3LTBA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.6 a after 3 weeks of incubation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltbA00
3DGNA 3LTCA 3DGMA 3LTDA 1UW1A 3DGLA 2P0XA 3LT9A 3DGOA 3LTBA 3LTAA 2P05A 2P09A 3LT8A
chains in the Genus database with same CATH superfamily
5IEPA 1IV7A 1PU4A 3HIIA 1RCKA 4NHFA 4R9KA 5AIGA 4K1VA 1SPUA 3RNTA 3S27A 1A90A 1FZUA 1EEJA 2BMOB 1V74A 2XGLA 2YFLB 3KSPA 4FCJA 1MGWA 4MJDA 5G2GA 3IJEB 1MOLA 3NM2A 1UUVB 4RZMA 3LT9A 1GOUA 3EF8A 4ZM8A 3UL5A 5G1LA 4CJNA 1FUWA 1O7PB 4N6MA 3OWSA 1CEWI 3DY5A 3LOYA 3X3XA 4RNTA 3CCR3 1OACA 1QVF2 2W03A 1TP6A 1YGEA 3MWZA 2IUJA 3NXJA 3CCE3 3KCHA 2J8XB 5HOHA 1RTUA 4HM5B 2BT3A 1Y4KA 4J5GA 1STDA 1GY6A 2BNGA 3LH4A 1HKXA 1W00A 3MSOA 3SYUA 2CH9A 4FMAA 4O02B 1NDOB 1YJW3 2GBXB 1T5YA 2XSOB 1BSBA 1RN7A 2HMLB 2OOVA 1IVUA 2IYJA 2B1XB 2HMKB 3B4OA 3Q90A 3BB9A 4FMBA 1JB2A 2HMMB 2OTL3 2XSHB 1QAKA 3Q3FA 3ER7A 4OK0A 3L0RA 3LTCA 5ELUA 1VQO3 5BXQA 3A76A 5AYSC 3STDA 3NBJA 3S29A 1GYBA 3S28A 1RJOA 2MF7A 1UW1A 2XFTA 4R80A 4XBTA 2KAAA 1G02A 8RNTA 3GRDA 3NQZA 3LT8A 4EYCA 1BUQA 1RN1A 3MG2A 3X41A 1UI8A 2QIYA 2K54A 3X3ZA 2SARA 1V58A 2ML5A 1ZO2A 3NV0A 1RSNA 3K9MC 4WHAA 3N54B 5AEWB 3MHEA 2KF3A 1IYYA 1VQ53 1M9GA 2CWVA 4BL2A 3BIRA 3ZFZA 1EG9B 3F9SA 3SLUA 4XB5A 5IENA 4O8SA 3CNMA 3JUPA 1OHOA 1JN5A 1OGZA 1Q864 3D9RA 2R4IA 4O2HA 1B21A 3PZWA 5KP1A 3CCM3 3KSED 2KF4A 2C4BA 2IMJA 2CKFB 1FGRA 2ZDJA 4MMZB 4DKIA 5AIHA 5BVBA 1GD3A 3I553 4I5QA 1I2GA 1W01A 4KZ1A 1Q40A 1LOYA 1UCJA 3JUOA 1F8NA 5EEOA 4CCVA 5IG4A 1IK3A 4WWUC 1PYLA 2RNTA 1X1YA 2KF6A 3ROBA 1U5OA 5CF2A 1FUSA 4HM8B 3N9HA 6RNTA 3SOAA 2BIRA 4HVNA 2E2VA 1O7MB 1N8QA 1GOYA 4RNZA 3D79A 1QMAA 3MYTA 1BNFA 1TTOA 3RDEA 4WYKB 1BIRA 1K28A 5KP4A 2LYXA 4L7KA 1CYUA 1LOVA 3DZLA 2D42A 1GMPA 4L8OA 3HIGA 2CG1A 1OH0A 1BNIA 1JV2B 1RRLA 1W7CA 4HM4B 4J8TA 3X42A 4EXRA 2JQ5A 3G8ZA 2F99A 1I0VA 2PZVA 4HM3B 2P0XA 1BRIA 1Q7Y4 2FXTA 3S5CA 1JJ22 1C7HA 1W5ZA 2WO0A 2I9WA 3ECFA 3G4S3 4XBXA 3WR2A 3URPA 1ZS7A 1BAOA 1ROAA 3HOHA 1ISKA 1IVXA 1GOVA 4LEHA 1G0TA 1MGRA 3CNXA 3DXOA 2Z7AA 4N6UA 1IVWA 2ML6A 4NPBA 1RLSA 2Z6BA 4HM0B 1RGEA 1SQWA 2H0IA 1WTHA 1NJI4 1BRNL 1E97A 1Z1SA 2FGTA 1WMPA 2CFGA 1VQL3 1UUWB 2XF3A 1OF5B 2WOFA 3DGOA 1ULJB 4G1MB 4HM2B 4CDLA 5I97A 2XRXB 3LYGA 1B2ZA 3K5TA 1OHPA 3FG1A 4J5KA 1OUNA 4L8PA 1AVKA 3WODG 2HMOB 1CYVA 2Y74A 3PXMA 1N8R4 3LXUX 6STDA 1DYUA 1LRAA 1T2HA 4GHOA 4LSOA 5M18A 2MC8A 4GSPA 7RNTA 1NNVA 1NO3A 1TFOA 5DREA 5LC7A 1B27A 4HM6B 3WDGB 1K9M4 1RGAA 4QWTA 1DE3A 3D3LA 1R4YA 1FGOA 2CX0A 3DM8A 3HI7A 3LTBA 2XEPA 1W2B2 3FF2A 5BU4A 3JUQA 4K1UA 4Q53A 5CXOA 2O3OA 6GSPA 5IW9A 5JPUA 3EX9A 5G1KA 1LOXA 1K734 1DMQA 5FW5A 3T8NA 3QK9A 1I8VA 1OHSA 3PS8A 3CXC2 1NB5I 3X40A 5IG3A 5AYRB 1QJGA 1JZOA 3VSYA 4EC6A 4JF8A 5BIRA 1N9JA 3AMOA 2W9QA 1E3VA 4X2OA 2QA43 5AEUB 2E2TA 2L4VA 3H51A 4HKVB 1NU3A 5D81A 1RN4A 3HK4A 2OQEA 1WNHA 3EN1B 1OCVA 3UJMA 1X1XA 2GSPA 1AQZA 4HM1B 3SVAA 3CU3A 2GEXA 3AGNA 3ZG0A 3G16A 2P09A 3GZYB 1B2SA 3RGRA 2F5MA 1FGTA 2XFSA 1RGLA 1KC84 2IUKA 3NV0B 1BNEA 3PYJA 2KCDA 3FZWA 2P38A 4ILFA 2AADA 3NHXA 3N8BA 3SX1A 3OV4A 2CK3H 3CCL3 1JN5B 1N5HA 1KQS2 4OUQA 2W56A 1HU9A 3EBTA 1IQ8A 3BNBA 1J2BA 4RNYA 3OWUA 1EUIC 1I0XA 1PY3A 1BOXA 1RMSA 1SIHA 1WMNA 2F5WA 3AGOA 3RGAA 3IPTA 1BRSA 2CG0A 5IG5A 3PCSA 3M8CA 2CWUA 3UB1A 1GY5A 3CME3 3GWRA 2CHCA 1Q40B 3OWYA 1W2ZA 3CD63 4O3VA 4MMYB 3G713 2R41A 1ZX2A 2KXGA 1AR0A 3K0ZA 1A2PA 3CC43 3WA2X 1HZ1A 4HOHA 1I2EA 1L5GB 1W6CA 2OQEC 4H3UA 1JBRA 1O7HB 1VQK3 3MG1A 1JRQA 2HMJB 1EA2A 2H0GA 3F7SA 2WGQA 1FA3A 5CF1A 1YIJ3 2OOVC 1VQ43 4FCZA 1IU7A 1UGHI 4HJLB 1N9EA 1CQSA 1DVCA 3EC9A 3WHOA 1D6YA 5EVHA 3D5GA 3DUKA 4U13A 1YJ93 2Q07A 1I70A 1LOWA 3EE1A 3MKIA 1IVVA 1VQ63 2H0HA 3B7CA 1NB3I 1TRQA 2RSXA 3I563 1DVDA 1T2IA 1UCIA 3GAXA 2WOHA 1MWTA 1TFKA 4RBNA 3JUMA 5ELJA 3E99A 2RCDA 4MEIA 4IPBA 2OCTA 1R4CA 1B2XA 2C10A 3CC23 3UL6A 1MWSA 3EQQB 3CC73 1LVNA 2W04A 3B8LA 1ULIB 1I3FA 5TGNA 3WOFB 5M1AA 4LYLB 3T8UA 2CW9A 1YVSA 1EKMA 1Q42A 1O7WB 3WMDA 4LMIA 1BSAA 4XDVA 1LQMB 1NWWA 3D4AA 1JBTA 1RGKA 1E3RA 2INXA 3GZXB 2BMQB 2RBIA 2YFJB 4N6LA 3BNEA 3DMCA 3X3YA 2CX1A 3LMLA 1WQLB 7GSPA 3SXXA 1I3IA 2K0MA 1IT7A 5EQLA 1JB5A 2LQVA 4HAAA 3CCQ3 4EW5A 1IV9A 2OWPA 1B20A 1IT8A 1Q7HA 1Q9EA 3BLZA 2CWTA 1JKGA 1ROVA 1T3BA 3MPHA 4HZBB 4BTWA 1STFI 1AY7A 1PFPA 4LZIA 4EV2A 1MNLA 1SARA 2W9PA 1G96A 3NX0A 3NQYA 5M19A 3OX9A 4STDA 2OTJ3 3F40A 2YX9A 3JVCA 1RNTA 4BTXA 5JPPA 1JBSA 1RGHA 4WYKA 4HBRA 2JDIH 2GBWB 3FGYA 4JRFA 1MWRA 1SIIA 5AI1A 5KP3A 1W6GA 3DGMA 3SOYA 3S67A 2F98A 3J7Yd 4LGQA 1EQKA 2K3DA 1ZGXA 1W02A 1IQYA 1VQQA 3OXAA 4MMXB 3SEDA 1K41A 2XR8B 5IEOA 5IF6A 3BU4A 3FLJA 2BHMA 3BNDA 3CCU3 3FCSB 1YNVX 1O7NB 2RGQA 1RGGA 1RGCA 5D82A 5RNTA 2C11A 1GMRA 3V99A 1M1K4 1SJWA 5JBSA 1TUHA 2ZHXB 3EHCA 1B2UA 1RKYA 1MWUA 2F4YA 3DH2A 4KFDA 3BNCA 2QEX3 2GU3A 3G0KA 1VQP3 1Q824 5AIIA 3HX8A 4BTYA 2BO9B 4N6OB 1O7GB 2W56B 4TX4A 3ALAA 1IQXA 2IY2A 3EN8A 3KIIA 1RHLA 2RFRA 1OF5A 2CFKA 4WFOA 1LXEA 5A0OB 2CFDA 1US1A 3PCRA 4KT3B 1CH0A 1RGFA 1YGWA 4K90B 1RNBA 5IG0A 1A67A 4K61A 4HYZA 3QRDA 1LNHA 4BIRA 3OW22 2YFIB 2CFLA 5STDA 3FG4A 2QGUA 2XH9A 1BNGA 3NBRA 4FCMA 4FR9A 2CIUA 3CPOA 3WOEB 2PNCA 4FMDA 2F86B 3FSDA 3U97A 3H3HA 2STDA 1FGQA 4N3VA 4OVMA 7STDA 1JNQA 3WA3A 1AVLA 5FGOA 4BL3A 3GSPA 9RNTA 1LNIA 4IT7A 3B4PA 2ZL8A 5IERA 1YI23 1BNRA 1U8CB 1D6ZA 1B3SA 2W6JH 1BSCA 1VQM3 1A2VA 1BVIA 1GS3A 4KFEA 1C54A 1UCLA 3CCS3 1N5PA 5CLKA 3CCV3 3VGNA 3KE7A 3D5IA 4FMCA 4AKYA 3F8XA 1DETA 1X1UA 3MG3A 4R9LA 1FUTA 4HM7B 4J9AA 4XDWA 5LC6A 3VF1A 2ZA4A 4X2HA 1BNSA 4EV5A 1UDII 1GMQA 3EJVA 3NUVA 4XBYA 1B2MA 1DMNA 1QAFA 4NREA 1DMMA 1K8A4 3DGLA 2B24B 1VQ83 4CPKA 2AAEA 3Q2PA 4H61A 1BGSA 3FF0A 1OPYA 4N6TA 5GSPA 2WGOA 1BNJA 1BU4A 2F56A 4WP5A 4AKZA 3LTAA 5AIFA 1VZZA 1JZDA 3K7CA 3EBYA 1JB4A 1S723 2M7OA 1YVBI 2W2CA 1RCLA 2UUGC 3LZAA 4N6NB 2BU4A 1YJN3 2XGNA 2V1LA 2L1SA 4R4KA 1V57A 2BMRB 4BU4A 3Q1CA 3K63A 1BUJA 2GU1A 4IIAA 3TDGA 3FH1A 1JKGB 2Z76A 1ASKA 1TJDA 1YHQ3 3F8HA 3O8YA 3T0UA 4EBGA 1BRHA 1Q814 3CCJ3 1TIJA 3DGNA 1KSIA 1BSEA 3IMAB 1BSDA 1IDPA 3A5EA 1M904 3FG3A 1TU5A 1HYFA 3U1WA 1QALA 1UI7A 5HGRA 1OGXA 3KFQC 3PGBA 2E2UA 4N6V0 1KWIA 3CMA3 2FNQA 1FW7A 1S5AA 1RRHA 1UUGB 4GL6A 2HMNB 3KKGA 5DRVA 1VQ93 2GEYA 3NM7A 5D83A 1GSPA 4PEJA 2UGIA 1GD4A 1QVG2 1FYSA 1A2KA 3AHWA 1VQ73 5CK6A 1KD14 1X1WA 2Z77A 1VQN3 4XM4A 3GZRA 1UCKA 3DGYA 1WMOA 1TRPA 1UGIA 3KZTA 2IA7A 3AMOB 2HOHA 3V92A 2KF5A 1GY7A 2CC3A 3LTDA 1I2FA 3V98A 3EB8A 3UNLA 3I0YA 3G6E3 4GB5A 2D1WA 3GZBA 3F7XA 3CPW2 1D6UA 4KVHA 3AHSA 2W0QA 2O9UX 3ZG5A 1BRGA 3FKAA 3KN4A 1FGMA 2Y73A 4AEQA 3NBBA 8CHOA 1M1XB 2P05A 2A15A 1RDSA 3F14A 2UX0A 1BRJA 2CFWA 4HZ9B 1AV4A 1BANA 4I4KA 4ORLA 3HZPA 1YIT3 2P0MA 3JUNA 4R1KA 2KRTA 2SBLA 1LQGC 1W4NA 2GXFA 4KFFA 1BRKA 1W6YA
chains in the Genus database with same CATH topology
5IEPA 1IV7A 1PU4A 3HIIA 4NHFA 4R9KA 5AIGA 4K1VA 1SPUA 3S27A 1A90A 3KSPA 2BMOB 2XGLA 1V74A 2YFLB 4FCJA 4MJDA 5G2GA 3IJEB 1MOLA 3NM2A 1UUVB 4RZMA 3LT9A 3EF8A 4ZM8A 3UL5A 1FUWA 1O7PB 4N6MA 3OWSA 1CEWI 3DY5A 3LOYA 3X3XA 3CCR3 1OACA 1QVF2 2W03A 1TP6A 1YGEA 3MWZA 2IUJA 3NXJA 3CCE3 4HM5B 2BT3A 1Y4KA 1STDA 1GY6A 2BNGA 3LH4A 1HKXA 1W00A 3MSOA 2CH9A 4FMAA 4O02B 1NDOB 1YJW3 2GBXB 1T5YA 2XSOB 1RN7A 2HMLB 2OOVA 1IVUA 2B1XB 2HMKB 3B4OA 3Q90A 3BB9A 4FMBA 1JB2A 2HMMB 2OTL3 2XSHB 1QAKA 3ER7A 4OK0A 3L0RA 3LTCA 5ELUA 1VQO3 5BXQA 3A76A 5AYSC 3STDA 3NBJA 3S29A 1GYBA 3S28A 1RJOA 2MF7A 1UW1A 2XFTA 4R80A 4XBTA 3GRDA 3NQZA 3LT8A 4EYCA 1BUQA 3MG2A 3X41A 1UI8A 2QIYA 2K54A 3X3ZA 2ML5A 1ZO2A 3NV0A 4WHAA 3K9MC 3N54B 5AEWB 3MHEA 1VQ53 1M9GA 2CWVA 1EG9B 3F9SA 3SLUA 4XB5A 5IENA 4O8SA 3CNMA 3JUPA 1OHOA 1JN5A 1OGZA 1Q864 3D9RA 2R4IA 4O2HA 3PZWA 3CCM3 5KP1A 3KSED 2IMJA 2CKFB 1FGRA 2ZDJA 4MMZB 5AIHA 5BVBA 1GD3A 3I553 5EEOA 1W01A 4KZ1A 1Q40A 4CCVA 3JUOA 1F8NA 5IG4A 1IK3A 4WWUC 3ROBA 1U5OA 5CF2A 4HM8B 3N9HA 3SOAA 4HVNA 2E2VA 1O7MB 1N8QA 4RNZA 1QMAA 3MYTA 3RDEA 4WYKB 1K28A 5KP4A 2LYXA 4L7KA 1CYUA 3DZLA 2D42A 4L8OA 3HIGA 2CG1A 1OH0A 1JV2B 1RRLA 1W7CA 4J8TA 4HM4B 3X42A 4EXRA 2JQ5A 3G8ZA 2F99A 2PZVA 4HM3B 2P0XA 1Q7Y4 2FXTA 3S5CA 1JJ22 1C7HA 1W5ZA 2WO0A 2I9WA 3ECFA 3G4S3 4XBXA 1ROAA 1ISKA 1IVXA 4LEHA 3CNXA 3DXOA 2Z7AA 4N6UA 1IVWA 2ML6A 2Z6BA 4HM0B 1SQWA 1WTHA 1NJI4 1E97A 1Z1SA 2FGTA 1WMPA 2CFGA 1VQL3 1UUWB 2XF3A 1OF5B 2WOFA 3DGOA 1ULJB 4G1MB 4HM2B 5I97A 2XRXB 3LYGA 3K5TA 1OHPA 3FG1A 1OUNA 4L8PA 1AVKA 3WODG 2HMOB 1CYVA 2Y74A 3PXMA 1N8R4 3LXUX 6STDA 1DYUA 4LSOA 2MC8A 1NO3A 1TFOA 5DREA 5LC7A 4HM6B 3WDGB 1K9M4 4QWTA 3D3LA 1FGOA 3DM8A 3HI7A 3LTBA 1W2B2 2XEPA 3FF2A 3JUQA 4K1UA 4Q53A 5CXOA 2O3OA 5IW9A 5JPUA 3EX9A 1LOXA 1K734 1DMQA 5FW5A 3T8NA 3QK9A 1OHSA 1NB5I 3PS8A 3CXC2 3X40A 5IG3A 5AYRB 1QJGA 3VSYA 4EC6A 4JF8A 1N9JA 3AMOA 2W9QA 1E3VA 4X2OA 2QA43 5AEUB 2E2TA 2L4VA 3H51A 4HKVB 1NU3A 5D81A 3HK4A 2OQEA 3UJMA 1WNHA 3EN1B 1OCVA 4CDLA 4HM1B 3SVAA 3CU3A 2GEXA 3G16A 2P09A 3GZYB 3RGRA 1FGTA 2XFSA 1KC84 2IUKA 3NV0B 3PYJA 2KCDA 3FZWA 2P38A 3NHXA 3N8BA 3SX1A 3OV4A 2CK3H 3CCL3 1JN5B 1N5HA 1KQS2 4OUQA 2W56A 1HU9A 3EBTA 1IQ8A 3BNBA 1J2BA 4RNYA 3OWUA 3RGAA 1WMNA 1SIHA 3IPTA 2CG0A 5IG5A 3PCSA 3M8CA 2CWUA 3UB1A 1GY5A 3CME3 3GWRA 2CHCA 1Q40B 3OWYA 1W2ZA 3CD63 4O3VA 4MMYB 3G713 1ZX2A 2KXGA 1AR0A 3K0ZA 3CC43 3WA2X 1L5GB 1W6CA 2OQEC 4H3UA 1O7HB 1VQK3 3MG1A 1JRQA 2HMJB 1EA2A 3F7SA 2WGQA 1FA3A 5CF1A 1YIJ3 2OOVC 1VQ43 4FCZA 1IU7A 4HJLB 1N9EA 1CQSA 1DVCA 3EC9A 1D6YA 5EVHA 3DUKA 4U13A 1YJ93 2Q07A 3EE1A 3MKIA 1IVVA 1VQ63 3B7CA 1NB3I 2RSXA 3I563 1DVDA 3GAXA 2WOHA 4RBNA 1TFKA 3JUMA 5ELJA 3E99A 2RCDA 4MEIA 4IPBA 2OCTA 1R4CA 2C10A 3UL6A 3EQQB 3CC73 1LVNA 2W04A 3B8LA 1ULIB 5TGNA 3WOFB 3T8UA 2CW9A 1EKMA 1Q42A 1O7WB 3WMDA 4LMIA 4XDVA 1NWWA 1E3RA 2INXA 3GZXB 2BMQB 4N6LA 2YFJB 3BNEA 3DMCA 3X3YA 3LMLA 1WQLB 3SXXA 2K0MA 1IT7A 5EQLA 1JB5A 2LQVA 3CCQ3 1IV9A 2OWPA 1IT8A 4BTWA 3CC23 3BLZA 2CWTA 1JKGA 1ROVA 3MPHA 4HZBB 1STFI 1PFPA 4LZIA 4EV2A 1MNLA 2W9PA 1G96A 3NX0A 3NQYA 3OX9A 4STDA 2OTJ3 3F40A 2YX9A 3JVCA 4BTXA 5JPPA 4WYKA 4HBRA 2JDIH 2GBWB 3FGYA 4JRFA 1SIIA 5AI1A 5KP3A 1W6GA 3DGMA 3SOYA 3S67A 2F98A 3J7Yd 4LGQA 1EQKA 1W02A 1IQYA 3OXAA 4MMXB 3SEDA 1K41A 2XR8B 5IEOA 5IF6A 3FLJA 2BHMA 3BNDA 3CCU3 3FCSB 1O7NB 2RGQA 5D82A 2C11A 3V99A 1M1K4 1SJWA 5JBSA 1TUHA 3EHCA 1RKYA 4KFDA 1VQP3 2QEX3 3BNCA 1Q824 2GU3A 3G0KA 5AIIA 3HX8A 4BTYA 2BO9B 4N6OB 1O7GB 2W56B 4TX4A 3ALAA 1IQXA 3EN8A 3KIIA 2RFRA 1OF5A 4WFOA 5A0OB 1LXEA 2CFDA 1US1A 3PCRA 4K90B 5IG0A 1A67A 4K61A 4HYZA 3QRDA 1LNHA 3OW22 2YFIB 2CFLA 5STDA 3FG4A 2QGUA 2XH9A 3NBRA 4FCMA 4FR9A 2CIUA 3CPOA 3WOEB 2PNCA 4FMDA 2F86B 3FSDA 3U97A 3H3HA 2STDA 1FGQA 4N3VA 4OVMA 7STDA 1JNQA 3WA3A 1AVLA 5FGOA 4IT7A 3B4PA 2ZL8A 5IERA 1YI23 1U8CB 1D6ZA 2W6JH 1VQM3 1A2VA 1GS3A 4KFEA 3CCS3 1N5PA 5CLKA 3CCV3 3VGNA 3KE7A 4FMCA 4AKYA 3F8XA 3MG3A 4R9LA 4HM7B 4J9AA 4XDWA 5LC6A 3VF1A 4X2HA 4EV5A 4XBYA 3NUVA 3EJVA 1DMNA 1QAFA 4NREA 1DMMA 1K8A4 3DGLA 2B24B 1VQ83 3Q2PA 4H61A 3FF0A 1OPYA 4N6TA 2WGOA 4WP5A 4AKZA 3LTAA 5AIFA 1VZZA 3K7CA 3EBYA 1JB4A 1S723 2M7OA 1YVBI 2W2CA 3LZAA 4N6NB 1YJN3 2XGNA 2V1LA 4R4KA 2BMRB 3Q1CA 3K63A 2GU1A 4IIAA 3TDGA 3FH1A 1JKGB 2Z76A 1ASKA 1YHQ3 3F8HA 3O8YA 3T0UA 4EBGA 1Q814 3CCJ3 1TIJA 3DGNA 1KSIA 3IMAB 1IDPA 1M904 3FG3A 1TU5A 3U1WA 1QALA 1UI7A 5HGRA 1OGXA 3KFQC 3PGBA 2E2UA 4N6V0 1KWIA 3CMA3 2FNQA 1S5AA 1RRHA 4GL6A 2HMNB 3KKGA 5DRVA 1VQ93 2GEYA 3NM7A 5D83A 4PEJA 1GD4A 1QVG2 1A2KA 1VQ73 5CK6A 1KD14 2Z77A 1VQN3 4XM4A 3GZRA 1WMOA 3KZTA 2IA7A 3AMOB 3V92A 1GY7A 2CC3A 3LTDA 3V98A 3EB8A 3UNLA 3I0YA 3G6E3 4GB5A 2D1WA 3GZBA 3F7XA 3CPW2 1D6UA 4KVHA 2W0QA 2O9UX 3FKAA 3KN4A 1FGMA 2Y73A 4AEQA 3NBBA 8CHOA 1M1XB 2P05A 2A15A 3F14A 2UX0A 2CFWA 4HZ9B 1AV4A 4I4KA 4ORLA 1YIT3 3HZPA 2P0MA 3JUNA 4R1KA 2KRTA 2SBLA 4KFFA 1W4NA 2GXFA 2CFKA 1W6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGN A;  3LTC A;  3DGM A;  3LTD A;  1UW1 A;  3DGL A;  2P0X A;  3LT9 A;  3DGO A;  3LTB A;  3LTA A;  2P05 A;  2P09 A;  3LT8 A; 
#chains in the Genus database with same CATH topology
 5IEP A;  1IV7 A;  1PU4 A;  3HII A;  1RCK A;  4NHF A;  4R9K A;  5AIG A;  4K1V A;  1SPU A;  3RNT A;  3S27 A;  1A90 A;  1FZU A;  1EEJ A;  2BMO B;  1V74 A;  2XGL A;  2YFL B;  3KSP A;  4FCJ A;  1MGW A;  4MJD A;  5G2G A;  3IJE B;  1MOL A;  3NM2 A;  1UUV B;  4RZM A;  3LT9 A;  1GOU A;  3EF8 A;  4ZM8 A;  3UL5 A;  5G1L A;  4CJN A;  1FUW A;  1O7P B;  4N6M A;  3OWS A;  1CEW I;  3DY5 A;  3LOY A;  3X3X A;  4RNT A;  3CCR 3;  1OAC A;  1QVF 2;  2W03 A;  1TP6 A;  1YGE A;  3MWZ A;  2IUJ A;  3NXJ A;  3CCE 3;  3KCH A;  2J8X B;  5HOH A;  1RTU A;  4HM5 B;  2BT3 A;  1Y4K A;  4J5G A;  1STD A;  1GY6 A;  2BNG A;  3LH4 A;  1HKX A;  1W00 A;  3MSO A;  3SYU A;  2CH9 A;  4FMA A;  4O02 B;  1NDO B;  1YJW 3;  2GBX B;  1T5Y A;  2XSO B;  1BSB A;  1RN7 A;  2HML B;  2OOV A;  1IVU A;  2IYJ A;  2B1X B;  2HMK B;  3B4O A;  3Q90 A;  3BB9 A;  4FMB A;  1JB2 A;  2HMM B;  2OTL 3;  2XSH B;  1QAK A;  3Q3F A;  3ER7 A;  4OK0 A;  3L0R A;  3LTC A;  5ELU A;  1VQO 3;  5BXQ A;  3A76 A;  5AYS C;  3STD A;  3NBJ A;  3S29 A;  1GYB A;  3S28 A;  1RJO A;  2MF7 A;  1UW1 A;  2XFT A;  4R80 A;  4XBT A;  2KAA A;  1G02 A;  8RNT A;  3GRD A;  3NQZ A;  3LT8 A;  4EYC A;  1BUQ A;  1RN1 A;  3MG2 A;  3X41 A;  1UI8 A;  2QIY A;  2K54 A;  3X3Z A;  2SAR A;  1V58 A;  2ML5 A;  1ZO2 A;  3NV0 A;  1RSN A;  3K9M C;  4WHA A;  3N54 B;  5AEW B;  3MHE A;  2KF3 A;  1IYY A;  1VQ5 3;  1M9G A;  2CWV A;  4BL2 A;  3BIR A;  3ZFZ A;  1EG9 B;  3F9S A;  3SLU A;  4XB5 A;  5IEN A;  4O8S A;  3CNM A;  3JUP A;  1OHO A;  1JN5 A;  1OGZ A;  1Q86 4;  3D9R A;  2R4I A;  4O2H A;  1B21 A;  3PZW A;  5KP1 A;  3CCM 3;  3KSE D;  2KF4 A;  2C4B A;  2IMJ A;  2CKF B;  1FGR A;  2ZDJ A;  4MMZ B;  4DKI A;  5AIH A;  5BVB A;  1GD3 A;  3I55 3;  4I5Q A;  1I2G A;  1W01 A;  4KZ1 A;  1Q40 A;  1LOY A;  1UCJ A;  3JUO A;  1F8N A;  5EEO A;  4CCV A;  5IG4 A;  1IK3 A;  4WWU C;  1PYL A;  2RNT A;  1X1Y A;  2KF6 A;  3ROB A;  1U5O A;  5CF2 A;  1FUS A;  4HM8 B;  3N9H A;  6RNT A;  3SOA A;  2BIR A;  4HVN A;  2E2V A;  1O7M B;  1N8Q A;  1GOY A;  4RNZ A;  3D79 A;  1QMA A;  3MYT A;  1BNF A;  1TTO A;  3RDE A;  4WYK B;  1BIR A;  1K28 A;  5KP4 A;  2LYX A;  4L7K A;  1CYU A;  1LOV A;  3DZL A;  2D42 A;  1GMP A;  4L8O A;  3HIG A;  2CG1 A;  1OH0 A;  1BNI A;  1JV2 B;  1RRL A;  1W7C A;  4HM4 B;  4J8T A;  3X42 A;  4EXR A;  2JQ5 A;  3G8Z A;  2F99 A;  1I0V A;  2PZV A;  4HM3 B;  2P0X A;  1BRI A;  1Q7Y 4;  2FXT A;  3S5C A;  1JJ2 2;  1C7H A;  1W5Z A;  2WO0 A;  2I9W A;  3ECF A;  3G4S 3;  4XBX A;  3WR2 A;  3URP A;  1ZS7 A;  1BAO A;  1ROA A;  3HOH A;  1ISK A;  1IVX A;  1GOV A;  4LEH A;  1G0T A;  1MGR A;  3CNX A;  3DXO A;  2Z7A A;  4N6U A;  1IVW A;  2ML6 A;  4NPB A;  1RLS A;  2Z6B A;  4HM0 B;  1RGE A;  1SQW A;  2H0I A;  1WTH A;  1NJI 4;  1BRN L;  1E97 A;  1Z1S A;  2FGT A;  1WMP A;  2CFG A;  1VQL 3;  1UUW B;  2XF3 A;  1OF5 B;  2WOF A;  3DGO A;  1ULJ B;  4G1M B;  4HM2 B;  4CDL A;  5I97 A;  2XRX B;  3LYG A;  1B2Z A;  3K5T A;  1OHP A;  3FG1 A;  4J5K A;  1OUN A;  4L8P A;  1AVK A;  3WOD G;  2HMO B;  1CYV A;  2Y74 A;  3PXM A;  1N8R 4;  3LXU X;  6STD A;  1DYU A;  1LRA A;  1T2H A;  4GHO A;  4LSO A;  5M18 A;  2MC8 A;  4GSP A;  7RNT A;  1NNV A;  1NO3 A;  1TFO A;  5DRE A;  5LC7 A;  1B27 A;  4HM6 B;  3WDG B;  1K9M 4;  1RGA A;  4QWT A;  1DE3 A;  3D3L A;  1R4Y A;  1FGO A;  2CX0 A;  3DM8 A;  3HI7 A;  3LTB A;  2XEP A;  1W2B 2;  3FF2 A;  5BU4 A;  3JUQ A;  4K1U A;  4Q53 A;  5CXO A;  2O3O A;  6GSP A;  5IW9 A;  5JPU A;  3EX9 A;  5G1K A;  1LOX A;  1K73 4;  1DMQ A;  5FW5 A;  3T8N A;  3QK9 A;  1I8V A;  1OHS A;  3PS8 A;  3CXC 2;  1NB5 I;  3X40 A;  5IG3 A;  5AYR B;  1QJG A;  1JZO A;  3VSY A;  4EC6 A;  4JF8 A;  5BIR A;  1N9J A;  3AMO A;  2W9Q A;  1E3V A;  4X2O A;  2QA4 3;  5AEU B;  2E2T A;  2L4V A;  3H51 A;  4HKV B;  1NU3 A;  5D81 A;  1RN4 A;  3HK4 A;  2OQE A;  1WNH A;  3EN1 B;  1OCV A;  3UJM A;  1X1X A;  2GSP A;  1AQZ A;  4HM1 B;  3SVA A;  3CU3 A;  2GEX A;  3AGN A;  3ZG0 A;  3G16 A;  2P09 A;  3GZY B;  1B2S A;  3RGR A;  2F5M A;  1FGT A;  2XFS A;  1RGL A;  1KC8 4;  2IUK A;  3NV0 B;  1BNE A;  3PYJ A;  2KCD A;  3FZW A;  2P38 A;  4ILF A;  2AAD A;  3NHX A;  3N8B A;  3SX1 A;  3OV4 A;  2CK3 H;  3CCL 3;  1JN5 B;  1N5H A;  1KQS 2;  4OUQ A;  2W56 A;  1HU9 A;  3EBT A;  1IQ8 A;  3BNB A;  1J2B A;  4RNY A;  3OWU A;  1EUI C;  1I0X A;  1PY3 A;  1BOX A;  1RMS A;  1SIH A;  1WMN A;  2F5W A;  3AGO A;  3RGA A;  3IPT A;  1BRS A;  2CG0 A;  5IG5 A;  3PCS A;  3M8C A;  2CWU A;  3UB1 A;  1GY5 A;  3CME 3;  3GWR A;  2CHC A;  1Q40 B;  3OWY A;  1W2Z A;  3CD6 3;  4O3V A;  4MMY B;  3G71 3;  2R41 A;  1ZX2 A;  2KXG A;  1AR0 A;  3K0Z A;  1A2P A;  3CC4 3;  3WA2 X;  1HZ1 A;  4HOH A;  1I2E A;  1L5G B;  1W6C A;  2OQE C;  4H3U A;  1JBR A;  1O7H B;  1VQK 3;  3MG1 A;  1JRQ A;  2HMJ B;  1EA2 A;  2H0G A;  3F7S A;  2WGQ A;  1FA3 A;  5CF1 A;  1YIJ 3;  2OOV C;  1VQ4 3;  4FCZ A;  1IU7 A;  1UGH I;  4HJL B;  1N9E A;  1CQS A;  1DVC A;  3EC9 A;  3WHO A;  1D6Y A;  5EVH A;  3D5G A;  3DUK A;  4U13 A;  1YJ9 3;  2Q07 A;  1I70 A;  1LOW A;  3EE1 A;  3MKI A;  1IVV A;  1VQ6 3;  2H0H A;  3B7C A;  1NB3 I;  1TRQ A;  2RSX A;  3I56 3;  1DVD A;  1T2I A;  1UCI A;  3GAX A;  2WOH A;  1MWT A;  1TFK A;  4RBN A;  3JUM A;  5ELJ A;  3E99 A;  2RCD A;  4MEI A;  4IPB A;  2OCT A;  1R4C A;  1B2X A;  2C10 A;  3CC2 3;  3UL6 A;  1MWS A;  3EQQ B;  3CC7 3;  1LVN A;  2W04 A;  3B8L A;  1ULI B;  1I3F A;  5TGN A;  3WOF B;  5M1A A;  4LYL B;  3T8U A;  2CW9 A;  1YVS A;  1EKM A;  1Q42 A;  1O7W B;  3WMD A;  4LMI A;  1BSA A;  4XDV A;  1LQM B;  1NWW A;  3D4A A;  1JBT A;  1RGK A;  1E3R A;  2INX A;  3GZX B;  2BMQ B;  2RBI A;  2YFJ B;  4N6L A;  3BNE A;  3DMC A;  3X3Y A;  2CX1 A;  3LML A;  1WQL B;  7GSP A;  3SXX A;  1I3I A;  2K0M A;  1IT7 A;  5EQL A;  1JB5 A;  2LQV A;  4HAA A;  3CCQ 3;  4EW5 A;  1IV9 A;  2OWP A;  1B20 A;  1IT8 A;  1Q7H A;  1Q9E A;  3BLZ A;  2CWT A;  1JKG A;  1ROV A;  1T3B A;  3MPH A;  4HZB B;  4BTW A;  1STF I;  1AY7 A;  1PFP A;  4LZI A;  4EV2 A;  1MNL A;  1SAR A;  2W9P A;  1G96 A;  3NX0 A;  3NQY A;  5M19 A;  3OX9 A;  4STD A;  2OTJ 3;  3F40 A;  2YX9 A;  3JVC A;  1RNT A;  4BTX A;  5JPP A;  1JBS A;  1RGH A;  4WYK A;  4HBR A;  2JDI H;  2GBW B;  3FGY A;  4JRF A;  1MWR A;  1SII A;  5AI1 A;  5KP3 A;  1W6G A;  3DGM A;  3SOY A;  3S67 A;  2F98 A;  3J7Y d;  4LGQ A;  1EQK A;  2K3D A;  1ZGX A;  1W02 A;  1IQY A;  1VQQ A;  3OXA A;  4MMX B;  3SED A;  1K41 A;  2XR8 B;  5IEO A;  5IF6 A;  3BU4 A;  3FLJ A;  2BHM A;  3BND A;  3CCU 3;  3FCS B;  1YNV X;  1O7N B;  2RGQ A;  1RGG A;  1RGC A;  5D82 A;  5RNT A;  2C11 A;  1GMR A;  3V99 A;  1M1K 4;  1SJW A;  5JBS A;  1TUH A;  2ZHX B;  3EHC A;  1B2U A;  1RKY A;  1MWU A;  2F4Y A;  3DH2 A;  4KFD A;  3BNC A;  2QEX 3;  2GU3 A;  3G0K A;  1VQP 3;  1Q82 4;  5AII A;  3HX8 A;  4BTY A;  2BO9 B;  4N6O B;  1O7G B;  2W56 B;  4TX4 A;  3ALA A;  1IQX A;  2IY2 A;  3EN8 A;  3KII A;  1RHL A;  2RFR A;  1OF5 A;  2CFK A;  4WFO A;  1LXE A;  5A0O B;  2CFD A;  1US1 A;  3PCR A;  4KT3 B;  1CH0 A;  1RGF A;  1YGW A;  4K90 B;  1RNB A;  5IG0 A;  1A67 A;  4K61 A;  4HYZ A;  3QRD A;  1LNH A;  4BIR A;  3OW2 2;  2YFI B;  2CFL A;  5STD A;  3FG4 A;  2QGU A;  2XH9 A;  1BNG A;  3NBR A;  4FCM A;  4FR9 A;  2CIU A;  3CPO A;  3WOE B;  2PNC A;  4FMD A;  2F86 B;  3FSD A;  3U97 A;  3H3H A;  2STD A;  1FGQ A;  4N3V A;  4OVM A;  7STD A;  1JNQ A;  3WA3 A;  1AVL A;  5FGO A;  4BL3 A;  3GSP A;  9RNT A;  1LNI A;  4IT7 A;  3B4P A;  2ZL8 A;  5IER A;  1YI2 3;  1BNR A;  1U8C B;  1D6Z A;  1B3S A;  2W6J H;  1BSC A;  1VQM 3;  1A2V A;  1BVI A;  1GS3 A;  4KFE A;  1C54 A;  1UCL A;  3CCS 3;  1N5P A;  5CLK A;  3CCV 3;  3VGN A;  3KE7 A;  3D5I A;  4FMC A;  4AKY A;  3F8X A;  1DET A;  1X1U A;  3MG3 A;  4R9L A;  1FUT A;  4HM7 B;  4J9A A;  4XDW A;  5LC6 A;  3VF1 A;  2ZA4 A;  4X2H A;  1BNS A;  4EV5 A;  1UDI I;  1GMQ A;  3EJV A;  3NUV A;  4XBY A;  1B2M A;  1DMN A;  1QAF A;  4NRE A;  1DMM A;  1K8A 4;  3DGL A;  2B24 B;  1VQ8 3;  4CPK A;  2AAE A;  3Q2P A;  4H61 A;  1BGS A;  3FF0 A;  1OPY A;  4N6T A;  5GSP A;  2WGO A;  1BNJ A;  1BU4 A;  2F56 A;  4WP5 A;  4AKZ A;  3LTA A;  5AIF A;  1VZZ A;  1JZD A;  3K7C A;  3EBY A;  1JB4 A;  1S72 3;  2M7O A;  1YVB I;  2W2C A;  1RCL A;  2UUG C;  3LZA A;  4N6N B;  2BU4 A;  1YJN 3;  2XGN A;  2V1L A;  2L1S A;  4R4K A;  1V57 A;  2BMR B;  4BU4 A;  3Q1C A;  3K63 A;  1BUJ A;  2GU1 A;  4IIA A;  3TDG A;  3FH1 A;  1JKG B;  2Z76 A;  1ASK A;  1TJD A;  1YHQ 3;  3F8H A;  3O8Y A;  3T0U A;  4EBG A;  1BRH A;  1Q81 4;  3CCJ 3;  1TIJ A;  3DGN A;  1KSI A;  1BSE A;  3IMA B;  1BSD A;  1IDP A;  3A5E A;  1M90 4;  3FG3 A;  1TU5 A;  1HYF A;  3U1W A;  1QAL A;  1UI7 A;  5HGR A;  1OGX A;  3KFQ C;  3PGB A;  2E2U A;  4N6V 0;  1KWI A;  3CMA 3;  2FNQ A;  1FW7 A;  1S5A A;  1RRH A;  1UUG B;  4GL6 A;  2HMN B;  3KKG A;  5DRV A;  1VQ9 3;  2GEY A;  3NM7 A;  5D83 A;  1GSP A;  4PEJ A;  2UGI A;  1GD4 A;  1QVG 2;  1FYS A;  1A2K A;  3AHW A;  1VQ7 3;  5CK6 A;  1KD1 4;  1X1W A;  2Z77 A;  1VQN 3;  4XM4 A;  3GZR A;  1UCK A;  3DGY A;  1WMO A;  1TRP A;  1UGI A;  3KZT A;  2IA7 A;  3AMO B;  2HOH A;  3V92 A;  2KF5 A;  1GY7 A;  2CC3 A;  3LTD A;  1I2F A;  3V98 A;  3EB8 A;  3UNL A;  3I0Y A;  3G6E 3;  4GB5 A;  2D1W A;  3GZB A;  3F7X A;  3CPW 2;  1D6U A;  4KVH A;  3AHS A;  2W0Q A;  2O9U X;  3ZG5 A;  1BRG A;  3FKA A;  3KN4 A;  1FGM A;  2Y73 A;  4AEQ A;  3NBB A;  8CHO A;  1M1X B;  2P05 A;  2A15 A;  1RDS A;  3F14 A;  2UX0 A;  1BRJ A;  2CFW A;  4HZ9 B;  1AV4 A;  1BAN A;  4I4K A;  4ORL A;  3HZP A;  1YIT 3;  2P0M A;  3JUN A;  4R1K A;  2KRT A;  2SBL A;  1LQG C;  1W4N A;  2GXF A;  4KFF A;  1BRK A;  1W6Y A; 
#chains in the Genus database with same CATH homology
 5IEP A;  1IV7 A;  1PU4 A;  3HII A;  4NHF A;  4R9K A;  5AIG A;  4K1V A;  1SPU A;  3S27 A;  1A90 A;  3KSP A;  2BMO B;  2XGL A;  1V74 A;  2YFL B;  4FCJ A;  4MJD A;  5G2G A;  3IJE B;  1MOL A;  3NM2 A;  1UUV B;  4RZM A;  3LT9 A;  3EF8 A;  4ZM8 A;  3UL5 A;  1FUW A;  1O7P B;  4N6M A;  3OWS A;  1CEW I;  3DY5 A;  3LOY A;  3X3X A;  3CCR 3;  1OAC A;  1QVF 2;  2W03 A;  1TP6 A;  1YGE A;  3MWZ A;  2IUJ A;  3NXJ A;  3CCE 3;  4HM5 B;  2BT3 A;  1Y4K A;  1STD A;  1GY6 A;  2BNG A;  3LH4 A;  1HKX A;  1W00 A;  3MSO A;  2CH9 A;  4FMA A;  4O02 B;  1NDO B;  1YJW 3;  2GBX B;  1T5Y A;  2XSO B;  1RN7 A;  2HML B;  2OOV A;  1IVU A;  2B1X B;  2HMK B;  3B4O A;  3Q90 A;  3BB9 A;  4FMB A;  1JB2 A;  2HMM B;  2OTL 3;  2XSH B;  1QAK A;  3ER7 A;  4OK0 A;  3L0R A;  3LTC A;  5ELU A;  1VQO 3;  5BXQ A;  3A76 A;  5AYS C;  3STD A;  3NBJ A;  3S29 A;  1GYB A;  3S28 A;  1RJO A;  2MF7 A;  1UW1 A;  2XFT A;  4R80 A;  4XBT A;  3GRD A;  3NQZ A;  3LT8 A;  4EYC A;  1BUQ A;  3MG2 A;  3X41 A;  1UI8 A;  2QIY A;  2K54 A;  3X3Z A;  2ML5 A;  1ZO2 A;  3NV0 A;  4WHA A;  3K9M C;  3N54 B;  5AEW B;  3MHE A;  1VQ5 3;  1M9G A;  2CWV A;  1EG9 B;  3F9S A;  3SLU A;  4XB5 A;  5IEN A;  4O8S A;  3CNM A;  3JUP A;  1OHO A;  1JN5 A;  1OGZ A;  1Q86 4;  3D9R A;  2R4I A;  4O2H A;  3PZW A;  3CCM 3;  5KP1 A;  3KSE D;  2IMJ A;  2CKF B;  1FGR A;  2ZDJ A;  4MMZ B;  5AIH A;  5BVB A;  1GD3 A;  3I55 3;  5EEO A;  1W01 A;  4KZ1 A;  1Q40 A;  4CCV A;  3JUO A;  1F8N A;  5IG4 A;  1IK3 A;  4WWU C;  3ROB A;  1U5O A;  5CF2 A;  4HM8 B;  3N9H A;  3SOA A;  4HVN A;  2E2V A;  1O7M B;  1N8Q A;  4RNZ A;  1QMA A;  3MYT A;  3RDE A;  4WYK B;  1K28 A;  5KP4 A;  2LYX A;  4L7K A;  1CYU A;  3DZL A;  2D42 A;  4L8O A;  3HIG A;  2CG1 A;  1OH0 A;  1JV2 B;  1RRL A;  1W7C A;  4J8T A;  4HM4 B;  3X42 A;  4EXR A;  2JQ5 A;  3G8Z A;  2F99 A;  2PZV A;  4HM3 B;  2P0X A;  1Q7Y 4;  2FXT A;  3S5C A;  1JJ2 2;  1C7H A;  1W5Z A;  2WO0 A;  2I9W A;  3ECF A;  3G4S 3;  4XBX A;  1ROA A;  1ISK A;  1IVX A;  4LEH A;  3CNX A;  3DXO A;  2Z7A A;  4N6U A;  1IVW A;  2ML6 A;  2Z6B A;  4HM0 B;  1SQW A;  1WTH A;  1NJI 4;  1E97 A;  1Z1S A;  2FGT A;  1WMP A;  2CFG A;  1VQL 3;  1UUW B;  2XF3 A;  1OF5 B;  2WOF A;  3DGO A;  1ULJ B;  4G1M B;  4HM2 B;  5I97 A;  2XRX B;  3LYG A;  3K5T A;  1OHP A;  3FG1 A;  1OUN A;  4L8P A;  1AVK A;  3WOD G;  2HMO B;  1CYV A;  2Y74 A;  3PXM A;  1N8R 4;  3LXU X;  6STD A;  1DYU A;  4LSO A;  2MC8 A;  1NO3 A;  1TFO A;  5DRE A;  5LC7 A;  4HM6 B;  3WDG B;  1K9M 4;  4QWT A;  3D3L A;  1FGO A;  3DM8 A;  3HI7 A;  3LTB A;  1W2B 2;  2XEP A;  3FF2 A;  3JUQ A;  4K1U A;  4Q53 A;  5CXO A;  2O3O A;  5IW9 A;  5JPU A;  3EX9 A;  1LOX A;  1K73 4;  1DMQ A;  5FW5 A;  3T8N A;  3QK9 A;  1OHS A;  1NB5 I;  3PS8 A;  3CXC 2;  3X40 A;  5IG3 A;  5AYR B;  1QJG A;  3VSY A;  4EC6 A;  4JF8 A;  1N9J A;  3AMO A;  2W9Q A;  1E3V A;  4X2O A;  2QA4 3;  5AEU B;  2E2T A;  2L4V A;  3H51 A;  4HKV B;  1NU3 A;  5D81 A;  3HK4 A;  2OQE A;  3UJM A;  1WNH A;  3EN1 B;  1OCV A;  4CDL A;  4HM1 B;  3SVA A;  3CU3 A;  2GEX A;  3G16 A;  2P09 A;  3GZY B;  3RGR A;  1FGT A;  2XFS A;  1KC8 4;  2IUK A;  3NV0 B;  3PYJ A;  2KCD A;  3FZW A;  2P38 A;  3NHX A;  3N8B A;  3SX1 A;  3OV4 A;  2CK3 H;  3CCL 3;  1JN5 B;  1N5H A;  1KQS 2;  4OUQ A;  2W56 A;  1HU9 A;  3EBT A;  1IQ8 A;  3BNB A;  1J2B A;  4RNY A;  3OWU A;  3RGA A;  1WMN A;  1SIH A;  3IPT A;  2CG0 A;  5IG5 A;  3PCS A;  3M8C A;  2CWU A;  3UB1 A;  1GY5 A;  3CME 3;  3GWR A;  2CHC A;  1Q40 B;  3OWY A;  1W2Z A;  3CD6 3;  4O3V A;  4MMY B;  3G71 3;  1ZX2 A;  2KXG A;  1AR0 A;  3K0Z A;  3CC4 3;  3WA2 X;  1L5G B;  1W6C A;  2OQE C;  4H3U A;  1O7H B;  1VQK 3;  3MG1 A;  1JRQ A;  2HMJ B;  1EA2 A;  3F7S A;  2WGQ A;  1FA3 A;  5CF1 A;  1YIJ 3;  2OOV C;  1VQ4 3;  4FCZ A;  1IU7 A;  4HJL B;  1N9E A;  1CQS A;  1DVC A;  3EC9 A;  1D6Y A;  5EVH A;  3DUK A;  4U13 A;  1YJ9 3;  2Q07 A;  3EE1 A;  3MKI A;  1IVV A;  1VQ6 3;  3B7C A;  1NB3 I;  2RSX A;  3I56 3;  1DVD A;  3GAX A;  2WOH A;  4RBN A;  1TFK A;  3JUM A;  5ELJ A;  3E99 A;  2RCD A;  4MEI A;  4IPB A;  2OCT A;  1R4C A;  2C10 A;  3UL6 A;  3EQQ B;  3CC7 3;  1LVN A;  2W04 A;  3B8L A;  1ULI B;  5TGN A;  3WOF B;  3T8U A;  2CW9 A;  1EKM A;  1Q42 A;  1O7W B;  3WMD A;  4LMI A;  4XDV A;  1NWW A;  1E3R A;  2INX A;  3GZX B;  2BMQ B;  4N6L A;  2YFJ B;  3BNE A;  3DMC A;  3X3Y A;  3LML A;  1WQL B;  3SXX A;  2K0M A;  1IT7 A;  5EQL A;  1JB5 A;  2LQV A;  3CCQ 3;  1IV9 A;  2OWP A;  1IT8 A;  4BTW A;  3CC2 3;  3BLZ A;  2CWT A;  1JKG A;  1ROV A;  3MPH A;  4HZB B;  1STF I;  1PFP A;  4LZI A;  4EV2 A;  1MNL A;  2W9P A;  1G96 A;  3NX0 A;  3NQY A;  3OX9 A;  4STD A;  2OTJ 3;  3F40 A;  2YX9 A;  3JVC A;  4BTX A;  5JPP A;  4WYK A;  4HBR A;  2JDI H;  2GBW B;  3FGY A;  4JRF A;  1SII A;  5AI1 A;  5KP3 A;  1W6G A;  3DGM A;  3SOY A;  3S67 A;  2F98 A;  3J7Y d;  4LGQ A;  1EQK A;  1W02 A;  1IQY A;  3OXA A;  4MMX B;  3SED A;  1K41 A;  2XR8 B;  5IEO A;  5IF6 A;  3FLJ A;  2BHM A;  3BND A;  3CCU 3;  3FCS B;  1O7N B;  2RGQ A;  5D82 A;  2C11 A;  3V99 A;  1M1K 4;  1SJW A;  5JBS A;  1TUH A;  3EHC A;  1RKY A;  4KFD A;  1VQP 3;  2QEX 3;  3BNC A;  1Q82 4;  2GU3 A;  3G0K A;  5AII A;  3HX8 A;  4BTY A;  2BO9 B;  4N6O B;  1O7G B;  2W56 B;  4TX4 A;  3ALA A;  1IQX A;  3EN8 A;  3KII A;  2RFR A;  1OF5 A;  4WFO A;  5A0O B;  1LXE A;  2CFD A;  1US1 A;  3PCR A;  4K90 B;  5IG0 A;  1A67 A;  4K61 A;  4HYZ A;  3QRD A;  1LNH A;  3OW2 2;  2YFI B;  2CFL A;  5STD A;  3FG4 A;  2QGU A;  2XH9 A;  3NBR A;  4FCM A;  4FR9 A;  2CIU A;  3CPO A;  3WOE B;  2PNC A;  4FMD A;  2F86 B;  3FSD A;  3U97 A;  3H3H A;  2STD A;  1FGQ A;  4N3V A;  4OVM A;  7STD A;  1JNQ A;  3WA3 A;  1AVL A;  5FGO A;  4IT7 A;  3B4P A;  2ZL8 A;  5IER A;  1YI2 3;  1U8C B;  1D6Z A;  2W6J H;  1VQM 3;  1A2V A;  1GS3 A;  4KFE A;  3CCS 3;  1N5P A;  5CLK A;  3CCV 3;  3VGN A;  3KE7 A;  4FMC A;  4AKY A;  3F8X A;  3MG3 A;  4R9L A;  4HM7 B;  4J9A A;  4XDW A;  5LC6 A;  3VF1 A;  4X2H A;  4EV5 A;  4XBY A;  3NUV A;  3EJV A;  1DMN A;  1QAF A;  4NRE A;  1DMM A;  1K8A 4;  3DGL A;  2B24 B;  1VQ8 3;  3Q2P A;  4H61 A;  3FF0 A;  1OPY A;  4N6T A;  2WGO A;  4WP5 A;  4AKZ A;  3LTA A;  5AIF A;  1VZZ A;  3K7C A;  3EBY A;  1JB4 A;  1S72 3;  2M7O A;  1YVB I;  2W2C A;  3LZA A;  4N6N B;  1YJN 3;  2XGN A;  2V1L A;  4R4K A;  2BMR B;  3Q1C A;  3K63 A;  2GU1 A;  4IIA A;  3TDG A;  3FH1 A;  1JKG B;  2Z76 A;  1ASK A;  1YHQ 3;  3F8H A;  3O8Y A;  3T0U A;  4EBG A;  1Q81 4;  3CCJ 3;  1TIJ A;  3DGN A;  1KSI A;  3IMA B;  1IDP A;  1M90 4;  3FG3 A;  1TU5 A;  3U1W A;  1QAL A;  1UI7 A;  5HGR A;  1OGX A;  3KFQ C;  3PGB A;  2E2U A;  4N6V 0;  1KWI A;  3CMA 3;  2FNQ A;  1S5A A;  1RRH A;  4GL6 A;  2HMN B;  3KKG A;  5DRV A;  1VQ9 3;  2GEY A;  3NM7 A;  5D83 A;  4PEJ A;  1GD4 A;  1QVG 2;  1A2K A;  1VQ7 3;  5CK6 A;  1KD1 4;  2Z77 A;  1VQN 3;  4XM4 A;  3GZR A;  1WMO A;  3KZT A;  2IA7 A;  3AMO B;  3V92 A;  1GY7 A;  2CC3 A;  3LTD A;  3V98 A;  3EB8 A;  3UNL A;  3I0Y A;  3G6E 3;  4GB5 A;  2D1W A;  3GZB A;  3F7X A;  3CPW 2;  1D6U A;  4KVH A;  2W0Q A;  2O9U X;  3FKA A;  3KN4 A;  1FGM A;  2Y73 A;  4AEQ A;  3NBB A;  8CHO A;  1M1X B;  2P05 A;  2A15 A;  3F14 A;  2UX0 A;  2CFW A;  4HZ9 B;  1AV4 A;  4I4K A;  4ORL A;  1YIT 3;  3HZP A;  2P0M A;  3JUN A;  4R1K A;  2KRT A;  2SBL A;  4KFF A;  1W4N A;  2GXF A;  2CFK A;  1W6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...