1YJ93

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yj9300
3CXC2 1VQ93 3CCM3 3OW22 1VQO3 1Q864 3G713 1VQM3 3CD63 1Q824 1KC84 3CCQ3 1K734 3I563 1VQK3 1KD14 1YJN3 1VQ83 1S723 1VQN3 1NJI4 1Q814 1K9M4 1QVF2 3CCR3 1YIT3 3CCV3 3CC43 3CCL3 1QVG2 1VQ53 1W2B2 2OTJ3 1YJ93 1YI23 1YHQ3 3CC23 3CCS3 3I553 1VQ43 1N8R4 1M904 3CPW2 1VQ73 3G4S3 3G6E3 3CC73 1YIJ3 1YJW3 1JJ22 3CMA3 2OTL3 1VQ63 3CCJ3 1VQP3 1VQL3 2QEX3 1Q7Y4 1M1K4 2QA43 1KQS2 3CCE3 3CCU3 3CME3 1K8A4
chains in the Genus database with same CATH superfamily
1FGOA 2RNTA 4EYCA 1I8VA 1KC84 1BSEA 3MHEA 1PFPA 2BT3A 1D6YA 1BU4A 3B8LA 3GRDA 3JUOA 1UCKA 4N6LA 2GBXB 3RNTA 1BNGA 3X42A 2IYJA 5IEPA 3OXAA 2OTJ3 1ROAA 1O7WB 3K9MC 1OF5A 1C54A 1KSIA 2Z77A 3EJVA 1I2EA 4K90B 3T8UA 3URPA 1M904 1DVCA 3MG2A 1GY5A 3HIGA 2C11A 2HMJB 4KFEA 1VQL3 2CW9A 1RMSA 3HX8A 1MWTA 2RSXA 2OQEC 3AHWA 5G2GA 6GSPA 1N9EA 5HOHA 5STDA 4L8PA 5FGOA 4KZ1A 3G8ZA 1STFI 4MJDA 1GY7A 2XFSA 5BIRA 5AEUB 1TRQA 4GL6A 1YJN3 1E3RA 3GZXB 4H3UA 2K3DA 2P38A 1BNFA 1A90A 1YNVX 3ALAA 1B2ZA 1RKYA 3H3HA 1IV7A 1VQ53 3LTCA 1B3SA 1YHQ3 1G96A 1MWRA 1YVSA 1UCIA 3IPTA 1N8R4 5AIGA 1OGXA 3BNBA 3FF0A 3KKGA 4HVNA 4MEIA 3CPW2 3Q3FA 1JB5A 5D82A 5IG0A 3FZWA 1JV2B 2LYXA 1W01A 2I9WA 2K0MA 3B4PA 5IW9A 2W2CA 1VQP3 1BRIA 3RGAA 3HK4A 2GEXA 1M1K4 2J8XB 4EBGA 2WGOA 1Q824 5CF1A 1MGRA 2BMOB 2UGIA 4J9AA 4JRFA 1EQKA 1V74A 2ML5A 2O9UX 1SARA 3PS8A 3LT9A 2W56A 1YIT3 3Q1CA 3AGOA 2SARA 4N6NB 2KXGA 1HZ1A 1AVLA 2A15A 1A2VA 1RGFA 4NPBA 2JDIH 2K54A 1FGTA 2BNGA 1GOUA 1TRPA 3G4S3 2RBIA 1TP6A 2W04A 2FNQA 3SOAA 1VZZA 1JZDA 1O7MB 1RLSA 1BVIA 1BRSA 4MMXB 4WYKA 2GBWB 3CU3A 3X41A 1A2PA 3AGNA 1LNIA 3LOYA 4KFDA 3D4AA 1I3IA 1W6CA 2FGTA 3CNMA 3LXUX 1QAKA 2IY2A 3A5EA 4O2HA 3ZG5A 1VQ93 3SEDA 2MC8A 2B1XB 3NV0A 3CNXA 4XDVA 2L1SA 3WA3A 1EKMA 1NNVA 5FW5A 5RNTA 2OOVC 5IF6A 4BL3A 1RRLA 2M7OA 1K28A 4TX4A 1PU4A 1JZOA 1GD4A 1RCLA 3KE7A 1JBSA 1UUWB 3BU4A 5IG4A 3PGBA 3A76A 4WP5A 3NXJA 1O7PB 2CH9A 5KP3A 1BANA 1M1XB 2XSOB 8CHOA 3ZG0A 5BXQA 2HOHA 1JN5A 4FCJA 3QRDA 1IYYA 1X1YA 1FYSA 1YJW3 2OTL3 2CX1A 4HJLB 2L4VA 4HM0B 3EBYA 2HMLB 4LSOA 1D6ZA 2E2VA 4HM2B 1DMNA 1BUJA 4I5QA 1HYFA 1YGWA 3UL5A 4CJNA 1Z1SA 1IVWA 1CQSA 4IT7A 3X3YA 1OF5B 1S723 3K7CA 1IK3A 3E99A 1VQQA 4Q53A 2HMNB 1TJDA 2CKFB 2UUGC 1O7HB 1GMRA 3OX9A 1NB5I 1W5ZA 3SLUA 4IIAA 1D6UA 2KF4A 2Z7AA 2W0QA 4KFFA 3PCRA 3EF8A 3GZYB 1K41A 4RNYA 1ULJB 4L7KA 5GSPA 1L5GB 2IMJA 2WOFA 2UX0A 4XBYA 2RGQA 4L8OA 4DKIA 3NQYA 1BNIA 3K63A 2QEX3 3LTDA 2IUJA 1Q42A 4MMYB 1W7CA 4R4KA 1IV9A 1U5OA 2YX9A 1SJWA 3CXC2 3JUPA 1O7GB 3EB8A 1JBRA 2ZL8A 3N9HA 2HMKB 3WOEB 3NX0A 3D5GA 6RNTA 3STDA 1IT8A 3FGYA 2P0XA 3U97A 3UL6A 1UI7A 3CCV3 2YFIB 4JF8A 3RGRA 2HMOB 1BRKA 1BRNL 4FMBA 6STDA 2CWTA 2C4BA 1I2FA 5IG5A 2LQVA 3KZTA 1UI8A 3CCS3 2XSHB 1LXEA 4LYLB 1OGZA 1BNEA 4N6V0 5EVHA 1JB4A 5D81A 2F99A 5TGNA 4AKYA 1YIJ3 3SX1A 3ECFA 5BU4A 1BRHA 3LTAA 5CK6A 4HM8B 4BU4A 1BIRA 3FCSB 4HM4B 1I2GA 2H0GA 2W56B 3DXOA 3I563 3S27A 1VQK3 1BNRA 1CEWI 5AYSC 1RGHA 2P09A 5JPPA 2WOHA 1W6GA 2OQEA 1WMOA 1RGGA 1RN4A 2F5WA 4LZIA 3GWRA 1BSBA 3JVCA 1FGQA 2SBLA 1YJ93 1Q40A 4WYKB 1QJGA 4FMCA 1IQXA 4R9KA 1RNTA 3GSPA 1PY3A 2XGNA 3DGYA 1B20A 5CXOA 2E2TA 3G0KA 4I4KA 2H0HA 3NV0B 4GSPA 1KWIA 7STDA 4N6UA 1O7NB 2JQ5A 1V57A 3HOHA 1GOVA 3MWZA 2RFRA 3OW22 3F7SA 1WMNA 3CD63 3LZAA 1IQYA 4FCMA 2F56A 4HYZA 2OCTA 3D5IA 3DMCA 3S29A 1AR0A 1WQLB 2CFDA 2PZVA 1LOXA 3LYGA 4KVHA 4O8SA 1K9M4 1JN5B 1PYLA 3DUKA 1UUGB 1RGAA 1ULIB 2Q07A 4EV5A 1ZO2A 1FGRA 4G1MB 1RGCA 1I70A 1GYBA 2BMQB 3ER7A 3FLJA 1AY7A 4J8TA 1ROVA 1TFOA 1SPUA 3JUQA 2YFJB 3N8BA 3F40A 4RBNA 3CPOA 1RGKA 1SIHA 1OHPA 1W2ZA 1FUWA 1B2UA 3MG1A 2QGUA 1OHOA 2GSPA 3WDGB 2QA43 1CYUA 1EUIC 2AAEA 1I3FA 1WMPA 3MG3A 4LMIA 1N8QA 3LH4A 3S28A 3LMLA 1VQO3 1BSAA 1UGHI 3G713 3EHCA 1R4YA 1LOWA 2AADA 1SIIA 3WMDA 5M18A 1TU5A 1QALA 3KCHA 1TIJA 2ZA4A 1VQN3 2HMMB 4FMAA 1NJI4 1A67A 1CH0A 4O02B 3N54B 2XR8B 4HKVB 4R9LA 1QVG2 4NHFA 1OPYA 3VF1A 1DE3A 1ZGXA 2B24B 3LTBA 3WR2A 2GEYA 4OVMA 1YI23 4EW5A 5IENA 2O3OA 3L0RA 3NBBA 2OOVA 1C7HA 1T2IA 1US1A 4STDA 3OWUA 3T0UA 1W6YA 3NM2A 8RNTA 4AEQA 1BSCA 4K61A 1UW1A 1DYUA 1RRHA 3I0YA 4WFOA 3RDEA 3V92A 3SXXA 1UGIA 5BVBA 3EN8A 2BIRA 4HAAA 3CME3 1K8A4 2BHMA 1UUVB 4RNTA 1DMMA 2F86B 1Q864 3EN1B 4K1VA 5EEOA 4CCVA 3CCQ3 1BGSA 4ILFA 1NWWA 2FXTA 3OWYA 3GZBA 2W9QA 1Y4KA 5KP4A 1NO3A 3NUVA 1FGMA 1FZUA 1RTUA 2WO0A 3CCL3 1BRJA 5DRVA 2CWUA 3J7Yd 1N9JA 3MYTA 4BTWA 2P0MA 2ML6A 1I0VA 2STDA 2XGLA 3D79A 2XH9A 1JBTA 3CC73 5D83A 1ZS7A 4GB5A 5G1KA 1VQ63 1JKGA 3NQZA 4LGQA 2CFLA 2E2UA 1A2KA 7GSPA 1Q7HA 3F14A 2CFGA 2F4YA 1GSPA 4X2OA 3X40A 2OWPA 1MGWA 3BNEA 1VQM3 1TTOA 3EE1A 1SQWA 3D9RA 2R4IA 1BUQA 1LQGC 4BTXA 2IUKA 4BIRA 1Q40B 3B7CA 5HGRA 3AMOA 4O3VA 3FG3A 3F8XA 3ROBA 2INXA 3VGNA 2PNCA 3Q90A 3DGMA 1RGLA 3OWSA 3CC43 1LRAA 3MPHA 1IQ8A 3DH2A 1UDII 1JB2A 2GXFA 4QWTA 4OK0A 4U13A 1NB3I 1QAFA 5CLKA 4CDLA 3V98A 4FCZA 2BO9B 3DGLA 3NBJA 5AIHA 1X1XA 4WWUC 1GD3A 1JJ22 1X1WA 2CX0A 2CFKA 2KCDA 2CIUA 5IG3A 1KQS2 2H0IA 2CC3A 5DREA 3F8HA 1RDSA 1HU9A 1RHLA 3FG1A 3KSED 3CCM3 2MF7A 3EX9A 1RN1A 3WA2X 1X1UA 3NHXA 3BNDA 3QK9A 4N6OB 4HOHA 4X2HA 1KD14 1G0TA 3B4OA 4H61A 3O8YA 1ZX2A 2BMRB 4NREA 1LVNA 2XRXB 3FH1A 3UNLA 2CG0A 5A0OB 1GS3A 3WHOA 1E97A 2YFLB 3H51A 3HIIA 3F7XA 1Q9EA 1W00A 1EA2A 4XM4A 4EXRA 1V58A 3CC23 1B21A 1EEJA 1B2SA 3Q2PA 1BSDA 3AHSA 2V1LA 3PYJA 3SYUA 5AIIA 1S5AA 1VQ73 1T5YA 1N5PA 5AI1A 1M9GA 2C10A 4RNZA 1RN7A 1BAOA 4OUQA 3EBTA 4IPBA 3CMA3 2W6JH 4AKZA 5ELJA 1W4NA 1F8NA 3IJEB 3X3ZA 1GMPA 1OUNA 3UJMA 1RCKA 3KN4A 1IU7A 3SVAA 1VQ83 1LOVA 1JRQA 1GY6A 1N5HA 1QVF2 2KRTA 2R41A 1R4CA 1W02A 1IVUA 1YGEA 2CHCA 5AIFA 2KF3A 3OV4A 4EV2A 4K1UA 2F5MA 4R1KA 1MNLA 3FG4A 1QMAA 7RNTA 4HBRA 4XBTA 2Z6BA 1AV4A 1G02A 2CFWA 4R80A 2Y74A 4FMDA 4MMZB 4CPKA 3EC9A 1Q7Y4 5IEOA 2D1WA 1BNJA 2IA7A 3KIIA 2QIYA 2CWVA 1DVDA 2ZDJA 3MSOA 1FA3A 1AVKA 3FKAA 5LC6A 2XEPA 5CF2A 1MWUA 1IDPA 4J5KA 5LC7A 1STDA 2D42A 3WODG 3KFQC 1Q814 1GOYA 1UCLA 2RCDA 1RNBA 1T2HA 3CCR3 5AEWB 3TDGA 4HM7B 1BOXA 3F9SA 1EG9B 3WOFB 1W2B2 5AYRB 9RNTA 1JKGB 2ZHXB 4N6MA 1OCVA 1WNHA 2XFTA 3U1WA 2F98A 3G16A 3PCSA 1LNHA 5M1AA 3IMAB 3I553 3K5TA 3EQQB 1GMQA 4HM6B 1FW7A 1IVXA 3VSYA 4HZBB 1UCJA 4LEHA 3S5CA 3HZPA 1OH0A 3BIRA 3S67A 2CK3H 3AMOB 4BTYA 1B2XA 3SOYA 4ORLA 2WGQA 2KF5A 3BLZA 3M8CA 4ZM8A 3BB9A 3ZFZA 2GU1A 4GHOA 3DM8A 1FUTA 3DGOA 4WHAA 1TFKA 5JBSA 3NBRA 4RZMA 1BNSA 1YVBI 2W03A 4XDWA 5G1LA 4HM3B 1AQZA 4HM5B 1OHSA 1ISKA 1JNQA 3G6E3 3JUMA 2BU4A 2W9PA 5KP1A 3CCJ3 1RJOA 2Y73A 3GZRA 1VQ43 3UB1A 3X3XA 1CYVA 3FF2A 3T8NA 3CCE3 1T3BA 3CCU3 1I0XA 1DMQA 2GU3A 4BL2A 1LQMB 2KF6A 3DGNA 4FR9A 3GAXA 1NDOB 1K734 4N3VA 1B27A 4HM1B 3PXMA 1J2BA 5IERA 3K0ZA 4EC6A 1IT7A 3FSDA 3NM7A 3PZWA 4PEJA 4XBXA 1E3VA 4HZ9B 1TUHA 2P05A 3DY5A 1LOYA 5I97A 1ASKA 1BRGA 1NU3A 1IVVA 3BNCA 5ELUA 3V99A 5EQLA 5M19A 1RGEA 1OACA 1HKXA 2Z76A 3DZLA 3LT8A 3MKIA 3JUNA 1U8CB 4KT3B 5JPUA 3D3LA 4J5GA 2KAAA 4XB5A 1MOLA 3KSPA 3HI7A 1B2MA 1RSNA 1WTHA 2XF3A 2CG1A 1DETA 1FUSA 4N6TA 1MWSA
chains in the Genus database with same CATH topology
1FGOA 4EYCA 1KC84 3MHEA 1PFPA 2BT3A 1D6YA 3B8LA 3GRDA 3JUOA 4N6LA 2GBXB 3X42A 5IEPA 3OXAA 2OTJ3 1ROAA 1O7WB 3K9MC 1OF5A 1KSIA 2Z77A 3EJVA 4K90B 3T8UA 1M904 1DVCA 3MG2A 1GY5A 3HIGA 2C11A 2HMJB 4KFEA 1VQL3 2CW9A 3HX8A 2RSXA 2OQEC 5G2GA 1N9EA 5STDA 4L8PA 5FGOA 4KZ1A 3G8ZA 1STFI 4MJDA 1GY7A 2XFSA 5AEUB 4GL6A 1YJN3 1E3RA 3GZXB 4H3UA 2P38A 1A90A 3ALAA 1RKYA 1VQ53 3H3HA 1IV7A 3LTCA 1YHQ3 1G96A 3IPTA 1N8R4 5AIGA 1OGXA 3BNBA 3FF0A 3KKGA 4HVNA 4MEIA 3CPW2 1JB5A 5D82A 5IG0A 3FZWA 1JV2B 2LYXA 1W01A 2I9WA 2K0MA 3B4PA 5IW9A 2W2CA 1VQP3 3RGAA 3HK4A 2GEXA 1M1K4 4EBGA 2WGOA 1Q824 5CF1A 2BMOB 4J9AA 4JRFA 1EQKA 1V74A 2ML5A 2O9UX 3PS8A 3LT9A 2W56A 1YIT3 3Q1CA 4N6NB 2KXGA 1AVLA 2A15A 1A2VA 2JDIH 2K54A 1FGTA 2BNGA 3G4S3 1TP6A 2W04A 2FNQA 3SOAA 1VZZA 1O7MB 4MMXB 4WYKA 2GBWB 3CU3A 3X41A 4KFDA 3LOYA 1W6CA 2FGTA 3CNMA 3LXUX 1QAKA 4O2HA 1VQ93 3SEDA 2MC8A 2B1XB 3NV0A 3CNXA 4XDVA 3WA3A 1EKMA 5FW5A 2OOVC 5IF6A 1RRLA 2M7OA 1K28A 4TX4A 1PU4A 1GD4A 3KE7A 1UUWB 5IG4A 3PGBA 3A76A 4WP5A 3NXJA 1O7PB 2CH9A 5KP3A 1M1XB 2XSOB 8CHOA 5BXQA 1JN5A 4FCJA 3QRDA 1YJW3 2OTL3 4HJLB 2L4VA 4HM0B 3EBYA 2HMLB 4LSOA 1D6ZA 2E2VA 4HM2B 1DMNA 3UL5A 1Z1SA 1IVWA 1CQSA 4IT7A 3X3YA 1OF5B 1S723 3K7CA 1IK3A 3E99A 4Q53A 2HMNB 2CKFB 1O7HB 3OX9A 1NB5I 1W5ZA 3SLUA 4IIAA 1D6UA 2Z7AA 2W0QA 4KFFA 3PCRA 3EF8A 3GZYB 1K41A 4RNYA 1ULJB 4L7KA 1L5GB 2IMJA 2WOFA 2UX0A 4XBYA 2RGQA 4L8OA 3NQYA 3K63A 2QEX3 3LTDA 2IUJA 1Q42A 4MMYB 1W7CA 4R4KA 1IV9A 1U5OA 2YX9A 1SJWA 3CXC2 3JUPA 1O7GB 3EB8A 2ZL8A 3N9HA 2HMKB 3WOEB 3NX0A 3STDA 1IT8A 3FGYA 2P0XA 3U97A 3UL6A 1UI7A 3CCV3 2YFIB 4JF8A 3RGRA 2HMOB 4FMBA 6STDA 2CWTA 5IG5A 2LQVA 3KZTA 1UI8A 3CCS3 2XSHB 1LXEA 1OGZA 4N6V0 5EVHA 1JB4A 5D81A 2F99A 5TGNA 4AKYA 1YIJ3 3SX1A 3ECFA 3LTAA 5CK6A 4HM8B 3FCSB 4HM4B 2W56B 3DXOA 3I563 3S27A 1VQK3 1CEWI 5AYSC 2P09A 5JPPA 2WOHA 1W6GA 2OQEA 1WMOA 4LZIA 3GWRA 3JVCA 1FGQA 2SBLA 1YJ93 1Q40A 4WYKB 1QJGA 4FMCA 1IQXA 4R9KA 2XGNA 5CXOA 2E2TA 3G0KA 4I4KA 3NV0B 1KWIA 7STDA 4N6UA 1O7NB 2JQ5A 3MWZA 2RFRA 3OW22 3F7SA 1WMNA 3CD63 3LZAA 1IQYA 4FCMA 4HYZA 2OCTA 3DMCA 3S29A 1AR0A 1WQLB 2CFDA 2PZVA 1LOXA 3LYGA 4KVHA 4O8SA 1K9M4 1JN5B 3DUKA 1ULIB 2Q07A 4EV5A 1ZO2A 1FGRA 4G1MB 1GYBA 2BMQB 3ER7A 3FLJA 1DVDA 4J8TA 1ROVA 1TFOA 1SPUA 3JUQA 2YFJB 3N8BA 3F40A 4RBNA 3CPOA 1FUWA 1SIHA 1OHPA 1W2ZA 3MG1A 2QGUA 1OHOA 3WDGB 2QA43 1CYUA 4LMIA 1WMPA 3MG3A 3S28A 1N8QA 3LH4A 3LMLA 1VQO3 3G713 3EHCA 1SIIA 3WMDA 1TU5A 1QALA 1TIJA 1VQN3 2HMMB 4FMAA 1NJI4 1A67A 4O02B 3N54B 2XR8B 4HKVB 4R9LA 1QVG2 4NHFA 1OPYA 3VF1A 1YI23 2B24B 3LTBA 2GEYA 4OVMA 5IENA 2O3OA 3L0RA 3NBBA 2OOVA 1C7HA 1US1A 4STDA 3OWUA 3T0UA 1W6YA 3NM2A 4AEQA 4WFOA 4K61A 1UW1A 1DYUA 1RRHA 3I0YA 3RDEA 3V92A 3SXXA 5BVBA 3EN8A 3CME3 1K8A4 2BHMA 1UUVB 1DMMA 2F86B 1Q864 3EN1B 4K1VA 5EEOA 4CCVA 3CCQ3 1NWWA 2FXTA 3OWYA 3GZBA 2W9QA 1Y4KA 5KP4A 1NO3A 3NUVA 1FGMA 2WO0A 3CCL3 5DRVA 2CWUA 3J7Yd 1N9JA 3MYTA 4BTWA 2P0MA 2ML6A 2STDA 2XGLA 2XH9A 3CC73 5D83A 4GB5A 1VQ63 1JKGA 3NQZA 4LGQA 2CFLA 2E2UA 1A2KA 3F14A 2CFGA 4X2OA 3X40A 2OWPA 3BNEA 1VQM3 3EE1A 1BUQA 1SQWA 3D9RA 2R4IA 4BTXA 2IUKA 1Q40B 3B7CA 5HGRA 3AMOA 4O3VA 3FG3A 3F8XA 3ROBA 2INXA 3VGNA 2PNCA 3Q90A 3DGMA 3OWSA 3CC43 3MPHA 1IQ8A 4QWTA 1JB2A 2GXFA 4U13A 4OK0A 5CLKA 1NB3I 1QAFA 4CDLA 3V98A 4FCZA 2BO9B 3DGLA 3NBJA 5AIHA 1JJ22 4WWUC 1GD3A 2CFKA 2KCDA 2CIUA 5IG3A 1KQS2 5DREA 2CC3A 3F8HA 1HU9A 3FG1A 3KSED 3CCM3 2MF7A 3EX9A 3WA2X 3NHXA 3BNDA 3QK9A 4N6OB 4X2HA 1KD14 3B4OA 4H61A 3O8YA 1ZX2A 2BMRB 4NREA 1LVNA 2XRXB 3FH1A 3UNLA 2CG0A 5A0OB 1GS3A 1E97A 2YFLB 3H51A 3HIIA 3F7XA 1W00A 1EA2A 4XM4A 4EXRA 3CC23 3Q2PA 3PYJA 2V1LA 5AIIA 1S5AA 1VQ73 1T5YA 1N5PA 5AI1A 1M9GA 2C10A 4RNZA 1RN7A 4OUQA 3EBTA 4IPBA 3CMA3 2W6JH 4AKZA 5ELJA 1W4NA 1F8NA 3IJEB 3X3ZA 1OUNA 3UJMA 3KN4A 1IU7A 3SVAA 1VQ83 1JRQA 1GY6A 1N5HA 1QVF2 2KRTA 1R4CA 1W02A 1IVUA 1YGEA 2CHCA 5AIFA 3OV4A 4EV2A 4K1UA 4R1KA 1MNLA 3FG4A 1QMAA 4HBRA 4XBTA 2Z6BA 1AV4A 2CFWA 4R80A 2Y74A 4FMDA 4MMZB 3EC9A 1Q7Y4 5IEOA 2D1WA 2IA7A 3KIIA 2QIYA 2CWVA 2ZDJA 3MSOA 1FA3A 1AVKA 3FKAA 5LC6A 2XEPA 5CF2A 1IDPA 5LC7A 1STDA 2D42A 3WODG 3KFQC 1Q814 2RCDA 3CCR3 5AEWB 3TDGA 4HM7B 3F9SA 3WOFB 1EG9B 1W2B2 5AYRB 1JKGB 4N6MA 1OCVA 1WNHA 2XFTA 3U1WA 2F98A 3G16A 3PCSA 1LNHA 3I553 3IMAB 3K5TA 3EQQB 4HM6B 1IVXA 3VSYA 4HZBB 4LEHA 3S5CA 3HZPA 1OH0A 3S67A 2CK3H 3AMOB 4BTYA 3SOYA 4ORLA 2WGQA 3BLZA 3M8CA 4ZM8A 3BB9A 2GU1A 3DM8A 3DGOA 4WHAA 1TFKA 5JBSA 3NBRA 4RZMA 1YVBI 2W03A 4XDWA 4HM3B 4HM5B 1OHSA 1ISKA 1JNQA 3G6E3 3JUMA 2W9PA 5KP1A 3CCJ3 1RJOA 2Y73A 3GZRA 1VQ43 3UB1A 3X3XA 1CYVA 3FF2A 3T8NA 3CCE3 3CCU3 1DMQA 2GU3A 3DGNA 4FR9A 3GAXA 1NDOB 1K734 4N3VA 4HM1B 1J2BA 3PXMA 5IERA 3K0ZA 4EC6A 1IT7A 3FSDA 3NM7A 3PZWA 4PEJA 4XBXA 1E3VA 4HZ9B 1TUHA 2P05A 3DY5A 5I97A 1ASKA 1NU3A 5ELUA 1IVVA 3BNCA 3V99A 5EQLA 3LT8A 1OACA 1HKXA 2Z76A 3DZLA 3MKIA 5JPUA 3JUNA 1U8CB 3D3LA 4XB5A 1MOLA 3KSPA 3HI7A 1WTHA 2XF3A 2CG1A 4N6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC 2;  1VQ9 3;  3CCM 3;  3OW2 2;  1VQO 3;  1Q86 4;  3G71 3;  1VQM 3;  3CD6 3;  1Q82 4;  1KC8 4;  3CCQ 3;  1K73 4;  3I56 3;  1VQK 3;  1KD1 4;  1YJN 3;  1VQ8 3;  1S72 3;  1VQN 3;  1NJI 4;  1Q81 4;  1K9M 4;  1QVF 2;  3CCR 3;  1YIT 3;  3CCV 3;  3CC4 3;  3CCL 3;  1QVG 2;  1VQ5 3;  1W2B 2;  2OTJ 3;  1YJ9 3;  1YI2 3;  1YHQ 3;  3CC2 3;  3CCS 3;  3I55 3;  1VQ4 3;  1N8R 4;  1M90 4;  3CPW 2;  1VQ7 3;  3G4S 3;  3G6E 3;  3CC7 3;  1YIJ 3;  1YJW 3;  1JJ2 2;  3CMA 3;  2OTL 3;  1VQ6 3;  3CCJ 3;  1VQP 3;  1VQL 3;  2QEX 3;  1Q7Y 4;  1M1K 4;  2QA4 3;  1KQS 2;  3CCE 3;  3CCU 3;  3CME 3;  1K8A 4; 
#chains in the Genus database with same CATH topology
 1FGO A;  2RNT A;  4EYC A;  1I8V A;  1KC8 4;  1BSE A;  3MHE A;  1PFP A;  2BT3 A;  1D6Y A;  1BU4 A;  3B8L A;  3GRD A;  3JUO A;  1UCK A;  4N6L A;  2GBX B;  3RNT A;  1BNG A;  3X42 A;  2IYJ A;  5IEP A;  3OXA A;  2OTJ 3;  1ROA A;  1O7W B;  3K9M C;  1OF5 A;  1C54 A;  1KSI A;  2Z77 A;  3EJV A;  1I2E A;  4K90 B;  3T8U A;  3URP A;  1M90 4;  1DVC A;  3MG2 A;  1GY5 A;  3HIG A;  2C11 A;  2HMJ B;  4KFE A;  1VQL 3;  2CW9 A;  1RMS A;  3HX8 A;  1MWT A;  2RSX A;  2OQE C;  3AHW A;  5G2G A;  6GSP A;  1N9E A;  5HOH A;  5STD A;  4L8P A;  5FGO A;  4KZ1 A;  3G8Z A;  1STF I;  4MJD A;  1GY7 A;  2XFS A;  5BIR A;  5AEU B;  1TRQ A;  4GL6 A;  1YJN 3;  1E3R A;  3GZX B;  4H3U A;  2K3D A;  2P38 A;  1BNF A;  1A90 A;  1YNV X;  3ALA A;  1B2Z A;  1RKY A;  3H3H A;  1IV7 A;  1VQ5 3;  3LTC A;  1B3S A;  1YHQ 3;  1G96 A;  1MWR A;  1YVS A;  1UCI A;  3IPT A;  1N8R 4;  5AIG A;  1OGX A;  3BNB A;  3FF0 A;  3KKG A;  4HVN A;  4MEI A;  3CPW 2;  3Q3F A;  1JB5 A;  5D82 A;  5IG0 A;  3FZW A;  1JV2 B;  2LYX A;  1W01 A;  2I9W A;  2K0M A;  3B4P A;  5IW9 A;  2W2C A;  1VQP 3;  1BRI A;  3RGA A;  3HK4 A;  2GEX A;  1M1K 4;  2J8X B;  4EBG A;  2WGO A;  1Q82 4;  5CF1 A;  1MGR A;  2BMO B;  2UGI A;  4J9A A;  4JRF A;  1EQK A;  1V74 A;  2ML5 A;  2O9U X;  1SAR A;  3PS8 A;  3LT9 A;  2W56 A;  1YIT 3;  3Q1C A;  3AGO A;  2SAR A;  4N6N B;  2KXG A;  1HZ1 A;  1AVL A;  2A15 A;  1A2V A;  1RGF A;  4NPB A;  2JDI H;  2K54 A;  1FGT A;  2BNG A;  1GOU A;  1TRP A;  3G4S 3;  2RBI A;  1TP6 A;  2W04 A;  2FNQ A;  3SOA A;  1VZZ A;  1JZD A;  1O7M B;  1RLS A;  1BVI A;  1BRS A;  4MMX B;  4WYK A;  2GBW B;  3CU3 A;  3X41 A;  1A2P A;  3AGN A;  1LNI A;  3LOY A;  4KFD A;  3D4A A;  1I3I A;  1W6C A;  2FGT A;  3CNM A;  3LXU X;  1QAK A;  2IY2 A;  3A5E A;  4O2H A;  3ZG5 A;  1VQ9 3;  3SED A;  2MC8 A;  2B1X B;  3NV0 A;  3CNX A;  4XDV A;  2L1S A;  3WA3 A;  1EKM A;  1NNV A;  5FW5 A;  5RNT A;  2OOV C;  5IF6 A;  4BL3 A;  1RRL A;  2M7O A;  1K28 A;  4TX4 A;  1PU4 A;  1JZO A;  1GD4 A;  1RCL A;  3KE7 A;  1JBS A;  1UUW B;  3BU4 A;  5IG4 A;  3PGB A;  3A76 A;  4WP5 A;  3NXJ A;  1O7P B;  2CH9 A;  5KP3 A;  1BAN A;  1M1X B;  2XSO B;  8CHO A;  3ZG0 A;  5BXQ A;  2HOH A;  1JN5 A;  4FCJ A;  3QRD A;  1IYY A;  1X1Y A;  1FYS A;  1YJW 3;  2OTL 3;  2CX1 A;  4HJL B;  2L4V A;  4HM0 B;  3EBY A;  2HML B;  4LSO A;  1D6Z A;  2E2V A;  4HM2 B;  1DMN A;  1BUJ A;  4I5Q A;  1HYF A;  1YGW A;  3UL5 A;  4CJN A;  1Z1S A;  1IVW A;  1CQS A;  4IT7 A;  3X3Y A;  1OF5 B;  1S72 3;  3K7C A;  1IK3 A;  3E99 A;  1VQQ A;  4Q53 A;  2HMN B;  1TJD A;  2CKF B;  2UUG C;  1O7H B;  1GMR A;  3OX9 A;  1NB5 I;  1W5Z A;  3SLU A;  4IIA A;  1D6U A;  2KF4 A;  2Z7A A;  2W0Q A;  4KFF A;  3PCR A;  3EF8 A;  3GZY B;  1K41 A;  4RNY A;  1ULJ B;  4L7K A;  5GSP A;  1L5G B;  2IMJ A;  2WOF A;  2UX0 A;  4XBY A;  2RGQ A;  4L8O A;  4DKI A;  3NQY A;  1BNI A;  3K63 A;  2QEX 3;  3LTD A;  2IUJ A;  1Q42 A;  4MMY B;  1W7C A;  4R4K A;  1IV9 A;  1U5O A;  2YX9 A;  1SJW A;  3CXC 2;  3JUP A;  1O7G B;  3EB8 A;  1JBR A;  2ZL8 A;  3N9H A;  2HMK B;  3WOE B;  3NX0 A;  3D5G A;  6RNT A;  3STD A;  1IT8 A;  3FGY A;  2P0X A;  3U97 A;  3UL6 A;  1UI7 A;  3CCV 3;  2YFI B;  4JF8 A;  3RGR A;  2HMO B;  1BRK A;  1BRN L;  4FMB A;  6STD A;  2CWT A;  2C4B A;  1I2F A;  5IG5 A;  2LQV A;  3KZT A;  1UI8 A;  3CCS 3;  2XSH B;  1LXE A;  4LYL B;  1OGZ A;  1BNE A;  4N6V 0;  5EVH A;  1JB4 A;  5D81 A;  2F99 A;  5TGN A;  4AKY A;  1YIJ 3;  3SX1 A;  3ECF A;  5BU4 A;  1BRH A;  3LTA A;  5CK6 A;  4HM8 B;  4BU4 A;  1BIR A;  3FCS B;  4HM4 B;  1I2G A;  2H0G A;  2W56 B;  3DXO A;  3I56 3;  3S27 A;  1VQK 3;  1BNR A;  1CEW I;  5AYS C;  1RGH A;  2P09 A;  5JPP A;  2WOH A;  1W6G A;  2OQE A;  1WMO A;  1RGG A;  1RN4 A;  2F5W A;  4LZI A;  3GWR A;  1BSB A;  3JVC A;  1FGQ A;  2SBL A;  1YJ9 3;  1Q40 A;  4WYK B;  1QJG A;  4FMC A;  1IQX A;  4R9K A;  1RNT A;  3GSP A;  1PY3 A;  2XGN A;  3DGY A;  1B20 A;  5CXO A;  2E2T A;  3G0K A;  4I4K A;  2H0H A;  3NV0 B;  4GSP A;  1KWI A;  7STD A;  4N6U A;  1O7N B;  2JQ5 A;  1V57 A;  3HOH A;  1GOV A;  3MWZ A;  2RFR A;  3OW2 2;  3F7S A;  1WMN A;  3CD6 3;  3LZA A;  1IQY A;  4FCM A;  2F56 A;  4HYZ A;  2OCT A;  3D5I A;  3DMC A;  3S29 A;  1AR0 A;  1WQL B;  2CFD A;  2PZV A;  1LOX A;  3LYG A;  4KVH A;  4O8S A;  1K9M 4;  1JN5 B;  1PYL A;  3DUK A;  1UUG B;  1RGA A;  1ULI B;  2Q07 A;  4EV5 A;  1ZO2 A;  1FGR A;  4G1M B;  1RGC A;  1I70 A;  1GYB A;  2BMQ B;  3ER7 A;  3FLJ A;  1AY7 A;  4J8T A;  1ROV A;  1TFO A;  1SPU A;  3JUQ A;  2YFJ B;  3N8B A;  3F40 A;  4RBN A;  3CPO A;  1RGK A;  1SIH A;  1OHP A;  1W2Z A;  1FUW A;  1B2U A;  3MG1 A;  2QGU A;  1OHO A;  2GSP A;  3WDG B;  2QA4 3;  1CYU A;  1EUI C;  2AAE A;  1I3F A;  1WMP A;  3MG3 A;  4LMI A;  1N8Q A;  3LH4 A;  3S28 A;  3LML A;  1VQO 3;  1BSA A;  1UGH I;  3G71 3;  3EHC A;  1R4Y A;  1LOW A;  2AAD A;  1SII A;  3WMD A;  5M18 A;  1TU5 A;  1QAL A;  3KCH A;  1TIJ A;  2ZA4 A;  1VQN 3;  2HMM B;  4FMA A;  1NJI 4;  1A67 A;  1CH0 A;  4O02 B;  3N54 B;  2XR8 B;  4HKV B;  4R9L A;  1QVG 2;  4NHF A;  1OPY A;  3VF1 A;  1DE3 A;  1ZGX A;  2B24 B;  3LTB A;  3WR2 A;  2GEY A;  4OVM A;  1YI2 3;  4EW5 A;  5IEN A;  2O3O A;  3L0R A;  3NBB A;  2OOV A;  1C7H A;  1T2I A;  1US1 A;  4STD A;  3OWU A;  3T0U A;  1W6Y A;  3NM2 A;  8RNT A;  4AEQ A;  1BSC A;  4K61 A;  1UW1 A;  1DYU A;  1RRH A;  3I0Y A;  4WFO A;  3RDE A;  3V92 A;  3SXX A;  1UGI A;  5BVB A;  3EN8 A;  2BIR A;  4HAA A;  3CME 3;  1K8A 4;  2BHM A;  1UUV B;  4RNT A;  1DMM A;  2F86 B;  1Q86 4;  3EN1 B;  4K1V A;  5EEO A;  4CCV A;  3CCQ 3;  1BGS A;  4ILF A;  1NWW A;  2FXT A;  3OWY A;  3GZB A;  2W9Q A;  1Y4K A;  5KP4 A;  1NO3 A;  3NUV A;  1FGM A;  1FZU A;  1RTU A;  2WO0 A;  3CCL 3;  1BRJ A;  5DRV A;  2CWU A;  3J7Y d;  1N9J A;  3MYT A;  4BTW A;  2P0M A;  2ML6 A;  1I0V A;  2STD A;  2XGL A;  3D79 A;  2XH9 A;  1JBT A;  3CC7 3;  5D83 A;  1ZS7 A;  4GB5 A;  5G1K A;  1VQ6 3;  1JKG A;  3NQZ A;  4LGQ A;  2CFL A;  2E2U A;  1A2K A;  7GSP A;  1Q7H A;  3F14 A;  2CFG A;  2F4Y A;  1GSP A;  4X2O A;  3X40 A;  2OWP A;  1MGW A;  3BNE A;  1VQM 3;  1TTO A;  3EE1 A;  1SQW A;  3D9R A;  2R4I A;  1BUQ A;  1LQG C;  4BTX A;  2IUK A;  4BIR A;  1Q40 B;  3B7C A;  5HGR A;  3AMO A;  4O3V A;  3FG3 A;  3F8X A;  3ROB A;  2INX A;  3VGN A;  2PNC A;  3Q90 A;  3DGM A;  1RGL A;  3OWS A;  3CC4 3;  1LRA A;  3MPH A;  1IQ8 A;  3DH2 A;  1UDI I;  1JB2 A;  2GXF A;  4QWT A;  4OK0 A;  4U13 A;  1NB3 I;  1QAF A;  5CLK A;  4CDL A;  3V98 A;  4FCZ A;  2BO9 B;  3DGL A;  3NBJ A;  5AIH A;  1X1X A;  4WWU C;  1GD3 A;  1JJ2 2;  1X1W A;  2CX0 A;  2CFK A;  2KCD A;  2CIU A;  5IG3 A;  1KQS 2;  2H0I A;  2CC3 A;  5DRE A;  3F8H A;  1RDS A;  1HU9 A;  1RHL A;  3FG1 A;  3KSE D;  3CCM 3;  2MF7 A;  3EX9 A;  1RN1 A;  3WA2 X;  1X1U A;  3NHX A;  3BND A;  3QK9 A;  4N6O B;  4HOH A;  4X2H A;  1KD1 4;  1G0T A;  3B4O A;  4H61 A;  3O8Y A;  1ZX2 A;  2BMR B;  4NRE A;  1LVN A;  2XRX B;  3FH1 A;  3UNL A;  2CG0 A;  5A0O B;  1GS3 A;  3WHO A;  1E97 A;  2YFL B;  3H51 A;  3HII A;  3F7X A;  1Q9E A;  1W00 A;  1EA2 A;  4XM4 A;  4EXR A;  1V58 A;  3CC2 3;  1B21 A;  1EEJ A;  1B2S A;  3Q2P A;  1BSD A;  3AHS A;  2V1L A;  3PYJ A;  3SYU A;  5AII A;  1S5A A;  1VQ7 3;  1T5Y A;  1N5P A;  5AI1 A;  1M9G A;  2C10 A;  4RNZ A;  1RN7 A;  1BAO A;  4OUQ A;  3EBT A;  4IPB A;  3CMA 3;  2W6J H;  4AKZ A;  5ELJ A;  1W4N A;  1F8N A;  3IJE B;  3X3Z A;  1GMP A;  1OUN A;  3UJM A;  1RCK A;  3KN4 A;  1IU7 A;  3SVA A;  1VQ8 3;  1LOV A;  1JRQ A;  1GY6 A;  1N5H A;  1QVF 2;  2KRT A;  2R41 A;  1R4C A;  1W02 A;  1IVU A;  1YGE A;  2CHC A;  5AIF A;  2KF3 A;  3OV4 A;  4EV2 A;  4K1U A;  2F5M A;  4R1K A;  1MNL A;  3FG4 A;  1QMA A;  7RNT A;  4HBR A;  4XBT A;  2Z6B A;  1AV4 A;  1G02 A;  2CFW A;  4R80 A;  2Y74 A;  4FMD A;  4MMZ B;  4CPK A;  3EC9 A;  1Q7Y 4;  5IEO A;  2D1W A;  1BNJ A;  2IA7 A;  3KII A;  2QIY A;  2CWV A;  1DVD A;  2ZDJ A;  3MSO A;  1FA3 A;  1AVK A;  3FKA A;  5LC6 A;  2XEP A;  5CF2 A;  1MWU A;  1IDP A;  4J5K A;  5LC7 A;  1STD A;  2D42 A;  3WOD G;  3KFQ C;  1Q81 4;  1GOY A;  1UCL A;  2RCD A;  1RNB A;  1T2H A;  3CCR 3;  5AEW B;  3TDG A;  4HM7 B;  1BOX A;  3F9S A;  1EG9 B;  3WOF B;  1W2B 2;  5AYR B;  9RNT A;  1JKG B;  2ZHX B;  4N6M A;  1OCV A;  1WNH A;  2XFT A;  3U1W A;  2F98 A;  3G16 A;  3PCS A;  1LNH A;  5M1A A;  3IMA B;  3I55 3;  3K5T A;  3EQQ B;  1GMQ A;  4HM6 B;  1FW7 A;  1IVX A;  3VSY A;  4HZB B;  1UCJ A;  4LEH A;  3S5C A;  3HZP A;  1OH0 A;  3BIR A;  3S67 A;  2CK3 H;  3AMO B;  4BTY A;  1B2X A;  3SOY A;  4ORL A;  2WGQ A;  2KF5 A;  3BLZ A;  3M8C A;  4ZM8 A;  3BB9 A;  3ZFZ A;  2GU1 A;  4GHO A;  3DM8 A;  1FUT A;  3DGO A;  4WHA A;  1TFK A;  5JBS A;  3NBR A;  4RZM A;  1BNS A;  1YVB I;  2W03 A;  4XDW A;  5G1L A;  4HM3 B;  1AQZ A;  4HM5 B;  1OHS A;  1ISK A;  1JNQ A;  3G6E 3;  3JUM A;  2BU4 A;  2W9P A;  5KP1 A;  3CCJ 3;  1RJO A;  2Y73 A;  3GZR A;  1VQ4 3;  3UB1 A;  3X3X A;  1CYV A;  3FF2 A;  3T8N A;  3CCE 3;  1T3B A;  3CCU 3;  1I0X A;  1DMQ A;  2GU3 A;  4BL2 A;  1LQM B;  2KF6 A;  3DGN A;  4FR9 A;  3GAX A;  1NDO B;  1K73 4;  4N3V A;  1B27 A;  4HM1 B;  3PXM A;  1J2B A;  5IER A;  3K0Z A;  4EC6 A;  1IT7 A;  3FSD A;  3NM7 A;  3PZW A;  4PEJ A;  4XBX A;  1E3V A;  4HZ9 B;  1TUH A;  2P05 A;  3DY5 A;  1LOY A;  5I97 A;  1ASK A;  1BRG A;  1NU3 A;  1IVV A;  3BNC A;  5ELU A;  3V99 A;  5EQL A;  5M19 A;  1RGE A;  1OAC A;  1HKX A;  2Z76 A;  3DZL A;  3LT8 A;  3MKI A;  3JUN A;  1U8C B;  4KT3 B;  5JPU A;  3D3L A;  4J5G A;  2KAA A;  4XB5 A;  1MOL A;  3KSP A;  3HI7 A;  1B2M A;  1RSN A;  1WTH A;  2XF3 A;  2CG1 A;  1DET A;  1FUS A;  4N6T A;  1MWS A; 
#chains in the Genus database with same CATH homology
 1FGO A;  4EYC A;  1KC8 4;  3MHE A;  1PFP A;  2BT3 A;  1D6Y A;  3B8L A;  3GRD A;  3JUO A;  4N6L A;  2GBX B;  3X42 A;  5IEP A;  3OXA A;  2OTJ 3;  1ROA A;  1O7W B;  3K9M C;  1OF5 A;  1KSI A;  2Z77 A;  3EJV A;  4K90 B;  3T8U A;  1M90 4;  1DVC A;  3MG2 A;  1GY5 A;  3HIG A;  2C11 A;  2HMJ B;  4KFE A;  1VQL 3;  2CW9 A;  3HX8 A;  2RSX A;  2OQE C;  5G2G A;  1N9E A;  5STD A;  4L8P A;  5FGO A;  4KZ1 A;  3G8Z A;  1STF I;  4MJD A;  1GY7 A;  2XFS A;  5AEU B;  4GL6 A;  1YJN 3;  1E3R A;  3GZX B;  4H3U A;  2P38 A;  1A90 A;  3ALA A;  1RKY A;  1VQ5 3;  3H3H A;  1IV7 A;  3LTC A;  1YHQ 3;  1G96 A;  3IPT A;  1N8R 4;  5AIG A;  1OGX A;  3BNB A;  3FF0 A;  3KKG A;  4HVN A;  4MEI A;  3CPW 2;  1JB5 A;  5D82 A;  5IG0 A;  3FZW A;  1JV2 B;  2LYX A;  1W01 A;  2I9W A;  2K0M A;  3B4P A;  5IW9 A;  2W2C A;  1VQP 3;  3RGA A;  3HK4 A;  2GEX A;  1M1K 4;  4EBG A;  2WGO A;  1Q82 4;  5CF1 A;  2BMO B;  4J9A A;  4JRF A;  1EQK A;  1V74 A;  2ML5 A;  2O9U X;  3PS8 A;  3LT9 A;  2W56 A;  1YIT 3;  3Q1C A;  4N6N B;  2KXG A;  1AVL A;  2A15 A;  1A2V A;  2JDI H;  2K54 A;  1FGT A;  2BNG A;  3G4S 3;  1TP6 A;  2W04 A;  2FNQ A;  3SOA A;  1VZZ A;  1O7M B;  4MMX B;  4WYK A;  2GBW B;  3CU3 A;  3X41 A;  4KFD A;  3LOY A;  1W6C A;  2FGT A;  3CNM A;  3LXU X;  1QAK A;  4O2H A;  1VQ9 3;  3SED A;  2MC8 A;  2B1X B;  3NV0 A;  3CNX A;  4XDV A;  3WA3 A;  1EKM A;  5FW5 A;  2OOV C;  5IF6 A;  1RRL A;  2M7O A;  1K28 A;  4TX4 A;  1PU4 A;  1GD4 A;  3KE7 A;  1UUW B;  5IG4 A;  3PGB A;  3A76 A;  4WP5 A;  3NXJ A;  1O7P B;  2CH9 A;  5KP3 A;  1M1X B;  2XSO B;  8CHO A;  5BXQ A;  1JN5 A;  4FCJ A;  3QRD A;  1YJW 3;  2OTL 3;  4HJL B;  2L4V A;  4HM0 B;  3EBY A;  2HML B;  4LSO A;  1D6Z A;  2E2V A;  4HM2 B;  1DMN A;  3UL5 A;  1Z1S A;  1IVW A;  1CQS A;  4IT7 A;  3X3Y A;  1OF5 B;  1S72 3;  3K7C A;  1IK3 A;  3E99 A;  4Q53 A;  2HMN B;  2CKF B;  1O7H B;  3OX9 A;  1NB5 I;  1W5Z A;  3SLU A;  4IIA A;  1D6U A;  2Z7A A;  2W0Q A;  4KFF A;  3PCR A;  3EF8 A;  3GZY B;  1K41 A;  4RNY A;  1ULJ B;  4L7K A;  1L5G B;  2IMJ A;  2WOF A;  2UX0 A;  4XBY A;  2RGQ A;  4L8O A;  3NQY A;  3K63 A;  2QEX 3;  3LTD A;  2IUJ A;  1Q42 A;  4MMY B;  1W7C A;  4R4K A;  1IV9 A;  1U5O A;  2YX9 A;  1SJW A;  3CXC 2;  3JUP A;  1O7G B;  3EB8 A;  2ZL8 A;  3N9H A;  2HMK B;  3WOE B;  3NX0 A;  3STD A;  1IT8 A;  3FGY A;  2P0X A;  3U97 A;  3UL6 A;  1UI7 A;  3CCV 3;  2YFI B;  4JF8 A;  3RGR A;  2HMO B;  4FMB A;  6STD A;  2CWT A;  5IG5 A;  2LQV A;  3KZT A;  1UI8 A;  3CCS 3;  2XSH B;  1LXE A;  1OGZ A;  4N6V 0;  5EVH A;  1JB4 A;  5D81 A;  2F99 A;  5TGN A;  4AKY A;  1YIJ 3;  3SX1 A;  3ECF A;  3LTA A;  5CK6 A;  4HM8 B;  3FCS B;  4HM4 B;  2W56 B;  3DXO A;  3I56 3;  3S27 A;  1VQK 3;  1CEW I;  5AYS C;  2P09 A;  5JPP A;  2WOH A;  1W6G A;  2OQE A;  1WMO A;  4LZI A;  3GWR A;  3JVC A;  1FGQ A;  2SBL A;  1YJ9 3;  1Q40 A;  4WYK B;  1QJG A;  4FMC A;  1IQX A;  4R9K A;  2XGN A;  5CXO A;  2E2T A;  3G0K A;  4I4K A;  3NV0 B;  1KWI A;  7STD A;  4N6U A;  1O7N B;  2JQ5 A;  3MWZ A;  2RFR A;  3OW2 2;  3F7S A;  1WMN A;  3CD6 3;  3LZA A;  1IQY A;  4FCM A;  4HYZ A;  2OCT A;  3DMC A;  3S29 A;  1AR0 A;  1WQL B;  2CFD A;  2PZV A;  1LOX A;  3LYG A;  4KVH A;  4O8S A;  1K9M 4;  1JN5 B;  3DUK A;  1ULI B;  2Q07 A;  4EV5 A;  1ZO2 A;  1FGR A;  4G1M B;  1GYB A;  2BMQ B;  3ER7 A;  3FLJ A;  1DVD A;  4J8T A;  1ROV A;  1TFO A;  1SPU A;  3JUQ A;  2YFJ B;  3N8B A;  3F40 A;  4RBN A;  3CPO A;  1FUW A;  1SIH A;  1OHP A;  1W2Z A;  3MG1 A;  2QGU A;  1OHO A;  3WDG B;  2QA4 3;  1CYU A;  4LMI A;  1WMP A;  3MG3 A;  3S28 A;  1N8Q A;  3LH4 A;  3LML A;  1VQO 3;  3G71 3;  3EHC A;  1SII A;  3WMD A;  1TU5 A;  1QAL A;  1TIJ A;  1VQN 3;  2HMM B;  4FMA A;  1NJI 4;  1A67 A;  4O02 B;  3N54 B;  2XR8 B;  4HKV B;  4R9L A;  1QVG 2;  4NHF A;  1OPY A;  3VF1 A;  1YI2 3;  2B24 B;  3LTB A;  2GEY A;  4OVM A;  5IEN A;  2O3O A;  3L0R A;  3NBB A;  2OOV A;  1C7H A;  1US1 A;  4STD A;  3OWU A;  3T0U A;  1W6Y A;  3NM2 A;  4AEQ A;  4WFO A;  4K61 A;  1UW1 A;  1DYU A;  1RRH A;  3I0Y A;  3RDE A;  3V92 A;  3SXX A;  5BVB A;  3EN8 A;  3CME 3;  1K8A 4;  2BHM A;  1UUV B;  1DMM A;  2F86 B;  1Q86 4;  3EN1 B;  4K1V A;  5EEO A;  4CCV A;  3CCQ 3;  1NWW A;  2FXT A;  3OWY A;  3GZB A;  2W9Q A;  1Y4K A;  5KP4 A;  1NO3 A;  3NUV A;  1FGM A;  2WO0 A;  3CCL 3;  5DRV A;  2CWU A;  3J7Y d;  1N9J A;  3MYT A;  4BTW A;  2P0M A;  2ML6 A;  2STD A;  2XGL A;  2XH9 A;  3CC7 3;  5D83 A;  4GB5 A;  1VQ6 3;  1JKG A;  3NQZ A;  4LGQ A;  2CFL A;  2E2U A;  1A2K A;  3F14 A;  2CFG A;  4X2O A;  3X40 A;  2OWP A;  3BNE A;  1VQM 3;  3EE1 A;  1BUQ A;  1SQW A;  3D9R A;  2R4I A;  4BTX A;  2IUK A;  1Q40 B;  3B7C A;  5HGR A;  3AMO A;  4O3V A;  3FG3 A;  3F8X A;  3ROB A;  2INX A;  3VGN A;  2PNC A;  3Q90 A;  3DGM A;  3OWS A;  3CC4 3;  3MPH A;  1IQ8 A;  4QWT A;  1JB2 A;  2GXF A;  4U13 A;  4OK0 A;  5CLK A;  1NB3 I;  1QAF A;  4CDL A;  3V98 A;  4FCZ A;  2BO9 B;  3DGL A;  3NBJ A;  5AIH A;  1JJ2 2;  4WWU C;  1GD3 A;  2CFK A;  2KCD A;  2CIU A;  5IG3 A;  1KQS 2;  5DRE A;  2CC3 A;  3F8H A;  1HU9 A;  3FG1 A;  3KSE D;  3CCM 3;  2MF7 A;  3EX9 A;  3WA2 X;  3NHX A;  3BND A;  3QK9 A;  4N6O B;  4X2H A;  1KD1 4;  3B4O A;  4H61 A;  3O8Y A;  1ZX2 A;  2BMR B;  4NRE A;  1LVN A;  2XRX B;  3FH1 A;  3UNL A;  2CG0 A;  5A0O B;  1GS3 A;  1E97 A;  2YFL B;  3H51 A;  3HII A;  3F7X A;  1W00 A;  1EA2 A;  4XM4 A;  4EXR A;  3CC2 3;  3Q2P A;  3PYJ A;  2V1L A;  5AII A;  1S5A A;  1VQ7 3;  1T5Y A;  1N5P A;  5AI1 A;  1M9G A;  2C10 A;  4RNZ A;  1RN7 A;  4OUQ A;  3EBT A;  4IPB A;  3CMA 3;  2W6J H;  4AKZ A;  5ELJ A;  1W4N A;  1F8N A;  3IJE B;  3X3Z A;  1OUN A;  3UJM A;  3KN4 A;  1IU7 A;  3SVA A;  1VQ8 3;  1JRQ A;  1GY6 A;  1N5H A;  1QVF 2;  2KRT A;  1R4C A;  1W02 A;  1IVU A;  1YGE A;  2CHC A;  5AIF A;  3OV4 A;  4EV2 A;  4K1U A;  4R1K A;  1MNL A;  3FG4 A;  1QMA A;  4HBR A;  4XBT A;  2Z6B A;  1AV4 A;  2CFW A;  4R80 A;  2Y74 A;  4FMD A;  4MMZ B;  3EC9 A;  1Q7Y 4;  5IEO A;  2D1W A;  2IA7 A;  3KII A;  2QIY A;  2CWV A;  2ZDJ A;  3MSO A;  1FA3 A;  1AVK A;  3FKA A;  5LC6 A;  2XEP A;  5CF2 A;  1IDP A;  5LC7 A;  1STD A;  2D42 A;  3WOD G;  3KFQ C;  1Q81 4;  2RCD A;  3CCR 3;  5AEW B;  3TDG A;  4HM7 B;  3F9S A;  3WOF B;  1EG9 B;  1W2B 2;  5AYR B;  1JKG B;  4N6M A;  1OCV A;  1WNH A;  2XFT A;  3U1W A;  2F98 A;  3G16 A;  3PCS A;  1LNH A;  3I55 3;  3IMA B;  3K5T A;  3EQQ B;  4HM6 B;  1IVX A;  3VSY A;  4HZB B;  4LEH A;  3S5C A;  3HZP A;  1OH0 A;  3S67 A;  2CK3 H;  3AMO B;  4BTY A;  3SOY A;  4ORL A;  2WGQ A;  3BLZ A;  3M8C A;  4ZM8 A;  3BB9 A;  2GU1 A;  3DM8 A;  3DGO A;  4WHA A;  1TFK A;  5JBS A;  3NBR A;  4RZM A;  1YVB I;  2W03 A;  4XDW A;  4HM3 B;  4HM5 B;  1OHS A;  1ISK A;  1JNQ A;  3G6E 3;  3JUM A;  2W9P A;  5KP1 A;  3CCJ 3;  1RJO A;  2Y73 A;  3GZR A;  1VQ4 3;  3UB1 A;  3X3X A;  1CYV A;  3FF2 A;  3T8N A;  3CCE 3;  3CCU 3;  1DMQ A;  2GU3 A;  3DGN A;  4FR9 A;  3GAX A;  1NDO B;  1K73 4;  4N3V A;  4HM1 B;  1J2B A;  3PXM A;  5IER A;  3K0Z A;  4EC6 A;  1IT7 A;  3FSD A;  3NM7 A;  3PZW A;  4PEJ A;  4XBX A;  1E3V A;  4HZ9 B;  1TUH A;  2P05 A;  3DY5 A;  5I97 A;  1ASK A;  1NU3 A;  5ELU A;  1IVV A;  3BNC A;  3V99 A;  5EQL A;  3LT8 A;  1OAC A;  1HKX A;  2Z76 A;  3DZL A;  3MKI A;  5JPU A;  3JUN A;  1U8C B;  3D3L A;  4XB5 A;  1MOL A;  3KSP A;  3HI7 A;  1WTH A;  2XF3 A;  2CG1 A;  4N6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...