2KCDA

Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SSP0047
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2kcdA00
5AYRB 5AYSC 2KCDA 3WDGB
chains in the Genus database with same CATH superfamily
2YFJB 2KXGA 1FUWA 1GY5A 1I8VA 2CFGA 4IIAA 4H61A 1TU5A 4ZM8A 1ULJB 3FGYA 5A0OB 1PFPA 1OGXA 1ZO2A 1D6YA 5IG5A 3LMLA 3CMA3 3D79A 1RGCA 1VQM3 1GMPA 4HM2B 1MWRA 1OACA 1SARA 1BRSA 1UUVB 1GYBA 3FG1A 3CCL3 3NXJA 1B2UA 2BIRA 2W0QA 3TDGA 3VF1A 1JB5A 3PZWA 1ROAA 2CHCA 1Q9EA 4HJLB 5JBSA 3CPOA 1LOVA 1VQ73 2GEXA 1B21A 3LYGA 1JB4A 1W6GA 5CF2A 1VQP3 4U13A 2XEPA 1K9M4 1X1XA 2P09A 4EC6A 1A2KA 1JB2A 4LYLB 5KP4A 4HM4B 2B1XB 5AYRB 1IVWA 3X41A 3NHXA 2HMKB 1E3RA 2BO9B 1BU4A 4FMCA 3F7SA 4DKIA 1NWWA 1RGHA 2F98A 3LXUX 3UB1A 1MGWA 2KF3A 4FCZA 5RNTA 5BXQA 1RHLA 4AKYA 2F5MA 1BSCA 3F7XA 1WQLB 1I2GA 2P05A 2WGQA 9RNTA 2B24B 2F99A 1G96A 2GSPA 3FG3A 1A2VA 1GSPA 2BT3A 2PZVA 1RTUA 2CKFB 4QWTA 3DUKA 1JBRA 3T8UA 1B3SA 1BNSA 3VGNA 2CG1A 1FGOA 3GZYB 4X2OA 2FXTA 1JJ22 2CH9A 2GBXB 1I2EA 3SYUA 3GRDA 4EV5A 1MWUA 1X1WA 1RLSA 3CXC2 1KQS2 4NREA 1TP6A 1NO3A 3CCS3 4XBTA 7STDA 3WOEB 2AAEA 2ZL8A 1M904 4R4KA 3AHSA 1W2ZA 2QIYA 5LC6A 1IV9A 5M19A 3AMOB 1AR0A 3GZBA 3HI7A 3V99A 1C7HA 2W04A 2XFTA 7GSPA 3CPW2 3N8BA 3ROBA 2OCTA 1RGEA 1W4NA 3Q2PA 5GSPA 1JKGA 1ULIB 2QGUA 1BRHA 1I0VA 1T2IA 2F5WA 1LQMB 3K63A 2R4IA 3PXMA 3DGNA 1B20A 2YFIB 1BUJA 3MG3A 1B27A 1FGQA 1RGLA 3KIIA 1A2PA 3T8NA 1GOUA 3LTAA 4R80A 5EEOA 4HBRA 3CCJ3 3FSDA 3A76A 1OGZA 3X42A 3CC23 1N9JA 2Z7AA 1F8NA 1D6ZA 2HMMB 3FCSB 4EXRA 3F14A 5AI1A 3EQQB 2W2CA 1G0TA 5AEUB 4J5GA 5ELUA 1AVKA 3RNTA 2INXA 3FLJA 1OCVA 3EN8A 2FGTA 1JRQA 1Q40B 1VZZA 3U1WA 3MPHA 2A15A 2K54A 3NBRA 1B2SA 2CFKA 1QVF2 1MOLA 1TRQA 4HM3B 1W01A 3DZLA 2Z6BA 5TGNA 1YJW3 1VQK3 1T5YA 1HZ1A 3D5IA 1ASKA 1RSNA 1B2MA 4LZIA 2CG0A 4I4KA 1GY7A 3ZG0A 3K5TA 3MG1A 5FGOA 4J8TA 4BTWA 3IJEB 1MWTA 5M1AA 3CD63 3DMCA 1QJGA 3OW22 2UUGC 5D82A 1BRKA 1E3VA 1RCLA 3GWRA 2F86B 5LC7A 2QA43 1UUGB 4LEHA 1TJDA 4WWUC 1WNHA 3BB9A 3WA3A 1W6CA 2F4YA 1BGSA 4HVNA 4R9KA 2XGLA 2RFRA 3NM2A 4MMZB 1I0XA 1DVCA 4O8SA 3G4S3 3V92A 4O02B 1OF5B 4LSOA 3PCRA 5CF1A 1FA3A 1QALA 3DM8A 1KSIA 2Z77A 1K734 2LQVA 3SOYA 5JPUA 3G8ZA 2HMOB 4I5QA 1M1K4 3CCV3 3HX8A 3X40A 1AY7A 2WOFA 3S67A 3WHOA 1OHSA 1N5HA 1SQWA 3G16A 1BRGA 3MYTA 3MWZA 3NBBA 3SEDA 1YJN3 3B4OA 4J5KA 3B8LA 1RRHA 1O7PB 1YVBI 5AEWB 1EKMA 2K3DA 4K1VA 1QAKA 3DY5A 1RDSA 1M9GA 1BUQA 4J9AA 1YIT3 1Q7Y4 3KFQC 3RGAA 1VQ83 1DETA 3X3YA 1JBTA 4HM5B 3EB8A 5I97A 1RN4A 1E97A 2HMNB 1NB3I 2W9QA 2XFSA 2HMJB 4O2HA 4XM4A 3Q1CA 2JDIH 1NU3A 4GSPA 1S723 3BLZA 1N8QA 2H0HA 3I563 1PYLA 1UCJA 1BOXA 3ER7A 4K61A 1JBSA 4HYZA 1TFKA 4CPKA 1GD3A 3CCE3 5JPPA 1MGRA 1OPYA 1Y4KA 2Y74A 4RZMA 4WFOA 4Q53A 3S29A 5BU4A 4FCJA 1UCLA 4XDVA 1GY6A 2H0GA 4WHAA 2K0MA 1BAOA 1KWIA 2YFLB 4BL3A 1LQGC 1I3IA 3D3LA 1GMQA 3JUPA 1UGHI 1Q864 4FMBA 2WGOA 2OQEA 2KAAA 3EC9A 4ILFA 1BVIA 1IVXA 1BSEA 3RDEA 1T3BA 1JKGB 3OXAA 3PS8A 8CHOA 1ISKA 1RN7A 1ZX2A 4N6V0 3KN4A 3OWYA 4KZ1A 3KSPA 3MSOA 4N6NB 2WOHA 1LOWA 4GHOA 3CU3A 2GU1A 2OOVC 2OTL3 1YGWA 1J2BA 3OWUA 1FUTA 4BTXA 3FF0A 3BNBA 2XR8B 1BRJA 3S28A 1KD14 5IG3A 1IQ8A 5ELJA 1GOYA 1YI23 3Q90A 1S5AA 1OUNA 1WTHA 3PCSA 2CIUA 1TUHA 1T2HA 1UUWB 4N6UA 2RGQA 3ZFZA 3NM7A 1IYYA 2E2TA 2OWPA 1K8A4 3S27A 5IF6A 1JZDA 1GOVA 3KE7A 3SXXA 4BIRA 1GD4A 3PGBA 1OH0A 2MC8A 3I553 2LYXA 3NV0B 4BU4A 3CC43 1HU9A 4KFDA 1LRAA 3HK4A 1JV2B 2ML6A 3CCU3 3SVAA 1JZOA 2CX0A 2UX0A 5DREA 3JVCA 1HYFA 5G2GA 1V57A 4L7KA 5IEOA 2KRTA 3N54B 5KP3A 4R1KA 4R9LA 3LH4A 3ZG5A 3F9SA 1YGEA 2OOVA 1B2XA 1BNFA 2CWTA 1X1UA 3J7Yd 1AVLA 3KSED 3WDGB 3CCQ3 4HZ9B 3DGYA 4H3UA 1QMAA 4WYKA 4JRFA 5IW9A 2XF3A 1VQL3 3AGOA 3KZTA 1HKXA 1Q40A 3JUOA 1FZUA 3B7CA 3LTDA 3WMDA 3CCR3 2YX9A 4HM0B 1DMQA 2XSOB 3BNDA 1O7WB 3S5CA 3D9RA 4EYCA 2OTJ3 4N6TA 1VQQA 2GU3A 3MKIA 3WODG 5D83A 5IG0A 5AIFA 5IENA 2Y73A 3JUMA 3HZPA 3A5EA 6RNTA 3EE1A 1W02A 3AHWA 3BU4A 2O9UX 6STDA 1FYSA 3OWSA 2O3OA 4MMXB 1CQSA 4XBYA 3STDA 3FG4A 3H51A 3WA2X 1V74A 3EHCA 3CME3 1RN1A 3ECFA 1VQN3 1LNHA 1UGIA 1SIHA 1QVG2 4TX4A 1SPUA 3RGRA 3U97A 2GXFA 1FGTA 1R4CA 1YJ93 1TRPA 2OQEC 5IERA 3OV4A 1JNQA 3Q3FA 5EQLA 1BNJA 2CX1A 1PU4A 1A90A 1LXEA 4IT7A 2C4BA 5G1LA 1Q824 4LMIA 1BSBA 2BU4A 3SOAA 1W7CA 3AGNA 1O7MB 3FKAA 1MWSA 4L8PA 4CDLA 3SX1A 1GMRA 2P38A 3D4AA 4OK0A 2GBWB 4AKZA 1LNIA 2F56A 3I0YA 2P0MA 1RJOA 4OUQA 2C10A 3T0UA 2IUKA 1DYUA 4EV2A 1RGGA 3EBYA 1BSDA 2P0XA 4NPBA 4MJDA 5STDA 2QEX3 3UNLA 3EJVA 1MNLA 4PEJA 1PY3A 2Z76A 3F8XA 3PYJA 3V98A 4WYKB 1EA2A 1EQKA 1IQYA 3HOHA 4EBGA 5AIGA 5IEPA 1WMNA 6GSPA 3GAXA 1UCKA 3JUQA 1FGRA 3LZAA 2RBIA 1DMMA 2V1LA 2KF6A 2IA7A 4GL6A 1VQ43 4WP5A 1IVUA 1CH0A 3X3XA 1CEWI 2FNQA 1A67A 2CFWA 2IYJA 3VSYA 2KF4A 2R41A 4EW5A 2WO0A 3CNMA 1V58A 2XGNA 1DE3A 1OF5A 1UI8A 2H0IA 1U5OA 1FUSA 1RRLA 2BNGA 2HOHA 1C54A 1Q7HA 3F8HA 1WMOA 1LVNA 4BTYA 5BVBA 1IQXA 3MG2A 1RNBA 3SLUA 3IMAB 4AEQA 1Z1SA 1TFOA 5G1KA 1FW7A 1LOYA 1BANA 1G02A 1VQO3 1EEJA 4G1MB 5AIIA 1D6UA 3URPA 1I70A 2ZHXB 3MHEA 1IDPA 1Q42A 1IK3A 1RGAA 1IT7A 1IT8A 1JN5B 4N3VA 4RNTA 1NB5I 4L8OA 2XH9A 3M8CA 1I3FA 1B2ZA 1N5PA 4FR9A 3BNCA 2IUJA 2ML5A 2PNCA 3OX9A 3G713 1RMSA 1BNRA 3EN1B 5AYSC 2ZA4A 3O8YA 3DXOA 1I2FA 3NUVA 1EG9B 1O7GB 4BL2A 1BNIA 1JN5A 4K1UA 1DVDA 1IU7A 1YNVX 2CFLA 3NQZA 1ROVA 1W6YA 3NQYA 5CXOA 1N8R4 1NNVA 2RSXA 2BMOB 4K90B 8RNTA 4RBNA 1M1XB 4N6LA 2GEYA 3BNEA 3NV0A 4HZBB 4N6MA 3UL6A 1VQ53 2XRXB 3ALAA 1RGFA 3LOYA 1STFI 1BNEA 2JQ5A 3JUNA 4N6OB 1AQZA 2CFDA 4ORLA 1RNTA 2W03A 3QK9A 1SIIA 1O7HB 1ZS7A 2AADA 3BIRA 3L0RA 2BMQB 2CW9A 3K7CA 3LTBA 4FMAA 1WMPA 1KC84 1CYVA 2J8XB 3UJMA 2HMLB 2UGIA 1GS3A 1K28A 2MF7A 4HKVB 1SJWA 4MEIA 2KF5A 1UI7A 4OVMA 4X2HA 5HGRA 4KFEA 2SBLA 2W56B 3DH2A 1BIRA 2CC3A 2I9WA 3DGLA 4HAAA 4HM7B 1YHQ3 5CLKA 4FMDA 3HIIA 2BMRB 1R4YA 1OHOA 3B4PA 4XBXA 1BRIA 4STDA 3GZXB 2D1WA 3DGOA 1IVVA 1ZGXA 4RNZA 5AIHA 1RCKA 3CC73 2E2UA 4HM6B 1L5GB 5HOHA 3D5GA 1YIJ3 1LOXA 3EX9A 4GB5A 4LGQA 1W00A 1NJI4 3NX0A 1Q814 1NDOB 2IMJA 1STDA 1RGKA 1RKYA 1US1A 3CNXA 2KCDA 3HIGA 2W9PA 4MMYB 1UCIA 3N9HA 3FZWA 2CK3H 3DGMA 3H3HA 3IPTA 4HM8B 2IY2A 4O3VA 1AV4A 1U8CB 4KT3B 2SARA 1W2B2 4NHFA 2W6JH 1DMNA 1IV7A 2RCDA 2ZDJA 3X3ZA 3WR2A 1FGMA 4IPBA 1TIJA 3GZRA 3GSPA 5KP1A 3FH1A 2STDA 1OHPA 5M18A 1YVSA 1EUIC 1BNGA 3LTCA 1BSAA 3FF2A 3LT9A 1UW1A 4JF8A 5BIRA 5EVHA 1UDII 2L4VA 3K9MC 2C11A 2L1SA 4HM1B 4FCMA 3CCM3 1BRNL 1K41A 4HOHA 3F40A 4XB5A 3KKGA 3G6E3 4XDWA 3G0KA 1O7NB 3KCHA 5FW5A 1QAFA 3UL5A 5CK6A 3AMOA 1N9EA 4CJNA 1W5ZA 2D42A 1CYUA 4RNYA 4CCVA 4KVHA 3NBJA 2CWUA 2XSHB 3K0ZA 3EBTA 2M7OA 2CWVA 2W56A 7RNTA 5IG4A 2Q07A 1X1YA 5DRVA 4KFFA 1TTOA 3EF8A 2RNTA 3LT8A 3QRDA 3WOFB 5D81A 1VQ93 3E99A 2E2VA 2BHMA 1VQ63
chains in the Genus database with same CATH topology
2YFJB 2KXGA 1FUWA 1GY5A 2CFGA 4IIAA 4H61A 1TU5A 4ZM8A 1ULJB 3FGYA 5A0OB 1PFPA 1OGXA 1ZO2A 1D6YA 5IG5A 3LMLA 3CMA3 1VQM3 4HM2B 1OACA 1UUVB 1GYBA 3FG1A 3CCL3 3NXJA 2W0QA 3TDGA 3VF1A 1JB5A 3PZWA 1ROAA 2CHCA 4HJLB 5JBSA 3CPOA 1VQ73 2GEXA 3LYGA 1JB4A 1W6GA 5CF2A 1VQP3 4U13A 2XEPA 1K9M4 2P09A 4EC6A 1A2KA 1JB2A 5KP4A 4HM4B 2B1XB 5AYRB 1IVWA 3X41A 3NHXA 2HMKB 1E3RA 2BO9B 4FMCA 3F7SA 1NWWA 2F98A 3LXUX 3UB1A 4FCZA 5BXQA 4AKYA 3F7XA 1WQLB 2WGQA 2P05A 2B24B 2F99A 1G96A 3FG3A 4QWTA 1A2VA 2BT3A 2PZVA 2CKFB 3DUKA 3T8UA 3VGNA 2CG1A 1FGOA 3GZYB 4X2OA 2FXTA 2CH9A 2GBXB 3GRDA 4EV5A 1KQS2 3CXC2 4NREA 1TP6A 1NO3A 3CCS3 4XBTA 7STDA 3WOEB 2ZL8A 1M904 4R4KA 5LC6A 1W2ZA 2QIYA 1IV9A 3AMOB 1AR0A 3GZBA 3HI7A 3V99A 1C7HA 2W04A 2XFTA 3CPW2 3N8BA 3ROBA 2OCTA 1W4NA 3Q2PA 1JKGA 1ULIB 2QGUA 3K63A 2R4IA 3PXMA 3DGNA 2YFIB 3MG3A 1FGQA 3KIIA 3T8NA 3LTAA 4R80A 5EEOA 4HBRA 3CCJ3 3FSDA 3A76A 1OGZA 3X42A 3CC23 1N9JA 2Z7AA 1F8NA 1D6ZA 2HMMB 3FCSB 4EXRA 3F14A 5AI1A 3EQQB 2W2CA 5AEUB 5ELUA 1AVKA 2INXA 3FLJA 1OCVA 3EN8A 2FGTA 1JRQA 1Q40B 1VZZA 3U1WA 3MPHA 2A15A 2K54A 3NBRA 2CFKA 1QVF2 1MOLA 4HM3B 1W01A 3DZLA 2Z6BA 5TGNA 1YJW3 1VQK3 1T5YA 1ASKA 4LZIA 2CG0A 4I4KA 1GY7A 3K5TA 3MG1A 5FGOA 4J8TA 4BTWA 3IJEB 3CD63 3DMCA 1QJGA 3OW22 5D82A 1E3VA 3GWRA 2F86B 5LC7A 2QA43 4LEHA 4WWUC 1WNHA 3BB9A 3WA3A 1W6CA 4R9KA 4HVNA 2XGLA 2RFRA 3NM2A 4MMZB 1DVCA 4O8SA 3G4S3 3V92A 4O02B 1OF5B 4LSOA 3PCRA 5CF1A 1FA3A 1QALA 3DM8A 1KSIA 2Z77A 1K734 2LQVA 3SOYA 5JPUA 3G8ZA 2HMOB 1M1K4 3CCV3 3HX8A 3X40A 2WOFA 3S67A 1OHSA 1N5HA 1SQWA 3G16A 3SEDA 3MYTA 3MWZA 3NBBA 1YJN3 3B4OA 3B8LA 1RRHA 1O7PB 1YVBI 5AEWB 1EKMA 4K1VA 1QAKA 3DY5A 1M9GA 1BUQA 4J9AA 1YIT3 1Q7Y4 3KFQC 3RGAA 1VQ83 3X3YA 4HM5B 3EB8A 5I97A 1E97A 2HMNB 1NB3I 2W9QA 2XFSA 2HMJB 4O2HA 4XM4A 3Q1CA 2JDIH 1NU3A 1S723 3BLZA 1N8QA 3I563 3ER7A 4K61A 4HYZA 1TFKA 3CCE3 1GD3A 5JPPA 1OPYA 1Y4KA 2Y74A 4RZMA 4WFOA 4Q53A 3S29A 4FCJA 4XDVA 1GY6A 4WHAA 2K0MA 1KWIA 2YFLB 3D3LA 3JUPA 1Q864 4FMBA 2WGOA 2OQEA 3EC9A 1IVXA 3RDEA 1JKGB 3OXAA 3PS8A 8CHOA 1ISKA 1RN7A 1ZX2A 4N6V0 3KN4A 3OWYA 4KZ1A 3KSPA 3MSOA 4N6NB 2WOHA 3CU3A 2GU1A 2OOVC 2OTL3 1J2BA 3OWUA 4BTXA 3FF0A 3BNBA 2XR8B 3S28A 1KD14 5IG3A 1IQ8A 5ELJA 1YI23 3Q90A 1S5AA 1OUNA 1WTHA 3PCSA 1TUHA 2CIUA 1UUWB 4N6UA 2RGQA 3NM7A 2E2TA 2OWPA 1K8A4 3S27A 5IF6A 3KE7A 3SXXA 1GD4A 3PGBA 1OH0A 2MC8A 3I553 2LYXA 3NV0B 3CC43 1HU9A 4KFDA 3HK4A 1JV2B 2ML6A 3CCU3 3SVAA 2UX0A 5DREA 3JVCA 5G2GA 4L7KA 5IEOA 2KRTA 3N54B 5KP3A 4R1KA 4R9LA 3LH4A 3F9SA 1YGEA 2OOVA 2CWTA 3J7Yd 1AVLA 3KSED 3WDGB 3CCQ3 4HZ9B 4WYKA 4H3UA 1QMAA 5IW9A 4JRFA 1VQL3 2XF3A 3KZTA 1HKXA 1Q40A 3JUOA 3B7CA 3LTDA 3WMDA 3CCR3 2YX9A 4HM0B 1DMQA 2XSOB 3BNDA 1O7WB 3S5CA 3D9RA 4EYCA 2OTJ3 4N6TA 2GU3A 3MKIA 3WODG 5D83A 5IG0A 5AIFA 5IENA 2Y73A 3JUMA 3HZPA 3EE1A 1W02A 2O9UX 6STDA 3OWSA 2O3OA 4MMXB 1CQSA 4XBYA 3STDA 3FG4A 3H51A 3WA2X 1V74A 3EHCA 3CME3 3ECFA 1VQN3 1LNHA 1QVG2 1SIHA 4TX4A 1SPUA 3RGRA 3U97A 2GXFA 1FGTA 1R4CA 1YJ93 2OQEC 5IERA 3OV4A 1JNQA 5EQLA 1PU4A 1A90A 1LXEA 4IT7A 1Q824 4LMIA 3SOAA 1W7CA 1O7MB 3FKAA 4L8PA 4CDLA 3SX1A 2P38A 4OK0A 2GBWB 4AKZA 3I0YA 2P0MA 1RJOA 4OUQA 2C10A 3T0UA 2IUKA 1DYUA 4EV2A 3EBYA 2P0XA 2QEX3 4MJDA 5STDA 3UNLA 3EJVA 1MNLA 4PEJA 2Z76A 3F8XA 3PYJA 3V98A 4WYKB 1EA2A 1EQKA 1IQYA 4EBGA 5AIGA 5IEPA 1WMNA 3GAXA 3JUQA 1FGRA 3LZAA 1DMMA 2V1LA 2IA7A 4GL6A 1VQ43 4WP5A 1IVUA 3X3XA 1CEWI 2FNQA 1A67A 2CFWA 3VSYA 2WO0A 3CNMA 2XGNA 1OF5A 1UI8A 1U5OA 1RRLA 2BNGA 3F8HA 1WMOA 1LVNA 4BTYA 5BVBA 1IQXA 3MG2A 3SLUA 3IMAB 4AEQA 1Z1SA 1TFOA 1VQO3 4G1MB 5AIIA 1D6UA 3MHEA 1IDPA 1Q42A 1IK3A 1IT7A 1IT8A 1JN5B 4N3VA 1NB5I 4L8OA 2XH9A 3M8CA 1N5PA 4FR9A 3BNCA 2IUJA 2ML5A 2PNCA 3OX9A 3G713 3EN1B 5AYSC 3O8YA 3DXOA 3NUVA 1EG9B 1O7GB 1JN5A 4K1UA 1DVDA 1IU7A 2CFLA 3NQZA 1ROVA 1W6YA 3NQYA 5CXOA 1N8R4 2RSXA 2BMOB 4K90B 4RBNA 1M1XB 4N6LA 2GEYA 3BNEA 3NV0A 4HZBB 4N6MA 3UL6A 1VQ53 2XRXB 3ALAA 3LOYA 1STFI 2JQ5A 3JUNA 4N6OB 2CFDA 4ORLA 2W03A 3QK9A 1SIIA 1O7HB 3L0RA 4FMAA 3LTBA 2BMQB 2CW9A 3K7CA 1KC84 1WMPA 1CYVA 3UJMA 2HMLB 1GS3A 1K28A 2MF7A 4HKVB 1SJWA 4MEIA 4OVMA 1UI7A 4X2HA 5HGRA 4KFEA 2SBLA 2W56B 1JJ22 2I9WA 3DGLA 2CC3A 4HM7B 1YHQ3 5CLKA 4FMDA 3HIIA 2BMRB 4XBXA 1OHOA 3B4PA 4STDA 3GZXB 2D1WA 3DGOA 1IVVA 4RNZA 5AIHA 3CC73 2E2UA 4HM6B 1L5GB 1YIJ3 1LOXA 3EX9A 4GB5A 4LGQA 1W00A 1NJI4 3NX0A 1Q814 1NDOB 2IMJA 1STDA 1RKYA 3CNXA 1US1A 2KCDA 3HIGA 2W9PA 4MMYB 3N9HA 3FZWA 2CK3H 3DGMA 3H3HA 3IPTA 4HM8B 4O3VA 1AV4A 1U8CB 1W2B2 4NHFA 2W6JH 1DMNA 1IV7A 2RCDA 2ZDJA 3X3ZA 1FGMA 4IPBA 1TIJA 3GZRA 5KP1A 3FH1A 2STDA 1OHPA 3LTCA 3FF2A 3LT9A 1UW1A 4JF8A 5EVHA 2L4VA 3K9MC 2C11A 4HM1B 4FCMA 3CCM3 1K41A 3F40A 4XB5A 3KKGA 3G6E3 4XDWA 3G0KA 1O7NB 5FW5A 1QAFA 3UL5A 5CK6A 3AMOA 1N9EA 1W5ZA 2D42A 1CYUA 4RNYA 4CCVA 4KVHA 3NBJA 2CWUA 2XSHB 3K0ZA 3EBTA 2M7OA 2CWVA 2W56A 5IG4A 2Q07A 5DRVA 4KFFA 3EF8A 3QRDA 3LT8A 3WOFB 5D81A 1VQ93 3E99A 2E2VA 2BHMA 1VQ63
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYR B;  5AYS C;  2KCD A;  3WDG B; 
#chains in the Genus database with same CATH topology
 2YFJ B;  2KXG A;  1FUW A;  1GY5 A;  1I8V A;  2CFG A;  4IIA A;  4H61 A;  1TU5 A;  4ZM8 A;  1ULJ B;  3FGY A;  5A0O B;  1PFP A;  1OGX A;  1ZO2 A;  1D6Y A;  5IG5 A;  3LML A;  3CMA 3;  3D79 A;  1RGC A;  1VQM 3;  1GMP A;  4HM2 B;  1MWR A;  1OAC A;  1SAR A;  1BRS A;  1UUV B;  1GYB A;  3FG1 A;  3CCL 3;  3NXJ A;  1B2U A;  2BIR A;  2W0Q A;  3TDG A;  3VF1 A;  1JB5 A;  3PZW A;  1ROA A;  2CHC A;  1Q9E A;  4HJL B;  5JBS A;  3CPO A;  1LOV A;  1VQ7 3;  2GEX A;  1B21 A;  3LYG A;  1JB4 A;  1W6G A;  5CF2 A;  1VQP 3;  4U13 A;  2XEP A;  1K9M 4;  1X1X A;  2P09 A;  4EC6 A;  1A2K A;  1JB2 A;  4LYL B;  5KP4 A;  4HM4 B;  2B1X B;  5AYR B;  1IVW A;  3X41 A;  3NHX A;  2HMK B;  1E3R A;  2BO9 B;  1BU4 A;  4FMC A;  3F7S A;  4DKI A;  1NWW A;  1RGH A;  2F98 A;  3LXU X;  3UB1 A;  1MGW A;  2KF3 A;  4FCZ A;  5RNT A;  5BXQ A;  1RHL A;  4AKY A;  2F5M A;  1BSC A;  3F7X A;  1WQL B;  1I2G A;  2P05 A;  2WGQ A;  9RNT A;  2B24 B;  2F99 A;  1G96 A;  2GSP A;  3FG3 A;  1A2V A;  1GSP A;  2BT3 A;  2PZV A;  1RTU A;  2CKF B;  4QWT A;  3DUK A;  1JBR A;  3T8U A;  1B3S A;  1BNS A;  3VGN A;  2CG1 A;  1FGO A;  3GZY B;  4X2O A;  2FXT A;  1JJ2 2;  2CH9 A;  2GBX B;  1I2E A;  3SYU A;  3GRD A;  4EV5 A;  1MWU A;  1X1W A;  1RLS A;  3CXC 2;  1KQS 2;  4NRE A;  1TP6 A;  1NO3 A;  3CCS 3;  4XBT A;  7STD A;  3WOE B;  2AAE A;  2ZL8 A;  1M90 4;  4R4K A;  3AHS A;  1W2Z A;  2QIY A;  5LC6 A;  1IV9 A;  5M19 A;  3AMO B;  1AR0 A;  3GZB A;  3HI7 A;  3V99 A;  1C7H A;  2W04 A;  2XFT A;  7GSP A;  3CPW 2;  3N8B A;  3ROB A;  2OCT A;  1RGE A;  1W4N A;  3Q2P A;  5GSP A;  1JKG A;  1ULI B;  2QGU A;  1BRH A;  1I0V A;  1T2I A;  2F5W A;  1LQM B;  3K63 A;  2R4I A;  3PXM A;  3DGN A;  1B20 A;  2YFI B;  1BUJ A;  3MG3 A;  1B27 A;  1FGQ A;  1RGL A;  3KII A;  1A2P A;  3T8N A;  1GOU A;  3LTA A;  4R80 A;  5EEO A;  4HBR A;  3CCJ 3;  3FSD A;  3A76 A;  1OGZ A;  3X42 A;  3CC2 3;  1N9J A;  2Z7A A;  1F8N A;  1D6Z A;  2HMM B;  3FCS B;  4EXR A;  3F14 A;  5AI1 A;  3EQQ B;  2W2C A;  1G0T A;  5AEU B;  4J5G A;  5ELU A;  1AVK A;  3RNT A;  2INX A;  3FLJ A;  1OCV A;  3EN8 A;  2FGT A;  1JRQ A;  1Q40 B;  1VZZ A;  3U1W A;  3MPH A;  2A15 A;  2K54 A;  3NBR A;  1B2S A;  2CFK A;  1QVF 2;  1MOL A;  1TRQ A;  4HM3 B;  1W01 A;  3DZL A;  2Z6B A;  5TGN A;  1YJW 3;  1VQK 3;  1T5Y A;  1HZ1 A;  3D5I A;  1ASK A;  1RSN A;  1B2M A;  4LZI A;  2CG0 A;  4I4K A;  1GY7 A;  3ZG0 A;  3K5T A;  3MG1 A;  5FGO A;  4J8T A;  4BTW A;  3IJE B;  1MWT A;  5M1A A;  3CD6 3;  3DMC A;  1QJG A;  3OW2 2;  2UUG C;  5D82 A;  1BRK A;  1E3V A;  1RCL A;  3GWR A;  2F86 B;  5LC7 A;  2QA4 3;  1UUG B;  4LEH A;  1TJD A;  4WWU C;  1WNH A;  3BB9 A;  3WA3 A;  1W6C A;  2F4Y A;  1BGS A;  4HVN A;  4R9K A;  2XGL A;  2RFR A;  3NM2 A;  4MMZ B;  1I0X A;  1DVC A;  4O8S A;  3G4S 3;  3V92 A;  4O02 B;  1OF5 B;  4LSO A;  3PCR A;  5CF1 A;  1FA3 A;  1QAL A;  3DM8 A;  1KSI A;  2Z77 A;  1K73 4;  2LQV A;  3SOY A;  5JPU A;  3G8Z A;  2HMO B;  4I5Q A;  1M1K 4;  3CCV 3;  3HX8 A;  3X40 A;  1AY7 A;  2WOF A;  3S67 A;  3WHO A;  1OHS A;  1N5H A;  1SQW A;  3G16 A;  1BRG A;  3MYT A;  3MWZ A;  3NBB A;  3SED A;  1YJN 3;  3B4O A;  4J5K A;  3B8L A;  1RRH A;  1O7P B;  1YVB I;  5AEW B;  1EKM A;  2K3D A;  4K1V A;  1QAK A;  3DY5 A;  1RDS A;  1M9G A;  1BUQ A;  4J9A A;  1YIT 3;  1Q7Y 4;  3KFQ C;  3RGA A;  1VQ8 3;  1DET A;  3X3Y A;  1JBT A;  4HM5 B;  3EB8 A;  5I97 A;  1RN4 A;  1E97 A;  2HMN B;  1NB3 I;  2W9Q A;  2XFS A;  2HMJ B;  4O2H A;  4XM4 A;  3Q1C A;  2JDI H;  1NU3 A;  4GSP A;  1S72 3;  3BLZ A;  1N8Q A;  2H0H A;  3I56 3;  1PYL A;  1UCJ A;  1BOX A;  3ER7 A;  4K61 A;  1JBS A;  4HYZ A;  1TFK A;  4CPK A;  1GD3 A;  3CCE 3;  5JPP A;  1MGR A;  1OPY A;  1Y4K A;  2Y74 A;  4RZM A;  4WFO A;  4Q53 A;  3S29 A;  5BU4 A;  4FCJ A;  1UCL A;  4XDV A;  1GY6 A;  2H0G A;  4WHA A;  2K0M A;  1BAO A;  1KWI A;  2YFL B;  4BL3 A;  1LQG C;  1I3I A;  3D3L A;  1GMQ A;  3JUP A;  1UGH I;  1Q86 4;  4FMB A;  2WGO A;  2OQE A;  2KAA A;  3EC9 A;  4ILF A;  1BVI A;  1IVX A;  1BSE A;  3RDE A;  1T3B A;  1JKG B;  3OXA A;  3PS8 A;  8CHO A;  1ISK A;  1RN7 A;  1ZX2 A;  4N6V 0;  3KN4 A;  3OWY A;  4KZ1 A;  3KSP A;  3MSO A;  4N6N B;  2WOH A;  1LOW A;  4GHO A;  3CU3 A;  2GU1 A;  2OOV C;  2OTL 3;  1YGW A;  1J2B A;  3OWU A;  1FUT A;  4BTX A;  3FF0 A;  3BNB A;  2XR8 B;  1BRJ A;  3S28 A;  1KD1 4;  5IG3 A;  1IQ8 A;  5ELJ A;  1GOY A;  1YI2 3;  3Q90 A;  1S5A A;  1OUN A;  1WTH A;  3PCS A;  2CIU A;  1TUH A;  1T2H A;  1UUW B;  4N6U A;  2RGQ A;  3ZFZ A;  3NM7 A;  1IYY A;  2E2T A;  2OWP A;  1K8A 4;  3S27 A;  5IF6 A;  1JZD A;  1GOV A;  3KE7 A;  3SXX A;  4BIR A;  1GD4 A;  3PGB A;  1OH0 A;  2MC8 A;  3I55 3;  2LYX A;  3NV0 B;  4BU4 A;  3CC4 3;  1HU9 A;  4KFD A;  1LRA A;  3HK4 A;  1JV2 B;  2ML6 A;  3CCU 3;  3SVA A;  1JZO A;  2CX0 A;  2UX0 A;  5DRE A;  3JVC A;  1HYF A;  5G2G A;  1V57 A;  4L7K A;  5IEO A;  2KRT A;  3N54 B;  5KP3 A;  4R1K A;  4R9L A;  3LH4 A;  3ZG5 A;  3F9S A;  1YGE A;  2OOV A;  1B2X A;  1BNF A;  2CWT A;  1X1U A;  3J7Y d;  1AVL A;  3KSE D;  3WDG B;  3CCQ 3;  4HZ9 B;  3DGY A;  4H3U A;  1QMA A;  4WYK A;  4JRF A;  5IW9 A;  2XF3 A;  1VQL 3;  3AGO A;  3KZT A;  1HKX A;  1Q40 A;  3JUO A;  1FZU A;  3B7C A;  3LTD A;  3WMD A;  3CCR 3;  2YX9 A;  4HM0 B;  1DMQ A;  2XSO B;  3BND A;  1O7W B;  3S5C A;  3D9R A;  4EYC A;  2OTJ 3;  4N6T A;  1VQQ A;  2GU3 A;  3MKI A;  3WOD G;  5D83 A;  5IG0 A;  5AIF A;  5IEN A;  2Y73 A;  3JUM A;  3HZP A;  3A5E A;  6RNT A;  3EE1 A;  1W02 A;  3AHW A;  3BU4 A;  2O9U X;  6STD A;  1FYS A;  3OWS A;  2O3O A;  4MMX B;  1CQS A;  4XBY A;  3STD A;  3FG4 A;  3H51 A;  3WA2 X;  1V74 A;  3EHC A;  3CME 3;  1RN1 A;  3ECF A;  1VQN 3;  1LNH A;  1UGI A;  1SIH A;  1QVG 2;  4TX4 A;  1SPU A;  3RGR A;  3U97 A;  2GXF A;  1FGT A;  1R4C A;  1YJ9 3;  1TRP A;  2OQE C;  5IER A;  3OV4 A;  1JNQ A;  3Q3F A;  5EQL A;  1BNJ A;  2CX1 A;  1PU4 A;  1A90 A;  1LXE A;  4IT7 A;  2C4B A;  5G1L A;  1Q82 4;  4LMI A;  1BSB A;  2BU4 A;  3SOA A;  1W7C A;  3AGN A;  1O7M B;  3FKA A;  1MWS A;  4L8P A;  4CDL A;  3SX1 A;  1GMR A;  2P38 A;  3D4A A;  4OK0 A;  2GBW B;  4AKZ A;  1LNI A;  2F56 A;  3I0Y A;  2P0M A;  1RJO A;  4OUQ A;  2C10 A;  3T0U A;  2IUK A;  1DYU A;  4EV2 A;  1RGG A;  3EBY A;  1BSD A;  2P0X A;  4NPB A;  4MJD A;  5STD A;  2QEX 3;  3UNL A;  3EJV A;  1MNL A;  4PEJ A;  1PY3 A;  2Z76 A;  3F8X A;  3PYJ A;  3V98 A;  4WYK B;  1EA2 A;  1EQK A;  1IQY A;  3HOH A;  4EBG A;  5AIG A;  5IEP A;  1WMN A;  6GSP A;  3GAX A;  1UCK A;  3JUQ A;  1FGR A;  3LZA A;  2RBI A;  1DMM A;  2V1L A;  2KF6 A;  2IA7 A;  4GL6 A;  1VQ4 3;  4WP5 A;  1IVU A;  1CH0 A;  3X3X A;  1CEW I;  2FNQ A;  1A67 A;  2CFW A;  2IYJ A;  3VSY A;  2KF4 A;  2R41 A;  4EW5 A;  2WO0 A;  3CNM A;  1V58 A;  2XGN A;  1DE3 A;  1OF5 A;  1UI8 A;  2H0I A;  1U5O A;  1FUS A;  1RRL A;  2BNG A;  2HOH A;  1C54 A;  1Q7H A;  3F8H A;  1WMO A;  1LVN A;  4BTY A;  5BVB A;  1IQX A;  3MG2 A;  1RNB A;  3SLU A;  3IMA B;  4AEQ A;  1Z1S A;  1TFO A;  5G1K A;  1FW7 A;  1LOY A;  1BAN A;  1G02 A;  1VQO 3;  1EEJ A;  4G1M B;  5AII A;  1D6U A;  3URP A;  1I70 A;  2ZHX B;  3MHE A;  1IDP A;  1Q42 A;  1IK3 A;  1RGA A;  1IT7 A;  1IT8 A;  1JN5 B;  4N3V A;  4RNT A;  1NB5 I;  4L8O A;  2XH9 A;  3M8C A;  1I3F A;  1B2Z A;  1N5P A;  4FR9 A;  3BNC A;  2IUJ A;  2ML5 A;  2PNC A;  3OX9 A;  3G71 3;  1RMS A;  1BNR A;  3EN1 B;  5AYS C;  2ZA4 A;  3O8Y A;  3DXO A;  1I2F A;  3NUV A;  1EG9 B;  1O7G B;  4BL2 A;  1BNI A;  1JN5 A;  4K1U A;  1DVD A;  1IU7 A;  1YNV X;  2CFL A;  3NQZ A;  1ROV A;  1W6Y A;  3NQY A;  5CXO A;  1N8R 4;  1NNV A;  2RSX A;  2BMO B;  4K90 B;  8RNT A;  4RBN A;  1M1X B;  4N6L A;  2GEY A;  3BNE A;  3NV0 A;  4HZB B;  4N6M A;  3UL6 A;  1VQ5 3;  2XRX B;  3ALA A;  1RGF A;  3LOY A;  1STF I;  1BNE A;  2JQ5 A;  3JUN A;  4N6O B;  1AQZ A;  2CFD A;  4ORL A;  1RNT A;  2W03 A;  3QK9 A;  1SII A;  1O7H B;  1ZS7 A;  2AAD A;  3BIR A;  3L0R A;  2BMQ B;  2CW9 A;  3K7C A;  3LTB A;  4FMA A;  1WMP A;  1KC8 4;  1CYV A;  2J8X B;  3UJM A;  2HML B;  2UGI A;  1GS3 A;  1K28 A;  2MF7 A;  4HKV B;  1SJW A;  4MEI A;  2KF5 A;  1UI7 A;  4OVM A;  4X2H A;  5HGR A;  4KFE A;  2SBL A;  2W56 B;  3DH2 A;  1BIR A;  2CC3 A;  2I9W A;  3DGL A;  4HAA A;  4HM7 B;  1YHQ 3;  5CLK A;  4FMD A;  3HII A;  2BMR B;  1R4Y A;  1OHO A;  3B4P A;  4XBX A;  1BRI A;  4STD A;  3GZX B;  2D1W A;  3DGO A;  1IVV A;  1ZGX A;  4RNZ A;  5AIH A;  1RCK A;  3CC7 3;  2E2U A;  4HM6 B;  1L5G B;  5HOH A;  3D5G A;  1YIJ 3;  1LOX A;  3EX9 A;  4GB5 A;  4LGQ A;  1W00 A;  1NJI 4;  3NX0 A;  1Q81 4;  1NDO B;  2IMJ A;  1STD A;  1RGK A;  1RKY A;  1US1 A;  3CNX A;  2KCD A;  3HIG A;  2W9P A;  4MMY B;  1UCI A;  3N9H A;  3FZW A;  2CK3 H;  3DGM A;  3H3H A;  3IPT A;  4HM8 B;  2IY2 A;  4O3V A;  1AV4 A;  1U8C B;  4KT3 B;  2SAR A;  1W2B 2;  4NHF A;  2W6J H;  1DMN A;  1IV7 A;  2RCD A;  2ZDJ A;  3X3Z A;  3WR2 A;  1FGM A;  4IPB A;  1TIJ A;  3GZR A;  3GSP A;  5KP1 A;  3FH1 A;  2STD A;  1OHP A;  5M18 A;  1YVS A;  1EUI C;  1BNG A;  3LTC A;  1BSA A;  3FF2 A;  3LT9 A;  1UW1 A;  4JF8 A;  5BIR A;  5EVH A;  1UDI I;  2L4V A;  3K9M C;  2C11 A;  2L1S A;  4HM1 B;  4FCM A;  3CCM 3;  1BRN L;  1K41 A;  4HOH A;  3F40 A;  4XB5 A;  3KKG A;  3G6E 3;  4XDW A;  3G0K A;  1O7N B;  3KCH A;  5FW5 A;  1QAF A;  3UL5 A;  5CK6 A;  3AMO A;  1N9E A;  4CJN A;  1W5Z A;  2D42 A;  1CYU A;  4RNY A;  4CCV A;  4KVH A;  3NBJ A;  2CWU A;  2XSH B;  3K0Z A;  3EBT A;  2M7O A;  2CWV A;  2W56 A;  7RNT A;  5IG4 A;  2Q07 A;  1X1Y A;  5DRV A;  4KFF A;  1TTO A;  3EF8 A;  2RNT A;  3LT8 A;  3QRD A;  3WOF B;  5D81 A;  1VQ9 3;  3E99 A;  2E2V A;  2BHM A;  1VQ6 3; 
#chains in the Genus database with same CATH homology
 2YFJ B;  2KXG A;  1FUW A;  1GY5 A;  2CFG A;  4IIA A;  4H61 A;  1TU5 A;  4ZM8 A;  1ULJ B;  3FGY A;  5A0O B;  1PFP A;  1OGX A;  1ZO2 A;  1D6Y A;  5IG5 A;  3LML A;  3CMA 3;  1VQM 3;  4HM2 B;  1OAC A;  1UUV B;  1GYB A;  3FG1 A;  3CCL 3;  3NXJ A;  2W0Q A;  3TDG A;  3VF1 A;  1JB5 A;  3PZW A;  1ROA A;  2CHC A;  4HJL B;  5JBS A;  3CPO A;  1VQ7 3;  2GEX A;  3LYG A;  1JB4 A;  1W6G A;  5CF2 A;  1VQP 3;  4U13 A;  2XEP A;  1K9M 4;  2P09 A;  4EC6 A;  1A2K A;  1JB2 A;  5KP4 A;  4HM4 B;  2B1X B;  5AYR B;  1IVW A;  3X41 A;  3NHX A;  2HMK B;  1E3R A;  2BO9 B;  4FMC A;  3F7S A;  1NWW A;  2F98 A;  3LXU X;  3UB1 A;  4FCZ A;  5BXQ A;  4AKY A;  3F7X A;  1WQL B;  2WGQ A;  2P05 A;  2B24 B;  2F99 A;  1G96 A;  3FG3 A;  4QWT A;  1A2V A;  2BT3 A;  2PZV A;  2CKF B;  3DUK A;  3T8U A;  3VGN A;  2CG1 A;  1FGO A;  3GZY B;  4X2O A;  2FXT A;  2CH9 A;  2GBX B;  3GRD A;  4EV5 A;  1KQS 2;  3CXC 2;  4NRE A;  1TP6 A;  1NO3 A;  3CCS 3;  4XBT A;  7STD A;  3WOE B;  2ZL8 A;  1M90 4;  4R4K A;  5LC6 A;  1W2Z A;  2QIY A;  1IV9 A;  3AMO B;  1AR0 A;  3GZB A;  3HI7 A;  3V99 A;  1C7H A;  2W04 A;  2XFT A;  3CPW 2;  3N8B A;  3ROB A;  2OCT A;  1W4N A;  3Q2P A;  1JKG A;  1ULI B;  2QGU A;  3K63 A;  2R4I A;  3PXM A;  3DGN A;  2YFI B;  3MG3 A;  1FGQ A;  3KII A;  3T8N A;  3LTA A;  4R80 A;  5EEO A;  4HBR A;  3CCJ 3;  3FSD A;  3A76 A;  1OGZ A;  3X42 A;  3CC2 3;  1N9J A;  2Z7A A;  1F8N A;  1D6Z A;  2HMM B;  3FCS B;  4EXR A;  3F14 A;  5AI1 A;  3EQQ B;  2W2C A;  5AEU B;  5ELU A;  1AVK A;  2INX A;  3FLJ A;  1OCV A;  3EN8 A;  2FGT A;  1JRQ A;  1Q40 B;  1VZZ A;  3U1W A;  3MPH A;  2A15 A;  2K54 A;  3NBR A;  2CFK A;  1QVF 2;  1MOL A;  4HM3 B;  1W01 A;  3DZL A;  2Z6B A;  5TGN A;  1YJW 3;  1VQK 3;  1T5Y A;  1ASK A;  4LZI A;  2CG0 A;  4I4K A;  1GY7 A;  3K5T A;  3MG1 A;  5FGO A;  4J8T A;  4BTW A;  3IJE B;  3CD6 3;  3DMC A;  1QJG A;  3OW2 2;  5D82 A;  1E3V A;  3GWR A;  2F86 B;  5LC7 A;  2QA4 3;  4LEH A;  4WWU C;  1WNH A;  3BB9 A;  3WA3 A;  1W6C A;  4R9K A;  4HVN A;  2XGL A;  2RFR A;  3NM2 A;  4MMZ B;  1DVC A;  4O8S A;  3G4S 3;  3V92 A;  4O02 B;  1OF5 B;  4LSO A;  3PCR A;  5CF1 A;  1FA3 A;  1QAL A;  3DM8 A;  1KSI A;  2Z77 A;  1K73 4;  2LQV A;  3SOY A;  5JPU A;  3G8Z A;  2HMO B;  1M1K 4;  3CCV 3;  3HX8 A;  3X40 A;  2WOF A;  3S67 A;  1OHS A;  1N5H A;  1SQW A;  3G16 A;  3SED A;  3MYT A;  3MWZ A;  3NBB A;  1YJN 3;  3B4O A;  3B8L A;  1RRH A;  1O7P B;  1YVB I;  5AEW B;  1EKM A;  4K1V A;  1QAK A;  3DY5 A;  1M9G A;  1BUQ A;  4J9A A;  1YIT 3;  1Q7Y 4;  3KFQ C;  3RGA A;  1VQ8 3;  3X3Y A;  4HM5 B;  3EB8 A;  5I97 A;  1E97 A;  2HMN B;  1NB3 I;  2W9Q A;  2XFS A;  2HMJ B;  4O2H A;  4XM4 A;  3Q1C A;  2JDI H;  1NU3 A;  1S72 3;  3BLZ A;  1N8Q A;  3I56 3;  3ER7 A;  4K61 A;  4HYZ A;  1TFK A;  3CCE 3;  1GD3 A;  5JPP A;  1OPY A;  1Y4K A;  2Y74 A;  4RZM A;  4WFO A;  4Q53 A;  3S29 A;  4FCJ A;  4XDV A;  1GY6 A;  4WHA A;  2K0M A;  1KWI A;  2YFL B;  3D3L A;  3JUP A;  1Q86 4;  4FMB A;  2WGO A;  2OQE A;  3EC9 A;  1IVX A;  3RDE A;  1JKG B;  3OXA A;  3PS8 A;  8CHO A;  1ISK A;  1RN7 A;  1ZX2 A;  4N6V 0;  3KN4 A;  3OWY A;  4KZ1 A;  3KSP A;  3MSO A;  4N6N B;  2WOH A;  3CU3 A;  2GU1 A;  2OOV C;  2OTL 3;  1J2B A;  3OWU A;  4BTX A;  3FF0 A;  3BNB A;  2XR8 B;  3S28 A;  1KD1 4;  5IG3 A;  1IQ8 A;  5ELJ A;  1YI2 3;  3Q90 A;  1S5A A;  1OUN A;  1WTH A;  3PCS A;  1TUH A;  2CIU A;  1UUW B;  4N6U A;  2RGQ A;  3NM7 A;  2E2T A;  2OWP A;  1K8A 4;  3S27 A;  5IF6 A;  3KE7 A;  3SXX A;  1GD4 A;  3PGB A;  1OH0 A;  2MC8 A;  3I55 3;  2LYX A;  3NV0 B;  3CC4 3;  1HU9 A;  4KFD A;  3HK4 A;  1JV2 B;  2ML6 A;  3CCU 3;  3SVA A;  2UX0 A;  5DRE A;  3JVC A;  5G2G A;  4L7K A;  5IEO A;  2KRT A;  3N54 B;  5KP3 A;  4R1K A;  4R9L A;  3LH4 A;  3F9S A;  1YGE A;  2OOV A;  2CWT A;  3J7Y d;  1AVL A;  3KSE D;  3WDG B;  3CCQ 3;  4HZ9 B;  4WYK A;  4H3U A;  1QMA A;  5IW9 A;  4JRF A;  1VQL 3;  2XF3 A;  3KZT A;  1HKX A;  1Q40 A;  3JUO A;  3B7C A;  3LTD A;  3WMD A;  3CCR 3;  2YX9 A;  4HM0 B;  1DMQ A;  2XSO B;  3BND A;  1O7W B;  3S5C A;  3D9R A;  4EYC A;  2OTJ 3;  4N6T A;  2GU3 A;  3MKI A;  3WOD G;  5D83 A;  5IG0 A;  5AIF A;  5IEN A;  2Y73 A;  3JUM A;  3HZP A;  3EE1 A;  1W02 A;  2O9U X;  6STD A;  3OWS A;  2O3O A;  4MMX B;  1CQS A;  4XBY A;  3STD A;  3FG4 A;  3H51 A;  3WA2 X;  1V74 A;  3EHC A;  3CME 3;  3ECF A;  1VQN 3;  1LNH A;  1QVG 2;  1SIH A;  4TX4 A;  1SPU A;  3RGR A;  3U97 A;  2GXF A;  1FGT A;  1R4C A;  1YJ9 3;  2OQE C;  5IER A;  3OV4 A;  1JNQ A;  5EQL A;  1PU4 A;  1A90 A;  1LXE A;  4IT7 A;  1Q82 4;  4LMI A;  3SOA A;  1W7C A;  1O7M B;  3FKA A;  4L8P A;  4CDL A;  3SX1 A;  2P38 A;  4OK0 A;  2GBW B;  4AKZ A;  3I0Y A;  2P0M A;  1RJO A;  4OUQ A;  2C10 A;  3T0U A;  2IUK A;  1DYU A;  4EV2 A;  3EBY A;  2P0X A;  2QEX 3;  4MJD A;  5STD A;  3UNL A;  3EJV A;  1MNL A;  4PEJ A;  2Z76 A;  3F8X A;  3PYJ A;  3V98 A;  4WYK B;  1EA2 A;  1EQK A;  1IQY A;  4EBG A;  5AIG A;  5IEP A;  1WMN A;  3GAX A;  3JUQ A;  1FGR A;  3LZA A;  1DMM A;  2V1L A;  2IA7 A;  4GL6 A;  1VQ4 3;  4WP5 A;  1IVU A;  3X3X A;  1CEW I;  2FNQ A;  1A67 A;  2CFW A;  3VSY A;  2WO0 A;  3CNM A;  2XGN A;  1OF5 A;  1UI8 A;  1U5O A;  1RRL A;  2BNG A;  3F8H A;  1WMO A;  1LVN A;  4BTY A;  5BVB A;  1IQX A;  3MG2 A;  3SLU A;  3IMA B;  4AEQ A;  1Z1S A;  1TFO A;  1VQO 3;  4G1M B;  5AII A;  1D6U A;  3MHE A;  1IDP A;  1Q42 A;  1IK3 A;  1IT7 A;  1IT8 A;  1JN5 B;  4N3V A;  1NB5 I;  4L8O A;  2XH9 A;  3M8C A;  1N5P A;  4FR9 A;  3BNC A;  2IUJ A;  2ML5 A;  2PNC A;  3OX9 A;  3G71 3;  3EN1 B;  5AYS C;  3O8Y A;  3DXO A;  3NUV A;  1EG9 B;  1O7G B;  1JN5 A;  4K1U A;  1DVD A;  1IU7 A;  2CFL A;  3NQZ A;  1ROV A;  1W6Y A;  3NQY A;  5CXO A;  1N8R 4;  2RSX A;  2BMO B;  4K90 B;  4RBN A;  1M1X B;  4N6L A;  2GEY A;  3BNE A;  3NV0 A;  4HZB B;  4N6M A;  3UL6 A;  1VQ5 3;  2XRX B;  3ALA A;  3LOY A;  1STF I;  2JQ5 A;  3JUN A;  4N6O B;  2CFD A;  4ORL A;  2W03 A;  3QK9 A;  1SII A;  1O7H B;  3L0R A;  4FMA A;  3LTB A;  2BMQ B;  2CW9 A;  3K7C A;  1KC8 4;  1WMP A;  1CYV A;  3UJM A;  2HML B;  1GS3 A;  1K28 A;  2MF7 A;  4HKV B;  1SJW A;  4MEI A;  4OVM A;  1UI7 A;  4X2H A;  5HGR A;  4KFE A;  2SBL A;  2W56 B;  1JJ2 2;  2I9W A;  3DGL A;  2CC3 A;  4HM7 B;  1YHQ 3;  5CLK A;  4FMD A;  3HII A;  2BMR B;  4XBX A;  1OHO A;  3B4P A;  4STD A;  3GZX B;  2D1W A;  3DGO A;  1IVV A;  4RNZ A;  5AIH A;  3CC7 3;  2E2U A;  4HM6 B;  1L5G B;  1YIJ 3;  1LOX A;  3EX9 A;  4GB5 A;  4LGQ A;  1W00 A;  1NJI 4;  3NX0 A;  1Q81 4;  1NDO B;  2IMJ A;  1STD A;  1RKY A;  3CNX A;  1US1 A;  2KCD A;  3HIG A;  2W9P A;  4MMY B;  3N9H A;  3FZW A;  2CK3 H;  3DGM A;  3H3H A;  3IPT A;  4HM8 B;  4O3V A;  1AV4 A;  1U8C B;  1W2B 2;  4NHF A;  2W6J H;  1DMN A;  1IV7 A;  2RCD A;  2ZDJ A;  3X3Z A;  1FGM A;  4IPB A;  1TIJ A;  3GZR A;  5KP1 A;  3FH1 A;  2STD A;  1OHP A;  3LTC A;  3FF2 A;  3LT9 A;  1UW1 A;  4JF8 A;  5EVH A;  2L4V A;  3K9M C;  2C11 A;  4HM1 B;  4FCM A;  3CCM 3;  1K41 A;  3F40 A;  4XB5 A;  3KKG A;  3G6E 3;  4XDW A;  3G0K A;  1O7N B;  5FW5 A;  1QAF A;  3UL5 A;  5CK6 A;  3AMO A;  1N9E A;  1W5Z A;  2D42 A;  1CYU A;  4RNY A;  4CCV A;  4KVH A;  3NBJ A;  2CWU A;  2XSH B;  3K0Z A;  3EBT A;  2M7O A;  2CWV A;  2W56 A;  5IG4 A;  2Q07 A;  5DRV A;  4KFF A;  3EF8 A;  3QRD A;  3LT8 A;  3WOF B;  5D81 A;  1VQ9 3;  3E99 A;  2E2V A;  2BHM A;  1VQ6 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...