNT A;  2ZA4 A;  4RNT A;  1BOX A;  2BT3 A;  1BNJ A;  1MGW A;  2STD A;  4KT3 B;  2I9W A;  5IG0 A;  2QEX 3;  3CCQ 3;  1DE3 A;  3STD A;  4HOH A;  2LQV A;  4R9L A;  1O7N B;  1RKY A;  1MNL A;  1A2P A;  1YIJ 3;  1QAL A;  2R4I A;  2UUG C;  1HYF A;  3NBJ A;  3H51 A;  2PZV A;  3GSP A;  8CHO A;  1BIR A;  3CCR 3;  1VQO 3;  4FCZ A;  1LQG C;  3D79 A;  3PGB A;  3BND A;  3Q3F A;  1BNI A;  3GWR A;  2V1L A;  3SED A;  3LTD A;  4O02 B;  3DH2 A;  3K9M C;  1SII A;  1UGI A;  1SPU A;  2WOF A;  4O2H A;  3BNC A;  1RTU A;  1ZX2 A;  5AI1 A;  2P38 A;  1X1Y A;  2E2T A;  3K0Z A;  5IEN A;  1BSE A;  4I5Q A;  2CFK A;  1WNH A;  1O7M B;  1UCL A;  5D82 A;  5GSP A;  1OGZ A;  7GSP A;  1TFK A;  1I70 A;  2BMO B;  3EC9 A;  3EB8 A;  1ISK A;  1TTO A;  4BTY A;  4CPK A;  1GY7 A;  1JB5 A;  1CYV A;  3LT8 A;  2GSP A;  1RN7 A;  2Z7A A;  3NQY A;  2F98 A;  1ULJ B;  2W56 A;  4L8O A;  4MMX B;  3CCE 3;  1GMR A;  1K9M 4;  4L8P A;  1BSD A;  2YFJ B;  1I0X A;  2OOV A;  4L7K A;  5M1A A;  1FUW A;  4H61 A;  1DVD A;  1BU4 A;  4GHO A;  1C7H A;  4FCJ A;  1EEJ A;  1O7G B;  3PYJ A;  1LOV A;  1QAK A;  3JUO A;  2Y73 A;  4JRF A;  2GU3 A;  1YNV X;  1YVB I;  2HML B;  2WOH A;  2IYJ A;  3WOF B;  3FH1 A;  3EBT A;  2OWP A;  2Z76 A;  4XB5 A;  1JBT A;  1EUI C;  1FZU A;  2Y74 A;  3S27 A;  1TIJ A;  4J5K A;  5FW5 A;  2J8X B;  3RGA A;  1OHS A;  1BUJ A;  2CFD A;  2KCD A;  4K61 A;  4HKV B;  1AVL A;  1BRK A;  2CFW A;  4R1K A;  5STD A;  1WMN A;  3OWY A;  2CIU A;  5AII A;  2BO9 B;  5KP3 A;  4K1V A;  2CFL A;  3OWU A;  5DRE A;  1Q86 4;  1OF5 A;  6RNT A;  1V74 A;  2UX0 A;  2XGN A;  2BIR A;  2CWT A;  1R4Y A;  4ZM8 A;  1CEW I;  1OUN A;  1I8V A;  1QVF 2;  1B21 A;  3F9S A;  3WR2 A;  1YJN 3;  4RBN A;  2F5W A;  3JUQ A;  4LZI A;  2HMJ B;  3DGO A;  1RGH A;  4ORL A;  5G2G A;  1UDI I;  4I4K A;  4K1U A;  1IVV A;  1TRP A;  1UUG B;  1EA2 A;  2P09 A;  2F56 A;  1BAN A;  3N54 B;  2F99 A;  3QRD A;  5TGN A;  4AKZ A;  1RNB A;  1JV2 B;  2W56 B;  4NPB A;  1O7P B;  5JPU A;  1RGA A;  1HU9 A;  3ZG5 A;  3CME 3;  3K5T A;  3OX9 A;  3CCV 3;  1MGR A;  2KF3 A;  1IVX A;  2C11 A;  1BRS A;  1JZO A;  1LRA A;  1NU3 A;  1B20 A;  3EQQ B;  4J5G A;  2IUJ A;  2YFL B;  3CC7 3;  3F14 A;  3F7S A;  4N6L A;  1GOV A;  3MKI A;  5D81 A;  3NBR A;  1GY5 A;  3EE1 A;  5FGO A;  3U97 A;  2GBX B;  5CLK A;  1JJ2 2;  3ALA A;  4FMB A;  2QA4 3;  1RGE A;  3CCM 3;  2PNC A;  1BRJ A;  4H3U A;  1G02 A;  3T8N A;  1BRI A;  1LOW A;  1VQ6 3;  4AEQ A;  4NRE A;  4WYK A;  2YFI B;  3NBB A;  2OQE A;  3VGN A;  1I3I A;  4FMC A;  1AVK A;  4Q53 A;  3OV4 A;  1MWS A;  2P05 A;  2XRX B;  1X1U A;  3AHS A;  1BRG A;  3FGY A;  3KSE D;  4R4K A;  4XDV A;  3WHO A;  3S29 A;  1LXE A;  5IEO A;  3B7C A;  3CMA 3;  4EXR A;  2KF6 A;  2W0Q A;  2KF5 A;  1IVW A;  2L4V A;  3RDE A;  1Q82 4;  1NWW A;  1Y4K A;  3NHX A;  1DET A;  1KC8 4;  1GSP A;  4BIR A;  2Q07 A;  5IG3 A;  3CC2 3;  3CCJ 3;  1V58 A;  3O8Y A;  4HM2 B;  1MWU A;  1X1W A;  4N6O B;  1N8Q A;  4BU4 A;  5HOH A;  2F5M A;  2XGL A;  1TRQ A;  1YJ9 3;  1IT7 A;  4MMZ B;  4OK0 A;  1T2I A;  1RJO A;  2ZL8 A;  3GAX A;  1UUV B;  2KAA A;  4PEJ A;  3FSD A;  3QK9 A;  1KSI A;  1JN5 A;  1STD A;  1LQM B;  1E97 A;  1GY6 A;  1YGE A;  3JVC A;  1LNI A;  2K0M A;  2BU4 A;  1Z1S A;  4FMD A;  4O3V A;  2GEY A;  1RSN A;  5CXO A;  1OF5 B;  4R9K A;  4EYC A;  9RNT A;  5KP4 A;  1B2S A;  3LOY A;  3D3L A;  3BIR A;  3HK4 A;  1FUT A;  4TX4 A;  3LH4 A;  2RBI A;  1RGL A;  1ZGX A;  3N9H A;  4KVH A;  4U13 A;  1JN5 B;  5M19 A;  1VZZ A;  1DMQ A;  3F8H A;  1BVI A;  1TUH A;  3EJV A;  1WMP A;  3G16 A;  3GZX B;  3F40 A;  3AGO A;  3CCU 3;  4OVM A;  1NB5 I;  1JBR A;  3EHC A;  1WMO A;  5EEO A;  1W7C A;  1DMM A;  4HYZ A;  3A5E A;  5AYS C;  5IF6 A;  1RCK A;  3GZB A;  1S5A A;  1Q81 4;  2UGI A;  2XSO B;  5A0O B;  2CKF B;  4N6N B;  1RGK A;  3NXJ A;  3FZW A;  3FF2 A;  1L5G B;  3Q90 A;  1M90 4;  1AY7 A; 
#chains in the Genus database with same CATH homology
 2OTL 3;  5EVH A;  2WO0 A;  3UJM A;  3WOD G;  2XEP A;  3NQZ A;  3MYT A;  4WFO A;  1U8C B;  1UUW B;  3IJE B;  1RRL A;  2GEX A;  1D6Y A;  5AIG A;  1TU5 A;  1E3R A;  1O7W B;  3EBY A;  3F7X A;  1K73 4;  2OQE C;  2Z6B A;  1W6C A;  1A2K A;  3DGM A;  2F86 B;  2CK3 H;  4HM7 B;  4HZB B;  1SIH A;  4X2O A;  5IG5 A;  1GD3 A;  1QJG A;  3FCS B;  1KQS 2;  2RCD A;  2MC8 A;  4HM4 B;  3OW2 2;  1CYU A;  3DUK A;  3KE7 A;  2WGQ A;  2KRT A;  1N9J A;  4J8T A;  2W04 A;  2JDI H;  1IK3 A;  4GB5 A;  3NV0 B;  3LZA A;  1W02 A;  3I0Y A;  3X42 A;  5BXQ A;  1DMN A;  3MHE A;  2W9P A;  3LT9 A;  5ELJ A;  1O7H B;  2CW9 A;  3CPO A;  1WTH A;  3V98 A;  1NO3 A;  1GS3 A;  2MF7 A;  4IPB A;  4HM8 B;  4MEI A;  3DY5 A;  4FMA A;  3X40 A;  2M7O A;  1STF I;  1ULI B;  5IW9 A;  1JKG A;  3ECF A;  3UL5 A;  3VF1 A;  3UNL A;  1OH0 A;  2P0X A;  1OPY A;  3LTC A;  3T8U A;  2FNQ A;  3GRD A;  5D83 A;  2B24 B;  3WA2 X;  1SJW A;  2ML5 A;  1VQP 3;  3PS8 A;  2BMQ B;  4RNY A;  1JNQ A;  2JQ5 A;  5LC6 A;  3S28 A;  4LGQ A;  3JUM A;  3FF0 A;  5IER A;  1YI2 3;  1Q7Y 4;  1N8R 4;  3K7C A;  4WYK B;  5I97 A;  2CH9 A;  2A15 A;  2C10 A;  1N5H A;  4N6M A;  5JBS A;  3V99 A;  1VQ5 3;  3DGL A;  4HJL B;  3OXA A;  6STD A;  2KXG A;  3BLZ A;  1MOL A;  1OHP A;  3CU3 A;  2FGT A;  3WA3 A;  1ASK A;  3HX8 A;  4N6U A;  5AIF A;  1NJI 4;  3WOE B;  1WQL B;  1A90 A;  2ZDJ A;  2CWV A;  4EV5 A;  2D1W A;  4MJD A;  3GZR A;  4STD A;  4HM1 B;  2XR8 B;  1UI7 A;  1IV9 A;  1OGX A;  4KFF A;  2CG1 A;  5CF1 A;  1PFP A;  2E2V A;  1VQL 3;  1FGM A;  2QGU A;  1RRH A;  1W2Z A;  1VQN 3;  1YJW 3;  4K90 B;  2P0M A;  1S72 3;  3K63 A;  3AMO B;  1M1X B;  5ELU A;  1VQ9 3;  1Q40 B;  3KII A;  1JKG B;  2INX A;  1W6G A;  3RGR A;  3UB1 A;  3G71 3;  2YX9 A;  3IPT A;  4QWT A;  3X3Z A;  4NHF A;  3PXM A;  1ROV A;  1W2B 2;  3KZT A;  1UI8 A;  2BHM A;  3KSP A;  5BVB A;  1QMA A;  1JB4 A;  4EBG A;  3CNX A;  1HKX A;  2XFS A;  2BNG A;  3Q1C A;  2CG0 A;  3G4S 3;  1Q40 A;  7STD A;  3LYG A;  3DMC A;  1IDP A;  5CF2 A;  2K54 A;  3HIG A;  3LML A;  1LOX A;  1US1 A;  1NDO B;  3MSO A;  3M8C A;  5AIH A;  3SOA A;  1LNH A;  3X41 A;  1UW1 A;  3SLU A;  2GU1 A;  1VQ4 3;  4N6V 0;  4X2H A;  3KFQ C;  2O9U X;  2XSH B;  2W2C A;  2W6J H;  2BMR B;  4EV2 A;  1R4C A;  3NUV A;  1A2V A;  1KD1 4;  3VSY A;  4HZ9 B;  1VQ7 3;  1YHQ 3;  1DYU A;  2XF3 A;  3BNB A;  1TFO A;  3CNM A;  3MG3 A;  5HGR A;  1EQK A;  1NB3 I;  4J9A A;  2RFR A;  5IEP A;  2IUK A;  5AEU B;  1LVN A;  2IMJ A;  2CHC A;  3FG1 A;  3KKG A;  3GZY B;  4MMY B;  1D6Z A;  3PCS A;  5LC7 A;  3J7Y d;  3E99 A;  1W4N A;  3MG1 A;  1AV4 A;  1FA3 A;  3FG4 A;  4EC6 A;  3FLJ A;  5EQL A;  4RNZ A;  4HM0 B;  4AKY A;  2HMO B;  5AEW B;  4HBR A;  1N9E A;  3B8L A;  3X3X A;  1K8A 4;  3NV0 A;  4JF8 A;  4LSO A;  4OUQ A;  1FGO A;  3FG3 A;  1FGQ A;  3OWS A;  3TDG A;  3V92 A;  2W9Q A;  3S67 A;  3L0R A;  1G96 A;  3MPH A;  1GD4 A;  2IA7 A;  4KZ1 A;  2CFG A;  2CC3 A;  1U5O A;  1YIT 3;  3CPW 2;  3D9R A;  4XBT A;  4BTW A;  3G8Z A;  1W00 A;  3EN8 A;  3U1W A;  4N6T A;  3T0U A;  3ER7 A;  3JUN A;  3Q2P A;  3EX9 A;  1TP6 A;  2O3O A;  3SVA A;  4XBY A;  1FGR A;  3WDG B;  3LTB A;  1ROA A;  1E3V A;  4HM6 B;  3X3Y A;  3CCL 3;  3MG2 A;  1W01 A;  3DM8 A;  3UL6 A;  3DGN A;  4IT7 A;  3BB9 A;  2W03 A;  3DXO A;  2HMN B;  2OCT A;  4G1M B;  1W6Y A;  4R80 A;  2HMM B;  2B1X B;  3DZL A;  3HII A;  1OHO A;  4LMI A;  2FXT A;  3I56 3;  3S5C A;  3SXX A;  5JPP A;  1IU7 A;  3NX0 A;  1OCV A;  1EG9 B;  2HMK B;  1F8N A;  1BUQ A;  4O8S A;  1FGT A;  4HM3 B;  3WMD A;  5AYR B;  1M1K 4;  2CWU A;  1IQ8 A;  1D6U A;  3KN4 A;  3LTA A;  5IG4 A;  2Z77 A;  1ZO2 A;  3PCR A;  4WWU C;  4IIA A;  5CK6 A;  3CXC 2;  5DRV A;  2LYX A;  2RGQ A;  3HI7 A;  4KFD A;  4WP5 A;  3G0K A;  5KP1 A;  4BTX A;  3ROB A;  4KFE A;  3A76 A;  3CC4 3;  2WGO A;  4FCM A;  1VQ8 3;  3AMO A;  3EN1 B;  3H3H A;  3FKA A;  1IVU A;  1QVG 2;  2OOV C;  2OTJ 3;  3B4O A;  3SX1 A;  3NM7 A;  2ML6 A;  2GXF A;  3EF8 A;  4RZM A;  1IQX A;  1EKM A;  3BNE A;  3IMA B;  4GL6 A;  1IV7 A;  1QAF A;  1PU4 A;  3CCS 3;  1J2B A;  1Q42 A;  4LEH A;  3SOY A;  3CD6 3;  1SQW A;  2RSX A;  4XBX A;  2QIY A;  4CCV A;  4HM5 B;  2XH9 A;  1GYB A;  2SBL A;  4HVN A;  1JRQ A;  3JUP A;  3NM2 A;  1A67 A;  4XM4 A;  1IQY A;  1M9G A;  1KWI A;  3F8X A;  1DVC A;  1CQS A;  2XFT A;  4FR9 A;  1JB2 A;  3PZW A;  4XDW A;  1K41 A;  3G6E 3;  1K28 A;  3I55 3;  1T5Y A;  1AR0 A;  2D42 A;  4CDL A;  1OAC A;  3HZP A;  3LXU X;  4N3V A;  3MWZ A;  1VQM 3;  2GBW B;  1W5Z A;  4WHA A;  3B4P A;  3N8B A;  1VQK 3;  1N5P A;  2E2U A;  2QEX 3;  2BT3 A;  3CCQ 3;  2STD A;  5IG0 A;  2I9W A;  3STD A;  2LQV A;  4R9L A;  1O7N B;  1RKY A;  1MNL A;  1YIJ 3;  1QAL A;  2R4I A;  3NBJ A;  3H51 A;  2PZV A;  1VQO 3;  8CHO A;  3CCR 3;  4FCZ A;  3PGB A;  3BND A;  3GWR A;  2V1L A;  3SED A;  3LTD A;  4O02 B;  3K9M C;  1SII A;  1SPU A;  2WOF A;  4O2H A;  3BNC A;  1ZX2 A;  5AI1 A;  2P38 A;  2E2T A;  3K0Z A;  5IEN A;  2CFK A;  1WNH A;  1O7M B;  5D82 A;  1OGZ A;  1TFK A;  2BMO B;  3EB8 A;  3EC9 A;  1ISK A;  4BTY A;  1GY7 A;  1JB5 A;  1CYV A;  3LT8 A;  1RN7 A;  2Z7A A;  3NQY A;  2F98 A;  1ULJ B;  2W56 A;  4L8O A;  4MMX B;  3CCE 3;  1K9M 4;  4L8P A;  2YFJ B;  2OOV A;  4L7K A;  1FUW A;  4H61 A;  1DVD A;  1C7H A;  4FCJ A;  1O7G B;  3PYJ A;  1QAK A;  3JUO A;  2Y73 A;  4JRF A;  2GU3 A;  2HML B;  1YVB I;  2WOH A;  3WOF B;  3FH1 A;  3EBT A;  2OWP A;  2Z76 A;  4XB5 A;  2Y74 A;  3S27 A;  1TIJ A;  5FW5 A;  3RGA A;  1OHS A;  2CFD A;  2KCD A;  4K61 A;  4HKV B;  1AVL A;  2CFW A;  4R1K A;  5STD A;  1WMN A;  3OWY A;  2CIU A;  5AII A;  2BO9 B;  5KP3 A;  4K1V A;  2CFL A;  3OWU A;  5DRE A;  1Q86 4;  1OF5 A;  1V74 A;  2UX0 A;  2XGN A;  2CWT A;  4ZM8 A;  1CEW I;  1OUN A;  1QVF 2;  3F9S A;  1YJN 3;  4RBN A;  3JUQ A;  4LZI A;  2HMJ B;  3DGO A;  4ORL A;  5G2G A;  4I4K A;  4K1U A;  1IVV A;  2P09 A;  1EA2 A;  3N54 B;  5TGN A;  2F99 A;  3QRD A;  4AKZ A;  1JV2 B;  2W56 B;  1O7P B;  5JPU A;  3CME 3;  1HU9 A;  3K5T A;  3OX9 A;  3CCV 3;  1IVX A;  2C11 A;  1NU3 A;  3EQQ B;  2IUJ A;  2YFL B;  3CC7 3;  3F14 A;  3F7S A;  4N6L A;  3MKI A;  5D81 A;  3NBR A;  1GY5 A;  3EE1 A;  5FGO A;  3U97 A;  2GBX B;  5CLK A;  1JJ2 2;  3ALA A;  4FMB A;  2QA4 3;  3CCM 3;  2PNC A;  4H3U A;  3T8N A;  1VQ6 3;  4AEQ A;  4NRE A;  4WYK A;  2YFI B;  3NBB A;  2OQE A;  3VGN A;  4FMC A;  4Q53 A;  1AVK A;  3OV4 A;  2P05 A;  4R4K A;  2XRX B;  4XDV A;  3FGY A;  3KSE D;  3S29 A;  1LXE A;  5IEO A;  3B7C A;  3CMA 3;  4EXR A;  2W0Q A;  1IVW A;  2L4V A;  3RDE A;  1Q82 4;  1NWW A;  1Y4K A;  3NHX A;  1KC8 4;  2Q07 A;  5IG3 A;  3CC2 3;  3CCJ 3;  3O8Y A;  4HM2 B;  4N6O B;  1N8Q A;  2XGL A;  1YJ9 3;  1IT7 A;  4MMZ B;  4OK0 A;  1RJO A;  2ZL8 A;  3GAX A;  1UUV B;  4PEJ A;  3FSD A;  3QK9 A;  1KSI A;  1JN5 A;  1STD A;  1E97 A;  1GY6 A;  1YGE A;  3JVC A;  2K0M A;  1Z1S A;  4FMD A;  4O3V A;  2GEY A;  5CXO A;  1OF5 B;  4R9K A;  4EYC A;  5KP4 A;  3LOY A;  3D3L A;  3HK4 A;  4TX4 A;  3LH4 A;  3N9H A;  4KVH A;  4U13 A;  1JN5 B;  1VZZ A;  1DMQ A;  3F8H A;  3EJV A;  1TUH A;  3G16 A;  1WMP A;  3GZX B;  3CCU 3;  3F40 A;  4OVM A;  1NB5 I;  3EHC A;  1WMO A;  5EEO A;  1W7C A;  1DMM A;  4HYZ A;  5AYS C;  5IF6 A;  3GZB A;  1S5A A;  1Q81 4;  2XSO B;  5A0O B;  2CKF B;  4N6N B;  3NXJ A;  3FZW A;  3FF2 A;  1L5G B;  3Q90 A;  1M90 4;  1IT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...