2KCDA

Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SSP0047
publication title Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2kcdA00
3WDGB 5AYRB 2KCDA 5AYSC
chains in the Genus database with same CATH superfamily
3TDGA 3UNLA 4NHFA 3WMDA 5IERA 3K5TA 4WYKA 5AYSC 2OQEC 2W9QA 2D1WA 3OX9A 1GSPA 3MSOA 3ZG5A 4HYZA 1STDA 2GEXA 1YVBI 3DGYA 1W6YA 3STDA 3NX0A 3WHOA 3LZAA 4MEIA 5DREA 5JPUA 3WA2X 1QAFA 1UDII 3GZYB 3MYTA 3S27A 4BU4A 2HMOB 1K28A 2P38A 1IU7A 3G0KA 4MJDA 4N6OB 1UCIA 4GB5A 2WOFA 3G4S3 1YJ93 3U1WA 2HMJB 3F14A 2R41A 1IVUA 1RGLA 1SIIA 1KWIA 1Q7HA 1ZX2A 2BU4A 3EC9A 2C11A 3B8LA 5CF1A 5IF6A 2BIRA 2BHMA 3LH4A 2KF3A 1RNBA 1GOYA 3PXMA 1JKGB 4WWUC 3SVAA 1N8R4 2HOHA 3NQYA 4KFEA 1KC84 3MKIA 4HM4B 5CLKA 3EN1B 5HOHA 2YFJB 1LNIA 8RNTA 4GSPA 3DGLA 3I553 4N3VA 1R4CA 1IK3A 2KXGA 5EQLA 4PEJA 1IV7A 4O2HA 1A2PA 2LQVA 1TU5A 2Q07A 2F4YA 5LC6A 4IIAA 1MWTA 3NHXA 4RNTA 5IG3A 1I8VA 4LZIA 1WTHA 2OQEA 1K9M4 2Y74A 1W5ZA 1JV2B 1QVG2 4HJLB 4BIRA 3NQZA 1U8CB 5ELJA 3PS8A 3NM2A 2V1LA 1JJ22 1GYBA 3GZBA 1AY7A 2IY2A 5I97A 1BRNL 4Q53A 5IG4A 1BRJA 3S28A 3MHEA 1BUQA 1OHPA 3FG4A 2BMOB 2P0MA 4HM2B 1UW1A 2XH9A 3DMCA 3Q1CA 2CG1A 3DGMA 4FCJA 1CEWI 1VQQA 3K7CA 4EW5A 4EV5A 1EQKA 1VQN3 1HKXA 3UL6A 1UI7A 2CG0A 3F7XA 3DXOA 1I2FA 1TP6A 5CK6A 3LMLA 1BANA 1EEJA 3MPHA 1JKGA 3DY5A 2CHCA 2WGOA 4HM1B 3X41A 4BL2A 3IPTA 4N6NB 3WODG 3GAXA 3CCM3 3CCV3 2IUKA 1BGSA 4JRFA 1MWRA 1RDSA 1GMPA 2JQ5A 2MF7A 2KRTA 3M8CA 5M1AA 5CXOA 4HBRA 4RBNA 3RNTA 5AEWB 3FG3A 1T2IA 1OACA 1VQK3 1NU3A 2P09A 1QVF2 4GHOA 1LQMB 3S29A 1LOXA 3WA3A 4DKIA 3HIIA 2RBIA 3ZFZA 4XDVA 1WMOA 1IQXA 2H0IA 4L7KA 1MGRA 3EBTA 3JUPA 4EC6A 2J8XB 3CC73 1ZS7A 4WFOA 1VQL3 1OHSA 2K54A 4FCMA 3AMOB 1SJWA 1U5OA 3FCSB 1M904 1AR0A 4R80A 1EUIC 4WYKB 3JUNA 3NV0B 4HAAA 1VQP3 2PZVA 1CH0A 1IVWA 1Q42A 4FR9A 4HM0B 3WDGB 3I0YA 3LT9A 1B3SA 1BRKA 1IQ8A 1NJI4 1W4NA 4O3VA 2KF5A 3EBYA 1D6ZA 4HM3B 3CPW2 3FSDA 1FGTA 1DVDA 3RDEA 1A2VA 3DZLA 5M19A 4CPKA 5CF2A 4N6LA 2F5WA 1W2ZA 1I0VA 1BNJA 3LT8A 1W2B2 1B2MA 3HIGA 4STDA 4L8PA 4LEHA 1FW7A 1NB5I 2KAAA 4WP5A 1FGOA 1RGGA 3SEDA 5IEOA 1UCJA 1OPYA 2UGIA 3J7Yd 2Y73A 1V74A 1Q40A 4LGQA 2QGUA 1RRHA 1FGRA 3FG1A 1KD14 1I2GA 1ULIB 2CX1A 5BVBA 1L5GB 1D6UA 1Q7Y4 1JB5A 4HOHA 1GY5A 3VSYA 2GBXB 3NV0A 3GSPA 3OWSA 2YX9A 3PYJA 1W6CA 1BVIA 3GZXB 2Z77A 3B7CA 3OXAA 4K90B 1RJOA 5LC7A 2BNGA 3IMAB 2BMQB 5BXQA 1RN1A 4LSOA 4LMIA 1GD4A 2W2CA 3FKAA 2CW9A 1VZZA 4U13A 1OH0A 3KIIA 3X3YA 4CDLA 4R4KA 1M1XB 2KF4A 5AI1A 4ZM8A 1B2SA 9RNTA 2P05A 1R4YA 3FGYA 5BIRA 1ZO2A 1NDOB 1TJDA 3KFQC 1BSBA 6GSPA 4LYLB 3LOYA 2XFSA 4RNYA 4CJNA 3GZRA 1WMNA 1D6YA 2F5MA 1RCKA 3LTBA 4KFFA 1K8A4 3EQQB 2ML6A 3EF8A 3CD63 1B20A 1ROVA 3EN8A 3JUOA 3MG3A 3Q90A 4HKVB 4XM4A 3PCSA 1BOXA 3D5GA 3EE1A 1GY6A 2C4BA 3E99A 4KZ1A 1X1YA 6RNTA 1FYSA 2W56B 2CH9A 1B21A 1DVCA 1JZOA 2K0MA 4N6MA 3G16A 3BU4A 5FGOA 3WR2A 2UUGC 3F40A 1OGZA 3NUVA 1UCKA 3ROBA 4EXRA 5DRVA 1YJN3 2OTJ3 3MWZA 4EV2A 1VQM3 3RGAA 3K0ZA 2ZDJA 1FUWA 2OOVC 3OWUA 7STDA 4CCVA 1FZUA 2CK3H 4O02B 1YVSA 3EHCA 3AGNA 4XBTA 1DMQA 4HVNA 2OWPA 1BIRA 1BAOA 3S5CA 5G1LA 3A76A 3HOHA 1UUGB 1BNRA 2IYJA 3KKGA 3F9SA 1YI23 5D83A 3SYUA 3D9RA 1LOYA 2F56A 3LTCA 4N6V0 3BLZA 3N8BA 4QWTA 1TUHA 5G2GA 1W01A 1DE3A 2QIYA 3DUKA 3K63A 4BTWA 2E2TA 1VQO3 2GXFA 3KZTA 3CMA3 1BSCA 2UX0A 2Z7AA 1IQYA 2WO0A 3BNCA 2A15A 4OK0A 4J8TA 4H3UA 1GD3A 2XSHB 1ASKA 1RSNA 1CQSA 5IW9A 1PY3A 2W03A 1JBRA 2W56A 3CNXA 1N5HA 1W7CA 4J5KA 3SOYA 1LOWA 2F99A 1MOLA 3MG1A 4NPBA 3FH1A 2QA43 1E3RA 2CKFB 2W6JH 3FZWA 3NM7A 5IG0A 1HZ1A 1YNVX 2STDA 3H3HA 1E97A 1YGWA 3NBBA 5AIIA 2FGTA 3T8NA 1IDPA 4KFDA 1IT8A 4ORLA 3CXC2 2ZHXB 2OOVA 4RZMA 5D81A 2AADA 3OW22 2OTL3 3DGOA 4J5GA 3MG2A 2XRXB 1Q40B 4MMZB 3CCR3 2XEPA 1TIJA 1BSAA 3UL5A 3V99A 4TX4A 3CME3 1HU9A 4J9AA 4BTXA 4R1KA 3KCHA 3NBJA 1Q824 1F8NA 1JBSA 1BUJA 2XGLA 2RGQA 2Z6BA 1UUVB 1BNEA 3CCS3 1WMPA 1T3BA 1LQGC 2CFWA 2I9WA 3ECFA 3D4AA 4I4KA 5D82A 3ZG0A 1W00A 3SXXA 1FUSA 1K41A 3HX8A 2CC3A 2FXTA 2R4IA 3AHWA 3B4PA 1GS3A 1PU4A 2K3DA 3URPA 2XR8B 1OF5A 2OCTA 4XBYA 5G1KA 2P0XA 3X40A 1YJW3 1UI8A 1RGAA 3CNMA 3LYGA 4X2HA 2RNTA 1VQ93 4N6TA 3FF2A 2XFTA 3AGOA 1BSEA 1QJGA 5TGNA 2HMLB 3UB1A 5A0OB 3LTAA 4X2OA 4GL6A 1KQS2 1LRAA 1W6GA 3KE7A 1I0XA 4HM8B 5FW5A 1ULJB 4EBGA 4HZBB 1BNSA 1GY7A 4XB5A 4RNZA 4G1MB 1ROAA 1BSDA 1JNQA 1IV9A 2XSOB 3QK9A 1JB2A 1RHLA 1O7MB 1A2KA 1RRLA 3EX9A 3VGNA 2BT3A 2QEX3 1VQ63 3KSPA 1ZGXA 1IYYA 3N9HA 5KP1A 1NNVA 3N54B 3G6E3 4L8OA 2L1SA 3LXUX 1Q9EA 1O7GB 4I5QA 1DMNA 2GEYA 3SLUA 4JF8A 2BMRB 1FA3A 3G8ZA 1RN7A 1OCVA 1T2HA 1NB3I 1SQWA 5ELUA 1GMQA 4NREA 3OWYA 1JN5A 3H51A 5IEPA 1NO3A 3LTDA 4ILFA 4FMAA 1C54A 2F86B 2RFRA 1VQ53 5IENA 1GOUA 1AVLA 1TTOA 3F7SA 2W04A 3DH2A 2CWVA 3QRDA 1RGCA 4BTYA 1O7NB 1LNHA 3G713 3EJVA 4BL3A 4K61A 3DM8A 1G96A 1PYLA 2KCDA 1YHQ3 1HYFA 3BNEA 3HK4A 4AKZA 1DYUA 1YIJ3 1BNGA 2CFGA 3X42A 1OGXA 1BRGA 2HMKB 3OV4A 4MMYB 1E3VA 1KSIA 5AIGA 2SARA 2RCDA 1YGEA 3CCE3 1IVVA 1BNFA 3T8UA 3Q3FA 4OVMA 3RGRA 1CYUA 4KT3B 4HZ9B 2AAEA 2IUJA 1SARA 2D42A 2WGQA 1I3FA 1NWWA 3BIRA 2BO9B 5AEUB 1RKYA 1I3IA 2FNQA 1PFPA 1BRIA 5KP4A 3GRDA 1LVNA 1RGHA 1S5AA 3X3ZA 3FF0A 5IG5A 1VQ73 2H0HA 3JVCA 3HZPA 1MWUA 1M1K4 1JZDA 2M7OA 1X1WA 3JUMA 2CX0A 2GBWB 1N5PA 2XGNA 1RCLA 1X1XA 1BU4A 1MWSA 4WHAA 5EEOA 3WOFB 1JBTA 3SOAA 3CCU3 2O9UX 5GSPA 4R9LA 1N9EA 1DETA 1RGFA 1J2BA 2O3OA 2MC8A 5AIFA 1V57A 1VQ43 5AYRB 1OF5B 1S723 1SIHA 3UJMA 1JRQA 2GU3A 2PNCA 3EB8A 4FMBA 5JBSA 4FMDA 4AKYA 3GWRA 1FUTA 4O8SA 3D3LA 2CFKA 3X3XA 3CCQ3 4K1UA 3BB9A 4OUQA 1Y4KA 1UGIA 3F8HA 1GMRA 5STDA 3IJEB 3CPOA 1SPUA 1UUWB 2CIUA 1TRQA 2HMMB 2B1XB 4IT7A 4KVHA 3CCJ3 1BNIA 1VQ83 2B24B 1LXEA 2C10A 3FLJA 1G0TA 3A5EA 3DGNA 4MMXB 1B27A 4N6UA 1OUNA 1JB4A 3JUQA 4IPBA 2RSXA 5RNTA 3I563 2E2UA 3KN4A 4FMCA 3HI7A 1LOVA 2GU1A 4XDWA 1I70A 3PZWA 4EYCA 2ML5A 2XF3A 4AEQA 2ZL8A 1O7HB 1I2EA 5AIHA 3D79A 2L4VA 4FCZA 1AV4A 1O7PB 1RGEA 5KP3A 1C7HA 1CYVA 3D5IA 2W0QA 4HM6B 1T5YA 1IT7A 2IMJA 3L0RA 1TFOA 4K1VA 1Q814 1RGKA 3BNBA 3S67A 2Z76A 5M18A 1QALA 6STDA 1Q864 3U97A 2SBLA 3NXJA 2LYXA 1WQLB 1K734 1JN5B 3Q2PA 2H0GA 1QAKA 2KF6A 2E2VA 1EKMA 1RTUA 1RNTA 2IA7A 1N8QA 1AQZA 1RMSA 2YFLB 1STFI 4XBXA 1AVKA 3SX1A 3WOEB 1DMMA 1OHOA 1EA2A 1B2ZA 1W02A 5EVHA 3B4OA 8CHOA 5BU4A 2JDIH 1MNLA 2INXA 2YFIB 3O8YA 3T0UA 1RN4A 1UCLA 3CC23 3PCRA 1MGWA 3V98A 3ALAA 3BNDA 1N9JA 3F8XA 1TFKA 2F98A 3CU3A 7GSPA 1G02A 2CFDA 3AHSA 3CC43 1O7WB 1YIT3 1B2UA 1ISKA 1A67A 4HM5B 2GSPA 1IVXA 2HMNB 5HGRA 3CCL3 1UGHI 3NBRA 7RNTA 2WOHA 5JPPA 1B2XA 1FGQA 3PGBA 2CWTA 3V92A 1X1UA 3KSED 3VF1A 4H61A 1FGMA 1GOVA 1Z1SA 1EG9B 1RLSA 2W9PA 1BRSA 2CWUA 4HM7B 3ER7A 2ZA4A 4R9KA 2CFLA 1US1A 1WNHA 1BRHA 1QMAA 1A90A 1V58A 3K9MC 3AMOA 1M9GA 1TRPA
chains in the Genus database with same CATH topology
3TDGA 3UNLA 4NHFA 3WMDA 5IERA 3K5TA 4WYKA 5AYSC 2OQEC 2W9QA 2D1WA 3OX9A 3MSOA 4HYZA 1STDA 2GEXA 1YVBI 1W6YA 3STDA 3NX0A 3LZAA 4MEIA 5DREA 5JPUA 3WA2X 1QAFA 3GZYB 3MYTA 3S27A 2HMOB 1K28A 2P38A 1IU7A 3G0KA 4MJDA 4N6OB 4GB5A 2WOFA 3G4S3 1YJ93 3U1WA 2HMJB 3F14A 1IVUA 1SIIA 1ZX2A 1KWIA 3EC9A 5CF1A 1YIT3 2C11A 3B8LA 5IF6A 2BHMA 3LH4A 3PXMA 1JKGB 4WWUC 3SVAA 1N8R4 3NQYA 4KFEA 1KC84 3MKIA 4HM4B 5CLKA 3EN1B 2YFJB 3DGLA 3I553 4N3VA 1R4CA 1IK3A 2KXGA 5EQLA 4PEJA 1IV7A 4O2HA 2LQVA 1TU5A 2Q07A 5LC6A 4IIAA 3NHXA 5IG3A 4LZIA 1WTHA 2OQEA 1K9M4 2Y74A 1W5ZA 1JV2B 1QVG2 4HJLB 3NQZA 1U8CB 5ELJA 3PS8A 3NM2A 2V1LA 1JJ22 1GYBA 3GZBA 5I97A 4Q53A 5IG4A 3S28A 1BUQA 3MHEA 1OHPA 3FG4A 2BMOB 2P0MA 4HM2B 1UW1A 2XH9A 3DMCA 3Q1CA 2CG1A 3DGMA 4FCJA 1CEWI 1EQKA 3K7CA 4EV5A 1VQN3 1HKXA 3UL6A 1UI7A 2CG0A 3F7XA 3DXOA 1TP6A 5CK6A 3LMLA 3MPHA 1JKGA 3DY5A 2CHCA 2WGOA 4HM1B 3X41A 3IPTA 4N6NB 3WODG 3GAXA 3CCM3 3CCV3 2IUKA 4JRFA 2JQ5A 2MF7A 2KRTA 3M8CA 5CXOA 4HBRA 4RBNA 5AEWB 1VQK3 3FG3A 1OACA 1NU3A 2P09A 1QVF2 3S29A 1LOXA 3WA3A 3HIIA 4XDVA 1WMOA 1IQXA 4L7KA 3EBTA 3JUPA 4EC6A 3CC73 4WFOA 1VQL3 1OHSA 2K54A 4FCMA 3AMOB 1SJWA 1U5OA 3FCSB 1M904 1AR0A 4R80A 4WYKB 3JUNA 3NV0B 1VQP3 2PZVA 1IVWA 1Q42A 4FR9A 4HM0B 3WDGB 3I0YA 3LT9A 1IQ8A 1NJI4 1W4NA 4O3VA 3EBYA 1D6ZA 4HM3B 3CPW2 3FSDA 1FGTA 1DVDA 3RDEA 1A2VA 3DZLA 5CF2A 4N6LA 1W2ZA 3LT8A 1W2B2 3HIGA 4STDA 4L8PA 4LEHA 1NB5I 4WP5A 1FGOA 3SEDA 5IEOA 1OPYA 3J7Yd 2Y73A 1V74A 1Q40A 4LGQA 2QGUA 1RRHA 1FGRA 3FG1A 1KD14 1ULIB 5BVBA 1L5GB 1D6UA 1Q7Y4 1JB5A 1GY5A 3VSYA 2GBXB 3NV0A 3OWSA 2YX9A 3PYJA 1W6CA 3GZXB 2Z77A 3B7CA 3OXAA 4K90B 1RJOA 5LC7A 2BNGA 3IMAB 2BMQB 5BXQA 4LSOA 4LMIA 1GD4A 2W2CA 3FKAA 2CW9A 1VZZA 4U13A 1OH0A 3KIIA 3X3YA 4CDLA 4R4KA 1M1XB 5AI1A 4ZM8A 2P05A 3FGYA 1ZO2A 1NDOB 3KFQC 3LOYA 2XFSA 4RNYA 3GZRA 1WMNA 1D6YA 3LTBA 4KFFA 1K8A4 3EQQB 2ML6A 3EF8A 3CD63 1ROVA 3EN8A 3JUOA 3MG3A 3Q90A 4HKVB 4XM4A 3PCSA 3EE1A 4KZ1A 1GY6A 3E99A 2W56B 2CH9A 1DVCA 2K0MA 4N6MA 3G16A 5FGOA 3F40A 3NUVA 1OGZA 3ROBA 4EXRA 5DRVA 1YJN3 2OTJ3 3MWZA 4EV2A 1VQM3 3RGAA 3K0ZA 2ZDJA 1FUWA 2OOVC 3OWUA 7STDA 4CCVA 2CK3H 4O02B 3EHCA 4XBTA 1DMQA 4HVNA 2OWPA 3S5CA 3A76A 3KKGA 3F9SA 1YI23 5D83A 3D9RA 4N6V0 3LTCA 3BLZA 3N8BA 4QWTA 1TUHA 5G2GA 1W01A 2QIYA 3DUKA 3K63A 4BTWA 2E2TA 1VQO3 2GXFA 3KZTA 3CMA3 2UX0A 2Z7AA 1IQYA 2WO0A 3BNCA 2A15A 4OK0A 4J8TA 4H3UA 1GD3A 2XSHB 1ASKA 1CQSA 5IW9A 2W03A 2W56A 3CNXA 1N5HA 1W7CA 3SOYA 2F99A 1MOLA 3MG1A 3FH1A 2QA43 2W6JH 2CKFB 1E3RA 3FZWA 3NM7A 5IG0A 2STDA 3H3HA 1E97A 3NBBA 5AIIA 3T8NA 2FGTA 1IDPA 4KFDA 1IT8A 4ORLA 3CXC2 2OOVA 4RZMA 5D81A 2OTL3 3OW22 3DGOA 3MG2A 2XRXB 1Q40B 4MMZB 3CCR3 2XEPA 1TIJA 3UL5A 3V99A 4TX4A 3CME3 1HU9A 4J9AA 4BTXA 4R1KA 3NBJA 1Q824 1F8NA 2XGLA 2RGQA 2Z6BA 1UUVB 3CCS3 1WMPA 2I9WA 2CFWA 3ECFA 4I4KA 5D82A 1W00A 3SXXA 1K41A 3HX8A 2CC3A 2FXTA 2R4IA 3B4PA 1PU4A 1GS3A 2XR8B 1OF5A 2OCTA 4XBYA 2P0XA 3X40A 1YJW3 1UI8A 3CNMA 3LYGA 4X2HA 1VQ93 4N6TA 3FF2A 2XFTA 5TGNA 1QJGA 3UB1A 2HMLB 5A0OB 3LTAA 4X2OA 4GL6A 1KQS2 5FW5A 1W6GA 3KE7A 4HM8B 1ULJB 4EBGA 4HZBB 1GY7A 4XB5A 4RNZA 4G1MB 1ROAA 1JNQA 1IV9A 2XSOB 3QK9A 1JB2A 3EX9A 1O7MB 1A2KA 1RRLA 3VGNA 2BT3A 2QEX3 1VQ63 3KSPA 3N9HA 5KP1A 3N54B 3G6E3 4L8OA 3LXUX 1O7GB 1DMNA 2GEYA 3SLUA 4JF8A 2BMRB 1FA3A 3G8ZA 1RN7A 1OCVA 1NB3I 1SQWA 5ELUA 4NREA 3OWYA 1JN5A 3H51A 5IEPA 1NO3A 3LTDA 4FMAA 2F86B 2RFRA 1VQ53 5IENA 1AVLA 3F7SA 2W04A 2CWVA 3QRDA 3G713 4BTYA 1O7NB 1LNHA 3EJVA 1YHQ3 4K61A 3DM8A 1G96A 2KCDA 3BNEA 3HK4A 4AKZA 1DYUA 1YIJ3 2CFGA 3X42A 1OGXA 2HMKB 3OV4A 4MMYB 1E3VA 1KSIA 5AIGA 2RCDA 1YGEA 3CCE3 1IVVA 3T8UA 4OVMA 3RGRA 1CYUA 4HZ9B 2IUJA 2D42A 2WGQA 1NWWA 2BO9B 5AEUB 1RKYA 2FNQA 1PFPA 5KP4A 3GRDA 1LVNA 1S5AA 3X3ZA 3FF0A 5IG5A 1VQ73 3JVCA 3HZPA 1M1K4 2M7OA 3JUMA 2GBWB 1N5PA 2XGNA 3WOFB 4WHAA 5EEOA 3SOAA 3CCU3 2O9UX 4R9LA 1N9EA 1J2BA 2O3OA 2MC8A 5AIFA 1VQ43 5AYRB 1OF5B 1S723 1SIHA 3UJMA 1JRQA 2GU3A 2PNCA 3EB8A 4FMBA 5JBSA 4FMDA 4AKYA 3GWRA 4O8SA 3D3LA 2CFKA 3X3XA 3CCQ3 4K1UA 3BB9A 4OUQA 1Y4KA 3F8HA 5STDA 3IJEB 3CPOA 1SPUA 1UUWB 2CIUA 2HMMB 2B1XB 4IT7A 4KVHA 3CCJ3 1VQ83 2B24B 1LXEA 2C10A 3FLJA 3DGNA 4MMXB 4N6UA 1OUNA 1JB4A 3JUQA 4IPBA 2RSXA 3I563 2E2UA 3KN4A 4FMCA 3HI7A 2GU1A 4XDWA 3PZWA 4EYCA 2ML5A 2XF3A 4AEQA 2ZL8A 1O7HB 5AIHA 2L4VA 4FCZA 1AV4A 1O7PB 5KP3A 1C7HA 1CYVA 2W0QA 4HM6B 1T5YA 1IT7A 2IMJA 3L0RA 1TFOA 4K1VA 1Q814 3BNBA 3S67A 2Z76A 1QALA 6STDA 1Q864 3U97A 2SBLA 3NXJA 2LYXA 1WQLB 1K734 1JN5B 3Q2PA 1QAKA 2E2VA 1EKMA 2IA7A 1N8QA 2YFLB 1STFI 4XBXA 1AVKA 3SX1A 3WOEB 1DMMA 1OHOA 1EA2A 1W02A 5EVHA 3B4OA 8CHOA 2JDIH 1MNLA 2INXA 2YFIB 3O8YA 3T0UA 3CC23 3PCRA 3V98A 3ALAA 3BNDA 1N9JA 3F8XA 1TFKA 2F98A 3CU3A 2CFDA 3CC43 1O7WB 1ISKA 1A67A 4HM5B 2HMNB 1IVXA 5HGRA 3CCL3 3NBRA 2WOHA 5JPPA 3V92A 1FGQA 3PGBA 2CWTA 3KSED 3VF1A 4H61A 1FGMA 2W9PA 1Z1SA 1EG9B 2CWUA 4HM7B 3ER7A 4R9KA 2CFLA 1US1A 1WNHA 1QMAA 1A90A 3K9MC 3AMOA 1M9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WDG B;  5AYR B;  2KCD A;  5AYS C; 
#chains in the Genus database with same CATH topology
 3TDG A;  3UNL A;  4NHF A;  3WMD A;  5IER A;  3K5T A;  4WYK A;  5AYS C;  2OQE C;  2W9Q A;  2D1W A;  3OX9 A;  1GSP A;  3MSO A;  3ZG5 A;  4HYZ A;  1STD A;  2GEX A;  1YVB I;  3DGY A;  1W6Y A;  3STD A;  3NX0 A;  3WHO A;  3LZA A;  4MEI A;  5DRE A;  5JPU A;  3WA2 X;  1QAF A;  1UDI I;  3GZY B;  3MYT A;  3S27 A;  4BU4 A;  2HMO B;  1K28 A;  2P38 A;  1IU7 A;  3G0K A;  4MJD A;  4N6O B;  1UCI A;  4GB5 A;  2WOF A;  3G4S 3;  1YJ9 3;  3U1W A;  2HMJ B;  3F14 A;  2R41 A;  1IVU A;  1RGL A;  1SII A;  1KWI A;  1Q7H A;  1ZX2 A;  2BU4 A;  3EC9 A;  2C11 A;  3B8L A;  5CF1 A;  5IF6 A;  2BIR A;  2BHM A;  3LH4 A;  2KF3 A;  1RNB A;  1GOY A;  3PXM A;  1JKG B;  4WWU C;  3SVA A;  1N8R 4;  2HOH A;  3NQY A;  4KFE A;  1KC8 4;  3MKI A;  4HM4 B;  5CLK A;  3EN1 B;  5HOH A;  2YFJ B;  1LNI A;  8RNT A;  4GSP A;  3DGL A;  3I55 3;  4N3V A;  1R4C A;  1IK3 A;  2KXG A;  5EQL A;  4PEJ A;  1IV7 A;  4O2H A;  1A2P A;  2LQV A;  1TU5 A;  2Q07 A;  2F4Y A;  5LC6 A;  4IIA A;  1MWT A;  3NHX A;  4RNT A;  5IG3 A;  1I8V A;  4LZI A;  1WTH A;  2OQE A;  1K9M 4;  2Y74 A;  1W5Z A;  1JV2 B;  1QVG 2;  4HJL B;  4BIR A;  3NQZ A;  1U8C B;  5ELJ A;  3PS8 A;  3NM2 A;  2V1L A;  1JJ2 2;  1GYB A;  3GZB A;  1AY7 A;  2IY2 A;  5I97 A;  1BRN L;  4Q53 A;  5IG4 A;  1BRJ A;  3S28 A;  3MHE A;  1BUQ A;  1OHP A;  3FG4 A;  2BMO B;  2P0M A;  4HM2 B;  1UW1 A;  2XH9 A;  3DMC A;  3Q1C A;  2CG1 A;  3DGM A;  4FCJ A;  1CEW I;  1VQQ A;  3K7C A;  4EW5 A;  4EV5 A;  1EQK A;  1VQN 3;  1HKX A;  3UL6 A;  1UI7 A;  2CG0 A;  3F7X A;  3DXO A;  1I2F A;  1TP6 A;  5CK6 A;  3LML A;  1BAN A;  1EEJ A;  3MPH A;  1JKG A;  3DY5 A;  2CHC A;  2WGO A;  4HM1 B;  3X41 A;  4BL2 A;  3IPT A;  4N6N B;  3WOD G;  3GAX A;  3CCM 3;  3CCV 3;  2IUK A;  1BGS A;  4JRF A;  1MWR A;  1RDS A;  1GMP A;  2JQ5 A;  2MF7 A;  2KRT A;  3M8C A;  5M1A A;  5CXO A;  4HBR A;  4RBN A;  3RNT A;  5AEW B;  3FG3 A;  1T2I A;  1OAC A;  1VQK 3;  1NU3 A;  2P09 A;  1QVF 2;  4GHO A;  1LQM B;  3S29 A;  1LOX A;  3WA3 A;  4DKI A;  3HII A;  2RBI A;  3ZFZ A;  4XDV A;  1WMO A;  1IQX A;  2H0I A;  4L7K A;  1MGR A;  3EBT A;  3JUP A;  4EC6 A;  2J8X B;  3CC7 3;  1ZS7 A;  4WFO A;  1VQL 3;  1OHS A;  2K54 A;  4FCM A;  3AMO B;  1SJW A;  1U5O A;  3FCS B;  1M90 4;  1AR0 A;  4R80 A;  1EUI C;  4WYK B;  3JUN A;  3NV0 B;  4HAA A;  1VQP 3;  2PZV A;  1CH0 A;  1IVW A;  1Q42 A;  4FR9 A;  4HM0 B;  3WDG B;  3I0Y A;  3LT9 A;  1B3S A;  1BRK A;  1IQ8 A;  1NJI 4;  1W4N A;  4O3V A;  2KF5 A;  3EBY A;  1D6Z A;  4HM3 B;  3CPW 2;  3FSD A;  1FGT A;  1DVD A;  3RDE A;  1A2V A;  3DZL A;  5M19 A;  4CPK A;  5CF2 A;  4N6L A;  2F5W A;  1W2Z A;  1I0V A;  1BNJ A;  3LT8 A;  1W2B 2;  1B2M A;  3HIG A;  4STD A;  4L8P A;  4LEH A;  1FW7 A;  1NB5 I;  2KAA A;  4WP5 A;  1FGO A;  1RGG A;  3SED A;  5IEO A;  1UCJ A;  1OPY A;  2UGI A;  3J7Y d;  2Y73 A;  1V74 A;  1Q40 A;  4LGQ A;  2QGU A;  1RRH A;  1FGR A;  3FG1 A;  1KD1 4;  1I2G A;  1ULI B;  2CX1 A;  5BVB A;  1L5G B;  1D6U A;  1Q7Y 4;  1JB5 A;  4HOH A;  1GY5 A;  3VSY A;  2GBX B;  3NV0 A;  3GSP A;  3OWS A;  2YX9 A;  3PYJ A;  1W6C A;  1BVI A;  3GZX B;  2Z77 A;  3B7C A;  3OXA A;  4K90 B;  1RJO A;  5LC7 A;  2BNG A;  3IMA B;  2BMQ B;  5BXQ A;  1RN1 A;  4LSO A;  4LMI A;  1GD4 A;  2W2C A;  3FKA A;  2CW9 A;  1VZZ A;  4U13 A;  1OH0 A;  3KII A;  3X3Y A;  4CDL A;  4R4K A;  1M1X B;  2KF4 A;  5AI1 A;  4ZM8 A;  1B2S A;  9RNT A;  2P05 A;  1R4Y A;  3FGY A;  5BIR A;  1ZO2 A;  1NDO B;  1TJD A;  3KFQ C;  1BSB A;  6GSP A;  4LYL B;  3LOY A;  2XFS A;  4RNY A;  4CJN A;  3GZR A;  1WMN A;  1D6Y A;  2F5M A;  1RCK A;  3LTB A;  4KFF A;  1K8A 4;  3EQQ B;  2ML6 A;  3EF8 A;  3CD6 3;  1B20 A;  1ROV A;  3EN8 A;  3JUO A;  3MG3 A;  3Q90 A;  4HKV B;  4XM4 A;  3PCS A;  1BOX A;  3D5G A;  3EE1 A;  1GY6 A;  2C4B A;  3E99 A;  4KZ1 A;  1X1Y A;  6RNT A;  1FYS A;  2W56 B;  2CH9 A;  1B21 A;  1DVC A;  1JZO A;  2K0M A;  4N6M A;  3G16 A;  3BU4 A;  5FGO A;  3WR2 A;  2UUG C;  3F40 A;  1OGZ A;  3NUV A;  1UCK A;  3ROB A;  4EXR A;  5DRV A;  1YJN 3;  2OTJ 3;  3MWZ A;  4EV2 A;  1VQM 3;  3RGA A;  3K0Z A;  2ZDJ A;  1FUW A;  2OOV C;  3OWU A;  7STD A;  4CCV A;  1FZU A;  2CK3 H;  4O02 B;  1YVS A;  3EHC A;  3AGN A;  4XBT A;  1DMQ A;  4HVN A;  2OWP A;  1BIR A;  1BAO A;  3S5C A;  5G1L A;  3A76 A;  3HOH A;  1UUG B;  1BNR A;  2IYJ A;  3KKG A;  3F9S A;  1YI2 3;  5D83 A;  3SYU A;  3D9R A;  1LOY A;  2F56 A;  3LTC A;  4N6V 0;  3BLZ A;  3N8B A;  4QWT A;  1TUH A;  5G2G A;  1W01 A;  1DE3 A;  2QIY A;  3DUK A;  3K63 A;  4BTW A;  2E2T A;  1VQO 3;  2GXF A;  3KZT A;  3CMA 3;  1BSC A;  2UX0 A;  2Z7A A;  1IQY A;  2WO0 A;  3BNC A;  2A15 A;  4OK0 A;  4J8T A;  4H3U A;  1GD3 A;  2XSH B;  1ASK A;  1RSN A;  1CQS A;  5IW9 A;  1PY3 A;  2W03 A;  1JBR A;  2W56 A;  3CNX A;  1N5H A;  1W7C A;  4J5K A;  3SOY A;  1LOW A;  2F99 A;  1MOL A;  3MG1 A;  4NPB A;  3FH1 A;  2QA4 3;  1E3R A;  2CKF B;  2W6J H;  3FZW A;  3NM7 A;  5IG0 A;  1HZ1 A;  1YNV X;  2STD A;  3H3H A;  1E97 A;  1YGW A;  3NBB A;  5AII A;  2FGT A;  3T8N A;  1IDP A;  4KFD A;  1IT8 A;  4ORL A;  3CXC 2;  2ZHX B;  2OOV A;  4RZM A;  5D81 A;  2AAD A;  3OW2 2;  2OTL 3;  3DGO A;  4J5G A;  3MG2 A;  2XRX B;  1Q40 B;  4MMZ B;  3CCR 3;  2XEP A;  1TIJ A;  1BSA A;  3UL5 A;  3V99 A;  4TX4 A;  3CME 3;  1HU9 A;  4J9A A;  4BTX A;  4R1K A;  3KCH A;  3NBJ A;  1Q82 4;  1F8N A;  1JBS A;  1BUJ A;  2XGL A;  2RGQ A;  2Z6B A;  1UUV B;  1BNE A;  3CCS 3;  1WMP A;  1T3B A;  1LQG C;  2CFW A;  2I9W A;  3ECF A;  3D4A A;  4I4K A;  5D82 A;  3ZG0 A;  1W00 A;  3SXX A;  1FUS A;  1K41 A;  3HX8 A;  2CC3 A;  2FXT A;  2R4I A;  3AHW A;  3B4P A;  1GS3 A;  1PU4 A;  2K3D A;  3URP A;  2XR8 B;  1OF5 A;  2OCT A;  4XBY A;  5G1K A;  2P0X A;  3X40 A;  1YJW 3;  1UI8 A;  1RGA A;  3CNM A;  3LYG A;  4X2H A;  2RNT A;  1VQ9 3;  4N6T A;  3FF2 A;  2XFT A;  3AGO A;  1BSE A;  1QJG A;  5TGN A;  2HML B;  3UB1 A;  5A0O B;  3LTA A;  4X2O A;  4GL6 A;  1KQS 2;  1LRA A;  1W6G A;  3KE7 A;  1I0X A;  4HM8 B;  5FW5 A;  1ULJ B;  4EBG A;  4HZB B;  1BNS A;  1GY7 A;  4XB5 A;  4RNZ A;  4G1M B;  1ROA A;  1BSD A;  1JNQ A;  1IV9 A;  2XSO B;  3QK9 A;  1JB2 A;  1RHL A;  1O7M B;  1A2K A;  1RRL A;  3EX9 A;  3VGN A;  2BT3 A;  2QEX 3;  1VQ6 3;  3KSP A;  1ZGX A;  1IYY A;  3N9H A;  5KP1 A;  1NNV A;  3N54 B;  3G6E 3;  4L8O A;  2L1S A;  3LXU X;  1Q9E A;  1O7G B;  4I5Q A;  1DMN A;  2GEY A;  3SLU A;  4JF8 A;  2BMR B;  1FA3 A;  3G8Z A;  1RN7 A;  1OCV A;  1T2H A;  1NB3 I;  1SQW A;  5ELU A;  1GMQ A;  4NRE A;  3OWY A;  1JN5 A;  3H51 A;  5IEP A;  1NO3 A;  3LTD A;  4ILF A;  4FMA A;  1C54 A;  2F86 B;  2RFR A;  1VQ5 3;  5IEN A;  1GOU A;  1AVL A;  1TTO A;  3F7S A;  2W04 A;  3DH2 A;  2CWV A;  3QRD A;  1RGC A;  4BTY A;  1O7N B;  1LNH A;  3G71 3;  3EJV A;  4BL3 A;  4K61 A;  3DM8 A;  1G96 A;  1PYL A;  2KCD A;  1YHQ 3;  1HYF A;  3BNE A;  3HK4 A;  4AKZ A;  1DYU A;  1YIJ 3;  1BNG A;  2CFG A;  3X42 A;  1OGX A;  1BRG A;  2HMK B;  3OV4 A;  4MMY B;  1E3V A;  1KSI A;  5AIG A;  2SAR A;  2RCD A;  1YGE A;  3CCE 3;  1IVV A;  1BNF A;  3T8U A;  3Q3F A;  4OVM A;  3RGR A;  1CYU A;  4KT3 B;  4HZ9 B;  2AAE A;  2IUJ A;  1SAR A;  2D42 A;  2WGQ A;  1I3F A;  1NWW A;  3BIR A;  2BO9 B;  5AEU B;  1RKY A;  1I3I A;  2FNQ A;  1PFP A;  1BRI A;  5KP4 A;  3GRD A;  1LVN A;  1RGH A;  1S5A A;  3X3Z A;  3FF0 A;  5IG5 A;  1VQ7 3;  2H0H A;  3JVC A;  3HZP A;  1MWU A;  1M1K 4;  1JZD A;  2M7O A;  1X1W A;  3JUM A;  2CX0 A;  2GBW B;  1N5P A;  2XGN A;  1RCL A;  1X1X A;  1BU4 A;  1MWS A;  4WHA A;  5EEO A;  3WOF B;  1JBT A;  3SOA A;  3CCU 3;  2O9U X;  5GSP A;  4R9L A;  1N9E A;  1DET A;  1RGF A;  1J2B A;  2O3O A;  2MC8 A;  5AIF A;  1V57 A;  1VQ4 3;  5AYR B;  1OF5 B;  1S72 3;  1SIH A;  3UJM A;  1JRQ A;  2GU3 A;  2PNC A;  3EB8 A;  4FMB A;  5JBS A;  4FMD A;  4AKY A;  3GWR A;  1FUT A;  4O8S A;  3D3L A;  2CFK A;  3X3X A;  3CCQ 3;  4K1U A;  3BB9 A;  4OUQ A;  1Y4K A;  1UGI A;  3F8H A;  1GMR A;  5STD A;  3IJE B;  3CPO A;  1SPU A;  1UUW B;  2CIU A;  1TRQ A;  2HMM B;  2B1X B;  4IT7 A;  4KVH A;  3CCJ 3;  1BNI A;  1VQ8 3;  2B24 B;  1LXE A;  2C10 A;  3FLJ A;  1G0T A;  3A5E A;  3DGN A;  4MMX B;  1B27 A;  4N6U A;  1OUN A;  1JB4 A;  3JUQ A;  4IPB A;  2RSX A;  5RNT A;  3I56 3;  2E2U A;  3KN4 A;  4FMC A;  3HI7 A;  1LOV A;  2GU1 A;  4XDW A;  1I70 A;  3PZW A;  4EYC A;  2ML5 A;  2XF3 A;  4AEQ A;  2ZL8 A;  1O7H B;  1I2E A;  5AIH A;  3D79 A;  2L4V A;  4FCZ A;  1AV4 A;  1O7P B;  1RGE A;  5KP3 A;  1C7H A;  1CYV A;  3D5I A;  2W0Q A;  4HM6 B;  1T5Y A;  1IT7 A;  2IMJ A;  3L0R A;  1TFO A;  4K1V A;  1Q81 4;  1RGK A;  3BNB A;  3S67 A;  2Z76 A;  5M18 A;  1QAL A;  6STD A;  1Q86 4;  3U97 A;  2SBL A;  3NXJ A;  2LYX A;  1WQL B;  1K73 4;  1JN5 B;  3Q2P A;  2H0G A;  1QAK A;  2KF6 A;  2E2V A;  1EKM A;  1RTU A;  1RNT A;  2IA7 A;  1N8Q A;  1AQZ A;  1RMS A;  2YFL B;  1STF I;  4XBX A;  1AVK A;  3SX1 A;  3WOE B;  1DMM A;  1OHO A;  1EA2 A;  1B2Z A;  1W02 A;  5EVH A;  3B4O A;  8CHO A;  5BU4 A;  2JDI H;  1MNL A;  2INX A;  2YFI B;  3O8Y A;  3T0U A;  1RN4 A;  1UCL A;  3CC2 3;  3PCR A;  1MGW A;  3V98 A;  3ALA A;  3BND A;  1N9J A;  3F8X A;  1TFK A;  2F98 A;  3CU3 A;  7GSP A;  1G02 A;  2CFD A;  3AHS A;  3CC4 3;  1O7W B;  1YIT 3;  1B2U A;  1ISK A;  1A67 A;  4HM5 B;  2GSP A;  1IVX A;  2HMN B;  5HGR A;  3CCL 3;  1UGH I;  3NBR A;  7RNT A;  2WOH A;  5JPP A;  1B2X A;  1FGQ A;  3PGB A;  2CWT A;  3V92 A;  1X1U A;  3KSE D;  3VF1 A;  4H61 A;  1FGM A;  1GOV A;  1Z1S A;  1EG9 B;  1RLS A;  2W9P A;  1BRS A;  2CWU A;  4HM7 B;  3ER7 A;  2ZA4 A;  4R9K A;  2CFL A;  1US1 A;  1WNH A;  1BRH A;  1QMA A;  1A90 A;  1V58 A;  3K9M C;  3AMO A;  1M9G A;  1TRP A; 
#chains in the Genus database with same CATH homology
 3TDG A;  3UNL A;  4NHF A;  3WMD A;  5IER A;  3K5T A;  4WYK A;  5AYS C;  2OQE C;  2W9Q A;  2D1W A;  3OX9 A;  3MSO A;  4HYZ A;  1STD A;  2GEX A;  1YVB I;  1W6Y A;  3STD A;  3NX0 A;  3LZA A;  4MEI A;  5DRE A;  5JPU A;  3WA2 X;  1QAF A;  3GZY B;  3MYT A;  3S27 A;  2HMO B;  1K28 A;  2P38 A;  1IU7 A;  3G0K A;  4MJD A;  4N6O B;  4GB5 A;  2WOF A;  3G4S 3;  1YJ9 3;  3U1W A;  2HMJ B;  3F14 A;  1IVU A;  1SII A;  1ZX2 A;  1KWI A;  3EC9 A;  5CF1 A;  1YIT 3;  2C11 A;  3B8L A;  5IF6 A;  2BHM A;  3LH4 A;  3PXM A;  1JKG B;  4WWU C;  3SVA A;  1N8R 4;  3NQY A;  4KFE A;  1KC8 4;  3MKI A;  4HM4 B;  5CLK A;  3EN1 B;  2YFJ B;  3DGL A;  3I55 3;  4N3V A;  1R4C A;  1IK3 A;  2KXG A;  5EQL A;  4PEJ A;  1IV7 A;  4O2H A;  2LQV A;  1TU5 A;  2Q07 A;  5LC6 A;  4IIA A;  3NHX A;  5IG3 A;  4LZI A;  1WTH A;  2OQE A;  1K9M 4;  2Y74 A;  1W5Z A;  1JV2 B;  1QVG 2;  4HJL B;  3NQZ A;  1U8C B;  5ELJ A;  3PS8 A;  3NM2 A;  2V1L A;  1JJ2 2;  1GYB A;  3GZB A;  5I97 A;  4Q53 A;  5IG4 A;  3S28 A;  1BUQ A;  3MHE A;  1OHP A;  3FG4 A;  2BMO B;  2P0M A;  4HM2 B;  1UW1 A;  2XH9 A;  3DMC A;  3Q1C A;  2CG1 A;  3DGM A;  4FCJ A;  1CEW I;  1EQK A;  3K7C A;  4EV5 A;  1VQN 3;  1HKX A;  3UL6 A;  1UI7 A;  2CG0 A;  3F7X A;  3DXO A;  1TP6 A;  5CK6 A;  3LML A;  3MPH A;  1JKG A;  3DY5 A;  2CHC A;  2WGO A;  4HM1 B;  3X41 A;  3IPT A;  4N6N B;  3WOD G;  3GAX A;  3CCM 3;  3CCV 3;  2IUK A;  4JRF A;  2JQ5 A;  2MF7 A;  2KRT A;  3M8C A;  5CXO A;  4HBR A;  4RBN A;  5AEW B;  1VQK 3;  3FG3 A;  1OAC A;  1NU3 A;  2P09 A;  1QVF 2;  3S29 A;  1LOX A;  3WA3 A;  3HII A;  4XDV A;  1WMO A;  1IQX A;  4L7K A;  3EBT A;  3JUP A;  4EC6 A;  3CC7 3;  4WFO A;  1VQL 3;  1OHS A;  2K54 A;  4FCM A;  3AMO B;  1SJW A;  1U5O A;  3FCS B;  1M90 4;  1AR0 A;  4R80 A;  4WYK B;  3JUN A;  3NV0 B;  1VQP 3;  2PZV A;  1IVW A;  1Q42 A;  4FR9 A;  4HM0 B;  3WDG B;  3I0Y A;  3LT9 A;  1IQ8 A;  1NJI 4;  1W4N A;  4O3V A;  3EBY A;  1D6Z A;  4HM3 B;  3CPW 2;  3FSD A;  1FGT A;  1DVD A;  3RDE A;  1A2V A;  3DZL A;  5CF2 A;  4N6L A;  1W2Z A;  3LT8 A;  1W2B 2;  3HIG A;  4STD A;  4L8P A;  4LEH A;  1NB5 I;  4WP5 A;  1FGO A;  3SED A;  5IEO A;  1OPY A;  3J7Y d;  2Y73 A;  1V74 A;  1Q40 A;  4LGQ A;  2QGU A;  1RRH A;  1FGR A;  3FG1 A;  1KD1 4;  1ULI B;  5BVB A;  1L5G B;  1D6U A;  1Q7Y 4;  1JB5 A;  1GY5 A;  3VSY A;  2GBX B;  3NV0 A;  3OWS A;  2YX9 A;  3PYJ A;  1W6C A;  3GZX B;  2Z77 A;  3B7C A;  3OXA A;  4K90 B;  1RJO A;  5LC7 A;  2BNG A;  3IMA B;  2BMQ B;  5BXQ A;  4LSO A;  4LMI A;  1GD4 A;  2W2C A;  3FKA A;  2CW9 A;  1VZZ A;  4U13 A;  1OH0 A;  3KII A;  3X3Y A;  4CDL A;  4R4K A;  1M1X B;  5AI1 A;  4ZM8 A;  2P05 A;  3FGY A;  1ZO2 A;  1NDO B;  3KFQ C;  3LOY A;  2XFS A;  4RNY A;  3GZR A;  1WMN A;  1D6Y A;  3LTB A;  4KFF A;  1K8A 4;  3EQQ B;  2ML6 A;  3EF8 A;  3CD6 3;  1ROV A;  3EN8 A;  3JUO A;  3MG3 A;  3Q90 A;  4HKV B;  4XM4 A;  3PCS A;  3EE1 A;  4KZ1 A;  1GY6 A;  3E99 A;  2W56 B;  2CH9 A;  1DVC A;  2K0M A;  4N6M A;  3G16 A;  5FGO A;  3F40 A;  3NUV A;  1OGZ A;  3ROB A;  4EXR A;  5DRV A;  1YJN 3;  2OTJ 3;  3MWZ A;  4EV2 A;  1VQM 3;  3RGA A;  3K0Z A;  2ZDJ A;  1FUW A;  2OOV C;  3OWU A;  7STD A;  4CCV A;  2CK3 H;  4O02 B;  3EHC A;  4XBT A;  1DMQ A;  4HVN A;  2OWP A;  3S5C A;  3A76 A;  3KKG A;  3F9S A;  1YI2 3;  5D83 A;  3D9R A;  4N6V 0;  3LTC A;  3BLZ A;  3N8B A;  4QWT A;  1TUH A;  5G2G A;  1W01 A;  2QIY A;  3DUK A;  3K63 A;  4BTW A;  2E2T A;  1VQO 3;  2GXF A;  3KZT A;  3CMA 3;  2UX0 A;  2Z7A A;  1IQY A;  2WO0 A;  3BNC A;  2A15 A;  4OK0 A;  4J8T A;  4H3U A;  1GD3 A;  2XSH B;  1ASK A;  1CQS A;  5IW9 A;  2W03 A;  2W56 A;  3CNX A;  1N5H A;  1W7C A;  3SOY A;  2F99 A;  1MOL A;  3MG1 A;  3FH1 A;  2QA4 3;  2W6J H;  2CKF B;  1E3R A;  3FZW A;  3NM7 A;  5IG0 A;  2STD A;  3H3H A;  1E97 A;  3NBB A;  5AII A;  3T8N A;  2FGT A;  1IDP A;  4KFD A;  1IT8 A;  4ORL A;  3CXC 2;  2OOV A;  4RZM A;  5D81 A;  2OTL 3;  3OW2 2;  3DGO A;  3MG2 A;  2XRX B;  1Q40 B;  4MMZ B;  3CCR 3;  2XEP A;  1TIJ A;  3UL5 A;  3V99 A;  4TX4 A;  3CME 3;  1HU9 A;  4J9A A;  4BTX A;  4R1K A;  3NBJ A;  1Q82 4;  1F8N A;  2XGL A;  2RGQ A;  2Z6B A;  1UUV B;  3CCS 3;  1WMP A;  2I9W A;  2CFW A;  3ECF A;  4I4K A;  5D82 A;  1W00 A;  3SXX A;  1K41 A;  3HX8 A;  2CC3 A;  2FXT A;  2R4I A;  3B4P A;  1PU4 A;  1GS3 A;  2XR8 B;  1OF5 A;  2OCT A;  4XBY A;  2P0X A;  3X40 A;  1YJW 3;  1UI8 A;  3CNM A;  3LYG A;  4X2H A;  1VQ9 3;  4N6T A;  3FF2 A;  2XFT A;  5TGN A;  1QJG A;  3UB1 A;  2HML B;  5A0O B;  3LTA A;  4X2O A;  4GL6 A;  1KQS 2;  5FW5 A;  1W6G A;  3KE7 A;  4HM8 B;  1ULJ B;  4EBG A;  4HZB B;  1GY7 A;  4XB5 A;  4RNZ A;  4G1M B;  1ROA A;  1JNQ A;  1IV9 A;  2XSO B;  3QK9 A;  1JB2 A;  3EX9 A;  1O7M B;  1A2K A;  1RRL A;  3VGN A;  2BT3 A;  2QEX 3;  1VQ6 3;  3KSP A;  3N9H A;  5KP1 A;  3N54 B;  3G6E 3;  4L8O A;  3LXU X;  1O7G B;  1DMN A;  2GEY A;  3SLU A;  4JF8 A;  2BMR B;  1FA3 A;  3G8Z A;  1RN7 A;  1OCV A;  1NB3 I;  1SQW A;  5ELU A;  4NRE A;  3OWY A;  1JN5 A;  3H51 A;  5IEP A;  1NO3 A;  3LTD A;  4FMA A;  2F86 B;  2RFR A;  1VQ5 3;  5IEN A;  1AVL A;  3F7S A;  2W04 A;  2CWV A;  3QRD A;  3G71 3;  4BTY A;  1O7N B;  1LNH A;  3EJV A;  1YHQ 3;  4K61 A;  3DM8 A;  1G96 A;  2KCD A;  3BNE A;  3HK4 A;  4AKZ A;  1DYU A;  1YIJ 3;  2CFG A;  3X42 A;  1OGX A;  2HMK B;  3OV4 A;  4MMY B;  1E3V A;  1KSI A;  5AIG A;  2RCD A;  1YGE A;  3CCE 3;  1IVV A;  3T8U A;  4OVM A;  3RGR A;  1CYU A;  4HZ9 B;  2IUJ A;  2D42 A;  2WGQ A;  1NWW A;  2BO9 B;  5AEU B;  1RKY A;  2FNQ A;  1PFP A;  5KP4 A;  3GRD A;  1LVN A;  1S5A A;  3X3Z A;  3FF0 A;  5IG5 A;  1VQ7 3;  3JVC A;  3HZP A;  1M1K 4;  2M7O A;  3JUM A;  2GBW B;  1N5P A;  2XGN A;  3WOF B;  4WHA A;  5EEO A;  3SOA A;  3CCU 3;  2O9U X;  4R9L A;  1N9E A;  1J2B A;  2O3O A;  2MC8 A;  5AIF A;  1VQ4 3;  5AYR B;  1OF5 B;  1S72 3;  1SIH A;  3UJM A;  1JRQ A;  2GU3 A;  2PNC A;  3EB8 A;  4FMB A;  5JBS A;  4FMD A;  4AKY A;  3GWR A;  4O8S A;  3D3L A;  2CFK A;  3X3X A;  3CCQ 3;  4K1U A;  3BB9 A;  4OUQ A;  1Y4K A;  3F8H A;  5STD A;  3IJE B;  3CPO A;  1SPU A;  1UUW B;  2CIU A;  2HMM B;  2B1X B;  4IT7 A;  4KVH A;  3CCJ 3;  1VQ8 3;  2B24 B;  1LXE A;  2C10 A;  3FLJ A;  3DGN A;  4MMX B;  4N6U A;  1OUN A;  1JB4 A;  3JUQ A;  4IPB A;  2RSX A;  3I56 3;  2E2U A;  3KN4 A;  4FMC A;  3HI7 A;  2GU1 A;  4XDW A;  3PZW A;  4EYC A;  2ML5 A;  2XF3 A;  4AEQ A;  2ZL8 A;  1O7H B;  5AIH A;  2L4V A;  4FCZ A;  1AV4 A;  1O7P B;  5KP3 A;  1C7H A;  1CYV A;  2W0Q A;  4HM6 B;  1T5Y A;  1IT7 A;  2IMJ A;  3L0R A;  1TFO A;  4K1V A;  1Q81 4;  3BNB A;  3S67 A;  2Z76 A;  1QAL A;  6STD A;  1Q86 4;  3U97 A;  2SBL A;  3NXJ A;  2LYX A;  1WQL B;  1K73 4;  1JN5 B;  3Q2P A;  1QAK A;  2E2V A;  1EKM A;  2IA7 A;  1N8Q A;  2YFL B;  1STF I;  4XBX A;  1AVK A;  3SX1 A;  3WOE B;  1DMM A;  1OHO A;  1EA2 A;  1W02 A;  5EVH A;  3B4O A;  8CHO A;  2JDI H;  1MNL A;  2INX A;  2YFI B;  3O8Y A;  3T0U A;  3CC2 3;  3PCR A;  3V98 A;  3ALA A;  3BND A;  1N9J A;  3F8X A;  1TFK A;  2F98 A;  3CU3 A;  2CFD A;  3CC4 3;  1O7W B;  1ISK A;  1A67 A;  4HM5 B;  2HMN B;  1IVX A;  5HGR A;  3CCL 3;  3NBR A;  2WOH A;  5JPP A;  3V92 A;  1FGQ A;  3PGB A;  2CWT A;  3KSE D;  3VF1 A;  4H61 A;  1FGM A;  2W9P A;  1Z1S A;  1EG9 B;  2CWU A;  4HM7 B;  3ER7 A;  4R9K A;  2CFL A;  1US1 A;  1WNH A;  1QMA A;  1A90 A;  3K9M C;  3AMO A;  1M9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...