2Z7AA

X-ray crystal structure of rv0760c from mycobacterium tuberculosis at 2.10 angstrom resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
TTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative steroid isomerase
publication title Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 40
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2z7aA00
1AR0A 3H51A 3SOAA 4R9KA 1UUWB 4LEHA 3EBYA 4I4KA 3MKIA 3DUKA 1C7HA 3SEDA 2UX0A 5KP1A 3RGAA 3LZAA 2RGQA 3I0YA 2OWPA 1W00A 5IG0A 4CDLA 2Z76A 4J8TA 1JB4A 3G8ZA 1OHPA 4HZ9B 3F7SA 3KKGA 3OV4A 4HM7B 5D81A 3NHXA 3EN1B 1TP6A 1OGXA 3OXAA 1BUQA 2QGUA 1Q40A 4HVNA 4HM0B 5IG3A 1DMMA 2YFLB 3ER7A 3BLZA 5TGNA 3MG1A 2JQ5A 1O7NB 4FCJA 3VGNA 3CNXA 2CHCA 3EX9A 3HX8A 4L8PA 3GWRA 4HZBB 5IF6A 3E99A 1ULIB 4XBTA 3KE7A 2B24B 1DMQA 3FKAA 3JUOA 3JUNA 1S5AA 3EC9A 3GZRA 4R1KA 2XSOB 4R9LA 1GY7A 5KP3A 3LYGA 5FW5A 4HM8B 1QJGA 3OWUA 3NBRA 3ECFA 2GBXB 5HGRA 1GS3A 3UJMA 7STDA 3MYTA 3KSPA 5DREA 3F14A 3NV0A 1W02A 4IIAA 3BB9A 4XBXA 5CF1A 2R4IA 1ASKA 1JKGA 6STDA 2INXA 2YFJB 1JB5A 1E3RA 3GZBA 2GBWB 4HM2B 2RCDA 4HM1B 1EA2A 1SJWA 4STDA 4L8OA 3EBTA 4MJDA 1ULJB 2HMOB 4LMIA 1QMAA 1OF5B 3EJVA 3JUMA 3FSDA 3GZXB 5IERA 3DXOA 1OH0A 3K0ZA 4XDWA 2HMLB 2Z77A 3OWSA 2YFIB 4N3VA 1JN5B 3G16A 4WP5A 4XDVA 4XBYA 5D82A 3F7XA 3F40A 4HJLB 4K1VA 4WWUC 4KVHA 1Q42A 3KZTA 1OGZA 5CXOA 3CU3A 2GEYA 2HMNB 1O7GB 3EF8A 3GZYB 1OUNA 3HZPA 3DM8A 5CK6A 3OX9A 3B7CA 3M8CA 2HMMB 3S5CA 3MG3A 1O7HB 4XM4A 3B4PA 1CQSA 2RFRA 2GXFA 3F8HA 3NXJA 4XB5A 5AIFA 5STDA 1O7PB 3VSYA 5CF2A 3FF2A 1OHSA 4HM5B 1K41A 3FLJA 5D83A 1IDPA 5AIIA 3CNMA 3EQQB 1ISKA 1NU3A 5DRVA 5IENA 4X2HA 1GY5A 5AEUB 4WYKB 1JN5A 3NM2A 4HM3B 4PEJA 2K54A 3FF0A 4HKVB 3STDA 2BMQB 4HM6B 1DMNA 4GB5A 3B4OA 3A76A 5AI1A 1W6YA 3JUQA 5CLKA 4LGQA 5AEWB 2BMRB 3FH1A 3Q90A 5G2GA 4K1UA 8CHOA 1VZZA 1GY6A 1ZX2A 3F9SA 3CPOA 1E97A 3JUPA 1OCVA 3FZWA 5AIHA 2HMKB 1Z1SA 2A15A 1JB2A 5IEPA 2GEXA 4ORLA 3FGYA 3OWYA 3HK4A 5JPUA 5KP4A 4X2OA 2STDA 3ROBA 3MHEA 3WMDA 2Z7AA 4U13A 4WYKA 1E3VA 2B1XB 3K7CA 1GYBA 2PZVA 2QIYA 4L7KA 4HM4B 2F98A 1STDA 2W2CA 5AIGA 5IEOA 2XR8B 1NDOB 3T8UA 5BVBA 4RZMA 3NV0B 2I9WA 1OPYA 1JKGB 4H3UA 3MSOA 3GRDA 3DZLA 3H3HA 2HMJB 1O7WB 2BNGA 1U5OA 3SOYA 3NUVA 1OF5A 1OHOA 1ZO2A 1EG9B 5JPPA 4Q53A 2XSHB 5IG4A 5EVHA 4FCMA 5BXQA 2CKFB 2BMOB 3EN8A 2XRXB 3B8LA 3G0KA 3UNLA 2F99A 1A2KA 1O7MB 3RGRA 3IPTA 4J9AA 3T8NA 3DMCA 1TUHA 1NWWA 3F8XA 3MG2A 4OVMA 3D9RA 4OUQA 1WQLB 3EHCA 1W01A 1HKXA 1Q40B 1UUVB 2F86B 2IMJA 5IG5A
chains in the Genus database with same CATH superfamily
1AR0A 3H51A 3SOAA 4N6LA 1I70A 1B2MA 2BU4A 3LH4A 4R9KA 3DGNA 1UUWB 4LEHA 3AHSA 4WHAA 2CWUA 2O9UX 3EBYA 2R41A 2KF6A 4I4KA 3MKIA 3HIGA 1TRQA 1DETA 3DUKA 1BUJA 1C7HA 1K9M4 4EBGA 4QWTA 3ALAA 3SEDA 3A5EA 1X1UA 1IVXA 1N9EA 3CCJ3 1SARA 3SYUA 2UX0A 1K734 1VQ63 3KN4A 2W9PA 5KP1A 2RBIA 2ZDJA 3X3XA 1LVNA 3VF1A 1WMNA 2CFLA 3PYJA 1LOYA 2XFSA 1I3FA 5M18A 1VQP3 4OK0A 3RGAA 2E2TA 3LZAA 3NQZA 4RBNA 1VQQA 2RGQA 1X1XA 3I0YA 2OWPA 1RNTA 4GL6A 1W00A 4KFFA 1GD3A 5LC6A 2F56A 5IG0A 3CME3 4CDLA 4EV2A 2OTJ3 2Z76A 4J8TA 1JB4A 3G8ZA 1OHPA 4HZ9B 1K28A 1BRGA 7RNTA 1KSIA 1VQ53 3CXC2 3DGMA 3F7SA 1B21A 1W7CA 4AKYA 2M7OA 3PS8A 3KKGA 1WTHA 4BL3A 2D42A 3OV4A 3I563 1W5ZA 4HM7B 3RNTA 3URPA 4FMDA 5D81A 1T3BA 3NHXA 3EN1B 3IJEB 3N9HA 1T2IA 3D5GA 1K8A4 1DVCA 1V57A 1W4NA 3KFQC 3ZG5A 4ZM8A 3S27A 2KF5A 2ZL8A 3G713 1TP6A 1NJI4 3DGOA 1LNHA 1SIIA 1OGXA 3OXAA 1BUQA 3BIRA 1BSBA 4NREA 4AKZA 2QGUA 1B2UA 3S67A 1Q40A 3CPW2 1DE3A 2XGLA 1PFPA 1MWRA 1A90A 2W56A 1G0TA 5BU4A 3DH2A 4HVNA 1QALA 4FMCA 4J5KA 1GOUA 4HM0B 1NB5I 1I2EA 3G6E3 5IG3A 1DMMA 3LTAA 4WFOA 1PY3A 1PYLA 1EEJA 2FXTA 2YFLB 3ER7A 1FUWA 3BLZA 3UL5A 1JZOA 5TGNA 5EEOA 1W6CA 3BNBA 4EW5A 1KWIA 3MG1A 4O02B 2RNTA 2JQ5A 1O7NB 1LQMB 2OOVC 2CH9A 2W9QA 1I2GA 4FCJA 1DVDA 1MGWA 4RNZA 1AVLA 1D6YA 1Q7HA 3G4S3 4J5GA 3VGNA 1RSNA 3CNXA 3CC43 2CWVA 3SXXA 1BRSA 1RN7A 2CHCA 2SARA 3EX9A 3HX8A 1BVIA 3S29A 4L8PA 1IVUA 2O3OA 1UI7A 1BU4A 3BNEA 1VQN3 1BIRA 3GWRA 4I5QA 1MOLA 1QVG2 2FGTA 3V99A 2Q07A 1BRIA 4HZBB 1OACA 1YGWA 3D3LA 3K5TA 3MPHA 1U8CB 1A2PA 5IF6A 3E99A 1BNEA 1ULIB 4XBTA 1Q824 3WR2A 1B2XA 3K9MC 5G1LA 3KE7A 2BO9B 1VQO3 2B24B 1LOWA 1RCKA 2V1LA 1DMQA 3FKAA 3JUOA 3JUNA 1EKMA 1WMOA 3LTDA 3CC73 1UDII 1S5AA 3TDGA 1G02A 1RRHA 5GSPA 3X40A 3EC9A 4HOHA 1FUSA 2L4VA 3GZRA 4R1KA 2XSOB 4R9LA 1GY7A 3KSED 2P05A 5KP3A 3Q3FA 3LYGA 5FW5A 4TX4A 1HU9A 4HM8B 2E2UA 3V92A 1QJGA 3OWUA 3V98A 3NBRA 1VQK3 3UL6A 4CPKA 2AADA 1NNVA 3ECFA 3FG3A 1BGSA 2GBXB 1EUIC 9RNTA 5HGRA 1TFKA 1GS3A 1L5GB 4EYCA 3UJMA 2LQVA 1FGQA 7STDA 1GOVA 3KSPA 1HYFA 3MYTA 1YI23 1KD14 1TJDA 8RNTA 1JNQA 5DREA 2Z6BA 3F14A 1GMPA 1W02A 2CFWA 3BB9A 3NV0A 2BHMA 4HBRA 4IIAA 5M1AA 4XBXA 5CF1A 2R4IA 4N6MA 1ASKA 2CG0A 1JKGA 6STDA 4KFEA 1D6UA 2INXA 1VQM3 2YFJB 1JB5A 1E3RA 3GZBA 2GBWB 1RGGA 4HM2B 2RCDA 4HM1B 2L1SA 1EA2A 1UCKA 2OOVA 1Q814 3D79A 1SJWA 3X41A 1BNFA 2LYXA 3CC23 4RNYA 4STDA 5AYRB 1MWTA 1MWUA 1SPUA 1EQKA 3KIIA 1CH0A 1TU5A 4L8OA 1YHQ3 3EBTA 3LXUX 3DGLA 1RMSA 4MJDA 1ULJB 2RSXA 4MMXB 2HMOB 2KRTA 3PCSA 1UI8A 4FMAA 3SLUA 5RNTA 1RGCA 4LMIA 3L0RA 1QMAA 1OF5B 3EJVA 3GSPA 3JUMA 4JF8A 3FSDA 4FMBA 1CYUA 3GZXB 5M19A 3CCR3 3LTBA 1YJW3 5IERA 1JJ22 4N6OB 2CFDA 1B2SA 3IMAB 3DXOA 4LYLB 1OH0A 3K0ZA 2WO0A 4XDWA 1IK3A 2HMLB 2Z77A 3OWSA 2YFIB 4N3VA 1JN5B 5LC7A 2WOHA 2CK3H 1FGTA 4HAAA 3NM7A 3NX0A 3G16A 1JBRA 4WP5A 4XDVA 4FR9A 2OQEC 2CFKA 4BTXA 1W2ZA 1GOYA 1I2FA 4XBYA 5D82A 3F7XA 1W2B2 3F40A 1YGEA 4HJLB 1IQXA 4K1VA 3LT9A 4WWUC 1R4CA 2C11A 1ROAA 2MF7A 1BNJA 2MC8A 4KVHA 1Q42A 2J8XB 2CIUA 3KZTA 6RNTA 1OGZA 4BL2A 1VQL3 1MWSA 3BNDA 3D4AA 1S723 3ZFZA 1IQ8A 4O8SA 5CXOA 3WOEB 3CU3A 2K3DA 1AQZA 1LOVA 2GEYA 3CCV3 2HMNB 1O7GB 3EF8A 1NB3I 3GZYB 1VQ43 2F5WA 2XGNA 1OUNA 1T2HA 2QEX3 3AGNA 2QA43 3HZPA 1IQYA 3DM8A 3LTCA 1V58A 1FGMA 2Y74A 5CK6A 1IYYA 3OX9A 1IT8A 2CX1A 2ML6A 3B7CA 1FYSA 3M8CA 1ZS7A 2HMMB 3S5CA 1Q864 3MG3A 3T0UA 1O7HB 1CEWI 4XM4A 3RDEA 4GHOA 1WNHA 3SX1A 3B4PA 1CQSA 2RFRA 2UUGC 3HIIA 6GSPA 2GXFA 3F8HA 3NXJA 1YJ93 1VQ93 2WGQA 2F4YA 3CD63 2Y73A 1DYUA 2CFGA 2IUKA 4XB5A 5AIFA 5STDA 1Y4KA 1IV7A 1O7PB 1FGOA 1AVKA 3KCHA 1RGFA 1GD4A 1TTOA 2UGIA 3VSYA 5CF2A 4BIRA 3FF2A 2KXGA 4N6V0 2FNQA 1OHSA 3CCU3 1TRPA 3AMOB 4HM5B 1K41A 3FLJA 1FGRA 5D83A 1IDPA 3LT8A 1BRKA 5AIIA 3CNMA 3EQQB 3ZG0A 1ISKA 3Q2PA 1NU3A 5DRVA 5IENA 4X2HA 3DGYA 3MWZA 1BNRA 1GY5A 1BAOA 1LRAA 1US1A 2P09A 2CC3A 2W6JH 2ZHXB 5AEUB 2WGOA 4WYKB 1JN5A 4CCVA 5BIRA 2ML5A 1RGLA 3NM2A 4EXRA 2OQEA 4HM3B 1UW1A 3I553 4BTWA 4MMZB 4PEJA 1YIT3 1BSAA 4HYZA 3X3YA 1BSCA 2H0GA 4K90B 2K54A 3BNCA 1UCLA 3FF0A 4HKVB 3STDA 2BMQB 1WMPA 2KCDA 4HM6B 1DMNA 1UUGB 2WOFA 3B4OA 3FG4A 4GB5A 3A76A 4N6NB 1B3SA 1VQ73 1C54A 2P0MA 2XFTA 5AI1A 1W6YA 2W56B 3JUQA 3DY5A 1IU7A 5CLKA 4LGQA 4KZ1A 1AY7A 1N9JA 5AEWB 1UCIA 2IUJA 2BMRB 3J7Yd 1Q9EA 3HOHA 3FH1A 3Q90A 5G2GA 4K1UA 1I0XA 1LNIA 1CYVA 1A67A 8CHOA 1VZZA 4KT3B 3LMLA 4BU4A 1GY6A 1FA3A 1GMRA 1BOXA 3O8YA 3NQYA 1ZX2A 2IYJA 3F9SA 4EV5A 1I0VA 1KQS2 1RDSA 1FUTA 3CPOA 1YNVX 3N8BA 1E97A 3EE1A 2YX9A 3JUPA 2P0XA 3LOYA 1M9GA 1OCVA 3FZWA 3Q1CA 4NPBA 1KC84 1FZUA 3PCRA 5IW9A 5AIHA 1MGRA 1UCJA 2GU3A 2HMKB 1RTUA 1Z1SA 1STFI 1M1XB 2OCTA 3AGOA 2A15A 1LXEA 1BSEA 1JB2A 5JBSA 1JRQA 3CMA3 5IEPA 2XF3A 2OTL3 2GEXA 1RGAA 5I97A 1FW7A 5A0OB 4ORLA 1UGIA 1PU4A 3FGYA 3OWYA 1LOXA 1BANA 1BRHA 3D5IA 1BRJA 3HK4A 4N6UA 1RRLA 3CCS3 5JPUA 3SVAA 1IVWA 2IY2A 1F8NA 3AMOA 5KP4A 4X2OA 2KF3A 2STDA 2HOHA 1R4YA 1J2BA 3ROBA 2C10A 1UGHI 3MHEA 3WMDA 2ZA4A 2H0IA 1GMQA 1SQWA 2Z7AA 4U13A 1RGHA 1JBSA 1HZ1A 3GAXA 4EC6A 1B27A 4WYKA 1E3VA 1X1YA 2B1XB 1N5PA 1YVBI 2GU1A 3K7CA 1ROVA 2BIRA 3PXMA 2W0QA 2KAAA 4MMYB 4R80A 5G1KA 3WDGB 1GYBA 2PZVA 3WHOA 1RNBA 3U1WA 1V74A 2QIYA 4O3VA 4L7KA 1T5YA 4KFDA 4LSOA 3WA2X 4HM4B 1N5HA 2F98A 2SBLA 5EQLA 1STDA 1YVSA 2AAEA 1I3IA 3QK9A 2CWTA 2W2CA 4JRFA 4AEQA 2W04A 2XEPA 5AIGA 1QAKA 2CX0A 2GSPA 5IEOA 2XR8B 1VQ83 1B20A 1RGKA 1NDOB 3T8UA 3U97A 5BVBA 4LZIA 4RZMA 1YJN3 3HI7A 1JZDA 1BNSA 3NV0B 4NHFA 1M1K4 1RN4A 2I9WA 1LQGC 1OPYA 1JKGB 1JV2B 4FCZA 4H3UA 5HOHA 3MSOA 3UB1A 4MEIA 3CCQ3 2E2VA 1RHLA 1N8R4 3GRDA 1IVVA 4G1MB 3PGBA 3PZWA 2F5MA 3DZLA 2P38A 3H3HA 4IT7A 2CG1A 1YIJ3 1A2VA 4N6TA 2HMJB 3N54B 1O7WB 2BNGA 2JDIH 4RNTA 1U5OA 2PNCA 2H0HA 3CCM3 3SOYA 3NUVA 3WA3A 1OF5A 1OHOA 1ZO2A 1IV9A 4IPBA 3S28A 1RGEA 1EG9B 1BNIA 3X42A 2K0MA 4Q53A 1TIJA 3WODG 1AV4A 4DKIA 5JPPA 1BSDA 2XSHB 7GSPA 1RKYA 1IT7A 1N8QA 1SIHA 3NBBA 4FCMA 4ILFA 5EVHA 5IG4A 3X3ZA 5BXQA 1W6GA 2BT3A 2CKFB 2BMOB 1BNGA 1I8VA 4K61A 1G96A 3EN8A 2XRXB 3B8LA 1TFOA 3JVCA 4BTYA 1GSPA 3G0KA 5ELJA 3UNLA 2F99A 3AHWA 2C4BA 1A2KA 4H61A 1O7MB 3RGRA 3IPTA 4GSPA 4J9AA 1RJOA 3FCSB 5ELUA 3T8NA 3DMCA 1TUHA 3FG1A 1MNLA 1NWWA 4CJNA 1RN1A 1M904 1Q7Y4 5FGOA 3F8XA 1RLSA 1JBTA 3MG2A 4OVMA 4R4KA 4O2HA 1QVF2 3D9RA 4OUQA 1WQLB 5AYSC 3EHCA 2IA7A 1W01A 1HKXA 1RCLA 3QRDA 1ZGXA 1Q40B 3NBJA 3OW22 1UUVB 2W03A 1B2ZA 2D1WA 1D6ZA 1BRNL 2CW9A 3EB8A 3K63A 2KF4A 2XH9A 3CCE3 2F86B 1X1WA 3WOFB 3CCL3 1NO3A 2IMJA 3BU4A 5IG5A 1QAFA
chains in the Genus database with same CATH topology
1AR0A 3H51A 3SOAA 4N6LA 3LH4A 4R9KA 3DGNA 1UUWB 4LEHA 4WHAA 2CWUA 2O9UX 3EBYA 4I4KA 3MKIA 3HIGA 3DUKA 1C7HA 1K9M4 4EBGA 4QWTA 3ALAA 3SEDA 1IVXA 1N9EA 3CCJ3 2UX0A 1K734 1VQ63 3KN4A 2W9PA 5KP1A 2ZDJA 3X3XA 1LVNA 3VF1A 1WMNA 2CFLA 3PYJA 2XFSA 1VQP3 4OK0A 3RGAA 2E2TA 3LZAA 3NQZA 4RBNA 2RGQA 3I0YA 2OWPA 4GL6A 4KFFA 1W00A 5LC6A 1GD3A 3CME3 5IG0A 4CDLA 4EV2A 2OTJ3 2Z76A 4J8TA 1JB4A 3G8ZA 1OHPA 4HZ9B 1K28A 1KSIA 1VQ53 3CXC2 3DGMA 3F7SA 1W7CA 4AKYA 2M7OA 3PS8A 3KKGA 1WTHA 2D42A 3OV4A 3I563 1W5ZA 4HM7B 4FMDA 5D81A 3NHXA 3EN1B 3IJEB 3N9HA 1K8A4 1DVCA 1W4NA 3KFQC 4ZM8A 3S27A 2ZL8A 3G713 1TP6A 1NJI4 3DGOA 1LNHA 1SIIA 1OGXA 3OXAA 1BUQA 4NREA 4AKZA 2QGUA 3S67A 3CPW2 1Q40A 2XGLA 1PFPA 1A90A 2W56A 4HVNA 1NB5I 1QALA 4FMCA 4HM0B 3G6E3 5IG3A 1DMMA 3LTAA 4WFOA 2FXTA 2YFLB 3ER7A 1FUWA 3BLZA 3UL5A 5TGNA 5EEOA 1W6CA 3BNBA 1KWIA 3MG1A 4O02B 2JQ5A 1O7NB 2OOVC 2W9QA 2CH9A 1DVDA 4FCJA 4RNZA 1AVLA 1D6YA 3G4S3 3VGNA 3CNXA 3CC43 2CWVA 3SXXA 1RN7A 2CHCA 3EX9A 3HX8A 3S29A 4L8PA 1IVUA 2O3OA 1UI7A 3BNEA 1VQN3 3GWRA 1MOLA 1QVG2 2FGTA 3V99A 2Q07A 4HZBB 1OACA 3D3LA 3K5TA 3MPHA 1U8CB 5IF6A 3E99A 1ULIB 4XBTA 1Q824 3K9MC 3KE7A 2BO9B 1VQO3 2B24B 2V1LA 1DMQA 3FKAA 3JUOA 3JUNA 1EKMA 1WMOA 3LTDA 3CC73 1S5AA 3TDGA 1RRHA 3X40A 3EC9A 2L4VA 3GZRA 4R1KA 2XSOB 4R9LA 1GY7A 3KSED 2P05A 5KP3A 3LYGA 5FW5A 4TX4A 1HU9A 4HM8B 2E2UA 3V92A 1QJGA 3OWUA 3V98A 3NBRA 1VQK3 3UL6A 3ECFA 3FG3A 2GBXB 5HGRA 1TFKA 1GS3A 1L5GB 4EYCA 3UJMA 2LQVA 1FGQA 7STDA 3MYTA 3KSPA 1YI23 1KD14 1JNQA 5DREA 2Z6BA 3F14A 3NV0A 1W02A 2CFWA 3BB9A 4HBRA 2BHMA 4IIAA 3WA3A 4XBXA 5CF1A 2R4IA 4N6MA 1ASKA 2CG0A 1JKGA 6STDA 4KFEA 1D6UA 2INXA 1VQM3 2YFJB 1JB5A 1E3RA 3GZBA 2GBWB 4HM2B 2RCDA 4HM1B 1EA2A 2OOVA 1Q814 3X41A 1SJWA 2LYXA 3CC23 4RNYA 4STDA 5AYRB 1SPUA 1EQKA 3KIIA 1TU5A 4L8OA 1YHQ3 3EBTA 3LXUX 3DGLA 4MJDA 1ULJB 2RSXA 4MMXB 2HMOB 2KRTA 3PCSA 1UI8A 4FMAA 3SLUA 4LMIA 3L0RA 1QMAA 1OF5B 3EJVA 3JUMA 4JF8A 3FSDA 4FMBA 1CYUA 3GZXB 3CCR3 3LTBA 1YJW3 5IERA 1JJ22 4N6OB 2CFDA 3IMAB 3DXOA 1OH0A 3K0ZA 2WO0A 4XDWA 1IK3A 2HMLB 2Z77A 3OWSA 2YFIB 4N3VA 1JN5B 5LC7A 2WOHA 2CK3H 1FGTA 3NM7A 3NX0A 3G16A 4WP5A 4XDVA 4FR9A 2OQEC 2CFKA 4BTXA 1W2ZA 4XBYA 5D82A 3F7XA 1W2B2 3F40A 1YGEA 4HJLB 1IQXA 4K1VA 3LT9A 4WWUC 1R4CA 2C11A 1ROAA 2MF7A 2MC8A 4KVHA 1Q42A 2CIUA 3KZTA 1OGZA 1VQL3 3BNDA 1S723 1IQ8A 4O8SA 5CXOA 3WOEB 3CU3A 3CCV3 2GEYA 2HMNB 1O7GB 3EF8A 1NB3I 3GZYB 1VQ43 2XGNA 1OUNA 2QEX3 2QA43 3HZPA 1IQYA 3DM8A 3LTCA 1FGMA 2Y74A 5CK6A 3OX9A 1IT8A 2ML6A 3B7CA 3M8CA 2HMMB 3S5CA 1Q864 3MG3A 3T0UA 1O7HB 1CEWI 4XM4A 3RDEA 1WNHA 3SX1A 3B4PA 1CQSA 2RFRA 3HIIA 2GXFA 3F8HA 3NXJA 1YJ93 1VQ93 2WGQA 3CD63 2Y73A 1DYUA 2CFGA 2IUKA 4XB5A 5AIFA 5STDA 1Y4KA 1IV7A 1O7PB 1FGOA 1AVKA 3VSYA 1GD4A 5CF2A 3FF2A 2KXGA 4N6V0 2FNQA 1OHSA 3CCU3 3AMOB 4HM5B 1K41A 3FLJA 1FGRA 5D83A 1IDPA 3LT8A 5AIIA 3CNMA 3EQQB 1ISKA 3Q2PA 1NU3A 5DRVA 5IENA 4X2HA 3MWZA 1GY5A 1US1A 2P09A 5AEUB 2W6JH 2CC3A 2WGOA 4WYKB 1JN5A 4CCVA 2ML5A 3NM2A 4EXRA 2OQEA 4HM3B 1UW1A 3I553 4BTWA 4MMZB 4PEJA 1YIT3 4HYZA 3X3YA 4K90B 2K54A 3BNCA 3FF0A 4HKVB 3STDA 2BMQB 1WMPA 2KCDA 4HM6B 1DMNA 3FG4A 2WOFA 3B4OA 4GB5A 4N6NB 3A76A 1VQ73 2P0MA 2XFTA 5AI1A 1W6YA 2W56B 3JUQA 3DY5A 1IU7A 5CLKA 4LGQA 4KZ1A 1N9JA 5AEWB 2IUJA 3J7Yd 2BMRB 3FH1A 3Q90A 5G2GA 4K1UA 1CYVA 1A67A 8CHOA 1VZZA 3LMLA 1FA3A 1GY6A 3O8YA 3NQYA 1ZX2A 4EV5A 3F9SA 1KQS2 3CPOA 3N8BA 1E97A 3EE1A 2YX9A 3JUPA 2P0XA 3LOYA 1M9GA 1OCVA 3FZWA 3Q1CA 1KC84 3PCRA 5IW9A 5AIHA 2GU3A 2OCTA 2HMKB 1STFI 1Z1SA 1M1XB 5JBSA 1LXEA 2A15A 1JB2A 1JRQA 3CMA3 5IEPA 2XF3A 2OTL3 2GEXA 5I97A 5A0OB 4ORLA 1PU4A 3FGYA 3OWYA 1LOXA 3HK4A 4N6UA 1RRLA 3CCS3 5JPUA 3SVAA 1IVWA 1F8NA 3AMOA 5KP4A 4X2OA 2STDA 1J2BA 3ROBA 2C10A 3MHEA 3WMDA 1SQWA 2Z7AA 4U13A 3GAXA 4EC6A 4WYKA 1E3VA 2B1XB 1N5PA 1YVBI 2GU1A 3K7CA 1ROVA 3PXMA 4R80A 2W0QA 4MMYB 3WDGB 1GYBA 2PZVA 3U1WA 1V74A 2QIYA 4O3VA 4L7KA 1T5YA 4KFDA 4LSOA 3WA2X 4HM4B 1N5HA 2F98A 2SBLA 5EQLA 1STDA 3QK9A 4JRFA 2CWTA 2W2CA 4AEQA 2W04A 2XEPA 5AIGA 1QAKA 5IEOA 2XR8B 1VQ83 1NDOB 3T8UA 3U97A 5BVBA 4LZIA 4RZMA 1YJN3 3HI7A 4NHFA 3NV0B 1M1K4 2I9WA 1OPYA 1JKGB 1JV2B 4FCZA 4H3UA 3MSOA 3UB1A 4MEIA 3CCQ3 2E2VA 1N8R4 3GRDA 1IVVA 4G1MB 3PGBA 3PZWA 1YIJ3 3DZLA 2P38A 3H3HA 4IT7A 2CG1A 1A2VA 4N6TA 2HMJB 3N54B 1O7WB 2BNGA 2JDIH 1U5OA 2PNCA 3CCM3 3SOYA 3NUVA 1OF5A 1OHOA 1ZO2A 1IV9A 4IPBA 3S28A 1EG9B 3X42A 2K0MA 4Q53A 1TIJA 3WODG 1AV4A 5JPPA 2XSHB 1RKYA 1IT7A 1N8QA 1SIHA 3NBBA 4FCMA 5EVHA 5IG4A 3X3ZA 5BXQA 1W6GA 2BT3A 2CKFB 2BMOB 4K61A 1G96A 3EN8A 2XRXB 3B8LA 1TFOA 3JVCA 4BTYA 3G0KA 5ELJA 3UNLA 2F99A 1A2KA 4H61A 1O7MB 3RGRA 3IPTA 4J9AA 1RJOA 3FCSB 5ELUA 3T8NA 3DMCA 1TUHA 3FG1A 1MNLA 1NWWA 1M904 1Q7Y4 5FGOA 3F8XA 3MG2A 4OVMA 4R4KA 4O2HA 1QVF2 3D9RA 4OUQA 1WQLB 5AYSC 3EHCA 2IA7A 1W01A 1HKXA 3QRDA 3OW22 1Q40B 3NBJA 1UUVB 2W03A 2D1WA 1D6ZA 2CW9A 3EB8A 3K63A 2XH9A 3CCE3 2F86B 3WOFB 3CCL3 1NO3A 2IMJA 5IG5A 1QAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR0 A;  3H51 A;  3SOA A;  4R9K A;  1UUW B;  4LEH A;  3EBY A;  4I4K A;  3MKI A;  3DUK A;  1C7H A;  3SED A;  2UX0 A;  5KP1 A;  3RGA A;  3LZA A;  2RGQ A;  3I0Y A;  2OWP A;  1W00 A;  5IG0 A;  4CDL A;  2Z76 A;  4J8T A;  1JB4 A;  3G8Z A;  1OHP A;  4HZ9 B;  3F7S A;  3KKG A;  3OV4 A;  4HM7 B;  5D81 A;  3NHX A;  3EN1 B;  1TP6 A;  1OGX A;  3OXA A;  1BUQ A;  2QGU A;  1Q40 A;  4HVN A;  4HM0 B;  5IG3 A;  1DMM A;  2YFL B;  3ER7 A;  3BLZ A;  5TGN A;  3MG1 A;  2JQ5 A;  1O7N B;  4FCJ A;  3VGN A;  3CNX A;  2CHC A;  3EX9 A;  3HX8 A;  4L8P A;  3GWR A;  4HZB B;  5IF6 A;  3E99 A;  1ULI B;  4XBT A;  3KE7 A;  2B24 B;  1DMQ A;  3FKA A;  3JUO A;  3JUN A;  1S5A A;  3EC9 A;  3GZR A;  4R1K A;  2XSO B;  4R9L A;  1GY7 A;  5KP3 A;  3LYG A;  5FW5 A;  4HM8 B;  1QJG A;  3OWU A;  3NBR A;  3ECF A;  2GBX B;  5HGR A;  1GS3 A;  3UJM A;  7STD A;  3MYT A;  3KSP A;  5DRE A;  3F14 A;  3NV0 A;  1W02 A;  4IIA A;  3BB9 A;  4XBX A;  5CF1 A;  2R4I A;  1ASK A;  1JKG A;  6STD A;  2INX A;  2YFJ B;  1JB5 A;  1E3R A;  3GZB A;  2GBW B;  4HM2 B;  2RCD A;  4HM1 B;  1EA2 A;  1SJW A;  4STD A;  4L8O A;  3EBT A;  4MJD A;  1ULJ B;  2HMO B;  4LMI A;  1QMA A;  1OF5 B;  3EJV A;  3JUM A;  3FSD A;  3GZX B;  5IER A;  3DXO A;  1OH0 A;  3K0Z A;  4XDW A;  2HML B;  2Z77 A;  3OWS A;  2YFI B;  4N3V A;  1JN5 B;  3G16 A;  4WP5 A;  4XDV A;  4XBY A;  5D82 A;  3F7X A;  3F40 A;  4HJL B;  4K1V A;  4WWU C;  4KVH A;  1Q42 A;  3KZT A;  1OGZ A;  5CXO A;  3CU3 A;  2GEY A;  2HMN B;  1O7G B;  3EF8 A;  3GZY B;  1OUN A;  3HZP A;  3DM8 A;  5CK6 A;  3OX9 A;  3B7C A;  3M8C A;  2HMM B;  3S5C A;  3MG3 A;  1O7H B;  4XM4 A;  3B4P A;  1CQS A;  2RFR A;  2GXF A;  3F8H A;  3NXJ A;  4XB5 A;  5AIF A;  5STD A;  1O7P B;  3VSY A;  5CF2 A;  3FF2 A;  1OHS A;  4HM5 B;  1K41 A;  3FLJ A;  5D83 A;  1IDP A;  5AII A;  3CNM A;  3EQQ B;  1ISK A;  1NU3 A;  5DRV A;  5IEN A;  4X2H A;  1GY5 A;  5AEU B;  4WYK B;  1JN5 A;  3NM2 A;  4HM3 B;  4PEJ A;  2K54 A;  3FF0 A;  4HKV B;  3STD A;  2BMQ B;  4HM6 B;  1DMN A;  4GB5 A;  3B4O A;  3A76 A;  5AI1 A;  1W6Y A;  3JUQ A;  5CLK A;  4LGQ A;  5AEW B;  2BMR B;  3FH1 A;  3Q90 A;  5G2G A;  4K1U A;  8CHO A;  1VZZ A;  1GY6 A;  1ZX2 A;  3F9S A;  3CPO A;  1E97 A;  3JUP A;  1OCV A;  3FZW A;  5AIH A;  2HMK B;  1Z1S A;  2A15 A;  1JB2 A;  5IEP A;  2GEX A;  4ORL A;  3FGY A;  3OWY A;  3HK4 A;  5JPU A;  5KP4 A;  4X2O A;  2STD A;  3ROB A;  3MHE A;  3WMD A;  2Z7A A;  4U13 A;  4WYK A;  1E3V A;  2B1X B;  3K7C A;  1GYB A;  2PZV A;  2QIY A;  4L7K A;  4HM4 B;  2F98 A;  1STD A;  2W2C A;  5AIG A;  5IEO A;  2XR8 B;  1NDO B;  3T8U A;  5BVB A;  4RZM A;  3NV0 B;  2I9W A;  1OPY A;  1JKG B;  4H3U A;  3MSO A;  3GRD A;  3DZL A;  3H3H A;  2HMJ B;  1O7W B;  2BNG A;  1U5O A;  3SOY A;  3NUV A;  1OF5 A;  1OHO A;  1ZO2 A;  1EG9 B;  5JPP A;  4Q53 A;  2XSH B;  5IG4 A;  5EVH A;  4FCM A;  5BXQ A;  2CKF B;  2BMO B;  3EN8 A;  2XRX B;  3B8L A;  3G0K A;  3UNL A;  2F99 A;  1A2K A;  1O7M B;  3RGR A;  3IPT A;  4J9A A;  3T8N A;  3DMC A;  1TUH A;  1NWW A;  3F8X A;  3MG2 A;  4OVM A;  3D9R A;  4OUQ A;  1WQL B;  3EHC A;  1W01 A;  1HKX A;  1Q40 B;  1UUV B;  2F86 B;  2IMJ A;  5IG5 A; 
#chains in the Genus database with same CATH topology
 1AR0 A;  3H51 A;  3SOA A;  4N6L A;  1I70 A;  1B2M A;  2BU4 A;  3LH4 A;  4R9K A;  3DGN A;  1UUW B;  4LEH A;  3AHS A;  4WHA A;  2CWU A;  2O9U X;  3EBY A;  2R41 A;  2KF6 A;  4I4K A;  3MKI A;  3HIG A;  1TRQ A;  1DET A;  3DUK A;  1BUJ A;  1C7H A;  1K9M 4;  4EBG A;  4QWT A;  3ALA A;  3SED A;  3A5E A;  1X1U A;  1IVX A;  1N9E A;  3CCJ 3;  1SAR A;  3SYU A;  2UX0 A;  1K73 4;  1VQ6 3;  3KN4 A;  2W9P A;  5KP1 A;  2RBI A;  2ZDJ A;  3X3X A;  1LVN A;  3VF1 A;  1WMN A;  2CFL A;  3PYJ A;  1LOY A;  2XFS A;  1I3F A;  5M18 A;  1VQP 3;  4OK0 A;  3RGA A;  2E2T A;  3LZA A;  3NQZ A;  4RBN A;  1VQQ A;  2RGQ A;  1X1X A;  3I0Y A;  2OWP A;  1RNT A;  4GL6 A;  1W00 A;  4KFF A;  1GD3 A;  5LC6 A;  2F56 A;  5IG0 A;  3CME 3;  4CDL A;  4EV2 A;  2OTJ 3;  2Z76 A;  4J8T A;  1JB4 A;  3G8Z A;  1OHP A;  4HZ9 B;  1K28 A;  1BRG A;  7RNT A;  1KSI A;  1VQ5 3;  3CXC 2;  3DGM A;  3F7S A;  1B21 A;  1W7C A;  4AKY A;  2M7O A;  3PS8 A;  3KKG A;  1WTH A;  4BL3 A;  2D42 A;  3OV4 A;  3I56 3;  1W5Z A;  4HM7 B;  3RNT A;  3URP A;  4FMD A;  5D81 A;  1T3B A;  3NHX A;  3EN1 B;  3IJE B;  3N9H A;  1T2I A;  3D5G A;  1K8A 4;  1DVC A;  1V57 A;  1W4N A;  3KFQ C;  3ZG5 A;  4ZM8 A;  3S27 A;  2KF5 A;  2ZL8 A;  3G71 3;  1TP6 A;  1NJI 4;  3DGO A;  1LNH A;  1SII A;  1OGX A;  3OXA A;  1BUQ A;  3BIR A;  1BSB A;  4NRE A;  4AKZ A;  2QGU A;  1B2U A;  3S67 A;  1Q40 A;  3CPW 2;  1DE3 A;  2XGL A;  1PFP A;  1MWR A;  1A90 A;  2W56 A;  1G0T A;  5BU4 A;  3DH2 A;  4HVN A;  1QAL A;  4FMC A;  4J5K A;  1GOU A;  4HM0 B;  1NB5 I;  1I2E A;  3G6E 3;  5IG3 A;  1DMM A;  3LTA A;  4WFO A;  1PY3 A;  1PYL A;  1EEJ A;  2FXT A;  2YFL B;  3ER7 A;  1FUW A;  3BLZ A;  3UL5 A;  1JZO A;  5TGN A;  5EEO A;  1W6C A;  3BNB A;  4EW5 A;  1KWI A;  3MG1 A;  4O02 B;  2RNT A;  2JQ5 A;  1O7N B;  1LQM B;  2OOV C;  2CH9 A;  2W9Q A;  1I2G A;  4FCJ A;  1DVD A;  1MGW A;  4RNZ A;  1AVL A;  1D6Y A;  1Q7H A;  3G4S 3;  4J5G A;  3VGN A;  1RSN A;  3CNX A;  3CC4 3;  2CWV A;  3SXX A;  1BRS A;  1RN7 A;  2CHC A;  2SAR A;  3EX9 A;  3HX8 A;  1BVI A;  3S29 A;  4L8P A;  1IVU A;  2O3O A;  1UI7 A;  1BU4 A;  3BNE A;  1VQN 3;  1BIR A;  3GWR A;  4I5Q A;  1MOL A;  1QVG 2;  2FGT A;  3V99 A;  2Q07 A;  1BRI A;  4HZB B;  1OAC A;  1YGW A;  3D3L A;  3K5T A;  3MPH A;  1U8C B;  1A2P A;  5IF6 A;  3E99 A;  1BNE A;  1ULI B;  4XBT A;  1Q82 4;  3WR2 A;  1B2X A;  3K9M C;  5G1L A;  3KE7 A;  2BO9 B;  1VQO 3;  2B24 B;  1LOW A;  1RCK A;  2V1L A;  1DMQ A;  3FKA A;  3JUO A;  3JUN A;  1EKM A;  1WMO A;  3LTD A;  3CC7 3;  1UDI I;  1S5A A;  3TDG A;  1G02 A;  1RRH A;  5GSP A;  3X40 A;  3EC9 A;  4HOH A;  1FUS A;  2L4V A;  3GZR A;  4R1K A;  2XSO B;  4R9L A;  1GY7 A;  3KSE D;  2P05 A;  5KP3 A;  3Q3F A;  3LYG A;  5FW5 A;  4TX4 A;  1HU9 A;  4HM8 B;  2E2U A;  3V92 A;  1QJG A;  3OWU A;  3V98 A;  3NBR A;  1VQK 3;  3UL6 A;  4CPK A;  2AAD A;  1NNV A;  3ECF A;  3FG3 A;  1BGS A;  2GBX B;  1EUI C;  9RNT A;  5HGR A;  1TFK A;  1GS3 A;  1L5G B;  4EYC A;  3UJM A;  2LQV A;  1FGQ A;  7STD A;  1GOV A;  3KSP A;  1HYF A;  3MYT A;  1YI2 3;  1KD1 4;  1TJD A;  8RNT A;  1JNQ A;  5DRE A;  2Z6B A;  3F14 A;  1GMP A;  1W02 A;  2CFW A;  3BB9 A;  3NV0 A;  2BHM A;  4HBR A;  4IIA A;  5M1A A;  4XBX A;  5CF1 A;  2R4I A;  4N6M A;  1ASK A;  2CG0 A;  1JKG A;  6STD A;  4KFE A;  1D6U A;  2INX A;  1VQM 3;  2YFJ B;  1JB5 A;  1E3R A;  3GZB A;  2GBW B;  1RGG A;  4HM2 B;  2RCD A;  4HM1 B;  2L1S A;  1EA2 A;  1UCK A;  2OOV A;  1Q81 4;  3D79 A;  1SJW A;  3X41 A;  1BNF A;  2LYX A;  3CC2 3;  4RNY A;  4STD A;  5AYR B;  1MWT A;  1MWU A;  1SPU A;  1EQK A;  3KII A;  1CH0 A;  1TU5 A;  4L8O A;  1YHQ 3;  3EBT A;  3LXU X;  3DGL A;  1RMS A;  4MJD A;  1ULJ B;  2RSX A;  4MMX B;  2HMO B;  2KRT A;  3PCS A;  1UI8 A;  4FMA A;  3SLU A;  5RNT A;  1RGC A;  4LMI A;  3L0R A;  1QMA A;  1OF5 B;  3EJV A;  3GSP A;  3JUM A;  4JF8 A;  3FSD A;  4FMB A;  1CYU A;  3GZX B;  5M19 A;  3CCR 3;  3LTB A;  1YJW 3;  5IER A;  1JJ2 2;  4N6O B;  2CFD A;  1B2S A;  3IMA B;  3DXO A;  4LYL B;  1OH0 A;  3K0Z A;  2WO0 A;  4XDW A;  1IK3 A;  2HML B;  2Z77 A;  3OWS A;  2YFI B;  4N3V A;  1JN5 B;  5LC7 A;  2WOH A;  2CK3 H;  1FGT A;  4HAA A;  3NM7 A;  3NX0 A;  3G16 A;  1JBR A;  4WP5 A;  4XDV A;  4FR9 A;  2OQE C;  2CFK A;  4BTX A;  1W2Z A;  1GOY A;  1I2F A;  4XBY A;  5D82 A;  3F7X A;  1W2B 2;  3F40 A;  1YGE A;  4HJL B;  1IQX A;  4K1V A;  3LT9 A;  4WWU C;  1R4C A;  2C11 A;  1ROA A;  2MF7 A;  1BNJ A;  2MC8 A;  4KVH A;  1Q42 A;  2J8X B;  2CIU A;  3KZT A;  6RNT A;  1OGZ A;  4BL2 A;  1VQL 3;  1MWS A;  3BND A;  3D4A A;  1S72 3;  3ZFZ A;  1IQ8 A;  4O8S A;  5CXO A;  3WOE B;  3CU3 A;  2K3D A;  1AQZ A;  1LOV A;  2GEY A;  3CCV 3;  2HMN B;  1O7G B;  3EF8 A;  1NB3 I;  3GZY B;  1VQ4 3;  2F5W A;  2XGN A;  1OUN A;  1T2H A;  2QEX 3;  3AGN A;  2QA4 3;  3HZP A;  1IQY A;  3DM8 A;  3LTC A;  1V58 A;  1FGM A;  2Y74 A;  5CK6 A;  1IYY A;  3OX9 A;  1IT8 A;  2CX1 A;  2ML6 A;  3B7C A;  1FYS A;  3M8C A;  1ZS7 A;  2HMM B;  3S5C A;  1Q86 4;  3MG3 A;  3T0U A;  1O7H B;  1CEW I;  4XM4 A;  3RDE A;  4GHO A;  1WNH A;  3SX1 A;  3B4P A;  1CQS A;  2RFR A;  2UUG C;  3HII A;  6GSP A;  2GXF A;  3F8H A;  3NXJ A;  1YJ9 3;  1VQ9 3;  2WGQ A;  2F4Y A;  3CD6 3;  2Y73 A;  1DYU A;  2CFG A;  2IUK A;  4XB5 A;  5AIF A;  5STD A;  1Y4K A;  1IV7 A;  1O7P B;  1FGO A;  1AVK A;  3KCH A;  1RGF A;  1GD4 A;  1TTO A;  2UGI A;  3VSY A;  5CF2 A;  4BIR A;  3FF2 A;  2KXG A;  4N6V 0;  2FNQ A;  1OHS A;  3CCU 3;  1TRP A;  3AMO B;  4HM5 B;  1K41 A;  3FLJ A;  1FGR A;  5D83 A;  1IDP A;  3LT8 A;  1BRK A;  5AII A;  3CNM A;  3EQQ B;  3ZG0 A;  1ISK A;  3Q2P A;  1NU3 A;  5DRV A;  5IEN A;  4X2H A;  3DGY A;  3MWZ A;  1BNR A;  1GY5 A;  1BAO A;  1LRA A;  1US1 A;  2P09 A;  2CC3 A;  2W6J H;  2ZHX B;  5AEU B;  2WGO A;  4WYK B;  1JN5 A;  4CCV A;  5BIR A;  2ML5 A;  1RGL A;  3NM2 A;  4EXR A;  2OQE A;  4HM3 B;  1UW1 A;  3I55 3;  4BTW A;  4MMZ B;  4PEJ A;  1YIT 3;  1BSA A;  4HYZ A;  3X3Y A;  1BSC A;  2H0G A;  4K90 B;  2K54 A;  3BNC A;  1UCL A;  3FF0 A;  4HKV B;  3STD A;  2BMQ B;  1WMP A;  2KCD A;  4HM6 B;  1DMN A;  1UUG B;  2WOF A;  3B4O A;  3FG4 A;  4GB5 A;  3A76 A;  4N6N B;  1B3S A;  1VQ7 3;  1C54 A;  2P0M A;  2XFT A;  5AI1 A;  1W6Y A;  2W56 B;  3JUQ A;  3DY5 A;  1IU7 A;  5CLK A;  4LGQ A;  4KZ1 A;  1AY7 A;  1N9J A;  5AEW B;  1UCI A;  2IUJ A;  2BMR B;  3J7Y d;  1Q9E A;  3HOH A;  3FH1 A;  3Q90 A;  5G2G A;  4K1U A;  1I0X A;  1LNI A;  1CYV A;  1A67 A;  8CHO A;  1VZZ A;  4KT3 B;  3LML A;  4BU4 A;  1GY6 A;  1FA3 A;  1GMR A;  1BOX A;  3O8Y A;  3NQY A;  1ZX2 A;  2IYJ A;  3F9S A;  4EV5 A;  1I0V A;  1KQS 2;  1RDS A;  1FUT A;  3CPO A;  1YNV X;  3N8B A;  1E97 A;  3EE1 A;  2YX9 A;  3JUP A;  2P0X A;  3LOY A;  1M9G A;  1OCV A;  3FZW A;  3Q1C A;  4NPB A;  1KC8 4;  1FZU A;  3PCR A;  5IW9 A;  5AIH A;  1MGR A;  1UCJ A;  2GU3 A;  2HMK B;  1RTU A;  1Z1S A;  1STF I;  1M1X B;  2OCT A;  3AGO A;  2A15 A;  1LXE A;  1BSE A;  1JB2 A;  5JBS A;  1JRQ A;  3CMA 3;  5IEP A;  2XF3 A;  2OTL 3;  2GEX A;  1RGA A;  5I97 A;  1FW7 A;  5A0O B;  4ORL A;  1UGI A;  1PU4 A;  3FGY A;  3OWY A;  1LOX A;  1BAN A;  1BRH A;  3D5I A;  1BRJ A;  3HK4 A;  4N6U A;  1RRL A;  3CCS 3;  5JPU A;  3SVA A;  1IVW A;  2IY2 A;  1F8N A;  3AMO A;  5KP4 A;  4X2O A;  2KF3 A;  2STD A;  2HOH A;  1R4Y A;  1J2B A;  3ROB A;  2C10 A;  1UGH I;  3MHE A;  3WMD A;  2ZA4 A;  2H0I A;  1GMQ A;  1SQW A;  2Z7A A;  4U13 A;  1RGH A;  1JBS A;  1HZ1 A;  3GAX A;  4EC6 A;  1B27 A;  4WYK A;  1E3V A;  1X1Y A;  2B1X B;  1N5P A;  1YVB I;  2GU1 A;  3K7C A;  1ROV A;  2BIR A;  3PXM A;  2W0Q A;  2KAA A;  4MMY B;  4R80 A;  5G1K A;  3WDG B;  1GYB A;  2PZV A;  3WHO A;  1RNB A;  3U1W A;  1V74 A;  2QIY A;  4O3V A;  4L7K A;  1T5Y A;  4KFD A;  4LSO A;  3WA2 X;  4HM4 B;  1N5H A;  2F98 A;  2SBL A;  5EQL A;  1STD A;  1YVS A;  2AAE A;  1I3I A;  3QK9 A;  2CWT A;  2W2C A;  4JRF A;  4AEQ A;  2W04 A;  2XEP A;  5AIG A;  1QAK A;  2CX0 A;  2GSP A;  5IEO A;  2XR8 B;  1VQ8 3;  1B20 A;  1RGK A;  1NDO B;  3T8U A;  3U97 A;  5BVB A;  4LZI A;  4RZM A;  1YJN 3;  3HI7 A;  1JZD A;  1BNS A;  3NV0 B;  4NHF A;  1M1K 4;  1RN4 A;  2I9W A;  1LQG C;  1OPY A;  1JKG B;  1JV2 B;  4FCZ A;  4H3U A;  5HOH A;  3MSO A;  3UB1 A;  4MEI A;  3CCQ 3;  2E2V A;  1RHL A;  1N8R 4;  3GRD A;  1IVV A;  4G1M B;  3PGB A;  3PZW A;  2F5M A;  3DZL A;  2P38 A;  3H3H A;  4IT7 A;  2CG1 A;  1YIJ 3;  1A2V A;  4N6T A;  2HMJ B;  3N54 B;  1O7W B;  2BNG A;  2JDI H;  4RNT A;  1U5O A;  2PNC A;  2H0H A;  3CCM 3;  3SOY A;  3NUV A;  3WA3 A;  1OF5 A;  1OHO A;  1ZO2 A;  1IV9 A;  4IPB A;  3S28 A;  1RGE A;  1EG9 B;  1BNI A;  3X42 A;  2K0M A;  4Q53 A;  1TIJ A;  3WOD G;  1AV4 A;  4DKI A;  5JPP A;  1BSD A;  2XSH B;  7GSP A;  1RKY A;  1IT7 A;  1N8Q A;  1SIH A;  3NBB A;  4FCM A;  4ILF A;  5EVH A;  5IG4 A;  3X3Z A;  5BXQ A;  1W6G A;  2BT3 A;  2CKF B;  2BMO B;  1BNG A;  1I8V A;  4K61 A;  1G96 A;  3EN8 A;  2XRX B;  3B8L A;  1TFO A;  3JVC A;  4BTY A;  1GSP A;  3G0K A;  5ELJ A;  3UNL A;  2F99 A;  3AHW A;  2C4B A;  1A2K A;  4H61 A;  1O7M B;  3RGR A;  3IPT A;  4GSP A;  4J9A A;  1RJO A;  3FCS B;  5ELU A;  3T8N A;  3DMC A;  1TUH A;  3FG1 A;  1MNL A;  1NWW A;  4CJN A;  1RN1 A;  1M90 4;  1Q7Y 4;  5FGO A;  3F8X A;  1RLS A;  1JBT A;  3MG2 A;  4OVM A;  4R4K A;  4O2H A;  1QVF 2;  3D9R A;  4OUQ A;  1WQL B;  5AYS C;  3EHC A;  2IA7 A;  1W01 A;  1HKX A;  1RCL A;  3QRD A;  1ZGX A;  1Q40 B;  3NBJ A;  3OW2 2;  1UUV B;  2W03 A;  1B2Z A;  2D1W A;  1D6Z A;  1BRN L;  2CW9 A;  3EB8 A;  3K63 A;  2KF4 A;  2XH9 A;  3CCE 3;  2F86 B;  1X1W A;  3WOF B;  3CCL 3;  1NO3 A;  2IMJ A;  3BU4 A;  5IG5 A;  1QAF A; 
#chains in the Genus database with same CATH homology
 1AR0 A;  3H51 A;  3SOA A;  4N6L A;  3LH4 A;  4R9K A;  3DGN A;  1UUW B;  4LEH A;  4WHA A;  2CWU A;  2O9U X;  3EBY A;  4I4K A;  3MKI A;  3HIG A;  3DUK A;  1C7H A;  1K9M 4;  4EBG A;  4QWT A;  3ALA A;  3SED A;  1IVX A;  1N9E A;  3CCJ 3;  2UX0 A;  1K73 4;  1VQ6 3;  3KN4 A;  2W9P A;  5KP1 A;  2ZDJ A;  3X3X A;  1LVN A;  3VF1 A;  1WMN A;  2CFL A;  3PYJ A;  2XFS A;  1VQP 3;  4OK0 A;  3RGA A;  2E2T A;  3LZA A;  3NQZ A;  4RBN A;  2RGQ A;  3I0Y A;  2OWP A;  4GL6 A;  4KFF A;  1W00 A;  5LC6 A;  1GD3 A;  3CME 3;  5IG0 A;  4CDL A;  4EV2 A;  2OTJ 3;  2Z76 A;  4J8T A;  1JB4 A;  3G8Z A;  1OHP A;  4HZ9 B;  1K28 A;  1KSI A;  1VQ5 3;  3CXC 2;  3DGM A;  3F7S A;  1W7C A;  4AKY A;  2M7O A;  3PS8 A;  3KKG A;  1WTH A;  2D42 A;  3OV4 A;  3I56 3;  1W5Z A;  4HM7 B;  4FMD A;  5D81 A;  3NHX A;  3EN1 B;  3IJE B;  3N9H A;  1K8A 4;  1DVC A;  1W4N A;  3KFQ C;  4ZM8 A;  3S27 A;  2ZL8 A;  3G71 3;  1TP6 A;  1NJI 4;  3DGO A;  1LNH A;  1SII A;  1OGX A;  3OXA A;  1BUQ A;  4NRE A;  4AKZ A;  2QGU A;  3S67 A;  3CPW 2;  1Q40 A;  2XGL A;  1PFP A;  1A90 A;  2W56 A;  4HVN A;  1NB5 I;  1QAL A;  4FMC A;  4HM0 B;  3G6E 3;  5IG3 A;  1DMM A;  3LTA A;  4WFO A;  2FXT A;  2YFL B;  3ER7 A;  1FUW A;  3BLZ A;  3UL5 A;  5TGN A;  5EEO A;  1W6C A;  3BNB A;  1KWI A;  3MG1 A;  4O02 B;  2JQ5 A;  1O7N B;  2OOV C;  2W9Q A;  2CH9 A;  1DVD A;  4FCJ A;  4RNZ A;  1AVL A;  1D6Y A;  3G4S 3;  3VGN A;  3CNX A;  3CC4 3;  2CWV A;  3SXX A;  1RN7 A;  2CHC A;  3EX9 A;  3HX8 A;  3S29 A;  4L8P A;  1IVU A;  2O3O A;  1UI7 A;  3BNE A;  1VQN 3;  3GWR A;  1MOL A;  1QVG 2;  2FGT A;  3V99 A;  2Q07 A;  4HZB B;  1OAC A;  3D3L A;  3K5T A;  3MPH A;  1U8C B;  5IF6 A;  3E99 A;  1ULI B;  4XBT A;  1Q82 4;  3K9M C;  3KE7 A;  2BO9 B;  1VQO 3;  2B24 B;  2V1L A;  1DMQ A;  3FKA A;  3JUO A;  3JUN A;  1EKM A;  1WMO A;  3LTD A;  3CC7 3;  1S5A A;  3TDG A;  1RRH A;  3X40 A;  3EC9 A;  2L4V A;  3GZR A;  4R1K A;  2XSO B;  4R9L A;  1GY7 A;  3KSE D;  2P05 A;  5KP3 A;  3LYG A;  5FW5 A;  4TX4 A;  1HU9 A;  4HM8 B;  2E2U A;  3V92 A;  1QJG A;  3OWU A;  3V98 A;  3NBR A;  1VQK 3;  3UL6 A;  3ECF A;  3FG3 A;  2GBX B;  5HGR A;  1TFK A;  1GS3 A;  1L5G B;  4EYC A;  3UJM A;  2LQV A;  1FGQ A;  7STD A;  3MYT A;  3KSP A;  1YI2 3;  1KD1 4;  1JNQ A;  5DRE A;  2Z6B A;  3F14 A;  3NV0 A;  1W02 A;  2CFW A;  3BB9 A;  4HBR A;  2BHM A;  4IIA A;  3WA3 A;  4XBX A;  5CF1 A;  2R4I A;  4N6M A;  1ASK A;  2CG0 A;  1JKG A;  6STD A;  4KFE A;  1D6U A;  2INX A;  1VQM 3;  2YFJ B;  1JB5 A;  1E3R A;  3GZB A;  2GBW B;  4HM2 B;  2RCD A;  4HM1 B;  1EA2 A;  2OOV A;  1Q81 4;  3X41 A;  1SJW A;  2LYX A;  3CC2 3;  4RNY A;  4STD A;  5AYR B;  1SPU A;  1EQK A;  3KII A;  1TU5 A;  4L8O A;  1YHQ 3;  3EBT A;  3LXU X;  3DGL A;  4MJD A;  1ULJ B;  2RSX A;  4MMX B;  2HMO B;  2KRT A;  3PCS A;  1UI8 A;  4FMA A;  3SLU A;  4LMI A;  3L0R A;  1QMA A;  1OF5 B;  3EJV A;  3JUM A;  4JF8 A;  3FSD A;  4FMB A;  1CYU A;  3GZX B;  3CCR 3;  3LTB A;  1YJW 3;  5IER A;  1JJ2 2;  4N6O B;  2CFD A;  3IMA B;  3DXO A;  1OH0 A;  3K0Z A;  2WO0 A;  4XDW A;  1IK3 A;  2HML B;  2Z77 A;  3OWS A;  2YFI B;  4N3V A;  1JN5 B;  5LC7 A;  2WOH A;  2CK3 H;  1FGT A;  3NM7 A;  3NX0 A;  3G16 A;  4WP5 A;  4XDV A;  4FR9 A;  2OQE C;  2CFK A;  4BTX A;  1W2Z A;  4XBY A;  5D82 A;  3F7X A;  1W2B 2;  3F40 A;  1YGE A;  4HJL B;  1IQX A;  4K1V A;  3LT9 A;  4WWU C;  1R4C A;  2C11 A;  1ROA A;  2MF7 A;  2MC8 A;  4KVH A;  1Q42 A;  2CIU A;  3KZT A;  1OGZ A;  1VQL 3;  3BND A;  1S72 3;  1IQ8 A;  4O8S A;  5CXO A;  3WOE B;  3CU3 A;  3CCV 3;  2GEY A;  2HMN B;  1O7G B;  3EF8 A;  1NB3 I;  3GZY B;  1VQ4 3;  2XGN A;  1OUN A;  2QEX 3;  2QA4 3;  3HZP A;  1IQY A;  3DM8 A;  3LTC A;  1FGM A;  2Y74 A;  5CK6 A;  3OX9 A;  1IT8 A;  2ML6 A;  3B7C A;  3M8C A;  2HMM B;  3S5C A;  1Q86 4;  3MG3 A;  3T0U A;  1O7H B;  1CEW I;  4XM4 A;  3RDE A;  1WNH A;  3SX1 A;  3B4P A;  1CQS A;  2RFR A;  3HII A;  2GXF A;  3F8H A;  3NXJ A;  1YJ9 3;  1VQ9 3;  2WGQ A;  3CD6 3;  2Y73 A;  1DYU A;  2CFG A;  2IUK A;  4XB5 A;  5AIF A;  5STD A;  1Y4K A;  1IV7 A;  1O7P B;  1FGO A;  1AVK A;  3VSY A;  1GD4 A;  5CF2 A;  3FF2 A;  2KXG A;  4N6V 0;  2FNQ A;  1OHS A;  3CCU 3;  3AMO B;  4HM5 B;  1K41 A;  3FLJ A;  1FGR A;  5D83 A;  1IDP A;  3LT8 A;  5AII A;  3CNM A;  3EQQ B;  1ISK A;  3Q2P A;  1NU3 A;  5DRV A;  5IEN A;  4X2H A;  3MWZ A;  1GY5 A;  1US1 A;  2P09 A;  5AEU B;  2W6J H;  2CC3 A;  2WGO A;  4WYK B;  1JN5 A;  4CCV A;  2ML5 A;  3NM2 A;  4EXR A;  2OQE A;  4HM3 B;  1UW1 A;  3I55 3;  4BTW A;  4MMZ B;  4PEJ A;  1YIT 3;  4HYZ A;  3X3Y A;  4K90 B;  2K54 A;  3BNC A;  3FF0 A;  4HKV B;  3STD A;  2BMQ B;  1WMP A;  2KCD A;  4HM6 B;  1DMN A;  3FG4 A;  2WOF A;  3B4O A;  4GB5 A;  4N6N B;  3A76 A;  1VQ7 3;  2P0M A;  2XFT A;  5AI1 A;  1W6Y A;  2W56 B;  3JUQ A;  3DY5 A;  1IU7 A;  5CLK A;  4LGQ A;  4KZ1 A;  1N9J A;  5AEW B;  2IUJ A;  3J7Y d;  2BMR B;  3FH1 A;  3Q90 A;  5G2G A;  4K1U A;  1CYV A;  1A67 A;  8CHO A;  1VZZ A;  3LML A;  1FA3 A;  1GY6 A;  3O8Y A;  3NQY A;  1ZX2 A;  4EV5 A;  3F9S A;  1KQS 2;  3CPO A;  3N8B A;  1E97 A;  3EE1 A;  2YX9 A;  3JUP A;  2P0X A;  3LOY A;  1M9G A;  1OCV A;  3FZW A;  3Q1C A;  1KC8 4;  3PCR A;  5IW9 A;  5AIH A;  2GU3 A;  2OCT A;  2HMK B;  1STF I;  1Z1S A;  1M1X B;  5JBS A;  1LXE A;  2A15 A;  1JB2 A;  1JRQ A;  3CMA 3;  5IEP A;  2XF3 A;  2OTL 3;  2GEX A;  5I97 A;  5A0O B;  4ORL A;  1PU4 A;  3FGY A;  3OWY A;  1LOX A;  3HK4 A;  4N6U A;  1RRL A;  3CCS 3;  5JPU A;  3SVA A;  1IVW A;  1F8N A;  3AMO A;  5KP4 A;  4X2O A;  2STD A;  1J2B A;  3ROB A;  2C10 A;  3MHE A;  3WMD A;  1SQW A;  2Z7A A;  4U13 A;  3GAX A;  4EC6 A;  4WYK A;  1E3V A;  2B1X B;  1N5P A;  1YVB I;  2GU1 A;  3K7C A;  1ROV A;  3PXM A;  4R80 A;  2W0Q A;  4MMY B;  3WDG B;  1GYB A;  2PZV A;  3U1W A;  1V74 A;  2QIY A;  4O3V A;  4L7K A;  1T5Y A;  4KFD A;  4LSO A;  3WA2 X;  4HM4 B;  1N5H A;  2F98 A;  2SBL A;  5EQL A;  1STD A;  3QK9 A;  4JRF A;  2CWT A;  2W2C A;  4AEQ A;  2W04 A;  2XEP A;  5AIG A;  1QAK A;  5IEO A;  2XR8 B;  1VQ8 3;  1NDO B;  3T8U A;  3U97 A;  5BVB A;  4LZI A;  4RZM A;  1YJN 3;  3HI7 A;  4NHF A;  3NV0 B;  1M1K 4;  2I9W A;  1OPY A;  1JKG B;  1JV2 B;  4FCZ A;  4H3U A;  3MSO A;  3UB1 A;  4MEI A;  3CCQ 3;  2E2V A;  1N8R 4;  3GRD A;  1IVV A;  4G1M B;  3PGB A;  3PZW A;  1YIJ 3;  3DZL A;  2P38 A;  3H3H A;  4IT7 A;  2CG1 A;  1A2V A;  4N6T A;  2HMJ B;  3N54 B;  1O7W B;  2BNG A;  2JDI H;  1U5O A;  2PNC A;  3CCM 3;  3SOY A;  3NUV A;  1OF5 A;  1OHO A;  1ZO2 A;  1IV9 A;  4IPB A;  3S28 A;  1EG9 B;  3X42 A;  2K0M A;  4Q53 A;  1TIJ A;  3WOD G;  1AV4 A;  5JPP A;  2XSH B;  1RKY A;  1IT7 A;  1N8Q A;  1SIH A;  3NBB A;  4FCM A;  5EVH A;  5IG4 A;  3X3Z A;  5BXQ A;  1W6G A;  2BT3 A;  2CKF B;  2BMO B;  4K61 A;  1G96 A;  3EN8 A;  2XRX B;  3B8L A;  1TFO A;  3JVC A;  4BTY A;  3G0K A;  5ELJ A;  3UNL A;  2F99 A;  1A2K A;  4H61 A;  1O7M B;  3RGR A;  3IPT A;  4J9A A;  1RJO A;  3FCS B;  5ELU A;  3T8N A;  3DMC A;  1TUH A;  3FG1 A;  1MNL A;  1NWW A;  1M90 4;  1Q7Y 4;  5FGO A;  3F8X A;  3MG2 A;  4OVM A;  4R4K A;  4O2H A;  1QVF 2;  3D9R A;  4OUQ A;  1WQL B;  5AYS C;  3EHC A;  2IA7 A;  1W01 A;  1HKX A;  3QRD A;  3OW2 2;  1Q40 B;  3NBJ A;  1UUV B;  2W03 A;  2D1W A;  1D6Z A;  2CW9 A;  3EB8 A;  3K63 A;  2XH9 A;  3CCE 3;  2F86 B;  3WOF B;  3CCL 3;  1NO3 A;  2IMJ A;  5IG5 A;  1QAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...