2KCDA

Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SSP0047
publication title Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Structural genomics, unknown function
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2kcdA00
5AYSC 2KCDA 3WDGB 5AYRB
chains in the Genus database with same CATH superfamily
2YFIB 3MWZA 4CPKA 3LTCA 3MG3A 1OGZA 1Q42A 1VZZA 3BB9A 1R4YA 2KF3A 1K28A 1SJWA 1LRAA 4X2OA 3DY5A 2K0MA 1VQ53 4PEJA 1JZOA 3HI7A 3NQZA 2D1WA 2XFTA 3GZXB 3VF1A 1EG9B 1X1XA 2GEXA 2QGUA 2WGQA 4KFEA 5GSPA 1UDII 1IU7A 3BLZA 1L5GB 1FUWA 1V57A 3EE1A 1Q9EA 3GZRA 5IENA 1IVXA 1IVWA 4AKZA 2HOHA 1JBTA 4XDWA 4HOHA 4WYKB 3CC43 1EUIC 1O7NB 3DGLA 2RNTA 2WGOA 3CXC2 1IV9A 1SARA 1OHOA 1K9M4 1BOXA 2E2UA 3NQYA 3T8UA 1BRNL 1U8CB 2IYJA 3D9RA 1RSNA 1GY6A 4NREA 5LC7A 4KVHA 1AQZA 1VQ63 1OUNA 3FF2A 1GOVA 2P38A 3AMOB 3CU3A 4RZMA 1UI7A 2W56A 3EC9A 1C54A 1BU4A 3DUKA 3IMAB 1VQ83 4FCZA 2J8XB 4I5QA 1BRHA 2W03A 3G4S3 3DH2A 4HM5B 1NJI4 1AVKA 3CC23 1A67A 2OOVC 2BIRA 1BRKA 1WMOA 1E3VA 1MNLA 1RCKA 5A0OB 3NV0A 4N6NB 3X40A 1Q824 4OK0A 2AADA 2XSHB 1I3FA 4ZM8A 1QALA 1YGEA 1N9EA 2F5WA 4LYLB 1OHPA 2K54A 1W02A 1Q864 1S723 2B1XB 1NB3I 1ULJB 5KP4A 2XH9A 1B3SA 2MF7A 4FMBA 3EHCA 1GMPA 2CWVA 2STDA 2KF4A 3LTAA 1IT8A 2H0HA 2QEX3 4XM4A 7RNTA 5IG5A 1WMPA 2CX1A 3D4AA 3SEDA 4AKYA 3NUVA 2A15A 4BTWA 1BNGA 2CK3H 1YJN3 1A2KA 2E2VA 5CLKA 3OWSA 3H51A 8RNTA 1KD14 1BRIA 5HOHA 3AGNA 3PCRA 2UUGC 1LOXA 4J5KA 1CYUA 3T0UA 1N5HA 1JV2B 3AGOA 1IV7A 3SOAA 3GRDA 2CHCA 1HZ1A 2LYXA 3SLUA 3UL6A 2Z7AA 4WP5A 1OHSA 1S5AA 1FGMA 2ZDJA 3B4PA 4NHFA 4GB5A 7STDA 1LOWA 1UCJA 2BO9B 1FGTA 1LQMB 1V58A 2BNGA 1NDOB 3CPOA 1ASKA 1EA2A 1LNIA 2K3DA 2P0MA 3NBBA 3UB1A 3PXMA 1RCLA 4K61A 3HIIA 5IEPA 5JPPA 1SIIA 4O02B 3LTDA 1I3IA 3OWUA 1IDPA 2L1SA 3WDGB 4LSOA 2ZHXB 1I2FA 1X1YA 1DETA 1JBRA 1NB5I 1OACA 1YVSA 3LOYA 4FMCA 1DMNA 1B27A 2W56B 4RNZA 5EEOA 1C7HA 2CG1A 3JUOA 3X3ZA 3DZLA 4XDVA 4MMZB 1D6ZA 4X2HA 1US1A 1TIJA 1M1K4 1TRQA 2I9WA 3N54B 2ML5A 1MOLA 3X42A 1BNJA 1RGLA 2HMNB 3NV0B 1KWIA 3SYUA 5KP1A 2D42A 2IMJA 5M18A 5AYRB 1FUTA 1MWTA 5M19A 4J8TA 3V98A 1OGXA 2HMLB 3MPHA 2BMOB 4KZ1A 1BNSA 4EXRA 2BHMA 3GSPA 5IG0A 1I0XA 2XRXB 3NBRA 4RNYA 5AIGA 3HIGA 1MGRA 1WMNA 2ML6A 4R4KA 3D79A 3F8XA 4LZIA 3T8NA 4HM6B 1YJ93 2BU4A 3GWRA 3QRDA 1UCLA 3UNLA 1RGEA 1RGKA 1R4CA 1AV4A 2Z6BA 3F40A 4QWTA 3STDA 3X41A 1EKMA 2SARA 3D5GA 3F14A 3FKAA 2O9UX 2C11A 2JDIH 1GD4A 2XEPA 2CIUA 2IUJA 1VQM3 1B2XA 1RGHA 1B2SA 1WNHA 1T2IA 1ZX2A 1YHQ3 5IG4A 4HM2B 1W00A 1BAOA 4KFFA 3OXAA 1N8QA 3ECFA 5JBSA 1IQ8A 1W5ZA 1EQKA 4HM0B 5AIIA 3RDEA 5M1AA 2W6JH 4XBYA 3JVCA 1FGQA 3RGRA 4HM1B 2OWPA 3CCV3 1ISKA 1FA3A 2IA7A 1I2EA 3G0KA 2MC8A 1BRSA 3S29A 1KC84 4RBNA 4XBTA 3EN8A 1LQGC 3CCU3 2W04A 2C4BA 3DGNA 1X1UA 1JB2A 2Y74A 3G6E3 2CG0A 1I2GA 5AIHA 4BU4A 1JJ22 1QAFA 1MWSA 1TRPA 3SVAA 2WOHA 3EQQB 5LC6A 1LOVA 5D81A 1Q40A 1STDA 1B2UA 3ZG5A 4ILFA 3LTBA 3WMDA 4WFOA 5CF2A 4EW5A 1BSAA 5G1LA 2Z77A 3V99A 2INXA 1IQXA 3KFQC 1B2MA 2SBLA 1A2VA 3K63A 2GBXB 1UCKA 3EF8A 3FH1A 2UX0A 1PU4A 1VQ93 1RHLA 1UUWB 1YNVX 2GXFA 4EV2A 1RN7A 3BNCA 3EJVA 3D3LA 7GSPA 2XGNA 1CH0A 1RN1A 1UI8A 2CFKA 5KP3A 5ELUA 4EBGA 2QIYA 1O7WB 3BIRA 3LMLA 3PYJA 2QA43 4HM7B 4GSPA 1RMSA 1BNRA 4MJDA 2JQ5A 3IPTA 1T3BA 5CK6A 1PFPA 2CFGA 3CPW2 1B21A 3I0YA 3NM7A 1LOYA 3NHXA 2KRTA 3Q2PA 1TFOA 3HOHA 3GZBA 3I563 3LH4A 4MEIA 4HJLB 3HK4A 3AHSA 2YX9A 3BNDA 3CCS3 1J2BA 1RJOA 4J5GA 1JNQA 3CNXA 4L8PA 1FUSA 5D83A 1KQS2 1NU3A 5FW5A 3WA2X 1JN5B 2AAEA 3CC73 4FR9A 1UGIA 1GMRA 2P09A 3O8YA 1ULIB 1VQ73 1BUJA 2OTJ3 1BUQA 2FXTA 1W6YA 1VQN3 2HMMB 1B20A 1JB5A 1TP6A 4KFDA 2CX0A 2WO0A 1CQSA 3NBJA 3WOEB 3PCSA 3CCQ3 3MSOA 2OTL3 3B7CA 1RTUA 3DGMA 1DMQA 2E2TA 2IY2A 3KE7A 1UUGB 4NPBA 4BL2A 3HZPA 1PY3A 3M8CA 3N8BA 1IYYA 4CCVA 1X1WA 3Q3FA 1VQO3 1BNIA 4FMDA 1CEWI 1QVG2 1W01A 2KAAA 4N6UA 1Q40B 5BU4A 3OW22 1OPYA 3EN1B 6RNTA 4CJNA 2GEYA 5JPUA 1O7HB 3K5TA 2BMQB 5AYSC 4N6TA 1YIJ3 2HMKB 1Z1SA 4LMIA 2P05A 3JUMA 5STDA 4O8SA 1NNVA 2W2CA 1V74A 1RGGA 2YFJB 3E99A 2CFLA 1LVNA 3CNMA 4HM8B 4HVNA 3UL5A 3URPA 1K734 1RLSA 3FCSB 2RSXA 3NX0A 4KT3B 1GY7A 1N8R4 2CH9A 2F56A 1FW7A 3Q90A 1LXEA 4J9AA 1GS3A 6STDA 5IERA 9RNTA 2CW9A 1Q7Y4 3FSDA 3OV4A 1T2HA 2UGIA 4FMAA 1CYVA 1JZDA 3K9MC 2M7OA 1N5PA 1DYUA 2XFSA 3WHOA 3FG3A 5FGOA 4BTYA 2H0IA 1WTHA 1UUVB 2F4YA 2C10A 4U13A 3G16A 4IIAA 2CC3A 1GSPA 1BIRA 1FGRA 4Q53A 1UW1A 1BNFA 1GMQA 2F98A 3EBTA 1LNHA 1K8A4 3WA3A 4HM4B 1RNBA 1BVIA 3MYTA 1BANA 5D82A 3G8ZA 2ZL8A 1M904 3BNBA 1IQYA 2CKFB 2W0QA 1DMMA 1DVDA 1W6GA 2F99A 3BNEA 2OCTA 1I8VA 3CMA3 1N9JA 4TX4A 2CFWA 2XR8B 4JF8A 1BSDA 3ALAA 3I553 3PGBA 5I97A 1RNTA 3S28A 4CDLA 1QJGA 2GU3A 2O3OA 4RNTA 3LZAA 2XGLA 1JN5A 4R1KA 2CWTA 3HX8A 3EX9A 5HGRA 3Q1CA 1DVCA 1GY5A 1JKGA 1OF5B 2XSOB 1W4NA 2W9QA 3AHWA 4BTXA 5IF6A 1TJDA 3F7SA 4O3VA 4H61A 4O2HA 2BT3A 1ROAA 2F5MA 3ZFZA 3DGYA 5G1KA 1G02A 1KSIA 1JBSA 3J7Yd 1STFI 1D6UA 3DM8A 4K90B 2GU1A 1W2ZA 1O7PB 1QMAA 2CWUA 4ORLA 1MGWA 1Q7HA 1BRGA 1D6YA 2W9PA 3CD63 4DKIA 1VQL3 3K0ZA 2Z76A 3KN4A 4HKVB 2RBIA 3CCJ3 1OCVA 3A76A 1FYSA 2IUKA 2WOFA 3OX9A 1EEJA 4IT7A 4R80A 3OWYA 1WQLB 3WODG 1RGCA 2ZA4A 2XF3A 5AEUB 1GOYA 1AVLA 4BIRA 1RKYA 3CCL3 2P0XA 2B24B 1FZUA 3S27A 1ZS7A 2V1LA 3FG1A 5IW9A 3A5EA 4LEHA 5IG3A 1UCIA 3SXXA 1BRJA 2PNCA 1W6CA 4N6OB 2R41A 3KKGA 2PZVA 4G1MB 2FGTA 4LGQA 8CHOA 2F86B 3SOYA 3KIIA 2KXGA 4N6LA 1NO3A 3MG1A 1Y4KA 5DRVA 1IVUA 3RNTA 3LXUX 3ROBA 1NWWA 1BSEA 3H3HA 1MWRA 4OVMA 1HU9A 3FG4A 4L8OA 3KCHA 5AEWB 2L4VA 5BXQA 6GSPA 4HZ9B 2OQEA 1HYFA 1HKXA 1RRLA 1YGWA 2HMJB 3CME3 1JKGB 2FNQA 1UGHI 5G2GA 3FF0A 1IVVA 3D5IA 3IJEB 2BMRB 1M1XB 1U5OA 3N9HA 3VGNA 3TDGA 3B8LA 3WOFB 4XB5A 3KZTA 1BSBA 3X3XA 2Y73A 5IEOA 1RRHA 4R9LA 1VQK3 1JB4A 1FGOA 3JUNA 4EYCA 1DE3A 3JUQA 4IPBA 1VQQA 3F8HA 3QK9A 1OF5A 3MG2A 4WWUC 2CFDA 1W7CA 1TFKA 1E97A 3DXOA 4GL6A 3U1WA 1Q814 1I70A 1MWUA 1F8NA 1QAKA 2KF5A 1PYLA 1ZO2A 3MKIA 1G96A 3X3YA 5EVHA 2KCDA 3LYGA 1I0VA 2Q07A 5CXOA 3FLJA 3V92A 1O7GB 4HAAA 1YIT3 1AR0A 1ROVA 3EBYA 3FZWA 3LT9A 1RGAA 4GHOA 1E3RA 4HZBB 5TGNA 1YJW3 2RGQA 1O7MB 1A2PA 4N6MA 1ZGXA 1QVF2 4L7KA 1GOUA 1IK3A 4FCMA 4AEQA 1GD3A 3L0RA 4EV5A 3ZG0A 3GAXA 5BIRA 4N3VA 1RGFA 4MMXB 4WYKA 2OQEC 3BU4A 1AY7A 1GYBA 3F9SA 1RN4A 4HYZA 1SPUA 4WHAA 5AI1A 3S67A 3RGAA 1YI23 3PZWA 1A90A 3KSPA 4OUQA 1RDSA 1SQWA 5EQLA 4N6V0 3NXJA 3VSYA 3WR2A 4BL3A 4XBXA 5CF1A 3G713 3PS8A 3AMOA 3EB8A 4EC6A 1W2B2 1BNEA 1G0TA 1YVBI 1TUHA 4MMYB 1M9GA 2YFLB 2HMOB 3FGYA 1TU5A 1SIHA 3DGOA 4H3UA 5ELJA 2H0GA 2GSPA 4HBRA 3ER7A 5RNTA 1K41A 5DREA 1BSCA 4FCJA 3CCR3 2RFRA 3SX1A 1B2ZA 1IT7A 4STDA 5AIFA 2KF6A 2RCDA 3K7CA 3KSED 1OH0A 3DMCA 3JUPA 3S5CA 4K1VA 1VQP3 1VQ43 2OOVA 3CCM3 1T5YA 5BVBA 3UJMA 3MHEA 1TTOA 3GZYB 3LT8A 3U97A 3CCE3 4K1UA 1BGSA 3B4OA 4I4KA 4R9KA 4JRFA 4HM3B 2GBWB 2R4IA 3NM2A 1JRQA 2LQVA 3F7XA
chains in the Genus database with same CATH topology
2YFIB 3MWZA 3LTCA 3MG3A 1OGZA 1Q42A 1VZZA 3BB9A 1K28A 1SJWA 4X2OA 3DY5A 2K0MA 1VQ53 4PEJA 3HI7A 3NQZA 2D1WA 2XFTA 3GZXB 3VF1A 1EG9B 2GEXA 2WGQA 2QGUA 4KFEA 1L5GB 1IU7A 3BLZA 1FUWA 3EE1A 3GZRA 5IENA 1IVXA 1IVWA 4AKZA 4XDWA 4WYKB 3CC43 1O7NB 3DGLA 2WGOA 3CXC2 1IV9A 1OHOA 1K9M4 2E2UA 3NQYA 3T8UA 1U8CB 3D9RA 1GY6A 4NREA 5LC7A 4KVHA 1VQ63 1OUNA 3FF2A 3AMOB 2P38A 3CU3A 4RZMA 1UI7A 2W56A 3EC9A 3DUKA 1VQ83 3IMAB 4FCZA 2W03A 3G4S3 4HM5B 1NJI4 1AVKA 3CC23 1A67A 2OOVC 1WMOA 1E3VA 1MNLA 5A0OB 3NV0A 4N6NB 3X40A 1Q824 4OK0A 2XSHB 4ZM8A 1QALA 1YGEA 1N9EA 1OHPA 2K54A 1W02A 1Q864 1S723 2B1XB 1NB3I 1ULJB 5KP4A 2XH9A 2MF7A 4FMBA 3EHCA 2CWVA 2STDA 3LTAA 1IT8A 2QEX3 4XM4A 5IG5A 3CCE3 1WMPA 3SEDA 4AKYA 4BTWA 1YJN3 3NUVA 2A15A 2CK3H 1A2KA 2E2VA 5CLKA 3OWSA 3H51A 1KD14 3PCRA 1LOXA 1CYUA 3T0UA 1N5HA 1JV2B 1IV7A 3SOAA 3GRDA 2CHCA 2LYXA 3SLUA 3UL6A 2Z7AA 4WP5A 1OHSA 1S5AA 1FGMA 2ZDJA 3B4PA 4NHFA 4GB5A 7STDA 2BO9B 1FGTA 2BNGA 1NDOB 3CPOA 1ASKA 1EA2A 2P0MA 3NBBA 3UB1A 3PXMA 4K61A 3HIIA 5IEPA 5JPPA 1SIIA 4O02B 3LTDA 3OWUA 1IDPA 3WDGB 4LSOA 1NB5I 1OACA 3LOYA 4FMCA 1DMNA 2W56B 4RNZA 5EEOA 2CG1A 1C7HA 3JUOA 3X3ZA 3DZLA 4XDVA 4MMZB 1D6ZA 4X2HA 1US1A 1TIJA 1M1K4 2I9WA 3N54B 2ML5A 1MOLA 3X42A 2HMNB 3NV0B 1KWIA 5KP1A 2D42A 2IMJA 5AYRB 4J8TA 3V98A 1OGXA 2HMLB 3MPHA 2BMOB 4KZ1A 4EXRA 2BHMA 5IG0A 2XRXB 3NBRA 4RNYA 5AIGA 3HIGA 4R4KA 1WMNA 2ML6A 3F8XA 4LZIA 3T8NA 4HM6B 1YJ93 3GWRA 3QRDA 3UNLA 2Z6BA 1R4CA 1AV4A 3F40A 4QWTA 3STDA 3X41A 1EKMA 3FKAA 3F14A 2O9UX 2C11A 2JDIH 1GD4A 2XEPA 2CIUA 2IUJA 1VQM3 1WNHA 1ZX2A 1YHQ3 5IG4A 4HM2B 1W00A 4KFFA 3OXAA 1N8QA 3ECFA 5JBSA 1IQ8A 1W5ZA 1EQKA 4HM0B 5AIIA 3RDEA 2W6JH 4XBYA 3JVCA 1FGQA 3RGRA 4HM1B 2OWPA 3CCV3 1ISKA 1FA3A 2IA7A 3G0KA 2MC8A 3S29A 1KC84 4RBNA 4XBTA 3EN8A 3CCU3 2W04A 3DGNA 3G6E3 2Y74A 1JB2A 2CG0A 5AIHA 1JJ22 1QAFA 3SVAA 2WOHA 3EQQB 5LC6A 5D81A 1Q40A 1STDA 3LTBA 3WMDA 4WFOA 5CF2A 2Z77A 3V99A 2INXA 1IQXA 3KFQC 2SBLA 1A2VA 3K63A 2GBXB 3EF8A 3FH1A 2UX0A 1PU4A 1VQ93 2GXFA 1UUWB 4EV2A 1RN7A 3BNCA 3EJVA 3D3LA 2XGNA 2CFKA 1UI8A 5KP3A 5ELUA 4EBGA 2QIYA 1O7WB 3LMLA 3PYJA 2QA43 4HM7B 4MJDA 2JQ5A 3IPTA 5CK6A 1PFPA 2CFGA 3CPW2 3I0YA 3NM7A 3NHXA 2KRTA 3Q2PA 1TFOA 3GZBA 3I563 3LH4A 4MEIA 4HJLB 3HK4A 3CCS3 2YX9A 3BNDA 1J2BA 1RJOA 4L8PA 1JNQA 3CNXA 5D83A 1KQS2 1NU3A 5FW5A 3WA2X 1JN5B 3CC73 4FR9A 2P09A 3O8YA 1ULIB 1VQ73 2OTJ3 1BUQA 2FXTA 1W6YA 1VQN3 2HMMB 1TP6A 1JB5A 4KFDA 3WOEB 2WO0A 3CCQ3 1CQSA 3NBJA 2OTL3 3PCSA 3MSOA 3B7CA 3DGMA 1DMQA 2E2TA 3KE7A 3HZPA 3M8CA 3N8BA 4CCVA 1VQO3 4FMDA 1CEWI 1QVG2 1W01A 4N6UA 1Q40B 3OW22 1OPYA 3EN1B 2GEYA 5JPUA 1O7HB 3K5TA 2BMQB 5AYSC 4N6TA 1YIJ3 2HMKB 1Z1SA 4LMIA 2P05A 3JUMA 5STDA 4O8SA 2W2CA 1V74A 4HM8B 2YFJB 3E99A 2CFLA 1LVNA 3CNMA 4HVNA 3UL5A 1K734 3FCSB 2RSXA 3NX0A 1GY7A 1N8R4 2CH9A 3Q90A 1LXEA 4J9AA 1GS3A 6STDA 5IERA 2CW9A 1Q7Y4 3FSDA 3OV4A 4FMAA 1CYVA 3K9MC 2M7OA 1N5PA 1DYUA 2XFSA 4BTYA 3FG3A 5FGOA 1WTHA 1UUVB 2C10A 4U13A 3G16A 4IIAA 2CC3A 1FGRA 4Q53A 1UW1A 2F98A 3EBTA 1LNHA 1K8A4 3WA3A 4HM4B 5D82A 3MYTA 3G8ZA 2ZL8A 1M904 3BNBA 1IQYA 2CKFB 2W0QA 1DMMA 1DVDA 1W6GA 2F99A 3BNEA 2OCTA 3CMA3 1N9JA 4TX4A 2CFWA 2XR8B 4JF8A 3ALAA 3I553 3PGBA 5I97A 3S28A 4CDLA 1QJGA 2GU3A 2O3OA 3LZAA 2XGLA 1JN5A 4R1KA 2CWTA 3HX8A 3EX9A 5HGRA 3Q1CA 1DVCA 1GY5A 1JKGA 1OF5B 2XSOB 1W4NA 2W9QA 4BTXA 5IF6A 3F7SA 4O3VA 4H61A 4O2HA 2BT3A 1ROAA 1KSIA 3J7Yd 1STFI 1D6UA 3DM8A 4K90B 2GU1A 1W2ZA 1O7PB 1QMAA 2CWUA 4ORLA 1D6YA 2W9PA 3CD63 1VQL3 3K0ZA 2Z76A 3KN4A 4HKVB 3CCJ3 1OCVA 3A76A 2IUKA 2WOFA 3OX9A 4IT7A 4R80A 3WODG 3OWYA 1WQLB 2XF3A 5AEUB 1AVLA 1RKYA 3CCL3 2P0XA 2B24B 3S27A 2V1LA 3FG1A 5IW9A 4LEHA 5IG3A 3SXXA 2PNCA 1W6CA 4N6OB 3KKGA 2PZVA 4G1MB 2FGTA 4LGQA 8CHOA 2F86B 3SOYA 3KIIA 2KXGA 4N6LA 1NO3A 3MG1A 1Y4KA 5DRVA 1IVUA 3LXUX 3ROBA 1NWWA 3H3HA 4OVMA 1HU9A 3FG4A 4L8OA 5AEWB 5BXQA 2L4VA 4HZ9B 2OQEA 1HKXA 1RRLA 2HMJB 3CME3 1JKGB 2FNQA 5G2GA 3FF0A 1IVVA 3IJEB 2BMRB 1M1XB 1U5OA 3N9HA 3VGNA 3TDGA 3B8LA 3WOFB 4XB5A 3KZTA 3X3XA 2Y73A 5IEOA 1RRHA 4R9LA 1VQK3 1JB4A 1FGOA 3JUNA 4EYCA 3JUQA 4IPBA 3F8HA 3QK9A 1OF5A 3MG2A 4WWUC 2CFDA 1W7CA 1TFKA 1E97A 3DXOA 4GL6A 3U1WA 1Q814 1F8NA 1QAKA 3MKIA 1ZO2A 3X3YA 1G96A 5EVHA 2KCDA 3LYGA 2Q07A 5CXOA 3FLJA 3V92A 1O7GB 1YIT3 1AR0A 1ROVA 3EBYA 3FZWA 3LT9A 4HZBB 1E3RA 1YJW3 5TGNA 2RGQA 1O7MB 4N6MA 1QVF2 4L7KA 1IK3A 4FCMA 4AEQA 1GD3A 3L0RA 4EV5A 3GAXA 4N3VA 4MMXB 4WYKA 2OQEC 1GYBA 4HYZA 3F9SA 5AI1A 3S67A 1SPUA 4WHAA 1A90A 3RGAA 1YI23 3PZWA 3KSPA 4OUQA 1SQWA 5EQLA 4N6V0 3NXJA 3VSYA 4XBXA 5CF1A 3G713 3PS8A 3AMOA 3EB8A 4EC6A 1W2B2 1YVBI 1TUHA 4MMYB 1M9GA 2YFLB 2HMOB 3FGYA 1TU5A 1SIHA 3DGOA 4H3UA 5ELJA 4HBRA 3ER7A 1K41A 5DREA 4FCJA 3CCR3 2RFRA 3SX1A 1IT7A 4STDA 5AIFA 2RCDA 3K7CA 3KSED 1OH0A 3DMCA 3JUPA 3S5CA 4K1VA 1VQP3 1VQ43 2OOVA 3CCM3 1T5YA 5BVBA 3UJMA 3MHEA 3GZYB 3LT8A 3U97A 4K1UA 4I4KA 3B4OA 4R9KA 4JRFA 4HM3B 2GBWB 2R4IA 3NM2A 1JRQA 2LQVA 3F7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYS C;  2KCD A;  3WDG B;  5AYR B; 
#chains in the Genus database with same CATH topology
 2YFI B;  3MWZ A;  4CPK A;  3LTC A;  3MG3 A;  1OGZ A;  1Q42 A;  1VZZ A;  3BB9 A;  1R4Y A;  2KF3 A;  1K28 A;  1SJW A;  1LRA A;  4X2O A;  3DY5 A;  2K0M A;  1VQ5 3;  4PEJ A;  1JZO A;  3HI7 A;  3NQZ A;  2D1W A;  2XFT A;  3GZX B;  3VF1 A;  1EG9 B;  1X1X A;  2GEX A;  2QGU A;  2WGQ A;  4KFE A;  5GSP A;  1UDI I;  1IU7 A;  3BLZ A;  1L5G B;  1FUW A;  1V57 A;  3EE1 A;  1Q9E A;  3GZR A;  5IEN A;  1IVX A;  1IVW A;  4AKZ A;  2HOH A;  1JBT A;  4XDW A;  4HOH A;  4WYK B;  3CC4 3;  1EUI C;  1O7N B;  3DGL A;  2RNT A;  2WGO A;  3CXC 2;  1IV9 A;  1SAR A;  1OHO A;  1K9M 4;  1BOX A;  2E2U A;  3NQY A;  3T8U A;  1BRN L;  1U8C B;  2IYJ A;  3D9R A;  1RSN A;  1GY6 A;  4NRE A;  5LC7 A;  4KVH A;  1AQZ A;  1VQ6 3;  1OUN A;  3FF2 A;  1GOV A;  2P38 A;  3AMO B;  3CU3 A;  4RZM A;  1UI7 A;  2W56 A;  3EC9 A;  1C54 A;  1BU4 A;  3DUK A;  3IMA B;  1VQ8 3;  4FCZ A;  2J8X B;  4I5Q A;  1BRH A;  2W03 A;  3G4S 3;  3DH2 A;  4HM5 B;  1NJI 4;  1AVK A;  3CC2 3;  1A67 A;  2OOV C;  2BIR A;  1BRK A;  1WMO A;  1E3V A;  1MNL A;  1RCK A;  5A0O B;  3NV0 A;  4N6N B;  3X40 A;  1Q82 4;  4OK0 A;  2AAD A;  2XSH B;  1I3F A;  4ZM8 A;  1QAL A;  1YGE A;  1N9E A;  2F5W A;  4LYL B;  1OHP A;  2K54 A;  1W02 A;  1Q86 4;  1S72 3;  2B1X B;  1NB3 I;  1ULJ B;  5KP4 A;  2XH9 A;  1B3S A;  2MF7 A;  4FMB A;  3EHC A;  1GMP A;  2CWV A;  2STD A;  2KF4 A;  3LTA A;  1IT8 A;  2H0H A;  2QEX 3;  4XM4 A;  7RNT A;  5IG5 A;  1WMP A;  2CX1 A;  3D4A A;  3SED A;  4AKY A;  3NUV A;  2A15 A;  4BTW A;  1BNG A;  2CK3 H;  1YJN 3;  1A2K A;  2E2V A;  5CLK A;  3OWS A;  3H51 A;  8RNT A;  1KD1 4;  1BRI A;  5HOH A;  3AGN A;  3PCR A;  2UUG C;  1LOX A;  4J5K A;  1CYU A;  3T0U A;  1N5H A;  1JV2 B;  3AGO A;  1IV7 A;  3SOA A;  3GRD A;  2CHC A;  1HZ1 A;  2LYX A;  3SLU A;  3UL6 A;  2Z7A A;  4WP5 A;  1OHS A;  1S5A A;  1FGM A;  2ZDJ A;  3B4P A;  4NHF A;  4GB5 A;  7STD A;  1LOW A;  1UCJ A;  2BO9 B;  1FGT A;  1LQM B;  1V58 A;  2BNG A;  1NDO B;  3CPO A;  1ASK A;  1EA2 A;  1LNI A;  2K3D A;  2P0M A;  3NBB A;  3UB1 A;  3PXM A;  1RCL A;  4K61 A;  3HII A;  5IEP A;  5JPP A;  1SII A;  4O02 B;  3LTD A;  1I3I A;  3OWU A;  1IDP A;  2L1S A;  3WDG B;  4LSO A;  2ZHX B;  1I2F A;  1X1Y A;  1DET A;  1JBR A;  1NB5 I;  1OAC A;  1YVS A;  3LOY A;  4FMC A;  1DMN A;  1B27 A;  2W56 B;  4RNZ A;  5EEO A;  1C7H A;  2CG1 A;  3JUO A;  3X3Z A;  3DZL A;  4XDV A;  4MMZ B;  1D6Z A;  4X2H A;  1US1 A;  1TIJ A;  1M1K 4;  1TRQ A;  2I9W A;  3N54 B;  2ML5 A;  1MOL A;  3X42 A;  1BNJ A;  1RGL A;  2HMN B;  3NV0 B;  1KWI A;  3SYU A;  5KP1 A;  2D42 A;  2IMJ A;  5M18 A;  5AYR B;  1FUT A;  1MWT A;  5M19 A;  4J8T A;  3V98 A;  1OGX A;  2HML B;  3MPH A;  2BMO B;  4KZ1 A;  1BNS A;  4EXR A;  2BHM A;  3GSP A;  5IG0 A;  1I0X A;  2XRX B;  3NBR A;  4RNY A;  5AIG A;  3HIG A;  1MGR A;  1WMN A;  2ML6 A;  4R4K A;  3D79 A;  3F8X A;  4LZI A;  3T8N A;  4HM6 B;  1YJ9 3;  2BU4 A;  3GWR A;  3QRD A;  1UCL A;  3UNL A;  1RGE A;  1RGK A;  1R4C A;  1AV4 A;  2Z6B A;  3F40 A;  4QWT A;  3STD A;  3X41 A;  1EKM A;  2SAR A;  3D5G A;  3F14 A;  3FKA A;  2O9U X;  2C11 A;  2JDI H;  1GD4 A;  2XEP A;  2CIU A;  2IUJ A;  1VQM 3;  1B2X A;  1RGH A;  1B2S A;  1WNH A;  1T2I A;  1ZX2 A;  1YHQ 3;  5IG4 A;  4HM2 B;  1W00 A;  1BAO A;  4KFF A;  3OXA A;  1N8Q A;  3ECF A;  5JBS A;  1IQ8 A;  1W5Z A;  1EQK A;  4HM0 B;  5AII A;  3RDE A;  5M1A A;  2W6J H;  4XBY A;  3JVC A;  1FGQ A;  3RGR A;  4HM1 B;  2OWP A;  3CCV 3;  1ISK A;  1FA3 A;  2IA7 A;  1I2E A;  3G0K A;  2MC8 A;  1BRS A;  3S29 A;  1KC8 4;  4RBN A;  4XBT A;  3EN8 A;  1LQG C;  3CCU 3;  2W04 A;  2C4B A;  3DGN A;  1X1U A;  1JB2 A;  2Y74 A;  3G6E 3;  2CG0 A;  1I2G A;  5AIH A;  4BU4 A;  1JJ2 2;  1QAF A;  1MWS A;  1TRP A;  3SVA A;  2WOH A;  3EQQ B;  5LC6 A;  1LOV A;  5D81 A;  1Q40 A;  1STD A;  1B2U A;  3ZG5 A;  4ILF A;  3LTB A;  3WMD A;  4WFO A;  5CF2 A;  4EW5 A;  1BSA A;  5G1L A;  2Z77 A;  3V99 A;  2INX A;  1IQX A;  3KFQ C;  1B2M A;  2SBL A;  1A2V A;  3K63 A;  2GBX B;  1UCK A;  3EF8 A;  3FH1 A;  2UX0 A;  1PU4 A;  1VQ9 3;  1RHL A;  1UUW B;  1YNV X;  2GXF A;  4EV2 A;  1RN7 A;  3BNC A;  3EJV A;  3D3L A;  7GSP A;  2XGN A;  1CH0 A;  1RN1 A;  1UI8 A;  2CFK A;  5KP3 A;  5ELU A;  4EBG A;  2QIY A;  1O7W B;  3BIR A;  3LML A;  3PYJ A;  2QA4 3;  4HM7 B;  4GSP A;  1RMS A;  1BNR A;  4MJD A;  2JQ5 A;  3IPT A;  1T3B A;  5CK6 A;  1PFP A;  2CFG A;  3CPW 2;  1B21 A;  3I0Y A;  3NM7 A;  1LOY A;  3NHX A;  2KRT A;  3Q2P A;  1TFO A;  3HOH A;  3GZB A;  3I56 3;  3LH4 A;  4MEI A;  4HJL B;  3HK4 A;  3AHS A;  2YX9 A;  3BND A;  3CCS 3;  1J2B A;  1RJO A;  4J5G A;  1JNQ A;  3CNX A;  4L8P A;  1FUS A;  5D83 A;  1KQS 2;  1NU3 A;  5FW5 A;  3WA2 X;  1JN5 B;  2AAE A;  3CC7 3;  4FR9 A;  1UGI A;  1GMR A;  2P09 A;  3O8Y A;  1ULI B;  1VQ7 3;  1BUJ A;  2OTJ 3;  1BUQ A;  2FXT A;  1W6Y A;  1VQN 3;  2HMM B;  1B20 A;  1JB5 A;  1TP6 A;  4KFD A;  2CX0 A;  2WO0 A;  1CQS A;  3NBJ A;  3WOE B;  3PCS A;  3CCQ 3;  3MSO A;  2OTL 3;  3B7C A;  1RTU A;  3DGM A;  1DMQ A;  2E2T A;  2IY2 A;  3KE7 A;  1UUG B;  4NPB A;  4BL2 A;  3HZP A;  1PY3 A;  3M8C A;  3N8B A;  1IYY A;  4CCV A;  1X1W A;  3Q3F A;  1VQO 3;  1BNI A;  4FMD A;  1CEW I;  1QVG 2;  1W01 A;  2KAA A;  4N6U A;  1Q40 B;  5BU4 A;  3OW2 2;  1OPY A;  3EN1 B;  6RNT A;  4CJN A;  2GEY A;  5JPU A;  1O7H B;  3K5T A;  2BMQ B;  5AYS C;  4N6T A;  1YIJ 3;  2HMK B;  1Z1S A;  4LMI A;  2P05 A;  3JUM A;  5STD A;  4O8S A;  1NNV A;  2W2C A;  1V74 A;  1RGG A;  2YFJ B;  3E99 A;  2CFL A;  1LVN A;  3CNM A;  4HM8 B;  4HVN A;  3UL5 A;  3URP A;  1K73 4;  1RLS A;  3FCS B;  2RSX A;  3NX0 A;  4KT3 B;  1GY7 A;  1N8R 4;  2CH9 A;  2F56 A;  1FW7 A;  3Q90 A;  1LXE A;  4J9A A;  1GS3 A;  6STD A;  5IER A;  9RNT A;  2CW9 A;  1Q7Y 4;  3FSD A;  3OV4 A;  1T2H A;  2UGI A;  4FMA A;  1CYV A;  1JZD A;  3K9M C;  2M7O A;  1N5P A;  1DYU A;  2XFS A;  3WHO A;  3FG3 A;  5FGO A;  4BTY A;  2H0I A;  1WTH A;  1UUV B;  2F4Y A;  2C10 A;  4U13 A;  3G16 A;  4IIA A;  2CC3 A;  1GSP A;  1BIR A;  1FGR A;  4Q53 A;  1UW1 A;  1BNF A;  1GMQ A;  2F98 A;  3EBT A;  1LNH A;  1K8A 4;  3WA3 A;  4HM4 B;  1RNB A;  1BVI A;  3MYT A;  1BAN A;  5D82 A;  3G8Z A;  2ZL8 A;  1M90 4;  3BNB A;  1IQY A;  2CKF B;  2W0Q A;  1DMM A;  1DVD A;  1W6G A;  2F99 A;  3BNE A;  2OCT A;  1I8V A;  3CMA 3;  1N9J A;  4TX4 A;  2CFW A;  2XR8 B;  4JF8 A;  1BSD A;  3ALA A;  3I55 3;  3PGB A;  5I97 A;  1RNT A;  3S28 A;  4CDL A;  1QJG A;  2GU3 A;  2O3O A;  4RNT A;  3LZA A;  2XGL A;  1JN5 A;  4R1K A;  2CWT A;  3HX8 A;  3EX9 A;  5HGR A;  3Q1C A;  1DVC A;  1GY5 A;  1JKG A;  1OF5 B;  2XSO B;  1W4N A;  2W9Q A;  3AHW A;  4BTX A;  5IF6 A;  1TJD A;  3F7S A;  4O3V A;  4H61 A;  4O2H A;  2BT3 A;  1ROA A;  2F5M A;  3ZFZ A;  3DGY A;  5G1K A;  1G02 A;  1KSI A;  1JBS A;  3J7Y d;  1STF I;  1D6U A;  3DM8 A;  4K90 B;  2GU1 A;  1W2Z A;  1O7P B;  1QMA A;  2CWU A;  4ORL A;  1MGW A;  1Q7H A;  1BRG A;  1D6Y A;  2W9P A;  3CD6 3;  4DKI A;  1VQL 3;  3K0Z A;  2Z76 A;  3KN4 A;  4HKV B;  2RBI A;  3CCJ 3;  1OCV A;  3A76 A;  1FYS A;  2IUK A;  2WOF A;  3OX9 A;  1EEJ A;  4IT7 A;  4R80 A;  3OWY A;  1WQL B;  3WOD G;  1RGC A;  2ZA4 A;  2XF3 A;  5AEU B;  1GOY A;  1AVL A;  4BIR A;  1RKY A;  3CCL 3;  2P0X A;  2B24 B;  1FZU A;  3S27 A;  1ZS7 A;  2V1L A;  3FG1 A;  5IW9 A;  3A5E A;  4LEH A;  5IG3 A;  1UCI A;  3SXX A;  1BRJ A;  2PNC A;  1W6C A;  4N6O B;  2R41 A;  3KKG A;  2PZV A;  4G1M B;  2FGT A;  4LGQ A;  8CHO A;  2F86 B;  3SOY A;  3KII A;  2KXG A;  4N6L A;  1NO3 A;  3MG1 A;  1Y4K A;  5DRV A;  1IVU A;  3RNT A;  3LXU X;  3ROB A;  1NWW A;  1BSE A;  3H3H A;  1MWR A;  4OVM A;  1HU9 A;  3FG4 A;  4L8O A;  3KCH A;  5AEW B;  2L4V A;  5BXQ A;  6GSP A;  4HZ9 B;  2OQE A;  1HYF A;  1HKX A;  1RRL A;  1YGW A;  2HMJ B;  3CME 3;  1JKG B;  2FNQ A;  1UGH I;  5G2G A;  3FF0 A;  1IVV A;  3D5I A;  3IJE B;  2BMR B;  1M1X B;  1U5O A;  3N9H A;  3VGN A;  3TDG A;  3B8L A;  3WOF B;  4XB5 A;  3KZT A;  1BSB A;  3X3X A;  2Y73 A;  5IEO A;  1RRH A;  4R9L A;  1VQK 3;  1JB4 A;  1FGO A;  3JUN A;  4EYC A;  1DE3 A;  3JUQ A;  4IPB A;  1VQQ A;  3F8H A;  3QK9 A;  1OF5 A;  3MG2 A;  4WWU C;  2CFD A;  1W7C A;  1TFK A;  1E97 A;  3DXO A;  4GL6 A;  3U1W A;  1Q81 4;  1I70 A;  1MWU A;  1F8N A;  1QAK A;  2KF5 A;  1PYL A;  1ZO2 A;  3MKI A;  1G96 A;  3X3Y A;  5EVH A;  2KCD A;  3LYG A;  1I0V A;  2Q07 A;  5CXO A;  3FLJ A;  3V92 A;  1O7G B;  4HAA A;  1YIT 3;  1AR0 A;  1ROV A;  3EBY A;  3FZW A;  3LT9 A;  1RGA A;  4GHO A;  1E3R A;  4HZB B;  5TGN A;  1YJW 3;  2RGQ A;  1O7M B;  1A2P A;  4N6M A;  1ZGX A;  1QVF 2;  4L7K A;  1GOU A;  1IK3 A;  4FCM A;  4AEQ A;  1GD3 A;  3L0R A;  4EV5 A;  3ZG0 A;  3GAX A;  5BIR A;  4N3V A;  1RGF A;  4MMX B;  4WYK A;  2OQE C;  3BU4 A;  1AY7 A;  1GYB A;  3F9S A;  1RN4 A;  4HYZ A;  1SPU A;  4WHA A;  5AI1 A;  3S67 A;  3RGA A;  1YI2 3;  3PZW A;  1A90 A;  3KSP A;  4OUQ A;  1RDS A;  1SQW A;  5EQL A;  4N6V 0;  3NXJ A;  3VSY A;  3WR2 A;  4BL3 A;  4XBX A;  5CF1 A;  3G71 3;  3PS8 A;  3AMO A;  3EB8 A;  4EC6 A;  1W2B 2;  1BNE A;  1G0T A;  1YVB I;  1TUH A;  4MMY B;  1M9G A;  2YFL B;  2HMO B;  3FGY A;  1TU5 A;  1SIH A;  3DGO A;  4H3U A;  5ELJ A;  2H0G A;  2GSP A;  4HBR A;  3ER7 A;  5RNT A;  1K41 A;  5DRE A;  1BSC A;  4FCJ A;  3CCR 3;  2RFR A;  3SX1 A;  1B2Z A;  1IT7 A;  4STD A;  5AIF A;  2KF6 A;  2RCD A;  3K7C A;  3KSE D;  1OH0 A;  3DMC A;  3JUP A;  3S5C A;  4K1V A;  1VQP 3;  1VQ4 3;  2OOV A;  3CCM 3;  1T5Y A;  5BVB A;  3UJM A;  3MHE A;  1TTO A;  3GZY B;  3LT8 A;  3U97 A;  3CCE 3;  4K1U A;  1BGS A;  3B4O A;  4I4K A;  4R9K A;  4JRF A;  4HM3 B;  2GBW B;  2R4I A;  3NM2 A;  1JRQ A;  2LQV A;  3F7X A; 
#chains in the Genus database with same CATH homology
 2YFI B;  3MWZ A;  3LTC A;  3MG3 A;  1OGZ A;  1Q42 A;  1VZZ A;  3BB9 A;  1K28 A;  1SJW A;  4X2O A;  3DY5 A;  2K0M A;  1VQ5 3;  4PEJ A;  3HI7 A;  3NQZ A;  2D1W A;  2XFT A;  3GZX B;  3VF1 A;  1EG9 B;  2GEX A;  2WGQ A;  2QGU A;  4KFE A;  1L5G B;  1IU7 A;  3BLZ A;  1FUW A;  3EE1 A;  3GZR A;  5IEN A;  1IVX A;  1IVW A;  4AKZ A;  4XDW A;  4WYK B;  3CC4 3;  1O7N B;  3DGL A;  2WGO A;  3CXC 2;  1IV9 A;  1OHO A;  1K9M 4;  2E2U A;  3NQY A;  3T8U A;  1U8C B;  3D9R A;  1GY6 A;  4NRE A;  5LC7 A;  4KVH A;  1VQ6 3;  1OUN A;  3FF2 A;  3AMO B;  2P38 A;  3CU3 A;  4RZM A;  1UI7 A;  2W56 A;  3EC9 A;  3DUK A;  1VQ8 3;  3IMA B;  4FCZ A;  2W03 A;  3G4S 3;  4HM5 B;  1NJI 4;  1AVK A;  3CC2 3;  1A67 A;  2OOV C;  1WMO A;  1E3V A;  1MNL A;  5A0O B;  3NV0 A;  4N6N B;  3X40 A;  1Q82 4;  4OK0 A;  2XSH B;  4ZM8 A;  1QAL A;  1YGE A;  1N9E A;  1OHP A;  2K54 A;  1W02 A;  1Q86 4;  1S72 3;  2B1X B;  1NB3 I;  1ULJ B;  5KP4 A;  2XH9 A;  2MF7 A;  4FMB A;  3EHC A;  2CWV A;  2STD A;  3LTA A;  1IT8 A;  2QEX 3;  4XM4 A;  5IG5 A;  3CCE 3;  1WMP A;  3SED A;  4AKY A;  4BTW A;  1YJN 3;  3NUV A;  2A15 A;  2CK3 H;  1A2K A;  2E2V A;  5CLK A;  3OWS A;  3H51 A;  1KD1 4;  3PCR A;  1LOX A;  1CYU A;  3T0U A;  1N5H A;  1JV2 B;  1IV7 A;  3SOA A;  3GRD A;  2CHC A;  2LYX A;  3SLU A;  3UL6 A;  2Z7A A;  4WP5 A;  1OHS A;  1S5A A;  1FGM A;  2ZDJ A;  3B4P A;  4NHF A;  4GB5 A;  7STD A;  2BO9 B;  1FGT A;  2BNG A;  1NDO B;  3CPO A;  1ASK A;  1EA2 A;  2P0M A;  3NBB A;  3UB1 A;  3PXM A;  4K61 A;  3HII A;  5IEP A;  5JPP A;  1SII A;  4O02 B;  3LTD A;  3OWU A;  1IDP A;  3WDG B;  4LSO A;  1NB5 I;  1OAC A;  3LOY A;  4FMC A;  1DMN A;  2W56 B;  4RNZ A;  5EEO A;  2CG1 A;  1C7H A;  3JUO A;  3X3Z A;  3DZL A;  4XDV A;  4MMZ B;  1D6Z A;  4X2H A;  1US1 A;  1TIJ A;  1M1K 4;  2I9W A;  3N54 B;  2ML5 A;  1MOL A;  3X42 A;  2HMN B;  3NV0 B;  1KWI A;  5KP1 A;  2D42 A;  2IMJ A;  5AYR B;  4J8T A;  3V98 A;  1OGX A;  2HML B;  3MPH A;  2BMO B;  4KZ1 A;  4EXR A;  2BHM A;  5IG0 A;  2XRX B;  3NBR A;  4RNY A;  5AIG A;  3HIG A;  4R4K A;  1WMN A;  2ML6 A;  3F8X A;  4LZI A;  3T8N A;  4HM6 B;  1YJ9 3;  3GWR A;  3QRD A;  3UNL A;  2Z6B A;  1R4C A;  1AV4 A;  3F40 A;  4QWT A;  3STD A;  3X41 A;  1EKM A;  3FKA A;  3F14 A;  2O9U X;  2C11 A;  2JDI H;  1GD4 A;  2XEP A;  2CIU A;  2IUJ A;  1VQM 3;  1WNH A;  1ZX2 A;  1YHQ 3;  5IG4 A;  4HM2 B;  1W00 A;  4KFF A;  3OXA A;  1N8Q A;  3ECF A;  5JBS A;  1IQ8 A;  1W5Z A;  1EQK A;  4HM0 B;  5AII A;  3RDE A;  2W6J H;  4XBY A;  3JVC A;  1FGQ A;  3RGR A;  4HM1 B;  2OWP A;  3CCV 3;  1ISK A;  1FA3 A;  2IA7 A;  3G0K A;  2MC8 A;  3S29 A;  1KC8 4;  4RBN A;  4XBT A;  3EN8 A;  3CCU 3;  2W04 A;  3DGN A;  3G6E 3;  2Y74 A;  1JB2 A;  2CG0 A;  5AIH A;  1JJ2 2;  1QAF A;  3SVA A;  2WOH A;  3EQQ B;  5LC6 A;  5D81 A;  1Q40 A;  1STD A;  3LTB A;  3WMD A;  4WFO A;  5CF2 A;  2Z77 A;  3V99 A;  2INX A;  1IQX A;  3KFQ C;  2SBL A;  1A2V A;  3K63 A;  2GBX B;  3EF8 A;  3FH1 A;  2UX0 A;  1PU4 A;  1VQ9 3;  2GXF A;  1UUW B;  4EV2 A;  1RN7 A;  3BNC A;  3EJV A;  3D3L A;  2XGN A;  2CFK A;  1UI8 A;  5KP3 A;  5ELU A;  4EBG A;  2QIY A;  1O7W B;  3LML A;  3PYJ A;  2QA4 3;  4HM7 B;  4MJD A;  2JQ5 A;  3IPT A;  5CK6 A;  1PFP A;  2CFG A;  3CPW 2;  3I0Y A;  3NM7 A;  3NHX A;  2KRT A;  3Q2P A;  1TFO A;  3GZB A;  3I56 3;  3LH4 A;  4MEI A;  4HJL B;  3HK4 A;  3CCS 3;  2YX9 A;  3BND A;  1J2B A;  1RJO A;  4L8P A;  1JNQ A;  3CNX A;  5D83 A;  1KQS 2;  1NU3 A;  5FW5 A;  3WA2 X;  1JN5 B;  3CC7 3;  4FR9 A;  2P09 A;  3O8Y A;  1ULI B;  1VQ7 3;  2OTJ 3;  1BUQ A;  2FXT A;  1W6Y A;  1VQN 3;  2HMM B;  1TP6 A;  1JB5 A;  4KFD A;  3WOE B;  2WO0 A;  3CCQ 3;  1CQS A;  3NBJ A;  2OTL 3;  3PCS A;  3MSO A;  3B7C A;  3DGM A;  1DMQ A;  2E2T A;  3KE7 A;  3HZP A;  3M8C A;  3N8B A;  4CCV A;  1VQO 3;  4FMD A;  1CEW I;  1QVG 2;  1W01 A;  4N6U A;  1Q40 B;  3OW2 2;  1OPY A;  3EN1 B;  2GEY A;  5JPU A;  1O7H B;  3K5T A;  2BMQ B;  5AYS C;  4N6T A;  1YIJ 3;  2HMK B;  1Z1S A;  4LMI A;  2P05 A;  3JUM A;  5STD A;  4O8S A;  2W2C A;  1V74 A;  4HM8 B;  2YFJ B;  3E99 A;  2CFL A;  1LVN A;  3CNM A;  4HVN A;  3UL5 A;  1K73 4;  3FCS B;  2RSX A;  3NX0 A;  1GY7 A;  1N8R 4;  2CH9 A;  3Q90 A;  1LXE A;  4J9A A;  1GS3 A;  6STD A;  5IER A;  2CW9 A;  1Q7Y 4;  3FSD A;  3OV4 A;  4FMA A;  1CYV A;  3K9M C;  2M7O A;  1N5P A;  1DYU A;  2XFS A;  4BTY A;  3FG3 A;  5FGO A;  1WTH A;  1UUV B;  2C10 A;  4U13 A;  3G16 A;  4IIA A;  2CC3 A;  1FGR A;  4Q53 A;  1UW1 A;  2F98 A;  3EBT A;  1LNH A;  1K8A 4;  3WA3 A;  4HM4 B;  5D82 A;  3MYT A;  3G8Z A;  2ZL8 A;  1M90 4;  3BNB A;  1IQY A;  2CKF B;  2W0Q A;  1DMM A;  1DVD A;  1W6G A;  2F99 A;  3BNE A;  2OCT A;  3CMA 3;  1N9J A;  4TX4 A;  2CFW A;  2XR8 B;  4JF8 A;  3ALA A;  3I55 3;  3PGB A;  5I97 A;  3S28 A;  4CDL A;  1QJG A;  2GU3 A;  2O3O A;  3LZA A;  2XGL A;  1JN5 A;  4R1K A;  2CWT A;  3HX8 A;  3EX9 A;  5HGR A;  3Q1C A;  1DVC A;  1GY5 A;  1JKG A;  1OF5 B;  2XSO B;  1W4N A;  2W9Q A;  4BTX A;  5IF6 A;  3F7S A;  4O3V A;  4H61 A;  4O2H A;  2BT3 A;  1ROA A;  1KSI A;  3J7Y d;  1STF I;  1D6U A;  3DM8 A;  4K90 B;  2GU1 A;  1W2Z A;  1O7P B;  1QMA A;  2CWU A;  4ORL A;  1D6Y A;  2W9P A;  3CD6 3;  1VQL 3;  3K0Z A;  2Z76 A;  3KN4 A;  4HKV B;  3CCJ 3;  1OCV A;  3A76 A;  2IUK A;  2WOF A;  3OX9 A;  4IT7 A;  4R80 A;  3WOD G;  3OWY A;  1WQL B;  2XF3 A;  5AEU B;  1AVL A;  1RKY A;  3CCL 3;  2P0X A;  2B24 B;  3S27 A;  2V1L A;  3FG1 A;  5IW9 A;  4LEH A;  5IG3 A;  3SXX A;  2PNC A;  1W6C A;  4N6O B;  3KKG A;  2PZV A;  4G1M B;  2FGT A;  4LGQ A;  8CHO A;  2F86 B;  3SOY A;  3KII A;  2KXG A;  4N6L A;  1NO3 A;  3MG1 A;  1Y4K A;  5DRV A;  1IVU A;  3LXU X;  3ROB A;  1NWW A;  3H3H A;  4OVM A;  1HU9 A;  3FG4 A;  4L8O A;  5AEW B;  5BXQ A;  2L4V A;  4HZ9 B;  2OQE A;  1HKX A;  1RRL A;  2HMJ B;  3CME 3;  1JKG B;  2FNQ A;  5G2G A;  3FF0 A;  1IVV A;  3IJE B;  2BMR B;  1M1X B;  1U5O A;  3N9H A;  3VGN A;  3TDG A;  3B8L A;  3WOF B;  4XB5 A;  3KZT A;  3X3X A;  2Y73 A;  5IEO A;  1RRH A;  4R9L A;  1VQK 3;  1JB4 A;  1FGO A;  3JUN A;  4EYC A;  3JUQ A;  4IPB A;  3F8H A;  3QK9 A;  1OF5 A;  3MG2 A;  4WWU C;  2CFD A;  1W7C A;  1TFK A;  1E97 A;  3DXO A;  4GL6 A;  3U1W A;  1Q81 4;  1F8N A;  1QAK A;  3MKI A;  1ZO2 A;  3X3Y A;  1G96 A;  5EVH A;  2KCD A;  3LYG A;  2Q07 A;  5CXO A;  3FLJ A;  3V92 A;  1O7G B;  1YIT 3;  1AR0 A;  1ROV A;  3EBY A;  3FZW A;  3LT9 A;  4HZB B;  1E3R A;  1YJW 3;  5TGN A;  2RGQ A;  1O7M B;  4N6M A;  1QVF 2;  4L7K A;  1IK3 A;  4FCM A;  4AEQ A;  1GD3 A;  3L0R A;  4EV5 A;  3GAX A;  4N3V A;  4MMX B;  4WYK A;  2OQE C;  1GYB A;  4HYZ A;  3F9S A;  5AI1 A;  3S67 A;  1SPU A;  4WHA A;  1A90 A;  3RGA A;  1YI2 3;  3PZW A;  3KSP A;  4OUQ A;  1SQW A;  5EQL A;  4N6V 0;  3NXJ A;  3VSY A;  4XBX A;  5CF1 A;  3G71 3;  3PS8 A;  3AMO A;  3EB8 A;  4EC6 A;  1W2B 2;  1YVB I;  1TUH A;  4MMY B;  1M9G A;  2YFL B;  2HMO B;  3FGY A;  1TU5 A;  1SIH A;  3DGO A;  4H3U A;  5ELJ A;  4HBR A;  3ER7 A;  1K41 A;  5DRE A;  4FCJ A;  3CCR 3;  2RFR A;  3SX1 A;  1IT7 A;  4STD A;  5AIF A;  2RCD A;  3K7C A;  3KSE D;  1OH0 A;  3DMC A;  3JUP A;  3S5C A;  4K1V A;  1VQP 3;  1VQ4 3;  2OOV A;  3CCM 3;  1T5Y A;  5BVB A;  3UJM A;  3MHE A;  3GZY B;  3LT8 A;  3U97 A;  4K1U A;  4I4K A;  3B4O A;  4R9K A;  4JRF A;  4HM3 B;  2GBW B;  2R4I A;  3NM2 A;  1JRQ A;  2LQV A;  3F7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...