3LTBA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.6 a after 3 weeks of incubation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
b'DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltbA00
2P05A 3LTCA 3DGNA 3LT9A 3LTBA 3LTAA 3DGMA 2P0XA 3DGOA 3DGLA 3LT8A 2P09A 1UW1A 3LTDA
chains in the Genus database with same CATH superfamily
5STDA 2RBIA 4NHFA 1LVNA 3BLZA 3NUVA 3N54B 3CU3A 2XSOB 1MGWA 1IK3A 3D79A 2WO0A 3B7CA 4X2OA 5AIIA 1OHSA 4RNYA 1N8QA 4HM8B 3S27A 1QJGA 2Z77A 4IT7A 3CCR3 1JBTA 1JZOA 3G16A 1BIRA 1STFI 3K7CA 5D83A 2MC8A 3X40A 1A2KA 1M904 4I5QA 1RGCA 1NDOB 1WMOA 4HJLB 1I70A 3IMAB 2KCDA 1YJN3 1NB5I 2ZDJA 1LQGC 3GZBA 1QVG2 1OUNA 4N6OB 2M7OA 4XBXA 1VQ83 4RNTA 4HKVB 4HM2B 3MG2A 2K0MA 1RHLA 2LQVA 3S28A 2A15A 2CIUA 3FCSB 3WA3A 4JF8A 4WFOA 1HU9A 1W6GA 4GB5A 2AAEA 1A2VA 1GYBA 1DMMA 2CFWA 4O02B 3DGLA 3L0RA 2Z76A 5G1LA 1JN5B 5CF2A 1W00A 3T8NA 2W6JH 5AIFA 4OUQA 3HIIA 4BU4A 5ELJA 3SYUA 1FUTA 1BSBA 2RFRA 2QA43 5CXOA 4EYCA 2B24B 3DXOA 4XM4A 1MWTA 1ZS7A 2KF3A 3NHXA 1RCLA 3S5CA 1TU5A 4HM6B 2GXFA 3IPTA 1M9GA 1UUVB 2BMQB 2CFKA 1VQ43 2R41A 2RNTA 1GMPA 1V57A 3D5IA 3DGNA 3S67A 1RGFA 1QAFA 3NBBA 3Q2PA 1JRQA 4H3UA 1UUWB 1UCJA 3ZG5A 3SOYA 5D82A 4DKIA 3IJEB 1BSAA 1N5HA 1LRAA 3LT9A 3MG3A 3DGMA 1W5ZA 1VQ63 4CPKA 1NU3A 4HAAA 1OF5A 4RNZA 3NXJA 1UW1A 1GD3A 8RNTA 1OH0A 1WMPA 2GBXB 3PS8A 3I563 1WNHA 2K3DA 1O7WB 3D3LA 3FG4A 5IG5A 5M19A 1GD4A 4LSOA 3STDA 3CCS3 3EBYA 1RLSA 4WWUC 1S5AA 4N6UA 4Q53A 2C11A 4R9KA 1SIIA 1YVSA 1T3BA 1F8NA 4EXRA 5BIRA 2P38A 1HKXA 4XDWA 1ZO2A 1Q9EA 3PCRA 4LZIA 2XEPA 2UGIA 1A67A 4WYKA 4RBNA 1SARA 3FKAA 2KF4A 2RCDA 1DYUA 3EN1B 4LYLB 2PZVA 1IT8A 2FXTA 1N8R4 3EX9A 7STDA 2ZHXB 2OCTA 4HM1B 1K41A 2XFSA 3S29A 2BT3A 2W03A 3A5EA 3BU4A 1O7PB 4HOHA 2XRXB 1LQMB 1BSDA 2HMNB 2P09A 2XSHB 3AHSA 3DGYA 4LEHA 2QGUA 5KP1A 3ZG0A 3NX0A 1E3RA 1JKGB 1GY5A 1N9JA 3DM8A 3DMCA 1GMQA 1Q7Y4 3KE7A 3E99A 4K90B 1US1A 5IG0A 1C7HA 4HM4B 3UB1A 5BVBA 9RNTA 3FF2A 4J5GA 2QIYA 1TRQA 2HMOB 4MJDA 3G713 4N6V0 3F7SA 2D42A 3UNLA 1N5PA 3ALAA 1LNHA 3KN4A 3G0KA 3WHOA 2LYXA 3BB9A 1BRJA 1ROAA 4K61A 5IG3A 3CCL3 3UJMA 2ML5A 1C54A 3I0YA 3LTCA 1MWRA 3AMOA 1I8VA 1D6YA 1CYUA 3KKGA 1BNJA 4XBTA 4L8OA 3T0UA 3ZFZA 1FUWA 1BNRA 1RNTA 2AADA 3H51A 5EQLA 5EVHA 1LOVA 2C10A 3URPA 2CHCA 1CYVA 5RNTA 1FW7A 1X1XA 3PGBA 1T2HA 4K1UA 2MF7A 1GY7A 3GWRA 4J9AA 1FGQA 4MMXB 2E2VA 1FUSA 1RGEA 2CK3H 3LT8A 4FCJA 4KT3B 1RGKA 3CPOA 3NM2A 1YI23 3F7XA 1AVKA 1PY3A 1VQ73 2OTJ3 4OK0A 1UGIA 1Q42A 3ECFA 3K0ZA 1W2B2 3CCV3 1BUJA 3WOEB 3KCHA 2W0QA 1IQ8A 1WQLB 4HM3B 1M1XB 3B8LA 4JRFA 4NREA 2W04A 1YJ93 1AQZA 1B27A 2INXA 3LYGA 1OHPA 5AYSC 1PFPA 2SARA 3RGAA 2UUGC 1UCKA 4MMZB 1K8A4 1A2PA 1B20A 3FZWA 1A90A 4HM5B 4O2HA 4XDVA 3OWSA 1AV4A 3HIGA 2L1SA 4FMDA 2YX9A 3HK4A 5BU4A 4N6MA 4K1VA 3CMA3 4J8TA 2W9QA 1EEJA 1PU4A 3KSED 4TX4A 1BNFA 4MEIA 2BO9B 1TTOA 2D1WA 4KVHA 1VQP3 1KSIA 4AKZA 1B2MA 1Q864 3FSDA 2F4YA 2IA7A 3CPW2 1KC84 2ZL8A 2RSXA 4HYZA 1BRKA 1RN4A 2BMRB 3LXUX 2OQEA 3PZWA 4GSPA 4N6LA 1BRSA 1G0TA 3KZTA 1WMNA 2HMKB 4H61A 2CFGA 3PXMA 1BRIA 3U1WA 2WOFA 1BRHA 8CHOA 3EC9A 1BANA 4NPBA 3CD63 1S723 1ROVA 1W6CA 4HZ9B 2IUKA 3OV4A 2CX1A 1JB4A 3LOYA 1VZZA 2CC3A 2GU3A 3OX9A 3NM7A 1B21A 1Q824 4GL6A 3N9HA 1I2FA 5D81A 1NJI4 3JUPA 4BTXA 4FCMA 1G96A 3FGYA 1BNGA 1IT7A 3JVCA 5AIHA 3UL6A 4U13A 3PCSA 5IEOA 3WDGB 2B1XB 1L5GB 2R4IA 1GOVA 1OGXA 3DZLA 1O7NB 3B4OA 4G1MB 1DVDA 4QWTA 1RMSA 3F8HA 2JQ5A 3CC23 2Z7AA 1KD14 2CWUA 3ROBA 4L8PA 3X41A 1B2SA 2F5WA 4STDA 3WMDA 3OXAA 4IIAA 4R9LA 6RNTA 4EV2A 4FMCA 2KAAA 1I3FA 4FMBA 3G4S3 2O3OA 2GBWB 4L7KA 1YJW3 1BU4A 1QALA 3GZRA 2XH9A 1UUGB 1G02A 2K54A 1BSCA 3BNBA 1YGEA 1EG9B 1IDPA 3F8XA 4I4KA 3J7Yd 2BHMA 1CQSA 3EN8A 2GSPA 1UGHI 1Q40A 3MSOA 3MYTA 1STDA 2YFIB 1TRPA 3X3XA 1OF5B 3QK9A 3DY5A 5IERA 3G8ZA 2QEX3 1VQK3 2WGOA 3GZXB 3MWZA 5EEOA 4HBRA 1FGTA 3CCE3 1JKGA 3AGNA 1MGRA 1JBRA 3SEDA 1IYYA 3NBRA 2E2TA 1IVWA 3FG1A 4FMAA 3CXC2 3CCM3 1E97A 2KF5A 5KP3A 1BAOA 1RRLA 2IYJA 5JBSA 1KQS2 1YVBI 1YNVX 2HMJB 3FF0A 3LZAA 3NV0A 3AHWA 3ER7A 2KRTA 4WYKB 3BNDA 3LH4A 1IVUA 1RCKA 2CX0A 1FGMA 3D9RA 4FCZA 1HZ1A 4EC6A 1FZUA 2FGTA 2P0MA 2YFLB 1RKYA 5GSPA 3MKIA 2H0HA 3T8UA 3G6E3 2OWPA 2W56A 3Q90A 2SBLA 3MG1A 3UL5A 5G1KA 3GSPA 4R1KA 1IVVA 5AI1A 1OGZA 3NBJA 5LC7A 1B2UA 2YFJB 1JJ22 1RSNA 4LMIA 1WTHA 2IY2A 1Z1SA 5AEWB 2F86B 2IMJA 2CFDA 4N3VA 1DVCA 3MPHA 1VQL3 1Q814 4WHAA 4PEJA 1U8CB 2PNCA 1B3SA 2WGQA 3V99A 3EQQB 1TFKA 5DREA 2CKFB 3OW22 4O3VA 1K734 1J2BA 5CK6A 3GRDA 3RDEA 5HOHA 6STDA 5IENA 3V92A 1W2ZA 4HZBB 1BNEA 1BOXA 3AMOB 1D6ZA 5LC6A 2HMMB 1W7CA 2OOVA 3D4AA 1BGSA 1LNIA 1ZGXA 5IF6A 2UX0A 3KIIA 5CF1A 4RZMA 3F40A 2KF6A 1ASKA 4N6NB 1EUIC 2Z6BA 2CWVA 4ORLA 2Y73A 4CJNA 1R4CA 1MWSA 3VF1A 3GAXA 3PYJA 4EW5A 2XF3A 3EE1A 1BNSA 1VQM3 1BRNL 2BIRA 5CLKA 2E2UA 3RNTA 1VQ53 4KFDA 3SXXA 1AR0A 1CH0A 1TFOA 2OQEC 3QRDA 4GHOA 7RNTA 2Y74A 2WOHA 4HVNA 1O7HB 1CEWI 1JN5A 1W02A 1UCIA 1Q7HA 2XGLA 3A76A 3DUKA 3LTDA 3N8BA 4EV5A 1V58A 1UI7A 1QMAA 3EJVA 2P0XA 1KWIA 2KXGA 1OPYA 2W9PA 2XR8B 3OWYA 1FA3A 1MWUA 3D5GA 3K5TA 4EBGA 1BUQA 4CDLA 1GOUA 1VQ93 1IU7A 3OWUA 2IUJA 1FGRA 2O9UX 2J8XB 2CH9A 3AGOA 3LMLA 3I553 1UI8A 1TUHA 1FGOA 2P05A 3CNMA 3WA2X 1K28A 5DRVA 1SQWA 1X1UA 2CW9A 3V98A 1JV2B 3F9SA 1YGWA 3X42A 3CME3 5FW5A 1MNLA 1QAKA 2I9WA 4FR9A 4ZM8A 2HMLB 4O8SA 5IW9A 1O7MB 4R80A 1GS3A 1JZDA 1M1K4 1BNIA 2H0IA 2RGQA 4AEQA 5A0OB 1N9EA 4BIRA 4KFEA 1AVLA 3BNCA 2CG0A 3WR2A 1V74A 1IQXA 1OACA 3EF8A 3K9MC 3KFQC 6GSPA 3K63A 3EBTA 3O8YA 3SLUA 2CWTA 5I97A 2F56A 4J5KA 1IVXA 4X2HA 2ML6A 2L4VA 1T5YA 1RN1A 3WOFB 1NWWA 4XB5A 1GMRA 3MHEA 3Q1CA 1B2ZA 1I0VA 2C4BA 1X1WA 1VQN3 3H3HA 3BIRA 1LOWA 2Q07A 5FGOA 2BNGA 2F98A 5TGNA 2GEYA 4BL3A 5HGRA 4BTYA 1X1YA 1HYFA 1JNQA 2HOHA 2XFTA 3HZPA 1ULIB 3EHCA 1GSPA 1T2IA 1QVF2 2W2CA 1RGGA 3SOAA 1NO3A 3JUQA 1I0XA 4CCVA 5JPPA 3JUOA 1IV9A 1BRGA 1RGAA 1ZX2A 1JB2A 1EKMA 4BTWA 3CCJ3 1JB5A 5AIGA 3VGNA 2FNQA 5AYRB 1NB3I 4HM0B 2ZA4A 3F14A 3WODG 5JPUA 1LXEA 2GEXA 4OVMA 1FYSA 1RDSA 1AY7A 1Q40B 2F5MA 1Y4KA 3GZYB 3U97A 1ISKA 5M1AA 3BNEA 1SIHA 3RGRA 1JBSA 1IQYA 3FH1A 1UDII 2CG1A 1SJWA 3SVAA 3HOHA 3JUMA 1VQO3 3NQZA 4XBYA 1RJOA 1UCLA 3Q3FA 1ULJB 5IEPA 2OTL3 1LOYA 1W6YA 3CCU3 1PYLA 3LTAA 3M8CA 3NV0B 1DMQA 3SX1A 4WP5A 5BXQA 1OCVA 5KP4A 1DE3A 3FLJA 3DH2A 4HM7B 3EB8A 3CCQ3 1TJDA 4IPBA 4BL2A 3B4PA 1K9M4 1I2EA 1NNVA 4AKYA 3VSYA 1SPUA 1GOYA 4KFFA 1TIJA 2CFLA 1VQQA 5AEUB 5IG4A 2STDA 3FG3A 1YIT3 2W56B 2OOVC 1BVIA 2BU4A 1EA2A 2F99A 3NQYA 4N6TA 1B2XA 1RGHA 1W4NA 3X3ZA 1DETA 3TDGA 1YHQ3 3HI7A 1RN7A 3CNXA 4LGQA 1I2GA 2H0GA 1R4YA 1EQKA 1U5OA 4MMYB 1D6UA 1MOLA 1O7GB 2V1LA 3CC73 2GU1A 1IV7A 3DGOA 1RRHA 1GY6A 3X3YA 1YIJ3 7GSPA 1DMNA 3CC43 1RTUA 1RGLA 4ILFA 1LOXA 5G2GA 1W01A 1RNBA 1E3VA 5M18A 1BSEA 4KZ1A 3LTBA 2BMOB 3JUNA 4R4KA 1I3IA 1TP6A 2JDIH 2XGNA 5ELUA 3KSPA 3HX8A 1OHOA
chains in the Genus database with same CATH topology
5STDA 4NHFA 1LVNA 3BLZA 3NUVA 3N54B 3CU3A 2XSOB 1IK3A 2WO0A 3B7CA 4X2OA 5AIIA 1OHSA 4RNYA 1N8QA 4HM8B 3S27A 1QJGA 2Z77A 4IT7A 3CCR3 3G16A 1STFI 3K7CA 5D83A 2MC8A 3X40A 1A2KA 1M904 1WMOA 1NDOB 4HJLB 3IMAB 2KCDA 1YJN3 1NB5I 2ZDJA 3GZBA 1QVG2 1OUNA 4N6OB 2M7OA 4XBXA 1VQ83 4HKVB 4HM2B 3MG2A 2K0MA 2LQVA 3S28A 2A15A 2CIUA 3FCSB 3WA3A 4JF8A 4WFOA 1HU9A 1W6GA 4GB5A 1A2VA 1GYBA 1DMMA 2CFWA 4O02B 3DGLA 3L0RA 2Z76A 1JN5B 5CF2A 1W00A 3T8NA 2W6JH 5AIFA 4OUQA 3HIIA 5ELJA 2RFRA 2QA43 5CXOA 4EYCA 2B24B 3DXOA 4XM4A 3NHXA 3S5CA 1TU5A 4HM6B 2GXFA 3IPTA 1M9GA 1UUVB 2BMQB 2CFKA 1VQ43 3DGNA 3S67A 3NBBA 1QAFA 3Q2PA 1JRQA 4H3UA 1UUWB 3SOYA 5D82A 3IJEB 1N5HA 3LT9A 3MG3A 3DGMA 1W5ZA 1VQ63 1NU3A 1OF5A 4RNZA 3NXJA 1UW1A 1GD3A 1OH0A 1WMPA 2GBXB 3PS8A 3I563 1WNHA 3D3LA 1O7WB 5IG5A 3FG4A 1GD4A 4LSOA 3STDA 3CCS3 3EBYA 4WWUC 1S5AA 4N6UA 4Q53A 2C11A 4R9KA 1SIIA 4EXRA 1F8NA 2P38A 1HKXA 4XDWA 1ZO2A 3PCRA 4LZIA 2XEPA 1A67A 4WYKA 4RBNA 3FKAA 2RCDA 1DYUA 3EN1B 2PZVA 1IT8A 2FXTA 1N8R4 3EX9A 7STDA 2OCTA 4HM1B 1K41A 2XFSA 3S29A 2BT3A 2W03A 5BVBA 1VQL3 1O7PB 2XRXB 2HMNB 2P09A 2XSHB 4LEHA 5KP1A 2QGUA 3NX0A 1E3RA 1JKGB 1GY5A 1N9JA 3DM8A 3DMCA 1Q7Y4 3KE7A 3E99A 4K90B 1US1A 5IG0A 1C7HA 4HM4B 3UB1A 3FF2A 2QIYA 2HMOB 4MJDA 4N6V0 3F7SA 2D42A 3UNLA 1N5PA 3ALAA 1LNHA 3KN4A 3G0KA 5IG3A 2LYXA 3BB9A 3CCL3 1ROAA 4K61A 3UJMA 2ML5A 3I0YA 3LTCA 3AMOA 1D6YA 1CYUA 3KKGA 4XBTA 4L8OA 3T0UA 1FUWA 3H51A 5EVHA 5EQLA 2C10A 2CHCA 1CYVA 3PGBA 4K1UA 2MF7A 1GY7A 3GWRA 4J9AA 1FGQA 4MMXB 2E2VA 2CK3H 3LT8A 4FCJA 3CPOA 3NM2A 1YI23 3F7XA 1AVKA 1VQ73 2OTJ3 4OK0A 1Q42A 3ECFA 3K0ZA 1W2B2 3CCV3 3WOEB 2W0QA 1IQ8A 1WQLB 4HM3B 1M1XB 3B8LA 4JRFA 4NREA 2W04A 1YJ93 2INXA 3LYGA 1OHPA 5AYSC 1PFPA 3RGAA 4MMZB 1K8A4 3FZWA 1A90A 4HM5B 4O2HA 4XDVA 3OWSA 1AV4A 3HIGA 4FMDA 2YX9A 3HK4A 4N6MA 4K1VA 3CMA3 4J8TA 2W9QA 1PU4A 3KSED 4TX4A 4MEIA 2BO9B 2D1WA 4KVHA 1VQP3 1KSIA 4AKZA 1Q864 3FSDA 2IA7A 3CPW2 1KC84 2ZL8A 2RSXA 4HYZA 2BMRB 3LXUX 2OQEA 3PZWA 4N6LA 3KZTA 1WMNA 2HMKB 4H61A 2CFGA 3PXMA 3U1WA 2WOFA 8CHOA 3EC9A 3CD63 1S723 1ROVA 1W6CA 4HZ9B 2IUKA 3OV4A 1JB4A 3LOYA 1VZZA 2CC3A 2GU3A 3OX9A 3NM7A 1Q824 4GL6A 3N9HA 5D81A 1NJI4 3JUPA 4BTXA 4FCMA 1G96A 3FGYA 1IT7A 3JVCA 5AIHA 3UL6A 4U13A 3PCSA 5IEOA 3WDGB 2B1XB 1L5GB 2R4IA 1OGXA 3DZLA 1O7NB 3B4OA 4G1MB 1DVDA 4QWTA 3F8HA 2JQ5A 3CC23 2Z7AA 1KD14 2CWUA 3ROBA 4L8PA 3X41A 4STDA 3WMDA 3OXAA 4IIAA 4R9LA 4EV2A 4FMCA 3G4S3 4FMBA 1YJW3 2O3OA 2GBWB 4L7KA 1QALA 3GZRA 2XH9A 2K54A 3BNBA 1YGEA 1EG9B 1IDPA 3F8XA 4I4KA 3J7Yd 2BHMA 1CQSA 3EN8A 3MSOA 1Q40A 3MYTA 1STDA 2YFIB 3X3XA 1OF5B 3QK9A 3DY5A 5IERA 3G8ZA 2QEX3 1VQK3 2WGOA 3GZXB 3MWZA 5EEOA 4HBRA 1FGTA 3CCE3 1JKGA 3SEDA 3NBRA 2E2TA 1IVWA 3FG1A 4FMAA 3CXC2 3CCM3 1E97A 5KP3A 1RRLA 5JBSA 1KQS2 1YVBI 2HMJB 3FF0A 3LZAA 3NV0A 3ER7A 2KRTA 4WYKB 3BNDA 3LH4A 1IVUA 1FGMA 3D9RA 4FCZA 4EC6A 2FGTA 2P0MA 2YFLB 1RKYA 3MKIA 3T8UA 3G6E3 2OWPA 2W56A 3Q90A 2SBLA 3MG1A 3UL5A 4R1KA 1IVVA 5AI1A 1OGZA 3NBJA 5LC7A 2YFJB 1JJ22 4LMIA 1WTHA 1Z1SA 5AEWB 2F86B 2IMJA 2CFDA 4N3VA 1DVCA 3MPHA 1Q814 4WHAA 4PEJA 1U8CB 2PNCA 2WGQA 3V99A 3EQQB 1TFKA 5DREA 2CKFB 3OW22 4O3VA 1K734 1J2BA 5CK6A 3GRDA 3RDEA 5IENA 6STDA 3V92A 1W2ZA 4HZBB 3AMOB 1D6ZA 5LC6A 2HMMB 1W7CA 2OOVA 5IF6A 2UX0A 3KIIA 5CF1A 4RZMA 3F40A 1ASKA 4N6NB 2Z6BA 2CWVA 4ORLA 2Y73A 1R4CA 3VF1A 3GAXA 3PYJA 2XF3A 3EE1A 1VQM3 5CLKA 2E2UA 1VQ53 4KFDA 3SXXA 1AR0A 1TFOA 2OQEC 3QRDA 2Y74A 2WOHA 4HVNA 1O7HB 1CEWI 1JN5A 1W02A 2XGLA 3LTDA 3N8BA 3A76A 3DUKA 4EV5A 1UI7A 1QMAA 3EJVA 2P0XA 1KWIA 2KXGA 1OPYA 2W9PA 2XR8B 3OWYA 1FA3A 3K5TA 1BUQA 4EBGA 4CDLA 1VQ93 1IU7A 3OWUA 2IUJA 2O9UX 1FGRA 3LMLA 2CH9A 3I553 1UI8A 1TUHA 1FGOA 2P05A 3CNMA 3WA2X 1K28A 5DRVA 1SQWA 2CW9A 3V98A 1JV2B 3F9SA 3X42A 3CME3 5FW5A 1MNLA 1QAKA 2I9WA 4FR9A 4ZM8A 2HMLB 4O8SA 5IW9A 1O7MB 4R80A 1GS3A 1M1K4 2RGQA 4AEQA 5A0OB 1N9EA 4KFEA 1AVLA 3BNCA 2CG0A 1V74A 1IQXA 1OACA 3EF8A 3K9MC 3KFQC 3K63A 3EBTA 3O8YA 3SLUA 2CWTA 5I97A 1IVXA 4X2HA 2ML6A 2L4VA 1T5YA 3WOFB 1NWWA 4XB5A 3MHEA 3Q1CA 1VQN3 3H3HA 2Q07A 5FGOA 2BNGA 2F98A 5TGNA 2GEYA 5HGRA 4BTYA 1JNQA 2XFTA 3HZPA 1ULIB 3EHCA 1QVF2 2W2CA 3SOAA 1NO3A 3JUQA 4CCVA 5JPPA 3JUOA 1IV9A 1ZX2A 1JB2A 1EKMA 4BTWA 3CCJ3 1JB5A 5AIGA 3VGNA 2FNQA 5AYRB 1NB3I 4HM0B 3F14A 3WODG 5JPUA 1LXEA 2GEXA 4OVMA 1Q40B 1Y4KA 3GZYB 3U97A 1ISKA 3BNEA 1SIHA 3RGRA 1IQYA 3FH1A 2CG1A 1SJWA 3SVAA 3JUMA 1VQO3 3NQZA 4XBYA 1RJOA 1ULJB 5IEPA 2OTL3 1W6YA 3CCU3 3LTAA 3M8CA 3NV0B 1DMQA 3SX1A 4WP5A 5BXQA 1OCVA 5KP4A 3FLJA 4HM7B 3EB8A 3CCQ3 4IPBA 3B4PA 1K9M4 4AKYA 3VSYA 1SPUA 4KFFA 1TIJA 2CFLA 5AEUB 5IG4A 2STDA 3FG3A 1YIT3 2W56B 2OOVC 4N6TA 1EA2A 2F99A 3NQYA 1W4NA 3X3ZA 3TDGA 1YHQ3 3HI7A 1RN7A 3CNXA 4LGQA 1EQKA 1U5OA 4MMYB 1D6UA 1MOLA 1O7GB 2V1LA 3CC73 2GU1A 1IV7A 3DGOA 1RRHA 1GY6A 3X3YA 1YIJ3 1DMNA 3CC43 1LOXA 5G2GA 1W01A 1E3VA 4KZ1A 3LTBA 2BMOB 3JUNA 4R4KA 2XGNA 1TP6A 2JDIH 5ELUA 3G713 3KSPA 3HX8A 1OHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P05 A;  3LTC A;  3DGN A;  3LT9 A;  3LTB A;  3LTA A;  3DGM A;  2P0X A;  3DGO A;  3DGL A;  3LT8 A;  2P09 A;  1UW1 A;  3LTD A; 
#chains in the Genus database with same CATH topology
 5STD A;  2RBI A;  4NHF A;  1LVN A;  3BLZ A;  3NUV A;  3N54 B;  3CU3 A;  2XSO B;  1MGW A;  1IK3 A;  3D79 A;  2WO0 A;  3B7C A;  4X2O A;  5AII A;  1OHS A;  4RNY A;  1N8Q A;  4HM8 B;  3S27 A;  1QJG A;  2Z77 A;  4IT7 A;  3CCR 3;  1JBT A;  1JZO A;  3G16 A;  1BIR A;  1STF I;  3K7C A;  5D83 A;  2MC8 A;  3X40 A;  1A2K A;  1M90 4;  4I5Q A;  1RGC A;  1NDO B;  1WMO A;  4HJL B;  1I70 A;  3IMA B;  2KCD A;  1YJN 3;  1NB5 I;  2ZDJ A;  1LQG C;  3GZB A;  1QVG 2;  1OUN A;  4N6O B;  2M7O A;  4XBX A;  1VQ8 3;  4RNT A;  4HKV B;  4HM2 B;  3MG2 A;  2K0M A;  1RHL A;  2LQV A;  3S28 A;  2A15 A;  2CIU A;  3FCS B;  3WA3 A;  4JF8 A;  4WFO A;  1HU9 A;  1W6G A;  4GB5 A;  2AAE A;  1A2V A;  1GYB A;  1DMM A;  2CFW A;  4O02 B;  3DGL A;  3L0R A;  2Z76 A;  5G1L A;  1JN5 B;  5CF2 A;  1W00 A;  3T8N A;  2W6J H;  5AIF A;  4OUQ A;  3HII A;  4BU4 A;  5ELJ A;  3SYU A;  1FUT A;  1BSB A;  2RFR A;  2QA4 3;  5CXO A;  4EYC A;  2B24 B;  3DXO A;  4XM4 A;  1MWT A;  1ZS7 A;  2KF3 A;  3NHX A;  1RCL A;  3S5C A;  1TU5 A;  4HM6 B;  2GXF A;  3IPT A;  1M9G A;  1UUV B;  2BMQ B;  2CFK A;  1VQ4 3;  2R41 A;  2RNT A;  1GMP A;  1V57 A;  3D5I A;  3DGN A;  3S67 A;  1RGF A;  1QAF A;  3NBB A;  3Q2P A;  1JRQ A;  4H3U A;  1UUW B;  1UCJ A;  3ZG5 A;  3SOY A;  5D82 A;  4DKI A;  3IJE B;  1BSA A;  1N5H A;  1LRA A;  3LT9 A;  3MG3 A;  3DGM A;  1W5Z A;  1VQ6 3;  4CPK A;  1NU3 A;  4HAA A;  1OF5 A;  4RNZ A;  3NXJ A;  1UW1 A;  1GD3 A;  8RNT A;  1OH0 A;  1WMP A;  2GBX B;  3PS8 A;  3I56 3;  1WNH A;  2K3D A;  1O7W B;  3D3L A;  3FG4 A;  5IG5 A;  5M19 A;  1GD4 A;  4LSO A;  3STD A;  3CCS 3;  3EBY A;  1RLS A;  4WWU C;  1S5A A;  4N6U A;  4Q53 A;  2C11 A;  4R9K A;  1SII A;  1YVS A;  1T3B A;  1F8N A;  4EXR A;  5BIR A;  2P38 A;  1HKX A;  4XDW A;  1ZO2 A;  1Q9E A;  3PCR A;  4LZI A;  2XEP A;  2UGI A;  1A67 A;  4WYK A;  4RBN A;  1SAR A;  3FKA A;  2KF4 A;  2RCD A;  1DYU A;  3EN1 B;  4LYL B;  2PZV A;  1IT8 A;  2FXT A;  1N8R 4;  3EX9 A;  7STD A;  2ZHX B;  2OCT A;  4HM1 B;  1K41 A;  2XFS A;  3S29 A;  2BT3 A;  2W03 A;  3A5E A;  3BU4 A;  1O7P B;  4HOH A;  2XRX B;  1LQM B;  1BSD A;  2HMN B;  2P09 A;  2XSH B;  3AHS A;  3DGY A;  4LEH A;  2QGU A;  5KP1 A;  3ZG0 A;  3NX0 A;  1E3R A;  1JKG B;  1GY5 A;  1N9J A;  3DM8 A;  3DMC A;  1GMQ A;  1Q7Y 4;  3KE7 A;  3E99 A;  4K90 B;  1US1 A;  5IG0 A;  1C7H A;  4HM4 B;  3UB1 A;  5BVB A;  9RNT A;  3FF2 A;  4J5G A;  2QIY A;  1TRQ A;  2HMO B;  4MJD A;  3G71 3;  4N6V 0;  3F7S A;  2D42 A;  3UNL A;  1N5P A;  3ALA A;  1LNH A;  3KN4 A;  3G0K A;  3WHO A;  2LYX A;  3BB9 A;  1BRJ A;  1ROA A;  4K61 A;  5IG3 A;  3CCL 3;  3UJM A;  2ML5 A;  1C54 A;  3I0Y A;  3LTC A;  1MWR A;  3AMO A;  1I8V A;  1D6Y A;  1CYU A;  3KKG A;  1BNJ A;  4XBT A;  4L8O A;  3T0U A;  3ZFZ A;  1FUW A;  1BNR A;  1RNT A;  2AAD A;  3H51 A;  5EQL A;  5EVH A;  1LOV A;  2C10 A;  3URP A;  2CHC A;  1CYV A;  5RNT A;  1FW7 A;  1X1X A;  3PGB A;  1T2H A;  4K1U A;  2MF7 A;  1GY7 A;  3GWR A;  4J9A A;  1FGQ A;  4MMX B;  2E2V A;  1FUS A;  1RGE A;  2CK3 H;  3LT8 A;  4FCJ A;  4KT3 B;  1RGK A;  3CPO A;  3NM2 A;  1YI2 3;  3F7X A;  1AVK A;  1PY3 A;  1VQ7 3;  2OTJ 3;  4OK0 A;  1UGI A;  1Q42 A;  3ECF A;  3K0Z A;  1W2B 2;  3CCV 3;  1BUJ A;  3WOE B;  3KCH A;  2W0Q A;  1IQ8 A;  1WQL B;  4HM3 B;  1M1X B;  3B8L A;  4JRF A;  4NRE A;  2W04 A;  1YJ9 3;  1AQZ A;  1B27 A;  2INX A;  3LYG A;  1OHP A;  5AYS C;  1PFP A;  2SAR A;  3RGA A;  2UUG C;  1UCK A;  4MMZ B;  1K8A 4;  1A2P A;  1B20 A;  3FZW A;  1A90 A;  4HM5 B;  4O2H A;  4XDV A;  3OWS A;  1AV4 A;  3HIG A;  2L1S A;  4FMD A;  2YX9 A;  3HK4 A;  5BU4 A;  4N6M A;  4K1V A;  3CMA 3;  4J8T A;  2W9Q A;  1EEJ A;  1PU4 A;  3KSE D;  4TX4 A;  1BNF A;  4MEI A;  2BO9 B;  1TTO A;  2D1W A;  4KVH A;  1VQP 3;  1KSI A;  4AKZ A;  1B2M A;  1Q86 4;  3FSD A;  2F4Y A;  2IA7 A;  3CPW 2;  1KC8 4;  2ZL8 A;  2RSX A;  4HYZ A;  1BRK A;  1RN4 A;  2BMR B;  3LXU X;  2OQE A;  3PZW A;  4GSP A;  4N6L A;  1BRS A;  1G0T A;  3KZT A;  1WMN A;  2HMK B;  4H61 A;  2CFG A;  3PXM A;  1BRI A;  3U1W A;  2WOF A;  1BRH A;  8CHO A;  3EC9 A;  1BAN A;  4NPB A;  3CD6 3;  1S72 3;  1ROV A;  1W6C A;  4HZ9 B;  2IUK A;  3OV4 A;  2CX1 A;  1JB4 A;  3LOY A;  1VZZ A;  2CC3 A;  2GU3 A;  3OX9 A;  3NM7 A;  1B21 A;  1Q82 4;  4GL6 A;  3N9H A;  1I2F A;  5D81 A;  1NJI 4;  3JUP A;  4BTX A;  4FCM A;  1G96 A;  3FGY A;  1BNG A;  1IT7 A;  3JVC A;  5AIH A;  3UL6 A;  4U13 A;  3PCS A;  5IEO A;  3WDG B;  2B1X B;  1L5G B;  2R4I A;  1GOV A;  1OGX A;  3DZL A;  1O7N B;  3B4O A;  4G1M B;  1DVD A;  4QWT A;  1RMS A;  3F8H A;  2JQ5 A;  3CC2 3;  2Z7A A;  1KD1 4;  2CWU A;  3ROB A;  4L8P A;  3X41 A;  1B2S A;  2F5W A;  4STD A;  3WMD A;  3OXA A;  4IIA A;  4R9L A;  6RNT A;  4EV2 A;  4FMC A;  2KAA A;  1I3F A;  4FMB A;  3G4S 3;  2O3O A;  2GBW B;  4L7K A;  1YJW 3;  1BU4 A;  1QAL A;  3GZR A;  2XH9 A;  1UUG B;  1G02 A;  2K54 A;  1BSC A;  3BNB A;  1YGE A;  1EG9 B;  1IDP A;  3F8X A;  4I4K A;  3J7Y d;  2BHM A;  1CQS A;  3EN8 A;  2GSP A;  1UGH I;  1Q40 A;  3MSO A;  3MYT A;  1STD A;  2YFI B;  1TRP A;  3X3X A;  1OF5 B;  3QK9 A;  3DY5 A;  5IER A;  3G8Z A;  2QEX 3;  1VQK 3;  2WGO A;  3GZX B;  3MWZ A;  5EEO A;  4HBR A;  1FGT A;  3CCE 3;  1JKG A;  3AGN A;  1MGR A;  1JBR A;  3SED A;  1IYY A;  3NBR A;  2E2T A;  1IVW A;  3FG1 A;  4FMA A;  3CXC 2;  3CCM 3;  1E97 A;  2KF5 A;  5KP3 A;  1BAO A;  1RRL A;  2IYJ A;  5JBS A;  1KQS 2;  1YVB I;  1YNV X;  2HMJ B;  3FF0 A;  3LZA A;  3NV0 A;  3AHW A;  3ER7 A;  2KRT A;  4WYK B;  3BND A;  3LH4 A;  1IVU A;  1RCK A;  2CX0 A;  1FGM A;  3D9R A;  4FCZ A;  1HZ1 A;  4EC6 A;  1FZU A;  2FGT A;  2P0M A;  2YFL B;  1RKY A;  5GSP A;  3MKI A;  2H0H A;  3T8U A;  3G6E 3;  2OWP A;  2W56 A;  3Q90 A;  2SBL A;  3MG1 A;  3UL5 A;  5G1K A;  3GSP A;  4R1K A;  1IVV A;  5AI1 A;  1OGZ A;  3NBJ A;  5LC7 A;  1B2U A;  2YFJ B;  1JJ2 2;  1RSN A;  4LMI A;  1WTH A;  2IY2 A;  1Z1S A;  5AEW B;  2F86 B;  2IMJ A;  2CFD A;  4N3V A;  1DVC A;  3MPH A;  1VQL 3;  1Q81 4;  4WHA A;  4PEJ A;  1U8C B;  2PNC A;  1B3S A;  2WGQ A;  3V99 A;  3EQQ B;  1TFK A;  5DRE A;  2CKF B;  3OW2 2;  4O3V A;  1K73 4;  1J2B A;  5CK6 A;  3GRD A;  3RDE A;  5HOH A;  6STD A;  5IEN A;  3V92 A;  1W2Z A;  4HZB B;  1BNE A;  1BOX A;  3AMO B;  1D6Z A;  5LC6 A;  2HMM B;  1W7C A;  2OOV A;  3D4A A;  1BGS A;  1LNI A;  1ZGX A;  5IF6 A;  2UX0 A;  3KII A;  5CF1 A;  4RZM A;  3F40 A;  2KF6 A;  1ASK A;  4N6N B;  1EUI C;  2Z6B A;  2CWV A;  4ORL A;  2Y73 A;  4CJN A;  1R4C A;  1MWS A;  3VF1 A;  3GAX A;  3PYJ A;  4EW5 A;  2XF3 A;  3EE1 A;  1BNS A;  1VQM 3;  1BRN L;  2BIR A;  5CLK A;  2E2U A;  3RNT A;  1VQ5 3;  4KFD A;  3SXX A;  1AR0 A;  1CH0 A;  1TFO A;  2OQE C;  3QRD A;  4GHO A;  7RNT A;  2Y74 A;  2WOH A;  4HVN A;  1O7H B;  1CEW I;  1JN5 A;  1W02 A;  1UCI A;  1Q7H A;  2XGL A;  3A76 A;  3DUK A;  3LTD A;  3N8B A;  4EV5 A;  1V58 A;  1UI7 A;  1QMA A;  3EJV A;  2P0X A;  1KWI A;  2KXG A;  1OPY A;  2W9P A;  2XR8 B;  3OWY A;  1FA3 A;  1MWU A;  3D5G A;  3K5T A;  4EBG A;  1BUQ A;  4CDL A;  1GOU A;  1VQ9 3;  1IU7 A;  3OWU A;  2IUJ A;  1FGR A;  2O9U X;  2J8X B;  2CH9 A;  3AGO A;  3LML A;  3I55 3;  1UI8 A;  1TUH A;  1FGO A;  2P05 A;  3CNM A;  3WA2 X;  1K28 A;  5DRV A;  1SQW A;  1X1U A;  2CW9 A;  3V98 A;  1JV2 B;  3F9S A;  1YGW A;  3X42 A;  3CME 3;  5FW5 A;  1MNL A;  1QAK A;  2I9W A;  4FR9 A;  4ZM8 A;  2HML B;  4O8S A;  5IW9 A;  1O7M B;  4R80 A;  1GS3 A;  1JZD A;  1M1K 4;  1BNI A;  2H0I A;  2RGQ A;  4AEQ A;  5A0O B;  1N9E A;  4BIR A;  4KFE A;  1AVL A;  3BNC A;  2CG0 A;  3WR2 A;  1V74 A;  1IQX A;  1OAC A;  3EF8 A;  3K9M C;  3KFQ C;  6GSP A;  3K63 A;  3EBT A;  3O8Y A;  3SLU A;  2CWT A;  5I97 A;  2F56 A;  4J5K A;  1IVX A;  4X2H A;  2ML6 A;  2L4V A;  1T5Y A;  1RN1 A;  3WOF B;  1NWW A;  4XB5 A;  1GMR A;  3MHE A;  3Q1C A;  1B2Z A;  1I0V A;  2C4B A;  1X1W A;  1VQN 3;  3H3H A;  3BIR A;  1LOW A;  2Q07 A;  5FGO A;  2BNG A;  2F98 A;  5TGN A;  2GEY A;  4BL3 A;  5HGR A;  4BTY A;  1X1Y A;  1HYF A;  1JNQ A;  2HOH A;  2XFT A;  3HZP A;  1ULI B;  3EHC A;  1GSP A;  1T2I A;  1QVF 2;  2W2C A;  1RGG A;  3SOA A;  1NO3 A;  3JUQ A;  1I0X A;  4CCV A;  5JPP A;  3JUO A;  1IV9 A;  1BRG A;  1RGA A;  1ZX2 A;  1JB2 A;  1EKM A;  4BTW A;  3CCJ 3;  1JB5 A;  5AIG A;  3VGN A;  2FNQ A;  5AYR B;  1NB3 I;  4HM0 B;  2ZA4 A;  3F14 A;  3WOD G;  5JPU A;  1LXE A;  2GEX A;  4OVM A;  1FYS A;  1RDS A;  1AY7 A;  1Q40 B;  2F5M A;  1Y4K A;  3GZY B;  3U97 A;  1ISK A;  5M1A A;  3BNE A;  1SIH A;  3RGR A;  1JBS A;  1IQY A;  3FH1 A;  1UDI I;  2CG1 A;  1SJW A;  3SVA A;  3HOH A;  3JUM A;  1VQO 3;  3NQZ A;  4XBY A;  1RJO A;  1UCL A;  3Q3F A;  1ULJ B;  5IEP A;  2OTL 3;  1LOY A;  1W6Y A;  3CCU 3;  1PYL A;  3LTA A;  3M8C A;  3NV0 B;  1DMQ A;  3SX1 A;  4WP5 A;  5BXQ A;  1OCV A;  5KP4 A;  1DE3 A;  3FLJ A;  3DH2 A;  4HM7 B;  3EB8 A;  3CCQ 3;  1TJD A;  4IPB A;  4BL2 A;  3B4P A;  1K9M 4;  1I2E A;  1NNV A;  4AKY A;  3VSY A;  1SPU A;  1GOY A;  4KFF A;  1TIJ A;  2CFL A;  1VQQ A;  5AEU B;  5IG4 A;  2STD A;  3FG3 A;  1YIT 3;  2W56 B;  2OOV C;  1BVI A;  2BU4 A;  1EA2 A;  2F99 A;  3NQY A;  4N6T A;  1B2X A;  1RGH A;  1W4N A;  3X3Z A;  1DET A;  3TDG A;  1YHQ 3;  3HI7 A;  1RN7 A;  3CNX A;  4LGQ A;  1I2G A;  2H0G A;  1R4Y A;  1EQK A;  1U5O A;  4MMY B;  1D6U A;  1MOL A;  1O7G B;  2V1L A;  3CC7 3;  2GU1 A;  1IV7 A;  3DGO A;  1RRH A;  1GY6 A;  3X3Y A;  1YIJ 3;  7GSP A;  1DMN A;  3CC4 3;  1RTU A;  1RGL A;  4ILF A;  1LOX A;  5G2G A;  1W01 A;  1RNB A;  1E3V A;  5M18 A;  1BSE A;  4KZ1 A;  3LTB A;  2BMO B;  3JUN A;  4R4K A;  1I3I A;  1TP6 A;  2JDI H;  2XGN A;  5ELU A;  3KSP A;  3HX8 A;  1OHO A; 
#chains in the Genus database with same CATH homology
 5STD A;  4NHF A;  1LVN A;  3BLZ A;  3NUV A;  3N54 B;  3CU3 A;  2XSO B;  1IK3 A;  2WO0 A;  3B7C A;  4X2O A;  5AII A;  1OHS A;  4RNY A;  1N8Q A;  4HM8 B;  3S27 A;  1QJG A;  2Z77 A;  4IT7 A;  3CCR 3;  3G16 A;  1STF I;  3K7C A;  5D83 A;  2MC8 A;  3X40 A;  1A2K A;  1M90 4;  1WMO A;  1NDO B;  4HJL B;  3IMA B;  2KCD A;  1YJN 3;  1NB5 I;  2ZDJ A;  3GZB A;  1QVG 2;  1OUN A;  4N6O B;  2M7O A;  4XBX A;  1VQ8 3;  4HKV B;  4HM2 B;  3MG2 A;  2K0M A;  2LQV A;  3S28 A;  2A15 A;  2CIU A;  3FCS B;  3WA3 A;  4JF8 A;  4WFO A;  1HU9 A;  1W6G A;  4GB5 A;  1A2V A;  1GYB A;  1DMM A;  2CFW A;  4O02 B;  3DGL A;  3L0R A;  2Z76 A;  1JN5 B;  5CF2 A;  1W00 A;  3T8N A;  2W6J H;  5AIF A;  4OUQ A;  3HII A;  5ELJ A;  2RFR A;  2QA4 3;  5CXO A;  4EYC A;  2B24 B;  3DXO A;  4XM4 A;  3NHX A;  3S5C A;  1TU5 A;  4HM6 B;  2GXF A;  3IPT A;  1M9G A;  1UUV B;  2BMQ B;  2CFK A;  1VQ4 3;  3DGN A;  3S67 A;  3NBB A;  1QAF A;  3Q2P A;  1JRQ A;  4H3U A;  1UUW B;  3SOY A;  5D82 A;  3IJE B;  1N5H A;  3LT9 A;  3MG3 A;  3DGM A;  1W5Z A;  1VQ6 3;  1NU3 A;  1OF5 A;  4RNZ A;  3NXJ A;  1UW1 A;  1GD3 A;  1OH0 A;  1WMP A;  2GBX B;  3PS8 A;  3I56 3;  1WNH A;  3D3L A;  1O7W B;  5IG5 A;  3FG4 A;  1GD4 A;  4LSO A;  3STD A;  3CCS 3;  3EBY A;  4WWU C;  1S5A A;  4N6U A;  4Q53 A;  2C11 A;  4R9K A;  1SII A;  4EXR A;  1F8N A;  2P38 A;  1HKX A;  4XDW A;  1ZO2 A;  3PCR A;  4LZI A;  2XEP A;  1A67 A;  4WYK A;  4RBN A;  3FKA A;  2RCD A;  1DYU A;  3EN1 B;  2PZV A;  1IT8 A;  2FXT A;  1N8R 4;  3EX9 A;  7STD A;  2OCT A;  4HM1 B;  1K41 A;  2XFS A;  3S29 A;  2BT3 A;  2W03 A;  5BVB A;  1VQL 3;  1O7P B;  2XRX B;  2HMN B;  2P09 A;  2XSH B;  4LEH A;  5KP1 A;  2QGU A;  3NX0 A;  1E3R A;  1JKG B;  1GY5 A;  1N9J A;  3DM8 A;  3DMC A;  1Q7Y 4;  3KE7 A;  3E99 A;  4K90 B;  1US1 A;  5IG0 A;  1C7H A;  4HM4 B;  3UB1 A;  3FF2 A;  2QIY A;  2HMO B;  4MJD A;  4N6V 0;  3F7S A;  2D42 A;  3UNL A;  1N5P A;  3ALA A;  1LNH A;  3KN4 A;  3G0K A;  5IG3 A;  2LYX A;  3BB9 A;  3CCL 3;  1ROA A;  4K61 A;  3UJM A;  2ML5 A;  3I0Y A;  3LTC A;  3AMO A;  1D6Y A;  1CYU A;  3KKG A;  4XBT A;  4L8O A;  3T0U A;  1FUW A;  3H51 A;  5EVH A;  5EQL A;  2C10 A;  2CHC A;  1CYV A;  3PGB A;  4K1U A;  2MF7 A;  1GY7 A;  3GWR A;  4J9A A;  1FGQ A;  4MMX B;  2E2V A;  2CK3 H;  3LT8 A;  4FCJ A;  3CPO A;  3NM2 A;  1YI2 3;  3F7X A;  1AVK A;  1VQ7 3;  2OTJ 3;  4OK0 A;  1Q42 A;  3ECF A;  3K0Z A;  1W2B 2;  3CCV 3;  3WOE B;  2W0Q A;  1IQ8 A;  1WQL B;  4HM3 B;  1M1X B;  3B8L A;  4JRF A;  4NRE A;  2W04 A;  1YJ9 3;  2INX A;  3LYG A;  1OHP A;  5AYS C;  1PFP A;  3RGA A;  4MMZ B;  1K8A 4;  3FZW A;  1A90 A;  4HM5 B;  4O2H A;  4XDV A;  3OWS A;  1AV4 A;  3HIG A;  4FMD A;  2YX9 A;  3HK4 A;  4N6M A;  4K1V A;  3CMA 3;  4J8T A;  2W9Q A;  1PU4 A;  3KSE D;  4TX4 A;  4MEI A;  2BO9 B;  2D1W A;  4KVH A;  1VQP 3;  1KSI A;  4AKZ A;  1Q86 4;  3FSD A;  2IA7 A;  3CPW 2;  1KC8 4;  2ZL8 A;  2RSX A;  4HYZ A;  2BMR B;  3LXU X;  2OQE A;  3PZW A;  4N6L A;  3KZT A;  1WMN A;  2HMK B;  4H61 A;  2CFG A;  3PXM A;  3U1W A;  2WOF A;  8CHO A;  3EC9 A;  3CD6 3;  1S72 3;  1ROV A;  1W6C A;  4HZ9 B;  2IUK A;  3OV4 A;  1JB4 A;  3LOY A;  1VZZ A;  2CC3 A;  2GU3 A;  3OX9 A;  3NM7 A;  1Q82 4;  4GL6 A;  3N9H A;  5D81 A;  1NJI 4;  3JUP A;  4BTX A;  4FCM A;  1G96 A;  3FGY A;  1IT7 A;  3JVC A;  5AIH A;  3UL6 A;  4U13 A;  3PCS A;  5IEO A;  3WDG B;  2B1X B;  1L5G B;  2R4I A;  1OGX A;  3DZL A;  1O7N B;  3B4O A;  4G1M B;  1DVD A;  4QWT A;  3F8H A;  2JQ5 A;  3CC2 3;  2Z7A A;  1KD1 4;  2CWU A;  3ROB A;  4L8P A;  3X41 A;  4STD A;  3WMD A;  3OXA A;  4IIA A;  4R9L A;  4EV2 A;  4FMC A;  3G4S 3;  4FMB A;  1YJW 3;  2O3O A;  2GBW B;  4L7K A;  1QAL A;  3GZR A;  2XH9 A;  2K54 A;  3BNB A;  1YGE A;  1EG9 B;  1IDP A;  3F8X A;  4I4K A;  3J7Y d;  2BHM A;  1CQS A;  3EN8 A;  3MSO A;  1Q40 A;  3MYT A;  1STD A;  2YFI B;  3X3X A;  1OF5 B;  3QK9 A;  3DY5 A;  5IER A;  3G8Z A;  2QEX 3;  1VQK 3;  2WGO A;  3GZX B;  3MWZ A;  5EEO A;  4HBR A;  1FGT A;  3CCE 3;  1JKG A;  3SED A;  3NBR A;  2E2T A;  1IVW A;  3FG1 A;  4FMA A;  3CXC 2;  3CCM 3;  1E97 A;  5KP3 A;  1RRL A;  5JBS A;  1KQS 2;  1YVB I;  2HMJ B;  3FF0 A;  3LZA A;  3NV0 A;  3ER7 A;  2KRT A;  4WYK B;  3BND A;  3LH4 A;  1IVU A;  1FGM A;  3D9R A;  4FCZ A;  4EC6 A;  2FGT A;  2P0M A;  2YFL B;  1RKY A;  3MKI A;  3T8U A;  3G6E 3;  2OWP A;  2W56 A;  3Q90 A;  2SBL A;  3MG1 A;  3UL5 A;  4R1K A;  1IVV A;  5AI1 A;  1OGZ A;  3NBJ A;  5LC7 A;  2YFJ B;  1JJ2 2;  4LMI A;  1WTH A;  1Z1S A;  5AEW B;  2F86 B;  2IMJ A;  2CFD A;  4N3V A;  1DVC A;  3MPH A;  1Q81 4;  4WHA A;  4PEJ A;  1U8C B;  2PNC A;  2WGQ A;  3V99 A;  3EQQ B;  1TFK A;  5DRE A;  2CKF B;  3OW2 2;  4O3V A;  1K73 4;  1J2B A;  5CK6 A;  3GRD A;  3RDE A;  5IEN A;  6STD A;  3V92 A;  1W2Z A;  4HZB B;  3AMO B;  1D6Z A;  5LC6 A;  2HMM B;  1W7C A;  2OOV A;  5IF6 A;  2UX0 A;  3KII A;  5CF1 A;  4RZM A;  3F40 A;  1ASK A;  4N6N B;  2Z6B A;  2CWV A;  4ORL A;  2Y73 A;  1R4C A;  3VF1 A;  3GAX A;  3PYJ A;  2XF3 A;  3EE1 A;  1VQM 3;  5CLK A;  2E2U A;  1VQ5 3;  4KFD A;  3SXX A;  1AR0 A;  1TFO A;  2OQE C;  3QRD A;  2Y74 A;  2WOH A;  4HVN A;  1O7H B;  1CEW I;  1JN5 A;  1W02 A;  2XGL A;  3LTD A;  3N8B A;  3A76 A;  3DUK A;  4EV5 A;  1UI7 A;  1QMA A;  3EJV A;  2P0X A;  1KWI A;  2KXG A;  1OPY A;  2W9P A;  2XR8 B;  3OWY A;  1FA3 A;  3K5T A;  1BUQ A;  4EBG A;  4CDL A;  1VQ9 3;  1IU7 A;  3OWU A;  2IUJ A;  2O9U X;  1FGR A;  3LML A;  2CH9 A;  3I55 3;  1UI8 A;  1TUH A;  1FGO A;  2P05 A;  3CNM A;  3WA2 X;  1K28 A;  5DRV A;  1SQW A;  2CW9 A;  3V98 A;  1JV2 B;  3F9S A;  3X42 A;  3CME 3;  5FW5 A;  1MNL A;  1QAK A;  2I9W A;  4FR9 A;  4ZM8 A;  2HML B;  4O8S A;  5IW9 A;  1O7M B;  4R80 A;  1GS3 A;  1M1K 4;  2RGQ A;  4AEQ A;  5A0O B;  1N9E A;  4KFE A;  1AVL A;  3BNC A;  2CG0 A;  1V74 A;  1IQX A;  1OAC A;  3EF8 A;  3K9M C;  3KFQ C;  3K63 A;  3EBT A;  3O8Y A;  3SLU A;  2CWT A;  5I97 A;  1IVX A;  4X2H A;  2ML6 A;  2L4V A;  1T5Y A;  3WOF B;  1NWW A;  4XB5 A;  3MHE A;  3Q1C A;  1VQN 3;  3H3H A;  2Q07 A;  5FGO A;  2BNG A;  2F98 A;  5TGN A;  2GEY A;  5HGR A;  4BTY A;  1JNQ A;  2XFT A;  3HZP A;  1ULI B;  3EHC A;  1QVF 2;  2W2C A;  3SOA A;  1NO3 A;  3JUQ A;  4CCV A;  5JPP A;  3JUO A;  1IV9 A;  1ZX2 A;  1JB2 A;  1EKM A;  4BTW A;  3CCJ 3;  1JB5 A;  5AIG A;  3VGN A;  2FNQ A;  5AYR B;  1NB3 I;  4HM0 B;  3F14 A;  3WOD G;  5JPU A;  1LXE A;  2GEX A;  4OVM A;  1Q40 B;  1Y4K A;  3GZY B;  3U97 A;  1ISK A;  3BNE A;  1SIH A;  3RGR A;  1IQY A;  3FH1 A;  2CG1 A;  1SJW A;  3SVA A;  3JUM A;  1VQO 3;  3NQZ A;  4XBY A;  1RJO A;  1ULJ B;  5IEP A;  2OTL 3;  1W6Y A;  3CCU 3;  3LTA A;  3M8C A;  3NV0 B;  1DMQ A;  3SX1 A;  4WP5 A;  5BXQ A;  1OCV A;  5KP4 A;  3FLJ A;  4HM7 B;  3EB8 A;  3CCQ 3;  4IPB A;  3B4P A;  1K9M 4;  4AKY A;  3VSY A;  1SPU A;  4KFF A;  1TIJ A;  2CFL A;  5AEU B;  5IG4 A;  2STD A;  3FG3 A;  1YIT 3;  2W56 B;  2OOV C;  4N6T A;  1EA2 A;  2F99 A;  3NQY A;  1W4N A;  3X3Z A;  3TDG A;  1YHQ 3;  3HI7 A;  1RN7 A;  3CNX A;  4LGQ A;  1EQK A;  1U5O A;  4MMY B;  1D6U A;  1MOL A;  1O7G B;  2V1L A;  3CC7 3;  2GU1 A;  1IV7 A;  3DGO A;  1RRH A;  1GY6 A;  3X3Y A;  1YIJ 3;  1DMN A;  3CC4 3;  1LOX A;  5G2G A;  1W01 A;  1E3V A;  4KZ1 A;  3LTB A;  2BMO B;  3JUN A;  4R4K A;  2XGN A;  1TP6 A;  2JDI H;  5ELU A;  3G71 3;  3KSP A;  3HX8 A;  1OHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...