2KCDA

Solution nmr structure of ssp0047 from staphylococcus saprophyticus. northeast structural genomics consortium target syr6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
120
structure length
120
Chain Sequence
MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAIGFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SSP0047
publication title Solution NMR structure of SSP0047 from Staphylococcus saprophyticus. Northeast Structural Genomics Consortium Target SyR6.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Structural genomics, unknown function
total genus 16
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2kcdA00
5AYRB 5AYSC 2KCDA 3WDGB
chains in the Genus database with same CATH superfamily
3KSPA 2AAEA 3F8XA 1KC84 1DMMA 3HZPA 3GZBA 2KCDA 3LT9A 1OH0A 1NJI4 1HKXA 2F99A 2H0HA 2XR8B 3GZRA 3X40A 5IG4A 1DMQA 1G0TA 2XH9A 3NV0B 1BSEA 5JPUA 1Z1SA 4R9KA 3NBJA 1SARA 3NM2A 1T2IA 3BNEA 3KZTA 1IDPA 5AIGA 3WHOA 4K1UA 4HZBB 5AEWB 1JBSA 4WYKA 4BU4A 4L8OA 4HM3B 5JPPA 1AR0A 1LVNA 3CNXA 2K54A 3NBBA 2GU1A 3WMDA 3LOYA 1MWRA 2R4IA 3A5EA 1ASKA 1FGQA 5IW9A 3MHEA 4CJNA 4BIRA 1JKGB 1X1UA 2E2TA 1FUWA 6GSPA 4EBGA 1GD3A 3DZLA 3J7Yd 2CFLA 5CF1A 1RTUA 1QALA 4ILFA 2OTJ3 2XGNA 4XBYA 4HM1B 3NHXA 1Q814 1N9EA 4GSPA 4J5GA 1PYLA 2OOVC 5AI1A 2Z7AA 3RNTA 3CCU3 5KP4A 1OGXA 3FF2A 3N54B 1UGHI 5LC7A 3UL6A 1TP6A 1BSAA 2STDA 4GL6A 2W2CA 5A0OB 2CH9A 2W0QA 1QVG2 1B3SA 1FW7A 4HM0B 1K734 1VQ53 1O7HB 1C54A 1BSBA 1EKMA 1B21A 3EJVA 2HOHA 3B8LA 4HM7B 2Z76A 1VQM3 3D79A 3ZFZA 1BANA 1SJWA 1SIIA 1RRLA 3RGAA 5STDA 3VSYA 1JB4A 3G0KA 2MC8A 1EA2A 3I0YA 4Q53A 1TJDA 1GSPA 2MF7A 1IVWA 1X1XA 2KRTA 2C4BA 2W9PA 1BVIA 2ZL8A 3LXUX 5CXOA 3B7CA 4N3VA 1LRAA 3DGMA 5IERA 1JBTA 2CWVA 4K1VA 2P0XA 1BAOA 3CCL3 1OF5A 2F56A 4HVNA 1IQYA 1GMPA 3CME3 3V99A 2HMNB 3OXAA 1YGEA 1UI7A 4AKZA 4WFOA 4AKYA 1VQ93 4GB5A 4BTWA 1QAFA 2GU3A 1FUTA 4KZ1A 2E2VA 3CCS3 1Q40B 3JUOA 1RLSA 1RDSA 5EEOA 1M1K4 2P0MA 1CQSA 3DUKA 3Q2PA 2I9WA 3H51A 3I553 4O2HA 2B24B 1NO3A 5LC6A 1IVXA 2C11A 1NB3I 2O9UX 3K0ZA 1JV2B 2YFIB 2INXA 3LMLA 4HJLB 4LZIA 1IYYA 2GSPA 3JVCA 5D81A 1W01A 3JUQA 1UUWB 3SOYA 1UCIA 1BRGA 3URPA 1AV4A 1R4YA 3EN8A 2W56A 3BNBA 3F7SA 4WP5A 1YNVX 3CPOA 1W2B2 1BU4A 3MYTA 3PCSA 2P09A 3X3XA 2Z6BA 2YFJB 3LZAA 5DREA 5M18A 1W7CA 3GAXA 3KE7A 2LYXA 3FG3A 4XM4A 1UUVB 3F14A 2F5WA 2QEX3 1DMNA 1LOYA 1QJGA 2IYJA 3A76A 1U8CB 1N8R4 4NHFA 1UW1A 1YI23 1LNHA 4RNYA 1IQ8A 1CYVA 4HBRA 3FLJA 4R4KA 1VQ43 5AIFA 4BTYA 2CX0A 1BRHA 1I3FA 4H3UA 2CG1A 2BIRA 2CFDA 4K90B 4HM5B 3K9MC 1FGRA 1UCKA 3JUPA 5IEOA 2RGQA 1JKGA 2XFSA 1JN5A 2R41A 3EBTA 2AADA 1VQO3 1AY7A 3V98A 1BNRA 4N6MA 4IPBA 1FGTA 4OK0A 1RGAA 2KXGA 3IJEB 5D82A 2ZDJA 5AYRB 4MMZB 1VQ63 2D42A 1D6ZA 4TX4A 2H0GA 1VQN3 1O7GB 3BU4A 1KD14 3FG4A 1V57A 1RHLA 3QK9A 3U97A 1A67A 4XB5A 3CCQ3 2IMJA 1MWTA 5CK6A 3FH1A 3H3HA 4FCJA 1GOVA 1IV9A 1KSIA 1IU7A 1OHOA 1JZOA 2BMRB 3OWYA 4N6UA 3UNLA 5G2GA 1UGIA 3UJMA 1RCKA 5KP1A 3EHCA 2BU4A 1NDOB 3DGNA 1I0VA 3KKGA 1B2ZA 2ML6A 2RNTA 2RFRA 3OV4A 3SYUA 1ZX2A 4R1KA 3O8YA 2Y73A 3CCJ3 5FW5A 3S28A 2XSHB 1WMNA 3FSDA 3FCSB 1MNLA 3I563 1ZO2A 1EG9B 1I70A 2CKFB 2SARA 3EC9A 4EYCA 1EEJA 3BLZA 3MG3A 3FKAA 5ELUA 3SLUA 3RGRA 1OGZA 2BMOB 3NXJA 2K0MA 1K41A 9RNTA 1CYUA 3KCHA 2KF6A 3PYJA 4NREA 1I2EA 1TRPA 3OWSA 4XBTA 1CH0A 1RNBA 3MSOA 1WNHA 2JQ5A 1W6CA 2BHMA 2LQVA 4BL3A 3AMOA 3G8ZA 1VQL3 4EW5A 2KF4A 3AHWA 3TDGA 3WDGB 1X1YA 1BNIA 2OQEA 5IG3A 1STFI 3AGOA 2PZVA 1VQ83 3EQQB 5M19A 3CCR3 1ISKA 1B2UA 2KF3A 2CX1A 5EQLA 4J8TA 3LH4A 4OVMA 1O7MB 1LOXA 1E97A 2JDIH 2HMJB 4EC6A 3FZWA 5TGNA 3ZG5A 1KWIA 1RGCA 4I4KA 1FGMA 1W5ZA 1AVLA 1O7PB 2O3OA 1N9JA 2GXFA 3K63A 5CF2A 1N8QA 3DY5A 2HMKB 8CHOA 1M904 2FGTA 4HZ9B 4G1MB 3V92A 1E3VA 3OX9A 1YJW3 1BUJA 4WWUC 3T8UA 5HGRA 1RN7A 1GD4A 3G16A 3JUNA 3LTCA 3PZWA 5M1AA 1DETA 3F8HA 3GZXB 2UUGC 3VF1A 3BNDA 5ELJA 1YJ93 4N6OB 1FUSA 2CFKA 4RNZA 1T5YA 1RGFA 1JRQA 1HYFA 3CC43 4JRFA 1BOXA 3SEDA 1A2KA 1JBRA 1RNTA 1OACA 3HIGA 3HK4A 5IG5A 3NM7A 2XSOB 4GHOA 1QAKA 1M1XB 2IUJA 1LOWA 1HZ1A 4HM6B 5DRVA 3LT8A 1I2GA 2F4YA 2OTL3 3RDEA 1OUNA 3EX9A 1SPUA 5AEUB 3PXMA 4N6TA 3U1WA 4O8SA 2PNCA 1ULJB 1UCJA 4FCZA 1NWWA 1R4CA 1UI8A 3DGLA 3SOAA 3WA2X 1VQP3 2ZA4A 1DVDA 2P38A 5BVBA 1RKYA 1UDII 1GY5A 3FF0A 3FG1A 3NV0A 2WGQA 4HAAA 1TU5A 1JJ22 3DM8A 2W04A 2WOHA 4MMXB 3CCE3 1F8NA 2CG0A 4X2OA 1DVCA 3NX0A 1Q9EA 2CWUA 1IV7A 3T0UA 1W2ZA 3KFQC 1TFKA 1WTHA 3KSED 1D6YA 3DXOA 3ZG0A 1J2BA 4WHAA 4EXRA 2OQEC 1SIHA 2ML5A 3GSPA 3MG1A 3CCV3 3SX1A 2XF3A 2RCDA 1RGGA 3D9RA 1BRJA 2XGLA 3NBRA 1B2SA 4QWTA 3PGBA 1NNVA 2B1XB 4HM8B 3BIRA 3CXC2 1E3RA 1I2FA 4R9LA 1ROAA 4U13A 1Y4KA 3EF8A 4FMCA 4N6NB 1NU3A 1UCLA 2QIYA 3WOEB 2M7OA 3Q1CA 1BNSA 1JB5A 1RGEA 3IMAB 3DMCA 5GSPA 3PCRA 4R80A 2GBWB 1MGWA 3K7CA 4EV2A 2V1LA 1RGLA 4LSOA 1AQZA 5G1LA 1IT7A 4CDLA 2XFTA 1IT8A 1M9GA 1ULIB 2IA7A 4FCMA 4RNTA 5IG0A 5BU4A 3CC73 3CD63 4DKIA 1U5OA 1VZZA 2W03A 3F40A 3UB1A 1YIJ3 1JNQA 3HOHA 1YVBI 4MMYB 1OHSA 2RSXA 2CW9A 6STDA 3HI7A 3NQZA 3CPW2 2OCTA 5G1KA 1GMRA 3BNCA 2RBIA 4K61A 2SBLA 1BNGA 2HMOB 3Q90A 1A90A 1O7NB 3GZYB 1GOYA 1IK3A 2OWPA 2GEYA 5IEPA 4RZMA 4XBXA 1BNJA 2YFLB 4NPBA 3WODG 5I97A 3GRDA 2L4VA 1N5PA 2CIUA 1A2PA 1W00A 4N6V0 5AIHA 1ZS7A 2BO9B 3F7XA 1WMPA 1PU4A 5CLKA 2CFGA 3S67A 1GYBA 4JF8A 2QA43 3D5IA 3UL5A 1KQS2 1DE3A 3LYGA 1GMQA 1BRKA 2Y74A 2W56B 1W4NA 2Z77A 1Q7Y4 1FA3A 2FNQA 3KN4A 2IUKA 1VQK3 6RNTA 2W9QA 3X42A 1LQGC 1G96A 3D3LA 1WMOA 3OWUA 1V58A 3FGYA 3S29A 1I3IA 1WQLB 4HKVB 4KFEA 1MGRA 3G713 4LEHA 3CNMA 1GY6A 4FMBA 4XDWA 1QVF2 3Q3FA 4STDA 1QMAA 1BUQA 1Q40A 1TRQA 2KAAA 4I5QA 5BIRA 2C10A 1MWSA 1IQXA 1YVSA 1BNEA 2XEPA 3OW22 1IVUA 1TTOA 2IY2A 1X1WA 4OUQA 4CCVA 2CK3H 1AVKA 1EUIC 5FGOA 2BMQB 2D1WA 4LYLB 2BNGA 3WR2A 1T3BA 3CU3A 3MG2A 4HM4B 1K8A4 1YIT3 1YJN3 3LTDA 2WGOA 1JN5B 1W6GA 2K3DA 1MOLA 3MPHA 2FXTA 3HIIA 1JB2A 3WOFB 1A2VA 3IPTA 1CEWI 1T2HA 2Q07A 3MWZA 1SQWA 2GEXA 3SVAA 1S723 7RNTA 1BSDA 1RCLA 2HMMB 4HOHA 4XDVA 3KIIA 5AYSC 3HX8A 4IT7A 5KP3A 3S5CA 3G6E3 1Q864 1TIJA 1YGWA 1Q42A 1OCVA 1TFOA 3ECFA 4HM2B 5IENA 1RGKA 1PFPA 1RMSA 2UX0A 4IIAA 4H61A 1I0XA 3B4OA 1LNIA 1UUGB 3M8CA 2F98A 3N8BA 4J9AA 1US1A 1OPYA 1VQ73 4J5KA 4ZM8A 4FMAA 1BNFA 1YHQ3 3AHSA 3D4AA 4WYKB 1RN1A 4X2HA 2YX9A 4MEIA 5BXQA 3EE1A 4KFFA 3T8NA 2ZHXB 3VGNA 3LTBA 2BT3A 3PS8A 3ROBA 3STDA 1B27A 3K5TA 3S27A 2W6JH 4L8PA 7STDA 4KFDA 1STDA 2XRXB 4KT3B 1LQMB 4LGQA 4O02B 1BIRA 2F86B 7GSPA 4N6LA 3AGNA 3X3YA 3AMOB 1O7WB 4L7KA 3CMA3 1BGSA 4O3VA 3LTAA 1GS3A 5HOHA 2E2UA 4KVHA 1RSNA 1DYUA 2A15A 3X3ZA 1RRHA 2CHCA 3L0RA 4EV5A 1BRNL 1GY7A 1VQQA 1FZUA 3EBYA 1OHPA 3CC23 1RJOA 1BRSA 1W6YA 3DGYA 1LXEA 1RGHA 1B2MA 1Q824 1K28A 1MWUA 3B4PA 1Q7HA 4CPKA 8RNTA 2WO0A 1LOVA 3G4S3 2KF5A 4HYZA 1FYSA 1I8VA 2UGIA 3F9SA 1BSCA 1L5GB 4PEJA 1ZGXA 3ALAA 1C7HA 4ORLA 2OOVA 1ROVA 3N9HA 1B2XA 3D5GA 2CWTA 3ER7A 3MKIA 4MJDA 1K9M4 3QRDA 1D6UA 5JBSA 5AIIA 2WOFA 5IF6A 3NQYA 3GWRA 1EQKA 1BRIA 3DGOA 3DH2A 3EN1B 2HMLB 3EB8A 1OF5B 4RBNA 2GBXB 1GOUA 5D83A 3CCM3 1NB5I 2L1SA 1RN4A 4LMIA 4BTXA 2QGUA 4FR9A 1W02A 1JZDA 3X41A 3SXXA 4BL2A 1FGOA 1V74A 3E99A 2J8XB 2H0IA 1G02A 3BB9A 1TUHA 3JUMA 4AEQA 2CFWA 2P05A 1S5AA 2CC3A 1IVVA 1HU9A 1N5HA 1PY3A 1B20A 5EVHA 3NUVA 5RNTA 3WA3A 4FMDA 2F5MA
chains in the Genus database with same CATH topology
3KSPA 3F8XA 1KC84 1DMMA 3HZPA 3GZBA 2KCDA 3LT9A 1OH0A 1NJI4 1HKXA 2F99A 3GZRA 2XR8B 5IG4A 3X40A 1DMQA 2XH9A 3NV0B 5JPUA 1Z1SA 4R9KA 3NBJA 3NM2A 3BNEA 3KZTA 1IDPA 5AIGA 4K1UA 4HZBB 5AEWB 4WYKA 4L8OA 4HM3B 5JPPA 1AR0A 1LVNA 3CNXA 2K54A 3NBBA 2GU1A 3WMDA 3LOYA 2R4IA 1ASKA 1FGQA 5IW9A 3MHEA 1JKGB 2E2TA 1FUWA 4EBGA 1GD3A 3DZLA 3J7Yd 2CFLA 5CF1A 1QALA 2OTJ3 2XGNA 4XBYA 4HM1B 3NHXA 1Q814 1N9EA 2OOVC 5AI1A 2Z7AA 3CCU3 5KP4A 1OGXA 3FF2A 3N54B 5LC7A 3UL6A 1TP6A 2STDA 4GL6A 1QVG2 2W2CA 5A0OB 2CH9A 2W0QA 1J2BA 4HM0B 1K734 1VQ53 1O7HB 1EKMA 3EJVA 4HM7B 3B8LA 2Z76A 1VQM3 1SJWA 1SIIA 1RRLA 3RGAA 5STDA 3VSYA 1JB4A 3G0KA 2MC8A 1EA2A 3I0YA 4Q53A 2MF7A 1IVWA 2KRTA 2W9PA 2ZL8A 3LXUX 5CXOA 3B7CA 4N3VA 3DGMA 5IERA 2CWVA 4K1VA 2P0XA 3CCL3 1OF5A 4HVNA 1IQYA 3CME3 3V99A 2HMNB 3OXAA 1YGEA 1UI7A 4AKZA 4WFOA 4AKYA 1VQ93 4GB5A 4BTWA 1QAFA 2GU3A 4KZ1A 2E2VA 3CCS3 1Q40B 3JUOA 1M1K4 5EEOA 2P0MA 1CQSA 3DUKA 3Q2PA 2I9WA 3H51A 3I553 4O2HA 2B24B 1NO3A 5LC6A 1IVXA 2C11A 1NB3I 2O9UX 3K0ZA 1JV2B 2YFIB 2INXA 3LMLA 4HJLB 4LZIA 5D81A 1W01A 3JUQA 1UUWB 3SOYA 1AV4A 3EN8A 2W56A 3BNBA 3F7SA 4WP5A 3CPOA 1W2B2 1YHQ3 3MYTA 3PCSA 2P09A 3X3XA 2Z6BA 2YFJB 3LZAA 5DREA 1W7CA 3GAXA 3KE7A 2LYXA 3FG3A 4XM4A 1UUVB 3F14A 2QEX3 1DMNA 1QJGA 3A76A 1U8CB 1N8R4 4NHFA 1UW1A 1YI23 1LNHA 4RNYA 1IQ8A 1CYVA 4HBRA 3FLJA 4R4KA 1VQ43 5AIFA 4BTYA 4H3UA 2CG1A 2CFDA 4K90B 4HM5B 3K9MC 1FGRA 3JUPA 5IEOA 2RGQA 1JKGA 2XFSA 1JN5A 3EBTA 1VQO3 3V98A 4N6MA 4IPBA 1FGTA 4OK0A 2KXGA 3IJEB 5D82A 2ZDJA 5AYRB 4MMZB 1VQ63 2D42A 1D6ZA 4TX4A 1VQN3 1O7GB 1KD14 3FG4A 3QK9A 3U97A 1A67A 4XB5A 3CCQ3 2IMJA 5CK6A 3FH1A 3H3HA 4FCJA 1KSIA 1IV9A 1OHOA 1IU7A 3OWYA 4N6UA 2BMRB 3UNLA 5G2GA 3UJMA 5KP1A 3EHCA 1NDOB 3DGNA 3KKGA 2ML6A 2RFRA 3OV4A 1ZX2A 4R1KA 3O8YA 2Y73A 3CCJ3 5FW5A 3S28A 2XSHB 1WMNA 3FSDA 3FCSB 1MNLA 3I563 1ZO2A 1EG9B 2CKFB 3EC9A 4EYCA 3BLZA 3MG3A 3FKAA 5ELUA 3SLUA 3RGRA 1OGZA 2BMOB 3NXJA 2K0MA 1K41A 1CYUA 4NREA 3PYJA 4XBTA 3OWSA 3MSOA 1WNHA 2JQ5A 1W6CA 2BHMA 2LQVA 3AMOA 3G8ZA 1VQL3 3TDGA 3WDGB 2OQEA 5IG3A 1STFI 2PZVA 1VQ83 3EQQB 3CCR3 1ISKA 5EQLA 4J8TA 3LH4A 4OVMA 1O7MB 1LOXA 1E97A 2JDIH 2HMJB 4EC6A 3FZWA 5TGNA 1KWIA 4I4KA 1FGMA 1W5ZA 1AVLA 1O7PB 2O3OA 1N9JA 2GXFA 3K63A 5CF2A 1N8QA 3DY5A 2HMKB 8CHOA 1M904 2FGTA 4HZ9B 4G1MB 3V92A 1E3VA 3OX9A 1YJW3 4WWUC 3T8UA 5HGRA 1RN7A 1GD4A 3G16A 3JUNA 3LTCA 3PZWA 3F8HA 3GZXB 3VF1A 3BNDA 5ELJA 1YJ93 4N6OB 2CFKA 4RNZA 1T5YA 1JRQA 3CC43 4JRFA 3SEDA 1A2KA 1OACA 3HIGA 3HK4A 5IG5A 3NM7A 2XSOB 1QAKA 1M1XB 2IUJA 5DRVA 4HM6B 3LT8A 2OTL3 3RDEA 1OUNA 3EX9A 1SPUA 5AEUB 3PXMA 4N6TA 3U1WA 4O8SA 2PNCA 1ULJB 4FCZA 1NWWA 1R4CA 1UI8A 3DGLA 3SOAA 3WA2X 1VQP3 1DVDA 2P38A 5BVBA 1RKYA 1GY5A 3FF0A 3FG1A 3NV0A 2WGQA 1TU5A 1JJ22 3DM8A 2W04A 2WOHA 4MMXB 3CCE3 1F8NA 2CG0A 4X2OA 1DVCA 3NX0A 3T0UA 2CWUA 1IV7A 1W2ZA 3KFQC 1TFKA 1WTHA 3KSED 1D6YA 3DXOA 4WHAA 4EXRA 2OQEC 1SIHA 2ML5A 3MG1A 3CCV3 3SX1A 2XF3A 2RCDA 3D9RA 2XGLA 3NBRA 4QWTA 3PGBA 2B1XB 4HM8B 3CXC2 1E3RA 4R9LA 1ROAA 4U13A 1Y4KA 3EF8A 4FMCA 4N6NB 1NU3A 2QIYA 3WOEB 2M7OA 3Q1CA 1JB5A 3IMAB 3DMCA 3PCRA 4R80A 2GBWB 3K7CA 4EV2A 2V1LA 4LSOA 1IT7A 4CDLA 2XFTA 1IT8A 1M9GA 1ULIB 2IA7A 4FCMA 3CD63 5IG0A 3CC73 1U5OA 1VZZA 2W03A 3F40A 3UB1A 1YIJ3 1JNQA 1YVBI 4MMYB 1OHSA 2RSXA 2CW9A 6STDA 3HI7A 3NQZA 3CPW2 2OCTA 4K61A 3BNCA 2SBLA 2HMOB 3Q90A 1A90A 1O7NB 3GZYB 1IK3A 2OWPA 2GEYA 5IEPA 4RZMA 4XBXA 2YFLB 3WODG 5I97A 3GRDA 2L4VA 1N5PA 2CIUA 4N6V0 1W00A 5AIHA 2BO9B 3F7XA 1WMPA 1PU4A 5CLKA 2CFGA 3S67A 1GYBA 4JF8A 2QA43 3UL5A 1KQS2 3LYGA 2Y74A 2W56B 1W4NA 2Z77A 1Q7Y4 1FA3A 2FNQA 3KN4A 2IUKA 1VQK3 2W9QA 3X42A 3D3LA 1G96A 3OWUA 1WMOA 3FGYA 3S29A 4HKVB 1WQLB 4KFEA 3G713 1K9M4 4LEHA 3CNMA 1GY6A 4FMBA 4XDWA 1QVF2 4STDA 1QMAA 1BUQA 1Q40A 2C10A 1IQXA 2XEPA 3OW22 1IVUA 4OUQA 4CCVA 2CK3H 1AVKA 5FGOA 2BMQB 2D1WA 2BNGA 3CU3A 3MG2A 4HM4B 1K8A4 1YIT3 1YJN3 3LTDA 2WGOA 1JN5B 1W6GA 3MPHA 1MOLA 2FXTA 3HIIA 1JB2A 3WOFB 1A2VA 3IPTA 1CEWI 2Q07A 3MWZA 1SQWA 2GEXA 3SVAA 1S723 4XDVA 2HMMB 3KIIA 5AYSC 3HX8A 4IT7A 5KP3A 3S5CA 3G6E3 1Q864 1TIJA 1Q42A 1OCVA 1TFOA 3ECFA 4HM2B 5IENA 1PFPA 2UX0A 4IIAA 4H61A 3B4OA 3M8CA 3N8BA 4J9AA 2F98A 1OPYA 1US1A 1VQ73 4ZM8A 4FMAA 4WYKB 4X2HA 2YX9A 4MEIA 5BXQA 3EE1A 4KFFA 3T8NA 3VGNA 3LTBA 2BT3A 3PS8A 3ROBA 3STDA 3K5TA 3S27A 2W6JH 4L8PA 7STDA 4KFDA 1STDA 2XRXB 4O02B 4LGQA 2F86B 4N6LA 3X3YA 3AMOB 1O7WB 4L7KA 3CMA3 4O3VA 3LTAA 1GS3A 2E2UA 4KVHA 1DYUA 2A15A 3X3ZA 1RRHA 2CHCA 3L0RA 4EV5A 1GY7A 3EBYA 1OHPA 3CC23 1RJOA 1W6YA 1LXEA 1Q824 1K28A 3B4PA 2WO0A 3G4S3 4HYZA 3F9SA 1L5GB 4PEJA 3ALAA 1C7HA 4ORLA 2OOVA 1ROVA 3N9HA 4MJDA 2CWTA 3ER7A 3MKIA 3QRDA 1D6UA 5JBSA 5AIIA 2WOFA 5IF6A 3NQYA 3GWRA 1EQKA 3DGOA 3EN1B 2HMLB 3EB8A 1OF5B 4RBNA 2GBXB 3CCM3 5D83A 1NB5I 4LMIA 4BTXA 2QGUA 4FR9A 1W02A 3X41A 3SXXA 1FGOA 1V74A 3E99A 3BB9A 1TUHA 3JUMA 4AEQA 2CFWA 2P05A 1S5AA 2CC3A 1IVVA 1HU9A 1N5HA 5EVHA 3NUVA 3WA3A 4FMDA 3JVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYR B;  5AYS C;  2KCD A;  3WDG B; 
#chains in the Genus database with same CATH topology
 3KSP A;  2AAE A;  3F8X A;  1KC8 4;  1DMM A;  3HZP A;  3GZB A;  2KCD A;  3LT9 A;  1OH0 A;  1NJI 4;  1HKX A;  2F99 A;  2H0H A;  2XR8 B;  3GZR A;  3X40 A;  5IG4 A;  1DMQ A;  1G0T A;  2XH9 A;  3NV0 B;  1BSE A;  5JPU A;  1Z1S A;  4R9K A;  3NBJ A;  1SAR A;  3NM2 A;  1T2I A;  3BNE A;  3KZT A;  1IDP A;  5AIG A;  3WHO A;  4K1U A;  4HZB B;  5AEW B;  1JBS A;  4WYK A;  4BU4 A;  4L8O A;  4HM3 B;  5JPP A;  1AR0 A;  1LVN A;  3CNX A;  2K54 A;  3NBB A;  2GU1 A;  3WMD A;  3LOY A;  1MWR A;  2R4I A;  3A5E A;  1ASK A;  1FGQ A;  5IW9 A;  3MHE A;  4CJN A;  4BIR A;  1JKG B;  1X1U A;  2E2T A;  1FUW A;  6GSP A;  4EBG A;  1GD3 A;  3DZL A;  3J7Y d;  2CFL A;  5CF1 A;  1RTU A;  1QAL A;  4ILF A;  2OTJ 3;  2XGN A;  4XBY A;  4HM1 B;  3NHX A;  1Q81 4;  1N9E A;  4GSP A;  4J5G A;  1PYL A;  2OOV C;  5AI1 A;  2Z7A A;  3RNT A;  3CCU 3;  5KP4 A;  1OGX A;  3FF2 A;  3N54 B;  1UGH I;  5LC7 A;  3UL6 A;  1TP6 A;  1BSA A;  2STD A;  4GL6 A;  2W2C A;  5A0O B;  2CH9 A;  2W0Q A;  1QVG 2;  1B3S A;  1FW7 A;  4HM0 B;  1K73 4;  1VQ5 3;  1O7H B;  1C54 A;  1BSB A;  1EKM A;  1B21 A;  3EJV A;  2HOH A;  3B8L A;  4HM7 B;  2Z76 A;  1VQM 3;  3D79 A;  3ZFZ A;  1BAN A;  1SJW A;  1SII A;  1RRL A;  3RGA A;  5STD A;  3VSY A;  1JB4 A;  3G0K A;  2MC8 A;  1EA2 A;  3I0Y A;  4Q53 A;  1TJD A;  1GSP A;  2MF7 A;  1IVW A;  1X1X A;  2KRT A;  2C4B A;  2W9P A;  1BVI A;  2ZL8 A;  3LXU X;  5CXO A;  3B7C A;  4N3V A;  1LRA A;  3DGM A;  5IER A;  1JBT A;  2CWV A;  4K1V A;  2P0X A;  1BAO A;  3CCL 3;  1OF5 A;  2F56 A;  4HVN A;  1IQY A;  1GMP A;  3CME 3;  3V99 A;  2HMN B;  3OXA A;  1YGE A;  1UI7 A;  4AKZ A;  4WFO A;  4AKY A;  1VQ9 3;  4GB5 A;  4BTW A;  1QAF A;  2GU3 A;  1FUT A;  4KZ1 A;  2E2V A;  3CCS 3;  1Q40 B;  3JUO A;  1RLS A;  1RDS A;  5EEO A;  1M1K 4;  2P0M A;  1CQS A;  3DUK A;  3Q2P A;  2I9W A;  3H51 A;  3I55 3;  4O2H A;  2B24 B;  1NO3 A;  5LC6 A;  1IVX A;  2C11 A;  1NB3 I;  2O9U X;  3K0Z A;  1JV2 B;  2YFI B;  2INX A;  3LML A;  4HJL B;  4LZI A;  1IYY A;  2GSP A;  3JVC A;  5D81 A;  1W01 A;  3JUQ A;  1UUW B;  3SOY A;  1UCI A;  1BRG A;  3URP A;  1AV4 A;  1R4Y A;  3EN8 A;  2W56 A;  3BNB A;  3F7S A;  4WP5 A;  1YNV X;  3CPO A;  1W2B 2;  1BU4 A;  3MYT A;  3PCS A;  2P09 A;  3X3X A;  2Z6B A;  2YFJ B;  3LZA A;  5DRE A;  5M18 A;  1W7C A;  3GAX A;  3KE7 A;  2LYX A;  3FG3 A;  4XM4 A;  1UUV B;  3F14 A;  2F5W A;  2QEX 3;  1DMN A;  1LOY A;  1QJG A;  2IYJ A;  3A76 A;  1U8C B;  1N8R 4;  4NHF A;  1UW1 A;  1YI2 3;  1LNH A;  4RNY A;  1IQ8 A;  1CYV A;  4HBR A;  3FLJ A;  4R4K A;  1VQ4 3;  5AIF A;  4BTY A;  2CX0 A;  1BRH A;  1I3F A;  4H3U A;  2CG1 A;  2BIR A;  2CFD A;  4K90 B;  4HM5 B;  3K9M C;  1FGR A;  1UCK A;  3JUP A;  5IEO A;  2RGQ A;  1JKG A;  2XFS A;  1JN5 A;  2R41 A;  3EBT A;  2AAD A;  1VQO 3;  1AY7 A;  3V98 A;  1BNR A;  4N6M A;  4IPB A;  1FGT A;  4OK0 A;  1RGA A;  2KXG A;  3IJE B;  5D82 A;  2ZDJ A;  5AYR B;  4MMZ B;  1VQ6 3;  2D42 A;  1D6Z A;  4TX4 A;  2H0G A;  1VQN 3;  1O7G B;  3BU4 A;  1KD1 4;  3FG4 A;  1V57 A;  1RHL A;  3QK9 A;  3U97 A;  1A67 A;  4XB5 A;  3CCQ 3;  2IMJ A;  1MWT A;  5CK6 A;  3FH1 A;  3H3H A;  4FCJ A;  1GOV A;  1IV9 A;  1KSI A;  1IU7 A;  1OHO A;  1JZO A;  2BMR B;  3OWY A;  4N6U A;  3UNL A;  5G2G A;  1UGI A;  3UJM A;  1RCK A;  5KP1 A;  3EHC A;  2BU4 A;  1NDO B;  3DGN A;  1I0V A;  3KKG A;  1B2Z A;  2ML6 A;  2RNT A;  2RFR A;  3OV4 A;  3SYU A;  1ZX2 A;  4R1K A;  3O8Y A;  2Y73 A;  3CCJ 3;  5FW5 A;  3S28 A;  2XSH B;  1WMN A;  3FSD A;  3FCS B;  1MNL A;  3I56 3;  1ZO2 A;  1EG9 B;  1I70 A;  2CKF B;  2SAR A;  3EC9 A;  4EYC A;  1EEJ A;  3BLZ A;  3MG3 A;  3FKA A;  5ELU A;  3SLU A;  3RGR A;  1OGZ A;  2BMO B;  3NXJ A;  2K0M A;  1K41 A;  9RNT A;  1CYU A;  3KCH A;  2KF6 A;  3PYJ A;  4NRE A;  1I2E A;  1TRP A;  3OWS A;  4XBT A;  1CH0 A;  1RNB A;  3MSO A;  1WNH A;  2JQ5 A;  1W6C A;  2BHM A;  2LQV A;  4BL3 A;  3AMO A;  3G8Z A;  1VQL 3;  4EW5 A;  2KF4 A;  3AHW A;  3TDG A;  3WDG B;  1X1Y A;  1BNI A;  2OQE A;  5IG3 A;  1STF I;  3AGO A;  2PZV A;  1VQ8 3;  3EQQ B;  5M19 A;  3CCR 3;  1ISK A;  1B2U A;  2KF3 A;  2CX1 A;  5EQL A;  4J8T A;  3LH4 A;  4OVM A;  1O7M B;  1LOX A;  1E97 A;  2JDI H;  2HMJ B;  4EC6 A;  3FZW A;  5TGN A;  3ZG5 A;  1KWI A;  1RGC A;  4I4K A;  1FGM A;  1W5Z A;  1AVL A;  1O7P B;  2O3O A;  1N9J A;  2GXF A;  3K63 A;  5CF2 A;  1N8Q A;  3DY5 A;  2HMK B;  8CHO A;  1M90 4;  2FGT A;  4HZ9 B;  4G1M B;  3V92 A;  1E3V A;  3OX9 A;  1YJW 3;  1BUJ A;  4WWU C;  3T8U A;  5HGR A;  1RN7 A;  1GD4 A;  3G16 A;  3JUN A;  3LTC A;  3PZW A;  5M1A A;  1DET A;  3F8H A;  3GZX B;  2UUG C;  3VF1 A;  3BND A;  5ELJ A;  1YJ9 3;  4N6O B;  1FUS A;  2CFK A;  4RNZ A;  1T5Y A;  1RGF A;  1JRQ A;  1HYF A;  3CC4 3;  4JRF A;  1BOX A;  3SED A;  1A2K A;  1JBR A;  1RNT A;  1OAC A;  3HIG A;  3HK4 A;  5IG5 A;  3NM7 A;  2XSO B;  4GHO A;  1QAK A;  1M1X B;  2IUJ A;  1LOW A;  1HZ1 A;  4HM6 B;  5DRV A;  3LT8 A;  1I2G A;  2F4Y A;  2OTL 3;  3RDE A;  1OUN A;  3EX9 A;  1SPU A;  5AEU B;  3PXM A;  4N6T A;  3U1W A;  4O8S A;  2PNC A;  1ULJ B;  1UCJ A;  4FCZ A;  1NWW A;  1R4C A;  1UI8 A;  3DGL A;  3SOA A;  3WA2 X;  1VQP 3;  2ZA4 A;  1DVD A;  2P38 A;  5BVB A;  1RKY A;  1UDI I;  1GY5 A;  3FF0 A;  3FG1 A;  3NV0 A;  2WGQ A;  4HAA A;  1TU5 A;  1JJ2 2;  3DM8 A;  2W04 A;  2WOH A;  4MMX B;  3CCE 3;  1F8N A;  2CG0 A;  4X2O A;  1DVC A;  3NX0 A;  1Q9E A;  2CWU A;  1IV7 A;  3T0U A;  1W2Z A;  3KFQ C;  1TFK A;  1WTH A;  3KSE D;  1D6Y A;  3DXO A;  3ZG0 A;  1J2B A;  4WHA A;  4EXR A;  2OQE C;  1SIH A;  2ML5 A;  3GSP A;  3MG1 A;  3CCV 3;  3SX1 A;  2XF3 A;  2RCD A;  1RGG A;  3D9R A;  1BRJ A;  2XGL A;  3NBR A;  1B2S A;  4QWT A;  3PGB A;  1NNV A;  2B1X B;  4HM8 B;  3BIR A;  3CXC 2;  1E3R A;  1I2F A;  4R9L A;  1ROA A;  4U13 A;  1Y4K A;  3EF8 A;  4FMC A;  4N6N B;  1NU3 A;  1UCL A;  2QIY A;  3WOE B;  2M7O A;  3Q1C A;  1BNS A;  1JB5 A;  1RGE A;  3IMA B;  3DMC A;  5GSP A;  3PCR A;  4R80 A;  2GBW B;  1MGW A;  3K7C A;  4EV2 A;  2V1L A;  1RGL A;  4LSO A;  1AQZ A;  5G1L A;  1IT7 A;  4CDL A;  2XFT A;  1IT8 A;  1M9G A;  1ULI B;  2IA7 A;  4FCM A;  4RNT A;  5IG0 A;  5BU4 A;  3CC7 3;  3CD6 3;  4DKI A;  1U5O A;  1VZZ A;  2W03 A;  3F40 A;  3UB1 A;  1YIJ 3;  1JNQ A;  3HOH A;  1YVB I;  4MMY B;  1OHS A;  2RSX A;  2CW9 A;  6STD A;  3HI7 A;  3NQZ A;  3CPW 2;  2OCT A;  5G1K A;  1GMR A;  3BNC A;  2RBI A;  4K61 A;  2SBL A;  1BNG A;  2HMO B;  3Q90 A;  1A90 A;  1O7N B;  3GZY B;  1GOY A;  1IK3 A;  2OWP A;  2GEY A;  5IEP A;  4RZM A;  4XBX A;  1BNJ A;  2YFL B;  4NPB A;  3WOD G;  5I97 A;  3GRD A;  2L4V A;  1N5P A;  2CIU A;  1A2P A;  1W00 A;  4N6V 0;  5AIH A;  1ZS7 A;  2BO9 B;  3F7X A;  1WMP A;  1PU4 A;  5CLK A;  2CFG A;  3S67 A;  1GYB A;  4JF8 A;  2QA4 3;  3D5I A;  3UL5 A;  1KQS 2;  1DE3 A;  3LYG A;  1GMQ A;  1BRK A;  2Y74 A;  2W56 B;  1W4N A;  2Z77 A;  1Q7Y 4;  1FA3 A;  2FNQ A;  3KN4 A;  2IUK A;  1VQK 3;  6RNT A;  2W9Q A;  3X42 A;  1LQG C;  1G96 A;  3D3L A;  1WMO A;  3OWU A;  1V58 A;  3FGY A;  3S29 A;  1I3I A;  1WQL B;  4HKV B;  4KFE A;  1MGR A;  3G71 3;  4LEH A;  3CNM A;  1GY6 A;  4FMB A;  4XDW A;  1QVF 2;  3Q3F A;  4STD A;  1QMA A;  1BUQ A;  1Q40 A;  1TRQ A;  2KAA A;  4I5Q A;  5BIR A;  2C10 A;  1MWS A;  1IQX A;  1YVS A;  1BNE A;  2XEP A;  3OW2 2;  1IVU A;  1TTO A;  2IY2 A;  1X1W A;  4OUQ A;  4CCV A;  2CK3 H;  1AVK A;  1EUI C;  5FGO A;  2BMQ B;  2D1W A;  4LYL B;  2BNG A;  3WR2 A;  1T3B A;  3CU3 A;  3MG2 A;  4HM4 B;  1K8A 4;  1YIT 3;  1YJN 3;  3LTD A;  2WGO A;  1JN5 B;  1W6G A;  2K3D A;  1MOL A;  3MPH A;  2FXT A;  3HII A;  1JB2 A;  3WOF B;  1A2V A;  3IPT A;  1CEW I;  1T2H A;  2Q07 A;  3MWZ A;  1SQW A;  2GEX A;  3SVA A;  1S72 3;  7RNT A;  1BSD A;  1RCL A;  2HMM B;  4HOH A;  4XDV A;  3KII A;  5AYS C;  3HX8 A;  4IT7 A;  5KP3 A;  3S5C A;  3G6E 3;  1Q86 4;  1TIJ A;  1YGW A;  1Q42 A;  1OCV A;  1TFO A;  3ECF A;  4HM2 B;  5IEN A;  1RGK A;  1PFP A;  1RMS A;  2UX0 A;  4IIA A;  4H61 A;  1I0X A;  3B4O A;  1LNI A;  1UUG B;  3M8C A;  2F98 A;  3N8B A;  4J9A A;  1US1 A;  1OPY A;  1VQ7 3;  4J5K A;  4ZM8 A;  4FMA A;  1BNF A;  1YHQ 3;  3AHS A;  3D4A A;  4WYK B;  1RN1 A;  4X2H A;  2YX9 A;  4MEI A;  5BXQ A;  3EE1 A;  4KFF A;  3T8N A;  2ZHX B;  3VGN A;  3LTB A;  2BT3 A;  3PS8 A;  3ROB A;  3STD A;  1B27 A;  3K5T A;  3S27 A;  2W6J H;  4L8P A;  7STD A;  4KFD A;  1STD A;  2XRX B;  4KT3 B;  1LQM B;  4LGQ A;  4O02 B;  1BIR A;  2F86 B;  7GSP A;  4N6L A;  3AGN A;  3X3Y A;  3AMO B;  1O7W B;  4L7K A;  3CMA 3;  1BGS A;  4O3V A;  3LTA A;  1GS3 A;  5HOH A;  2E2U A;  4KVH A;  1RSN A;  1DYU A;  2A15 A;  3X3Z A;  1RRH A;  2CHC A;  3L0R A;  4EV5 A;  1BRN L;  1GY7 A;  1VQQ A;  1FZU A;  3EBY A;  1OHP A;  3CC2 3;  1RJO A;  1BRS A;  1W6Y A;  3DGY A;  1LXE A;  1RGH A;  1B2M A;  1Q82 4;  1K28 A;  1MWU A;  3B4P A;  1Q7H A;  4CPK A;  8RNT A;  2WO0 A;  1LOV A;  3G4S 3;  2KF5 A;  4HYZ A;  1FYS A;  1I8V A;  2UGI A;  3F9S A;  1BSC A;  1L5G B;  4PEJ A;  1ZGX A;  3ALA A;  1C7H A;  4ORL A;  2OOV A;  1ROV A;  3N9H A;  1B2X A;  3D5G A;  2CWT A;  3ER7 A;  3MKI A;  4MJD A;  1K9M 4;  3QRD A;  1D6U A;  5JBS A;  5AII A;  2WOF A;  5IF6 A;  3NQY A;  3GWR A;  1EQK A;  1BRI A;  3DGO A;  3DH2 A;  3EN1 B;  2HML B;  3EB8 A;  1OF5 B;  4RBN A;  2GBX B;  1GOU A;  5D83 A;  3CCM 3;  1NB5 I;  2L1S A;  1RN4 A;  4LMI A;  4BTX A;  2QGU A;  4FR9 A;  1W02 A;  1JZD A;  3X41 A;  3SXX A;  4BL2 A;  1FGO A;  1V74 A;  3E99 A;  2J8X B;  2H0I A;  1G02 A;  3BB9 A;  1TUH A;  3JUM A;  4AEQ A;  2CFW A;  2P05 A;  1S5A A;  2CC3 A;  1IVV A;  1HU9 A;  1N5H A;  1PY3 A;  1B20 A;  5EVH A;  3NUV A;  5RNT A;  3WA3 A;  4FMD A;  2F5M A; 
#chains in the Genus database with same CATH homology
 3KSP A;  3F8X A;  1KC8 4;  1DMM A;  3HZP A;  3GZB A;  2KCD A;  3LT9 A;  1OH0 A;  1NJI 4;  1HKX A;  2F99 A;  3GZR A;  2XR8 B;  5IG4 A;  3X40 A;  1DMQ A;  2XH9 A;  3NV0 B;  5JPU A;  1Z1S A;  4R9K A;  3NBJ A;  3NM2 A;  3BNE A;  3KZT A;  1IDP A;  5AIG A;  4K1U A;  4HZB B;  5AEW B;  4WYK A;  4L8O A;  4HM3 B;  5JPP A;  1AR0 A;  1LVN A;  3CNX A;  2K54 A;  3NBB A;  2GU1 A;  3WMD A;  3LOY A;  2R4I A;  1ASK A;  1FGQ A;  5IW9 A;  3MHE A;  1JKG B;  2E2T A;  1FUW A;  4EBG A;  1GD3 A;  3DZL A;  3J7Y d;  2CFL A;  5CF1 A;  1QAL A;  2OTJ 3;  2XGN A;  4XBY A;  4HM1 B;  3NHX A;  1Q81 4;  1N9E A;  2OOV C;  5AI1 A;  2Z7A A;  3CCU 3;  5KP4 A;  1OGX A;  3FF2 A;  3N54 B;  5LC7 A;  3UL6 A;  1TP6 A;  2STD A;  4GL6 A;  1QVG 2;  2W2C A;  5A0O B;  2CH9 A;  2W0Q A;  1J2B A;  4HM0 B;  1K73 4;  1VQ5 3;  1O7H B;  1EKM A;  3EJV A;  4HM7 B;  3B8L A;  2Z76 A;  1VQM 3;  1SJW A;  1SII A;  1RRL A;  3RGA A;  5STD A;  3VSY A;  1JB4 A;  3G0K A;  2MC8 A;  1EA2 A;  3I0Y A;  4Q53 A;  2MF7 A;  1IVW A;  2KRT A;  2W9P A;  2ZL8 A;  3LXU X;  5CXO A;  3B7C A;  4N3V A;  3DGM A;  5IER A;  2CWV A;  4K1V A;  2P0X A;  3CCL 3;  1OF5 A;  4HVN A;  1IQY A;  3CME 3;  3V99 A;  2HMN B;  3OXA A;  1YGE A;  1UI7 A;  4AKZ A;  4WFO A;  4AKY A;  1VQ9 3;  4GB5 A;  4BTW A;  1QAF A;  2GU3 A;  4KZ1 A;  2E2V A;  3CCS 3;  1Q40 B;  3JUO A;  1M1K 4;  5EEO A;  2P0M A;  1CQS A;  3DUK A;  3Q2P A;  2I9W A;  3H51 A;  3I55 3;  4O2H A;  2B24 B;  1NO3 A;  5LC6 A;  1IVX A;  2C11 A;  1NB3 I;  2O9U X;  3K0Z A;  1JV2 B;  2YFI B;  2INX A;  3LML A;  4HJL B;  4LZI A;  5D81 A;  1W01 A;  3JUQ A;  1UUW B;  3SOY A;  1AV4 A;  3EN8 A;  2W56 A;  3BNB A;  3F7S A;  4WP5 A;  3CPO A;  1W2B 2;  1YHQ 3;  3MYT A;  3PCS A;  2P09 A;  3X3X A;  2Z6B A;  2YFJ B;  3LZA A;  5DRE A;  1W7C A;  3GAX A;  3KE7 A;  2LYX A;  3FG3 A;  4XM4 A;  1UUV B;  3F14 A;  2QEX 3;  1DMN A;  1QJG A;  3A76 A;  1U8C B;  1N8R 4;  4NHF A;  1UW1 A;  1YI2 3;  1LNH A;  4RNY A;  1IQ8 A;  1CYV A;  4HBR A;  3FLJ A;  4R4K A;  1VQ4 3;  5AIF A;  4BTY A;  4H3U A;  2CG1 A;  2CFD A;  4K90 B;  4HM5 B;  3K9M C;  1FGR A;  3JUP A;  5IEO A;  2RGQ A;  1JKG A;  2XFS A;  1JN5 A;  3EBT A;  1VQO 3;  3V98 A;  4N6M A;  4IPB A;  1FGT A;  4OK0 A;  2KXG A;  3IJE B;  5D82 A;  2ZDJ A;  5AYR B;  4MMZ B;  1VQ6 3;  2D42 A;  1D6Z A;  4TX4 A;  1VQN 3;  1O7G B;  1KD1 4;  3FG4 A;  3QK9 A;  3U97 A;  1A67 A;  4XB5 A;  3CCQ 3;  2IMJ A;  5CK6 A;  3FH1 A;  3H3H A;  4FCJ A;  1KSI A;  1IV9 A;  1OHO A;  1IU7 A;  3OWY A;  4N6U A;  2BMR B;  3UNL A;  5G2G A;  3UJM A;  5KP1 A;  3EHC A;  1NDO B;  3DGN A;  3KKG A;  2ML6 A;  2RFR A;  3OV4 A;  1ZX2 A;  4R1K A;  3O8Y A;  2Y73 A;  3CCJ 3;  5FW5 A;  3S28 A;  2XSH B;  1WMN A;  3FSD A;  3FCS B;  1MNL A;  3I56 3;  1ZO2 A;  1EG9 B;  2CKF B;  3EC9 A;  4EYC A;  3BLZ A;  3MG3 A;  3FKA A;  5ELU A;  3SLU A;  3RGR A;  1OGZ A;  2BMO B;  3NXJ A;  2K0M A;  1K41 A;  1CYU A;  4NRE A;  3PYJ A;  4XBT A;  3OWS A;  3MSO A;  1WNH A;  2JQ5 A;  1W6C A;  2BHM A;  2LQV A;  3AMO A;  3G8Z A;  1VQL 3;  3TDG A;  3WDG B;  2OQE A;  5IG3 A;  1STF I;  2PZV A;  1VQ8 3;  3EQQ B;  3CCR 3;  1ISK A;  5EQL A;  4J8T A;  3LH4 A;  4OVM A;  1O7M B;  1LOX A;  1E97 A;  2JDI H;  2HMJ B;  4EC6 A;  3FZW A;  5TGN A;  1KWI A;  4I4K A;  1FGM A;  1W5Z A;  1AVL A;  1O7P B;  2O3O A;  1N9J A;  2GXF A;  3K63 A;  5CF2 A;  1N8Q A;  3DY5 A;  2HMK B;  8CHO A;  1M90 4;  2FGT A;  4HZ9 B;  4G1M B;  3V92 A;  1E3V A;  3OX9 A;  1YJW 3;  4WWU C;  3T8U A;  5HGR A;  1RN7 A;  1GD4 A;  3G16 A;  3JUN A;  3LTC A;  3PZW A;  3F8H A;  3GZX B;  3VF1 A;  3BND A;  5ELJ A;  1YJ9 3;  4N6O B;  2CFK A;  4RNZ A;  1T5Y A;  1JRQ A;  3CC4 3;  4JRF A;  3SED A;  1A2K A;  1OAC A;  3HIG A;  3HK4 A;  5IG5 A;  3NM7 A;  2XSO B;  1QAK A;  1M1X B;  2IUJ A;  5DRV A;  4HM6 B;  3LT8 A;  2OTL 3;  3RDE A;  1OUN A;  3EX9 A;  1SPU A;  5AEU B;  3PXM A;  4N6T A;  3U1W A;  4O8S A;  2PNC A;  1ULJ B;  4FCZ A;  1NWW A;  1R4C A;  1UI8 A;  3DGL A;  3SOA A;  3WA2 X;  1VQP 3;  1DVD A;  2P38 A;  5BVB A;  1RKY A;  1GY5 A;  3FF0 A;  3FG1 A;  3NV0 A;  2WGQ A;  1TU5 A;  1JJ2 2;  3DM8 A;  2W04 A;  2WOH A;  4MMX B;  3CCE 3;  1F8N A;  2CG0 A;  4X2O A;  1DVC A;  3NX0 A;  3T0U A;  2CWU A;  1IV7 A;  1W2Z A;  3KFQ C;  1TFK A;  1WTH A;  3KSE D;  1D6Y A;  3DXO A;  4WHA A;  4EXR A;  2OQE C;  1SIH A;  2ML5 A;  3MG1 A;  3CCV 3;  3SX1 A;  2XF3 A;  2RCD A;  3D9R A;  2XGL A;  3NBR A;  4QWT A;  3PGB A;  2B1X B;  4HM8 B;  3CXC 2;  1E3R A;  4R9L A;  1ROA A;  4U13 A;  1Y4K A;  3EF8 A;  4FMC A;  4N6N B;  1NU3 A;  2QIY A;  3WOE B;  2M7O A;  3Q1C A;  1JB5 A;  3IMA B;  3DMC A;  3PCR A;  4R80 A;  2GBW B;  3K7C A;  4EV2 A;  2V1L A;  4LSO A;  1IT7 A;  4CDL A;  2XFT A;  1IT8 A;  1M9G A;  1ULI B;  2IA7 A;  4FCM A;  3CD6 3;  5IG0 A;  3CC7 3;  1U5O A;  1VZZ A;  2W03 A;  3F40 A;  3UB1 A;  1YIJ 3;  1JNQ A;  1YVB I;  4MMY B;  1OHS A;  2RSX A;  2CW9 A;  6STD A;  3HI7 A;  3NQZ A;  3CPW 2;  2OCT A;  4K61 A;  3BNC A;  2SBL A;  2HMO B;  3Q90 A;  1A90 A;  1O7N B;  3GZY B;  1IK3 A;  2OWP A;  2GEY A;  5IEP A;  4RZM A;  4XBX A;  2YFL B;  3WOD G;  5I97 A;  3GRD A;  2L4V A;  1N5P A;  2CIU A;  4N6V 0;  1W00 A;  5AIH A;  2BO9 B;  3F7X A;  1WMP A;  1PU4 A;  5CLK A;  2CFG A;  3S67 A;  1GYB A;  4JF8 A;  2QA4 3;  3UL5 A;  1KQS 2;  3LYG A;  2Y74 A;  2W56 B;  1W4N A;  2Z77 A;  1Q7Y 4;  1FA3 A;  2FNQ A;  3KN4 A;  2IUK A;  1VQK 3;  2W9Q A;  3X42 A;  3D3L A;  1G96 A;  3OWU A;  1WMO A;  3FGY A;  3S29 A;  4HKV B;  1WQL B;  4KFE A;  3G71 3;  1K9M 4;  4LEH A;  3CNM A;  1GY6 A;  4FMB A;  4XDW A;  1QVF 2;  4STD A;  1QMA A;  1BUQ A;  1Q40 A;  2C10 A;  1IQX A;  2XEP A;  3OW2 2;  1IVU A;  4OUQ A;  4CCV A;  2CK3 H;  1AVK A;  5FGO A;  2BMQ B;  2D1W A;  2BNG A;  3CU3 A;  3MG2 A;  4HM4 B;  1K8A 4;  1YIT 3;  1YJN 3;  3LTD A;  2WGO A;  1JN5 B;  1W6G A;  3MPH A;  1MOL A;  2FXT A;  3HII A;  1JB2 A;  3WOF B;  1A2V A;  3IPT A;  1CEW I;  2Q07 A;  3MWZ A;  1SQW A;  2GEX A;  3SVA A;  1S72 3;  4XDV A;  2HMM B;  3KII A;  5AYS C;  3HX8 A;  4IT7 A;  5KP3 A;  3S5C A;  3G6E 3;  1Q86 4;  1TIJ A;  1Q42 A;  1OCV A;  1TFO A;  3ECF A;  4HM2 B;  5IEN A;  1PFP A;  2UX0 A;  4IIA A;  4H61 A;  3B4O A;  3M8C A;  3N8B A;  4J9A A;  2F98 A;  1OPY A;  1US1 A;  1VQ7 3;  4ZM8 A;  4FMA A;  4WYK B;  4X2H A;  2YX9 A;  4MEI A;  5BXQ A;  3EE1 A;  4KFF A;  3T8N A;  3VGN A;  3LTB A;  2BT3 A;  3PS8 A;  3ROB A;  3STD A;  3K5T A;  3S27 A;  2W6J H;  4L8P A;  7STD A;  4KFD A;  1STD A;  2XRX B;  4O02 B;  4LGQ A;  2F86 B;  4N6L A;  3X3Y A;  3AMO B;  1O7W B;  4L7K A;  3CMA 3;  4O3V A;  3LTA A;  1GS3 A;  2E2U A;  4KVH A;  1DYU A;  2A15 A;  3X3Z A;  1RRH A;  2CHC A;  3L0R A;  4EV5 A;  1GY7 A;  3EBY A;  1OHP A;  3CC2 3;  1RJO A;  1W6Y A;  1LXE A;  1Q82 4;  1K28 A;  3B4P A;  2WO0 A;  3G4S 3;  4HYZ A;  3F9S A;  1L5G B;  4PEJ A;  3ALA A;  1C7H A;  4ORL A;  2OOV A;  1ROV A;  3N9H A;  4MJD A;  2CWT A;  3ER7 A;  3MKI A;  3QRD A;  1D6U A;  5JBS A;  5AII A;  2WOF A;  5IF6 A;  3NQY A;  3GWR A;  1EQK A;  3DGO A;  3EN1 B;  2HML B;  3EB8 A;  1OF5 B;  4RBN A;  2GBX B;  3CCM 3;  5D83 A;  1NB5 I;  4LMI A;  4BTX A;  2QGU A;  4FR9 A;  1W02 A;  3X41 A;  3SXX A;  1FGO A;  1V74 A;  3E99 A;  3BB9 A;  1TUH A;  3JUM A;  4AEQ A;  2CFW A;  2P05 A;  1S5A A;  2CC3 A;  1IVV A;  1HU9 A;  1N5H A;  5EVH A;  3NUV A;  3WA3 A;  4FMD A;  3JVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...