3LTBA

X-ray structure of a non-biological atp binding protein determined in the presence of 10 mm atp at 2.6 a after 3 weeks of incubation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
69
structure length
69
Chain Sequence
DDDDKKTNWLKRIYRVRPCVKCKVAPRDWKVKNKHLRIYNMCKTCFNNSIDIGDDTYHGHVDWLMYADS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP BINDING PROTEIN-DX
publication title Three-dimensional structures reveal multiple ADP/ATP binding modes for a synthetic class of artificial proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 19
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.210 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ltbA00
3DGLA 3DGMA 3LT9A 3LTCA 3LTDA 3DGNA 1UW1A 3DGOA 2P09A 3LTAA 2P0XA 3LT8A 3LTBA 2P05A
chains in the Genus database with same CATH superfamily
2BNGA 1E97A 2GEXA 3HI7A 4MJDA 4O8SA 1IU7A 1AQZA 4HZBB 5IW9A 5IEPA 5EQLA 1RGKA 3BIRA 2XH9A 2HMMB 2XFTA 2ZHXB 1RDSA 3EJVA 4HM1B 1LOVA 2BMOB 1UUVB 1BRHA 1BVIA 4STDA 1NB5I 4N6V0 1NNVA 1FUWA 1W2ZA 5CF1A 1RHLA 1W2B2 2OWPA 1JV2B 2GU1A 2W9QA 1RJOA 1BSBA 1S723 4HM5B 4H3UA 3ECFA 2CFLA 1RNBA 3K9MC 4L8OA 3S29A 4HVNA 4CJNA 3H3HA 1TUHA 4N6NB 3SX1A 3CC23 2W2CA 1X1YA 1Z1SA 7GSPA 2GU3A 1CYUA 4G1MB 4N6MA 3JUPA 4EW5A 1OHSA 4GSPA 2GEYA 5AYSC 5CF2A 1IQYA 1T2IA 4BL2A 3NBBA 2ML6A 1RCLA 4JF8A 1OUNA 1FGQA 1IQXA 3E99A 8RNTA 1SPUA 2OTJ3 1OACA 3EQQB 3NHXA 3CPW2 3MPHA 3OXAA 2GXFA 2R4IA 1GOUA 4KFDA 3ZG0A 1UCKA 4MEIA 2W0QA 1JKGB 1YNVX 5JPUA 2CHCA 1IVUA 2KXGA 2Y74A 3JUQA 5IERA 3LXUX 3WMDA 3GAXA 1NO3A 1A2PA 2C4BA 4RNZA 4HOHA 3CCU3 3WODG 4HYZA 5BVBA 3D4AA 3MG3A 4RNYA 1IV7A 2CG0A 1TRQA 3UL6A 2CFGA 3OWSA 3CME3 1AV4A 5AEUB 3B4OA 4FR9A 4HM8B 3KSED 1TRPA 2OCTA 3OX9A 4HM7B 2RNTA 3KN4A 3KIIA 1Q9EA 2P0XA 3CPOA 4FMBA 1I2FA 4J9AA 5KP1A 3B8LA 3NUVA 1JKGA 1JZOA 4KFEA 4AKZA 3LT9A 1RGFA 1VZZA 2R41A 1RMSA 2CK3H 5EEOA 2XSHB 3AMOB 1OPYA 1OH0A 2IYJA 4KVHA 5FGOA 1VQ83 6STDA 1MWSA 1B2SA 1BSCA 3KSPA 2O3OA 3V92A 5A0OB 1J2BA 1F8NA 1KC84 3CCM3 1TJDA 5LC6A 1UUWB 1FUSA 1RGGA 1A2VA 3LTCA 5AIGA 1VQ73 4EXRA 1LOYA 1BNSA 1SARA 1BUQA 4XM4A 5AI1A 1QAKA 1TP6A 4NHFA 1I0VA 2D1WA 3BNDA 4LSOA 2D42A 3PXMA 2Z6BA 1TIJA 1W01A 1Q864 3U97A 2CKFB 6GSPA 1GY6A 1RSNA 3DGMA 3VSYA 3G4S3 2CX0A 1O7MB 1N8R4 1BSAA 3NBRA 4OUQA 2E2UA 1B2XA 1MWUA 2P05A 4XB5A 1BNGA 3AHSA 3AHWA 4LEHA 3V99A 5IG4A 3IJEB 3DGNA 4XBXA 1BNRA 3J7Yd 3FLJA 2JQ5A 3U1WA 3DMCA 1EEJA 3X42A 3Q1CA 1FUTA 5CK6A 1PY3A 2XR8B 4R9KA 4X2OA 5EVHA 1Q7HA 2ZA4A 4BTYA 4BU4A 1FGRA 2Y73A 4FMAA 1AVLA 3WDGB 4EBGA 1W6CA 1QVF2 1IQ8A 1AVKA 2P0MA 4AEQA 1Q824 1QJGA 3X3ZA 3GZXB 1Q42A 3PS8A 1YHQ3 2E2TA 4WWUC 1IV9A 1BRNL 4RBNA 3EBYA 1BRJA 1RGAA 2OQEC 2P09A 2O9UX 2CFWA 3HIGA 2XF3A 2STDA 3AGOA 4FCZA 2P38A 1VQK3 2K3DA 1V57A 2IMJA 3BB9A 1GMQA 1OF5A 3DM8A 1PFPA 4BTWA 2BMQB 1IDPA 3ALAA 4BTXA 1BNFA 3A5EA 1KSIA 1C54A 1YVSA 3DGLA 4N6OB 1W6GA 1DE3A 1DMNA 1JJ22 2F5WA 1JBSA 3T8NA 1MWRA 3SXXA 1VQ43 2KF6A 1K734 5G2GA 2HMKB 4R1KA 1T2HA 5DREA 1MWTA 1EG9B 3K5TA 5G1KA 2J8XB 3B4PA 3UJMA 7RNTA 2XGNA 3MYTA 1FGMA 1BNEA 3FZWA 4R80A 2UGIA 1N5HA 3F40A 1QALA 4X2HA 4LZIA 2HMLB 1UGIA 3T0UA 4HM3B 2MF7A 5KP4A 3I0YA 4O2HA 5HGRA 2XGLA 2CFKA 1UW1A 1FYSA 2W56B 4FCMA 1ROVA 1YI23 4Q53A 1WQLB 2Z77A 4HKVB 2V1LA 3X41A 1D6ZA 5FW5A 2AADA 2CW9A 1ROAA 2CWVA 3CNMA 3F8XA 3PZWA 1WMOA 3QK9A 3PGBA 3T8UA 3M8CA 4L8PA 1ASKA 1US1A 2I9WA 4HM0B 4R9LA 2SBLA 4J5KA 1RNTA 1G02A 1O7WB 1I2GA 1TTOA 3G0KA 2HOHA 3O8YA 2OQEA 3LYGA 3IPTA 3GRDA 3ER7A 3NM7A 2W56A 5M1AA 3CCE3 4QWTA 3PCRA 4GB5A 3DGYA 3MKIA 3MWZA 2AAEA 2CX1A 3EC9A 1UDII 1BANA 3S67A 4CCVA 1M904 2RGQA 1N8QA 1NWWA 3MG1A 2FGTA 5BXQA 1IVXA 1STFI 2Z7AA 1ZO2A 2XEPA 1O7HB 3GZBA 3RDEA 5HOHA 1A2KA 2Z76A 1BSDA 3DY5A 3FG4A 3WR2A 1O7NB 1V58A 3D79A 1UCLA 1UI8A 3JUNA 4XDVA 1BRGA 3CC43 1G96A 1X1UA 1ZS7A 3KCHA 1BNIA 1ZGXA 1EQKA 4EV2A 1K8A4 1JBTA 1GMRA 1NJI4 1FGTA 1V74A 2F56A 3HIIA 3SLUA 1KD14 1RN1A 2QIYA 2GSPA 3QRDA 1C7HA 9RNTA 2CIUA 3ROBA 3SOAA 1JB4A 1E3VA 1LNHA 1RGLA 2UUGC 1RGEA 2HMNB 2WGOA 1RLSA 3KFQC 1U8CB 2HMOB 2RSXA 5IG0A 2YX9A 3S28A 1WMNA 1YVBI 1TU5A 1S5AA 4R4KA 1G0TA 4I4KA 1UUGB 1IVWA 1I3IA 1KWIA 1W02A 2WO0A 1IK3A 1ULIB 3A76A 2JDIH 3NV0A 3BNCA 6RNTA 1FA3A 1U5OA 3DXOA 3WA2X 1B2UA 1I70A 3X3XA 1TFKA 2Q07A 1JRQA 2L4VA 3CCL3 3F8HA 4RZMA 3KKGA 1FW7A 4ILFA 1KQS2 5AYRB 3GZYB 1I8VA 1EUIC 3Q90A 4N3VA 5BIRA 2BU4A 4EV5A 4XBYA 2F86B 1B2ZA 1AR0A 3JUOA 3Q2PA 1SIIA 4K90B 1N5PA 2CG1A 1PU4A 1ISKA 1YGEA 1BRIA 2INXA 2WOHA 4K1VA 2CFDA 3LTAA 1LQMB 2B24B 2H0HA 1BIRA 2C11A 1RN4A 3D3LA 1RRHA 1B3SA 1OF5B 2XFSA 4HM4B 2PZVA 5CLKA 4J5GA 4BL3A 3UNLA 1B2MA 3CCV3 1CH0A 2GBXB 4J8TA 2F5MA 4HZ9B 1BOXA 2KCDA 4N6TA 3N54B 3WA3A 1FZUA 2CWTA 1GY7A 3EN8A 3EHCA 1YIJ3 2ML5A 3CCJ3 4BIRA 4LMIA 3B7CA 2UX0A 5CXOA 4CPKA 5JBSA 1BRSA 4K61A 3FGYA 3STDA 1QMAA 1VQ93 1JB2A 1OGZA 1RCKA 1MGRA 1VQ53 3VF1A 1UCIA 1TFOA 4MMXB 1GY5A 1SQWA 3GSPA 2K54A 3EF8A 1R4YA 3F9SA 2H0IA 3VGNA 2BT3A 1BNJA 2CC3A 1GYBA 1Y4KA 4WP5A 4WHAA 5AIHA 3I553 3WOFB 1BGSA 1M9GA 5STDA 5AEWB 2KF3A 3WOEB 2WOFA 3SYUA 1CEWI 5RNTA 2KF5A 1GOVA 1MNLA 4GHOA 3ZFZA 1R4CA 2IUKA 1UI7A 4K1UA 3IMAB 1GMPA 2QA43 5D82A 1LVNA 5I97A 1UGHI 3HX8A 1AY7A 3L0RA 2SARA 2QGUA 1LOXA 4N6UA 1BAOA 4NPBA 3DGOA 4OK0A 1VQO3 1NU3A 1O7GB 1RN7A 3G8ZA 1DYUA 1GSPA 1CYVA 3DH2A 3LMLA 4GL6A 1IT7A 2F4YA 3G713 5D81A 1MOLA 2XRXB 1IYYA 3OWYA 1OHOA 3HOHA 3MHEA 1D6YA 4FMCA 4OVMA 1DVCA 1JN5A 3F7SA 2IUJA 5KP3A 4HAAA 3RGRA 1Q40A 3FF2A 4TX4A 5ELUA 3X3YA 4DKIA 3UB1A 3PCSA 4WYKB 1SJWA 1JB5A 1SIHA 1T3BA 4WFOA 3DUKA 4EYCA 4I5QA 3URPA 1OGXA 1D6UA 1IT8A 1STDA 1DMMA 2F99A 5BU4A 1UCJA 5M19A 1PYLA 3LTBA 1NB3I 1B21A 1X1XA 3AGNA 1NDOB 3OV4A 4O02B 2ZL8A 3LOYA 3H51A 4KZ1A 3G6E3 4PEJA 3CD63 1WTHA 2RFRA 4WYKA 3EB8A 1VQL3 1HU9A 2C10A 2W6JH 3D5IA 5TGNA 1YIT3 4MMYB 5LC7A 2ZDJA 3EBTA 4FMDA 3NV0B 1GD3A 3LH4A 2A15A 3MG2A 1I0XA 2FNQA 1BRKA 1LQGC 1RGHA 3MSOA 4LYLB 1WNHA 5G1LA 4AKYA 1CQSA 1W6YA 1O7PB 2IA7A 3X40A 3OW22 4NREA 3GZRA 3TDGA 3BU4A 4O3VA 2BO9B 3JUMA 1K28A 7STDA 2OOVC 5IEOA 2WGQA 1JZDA 4HBRA 5AIIA 3RGAA 2KAAA 3D5GA 3PYJA 5DRVA 3N8BA 2KF4A 3KZTA 2MC8A 2E2VA 1A90A 1GD4A 3FG1A 1FGOA 5M18A 2CH9A 4CDLA 2LQVA 4HJLB 1RRLA 1W4NA 4MMZB 1A67A 1LRAA 2FXTA 4IT7A 2L1SA 1X1WA 2YFLB 4IPBA 1HKXA 3RNTA 2M7OA 1L5GB 3K0ZA 3LZAA 1VQM3 3HK4A 2YFIB 3EN1B 3UL5A 1M1K4 2YFJB 4ZM8A 5IF6A 3CMA3 2RCDA 1N9JA 2W04A 4FCJA 4RNTA 4KFFA 4HM6B 3GWRA 4IIAA 1OCVA 3DZLA 1M1XB 4H61A 3EX9A 3CXC2 1OHPA 1RGCA 4XBTA 4N6LA 3CCR3 1BU4A 3CU3A 5IG3A 2XSOB 2H0GA 1IVVA 3NQZA 1VQP3 3NXJA 3I563 3LTDA 2F98A 3KE7A 1K41A 2B1XB 3BNBA 1EKMA 1W00A 1B27A 3JVCA 1LNIA 2RBIA 4U13A 4L7KA 2W9PA 1N9EA 5IENA 2OTL3 3AMOA 3SOYA 1Q814 3BLZA 1E3RA 1B20A 5ELJA 1BUJA 1YGWA 8CHOA 1W5ZA 2KRTA 2K0MA 1VQQA 5IG5A 3Q3FA 1RKYA 3D9RA 1K9M4 2PNCA 4KT3B 1JNQA 1MGWA 1I2EA 2IY2A 2OOVA 3WHOA 4EC6A 1QVG2 1VQN3 2HMJB 2GBWB 4ORLA 2W03A 3FG3A 2CWUA 1RTUA 3F14A 1HZ1A 2QEX3 3S27A 2BIRA 1QAFA 1WMPA 3CNXA 3NBJA 3SVAA 3HZPA 3FKAA 4XDWA 1W7CA 1DETA 3SEDA 3V98A 3EE1A 3F7XA 3NM2A 3CC73 1EA2A 1GOYA 1I3FA 1LXEA 3G16A 1DVDA 2BMRB 3OWUA 4HM2B 3FH1A 3CCQ3 1VQ63 1YJ93 1ZX2A 1BSEA 1Q7Y4 3FF0A 3FCSB 3NX0A 3ZG5A 3BNEA 3FSDA 5D83A 3LT8A 1JN5B 1ULJB 5GSPA 1JBRA 1GS3A 1YJW3 1Q40B 4JRFA 3NQYA 1LOWA 3CCS3 1DMQA 1T5YA 5JPPA 3K63A 3N9HA 4LGQA 1YJN3 1HYFA 5AIFA 3K7CA 3S5CA 2BHMA 2LYXA
chains in the Genus database with same CATH topology
2BNGA 1E97A 2GEXA 3HI7A 4MJDA 4O8SA 1IU7A 4HZBB 5IW9A 5IEPA 5EQLA 2XH9A 2HMMB 2XFTA 3EJVA 4HM1B 2BMOB 1UUVB 4STDA 1NB5I 4N6V0 1FUWA 1W2ZA 5CF1A 1W2B2 2OWPA 1JV2B 2GU1A 2W9QA 1RJOA 1S723 4HM5B 4H3UA 3ECFA 2CFLA 3K9MC 4L8OA 3S29A 4HVNA 3H3HA 1TUHA 4N6NB 3SX1A 3CC23 2W2CA 1Z1SA 2GU3A 1CYUA 4G1MB 4N6MA 3JUPA 1OHSA 2GEYA 5AYSC 5CF2A 1IQYA 3NBBA 2ML6A 4JF8A 1OUNA 1FGQA 1IQXA 3E99A 1SPUA 2OTJ3 1OACA 3EQQB 3NHXA 3CPW2 3MPHA 3OXAA 2GXFA 2R4IA 4KFDA 4MEIA 2W0QA 1JKGB 5JPUA 2CHCA 1IVUA 2KXGA 2Y74A 3JUQA 5IERA 3LXUX 3WMDA 3GAXA 1NO3A 4RNZA 3CCU3 3WODG 4HYZA 5BVBA 3MG3A 4RNYA 1IV7A 2CG0A 3UL6A 2CFGA 3OWSA 3CME3 1AV4A 5AEUB 3B4OA 4FR9A 4HM8B 3KSED 2OCTA 3OX9A 4HM7B 3KN4A 4J9AA 3KIIA 3CPOA 2P0XA 4FMBA 5KP1A 3B8LA 3NUVA 1JKGA 4KFEA 4AKZA 3LT9A 1VZZA 2CK3H 5EEOA 2XSHB 3AMOB 1OPYA 1OH0A 4KVHA 5FGOA 1VQ83 6STDA 3V92A 3KSPA 2O3OA 5A0OB 1J2BA 1F8NA 1KC84 3CCM3 5LC6A 1UUWB 1A2VA 3LTCA 5AIGA 1VQ73 4EXRA 1BUQA 4XM4A 5AI1A 1QAKA 1TP6A 4NHFA 2D1WA 3BNDA 4LSOA 2D42A 3PXMA 2Z6BA 1TIJA 1W01A 1Q864 3U97A 2CKFB 1GY6A 3DGMA 3VSYA 3G4S3 1O7MB 1N8R4 3NBRA 4OUQA 2E2UA 2P05A 4XB5A 4LEHA 5IG4A 3V99A 3IJEB 3DGNA 4XBXA 3J7Yd 3FLJA 2JQ5A 3U1WA 3DMCA 3X42A 3Q1CA 5CK6A 2XR8B 4X2OA 4R9KA 5EVHA 4BTYA 1FGRA 2Y73A 4FMAA 1AVLA 3WDGB 4EBGA 1W6CA 1QVF2 1IQ8A 1AVKA 2P0MA 4AEQA 1Q824 1QJGA 3X3ZA 3GZXB 1Q42A 3PS8A 1YHQ3 2E2TA 4WWUC 1IV9A 4RBNA 3EBYA 2OQEC 2P09A 2O9UX 2CFWA 3HIGA 2XF3A 2STDA 4FCZA 2P38A 1VQK3 2IMJA 3BB9A 3DM8A 1OF5A 1PFPA 4BTWA 1IDPA 3ALAA 4BTXA 1KSIA 4N6OB 3DGLA 1W6GA 1DMNA 1JJ22 3T8NA 3SXXA 1VQ43 1K734 5G2GA 2HMKB 4R1KA 5DREA 1EG9B 3K5TA 3B4PA 3UJMA 2XGNA 3MYTA 1FGMA 3FZWA 4R80A 1N5HA 3F40A 1QALA 4X2HA 4LZIA 2HMLB 3T0UA 4HM3B 2MF7A 5KP4A 3I0YA 4O2HA 5HGRA 2XGLA 2CFKA 1UW1A 2W56B 1YI23 4FCMA 1ROVA 4Q53A 1WQLB 2Z77A 4HKVB 2V1LA 3X41A 1D6ZA 5FW5A 2CW9A 1ROAA 2CWVA 3CNMA 3F8XA 3PZWA 1WMOA 3QK9A 3PGBA 3T8UA 3M8CA 4L8PA 1ASKA 1US1A 2I9WA 4HM0B 4R9LA 2SBLA 2BHMA 1O7WB 3G0KA 3O8YA 2OQEA 3LYGA 3IPTA 3GRDA 3ER7A 3NM7A 2W56A 3CCE3 4QWTA 3PCRA 4GB5A 3MKIA 3MWZA 3EC9A 1M904 3S67A 4CCVA 2RGQA 1N8QA 1NWWA 3MG1A 2FGTA 5BXQA 1IVXA 1STFI 2Z7AA 1ZO2A 2XEPA 1O7HB 3GZBA 3RDEA 1A2KA 2Z76A 3DY5A 3FG4A 1O7NB 1UI8A 3JUNA 4XDVA 3CC43 1G96A 1EQKA 4EV2A 1K8A4 1NJI4 1FGTA 1V74A 3HIIA 3SLUA 1KD14 2QIYA 3QRDA 1C7HA 2CIUA 3ROBA 3SOAA 1JB4A 1E3VA 1LNHA 2WGOA 2HMNB 3KFQC 1U8CB 2HMOB 2RSXA 5IG0A 2YX9A 3S28A 1WMNA 1YVBI 1TU5A 1S5AA 4R4KA 4I4KA 1IVWA 1KWIA 1W02A 2WO0A 1IK3A 1ULIB 3A76A 2JDIH 3NV0A 3BNCA 1FA3A 1U5OA 3DXOA 3WA2X 3X3XA 1TFKA 2Q07A 1JRQA 2L4VA 3CCL3 3F8HA 4RZMA 3KKGA 1KQS2 5AYRB 3GZYB 3Q90A 4N3VA 4EV5A 4XBYA 2F86B 1AR0A 3JUOA 3Q2PA 4K90B 1SIIA 2CG1A 1N5PA 1PU4A 1ISKA 1YGEA 2INXA 2WOHA 4K1VA 2CFDA 3LTAA 2B24B 2C11A 3D3LA 1RRHA 1OF5B 2XFSA 4HM4B 2PZVA 5CLKA 3UNLA 3CCV3 2GBXB 4J8TA 4HZ9B 2KCDA 4N6TA 3N54B 3WA3A 2CWTA 1GY7A 3EN8A 3EHCA 1YIJ3 2ML5A 3CCJ3 4LMIA 3B7CA 2UX0A 5CXOA 5JBSA 4K61A 3FGYA 3STDA 1QMAA 1VQ93 1JB2A 1OGZA 1VQ53 3VF1A 1TFOA 4MMXB 1GY5A 1SQWA 2K54A 3EF8A 3F9SA 3VGNA 2BT3A 2CC3A 1GYBA 1Y4KA 4WP5A 4WHAA 5AIHA 3I553 3WOFB 1M9GA 5STDA 5AEWB 3WOEB 2WOFA 1CEWI 1MNLA 1R4CA 2IUKA 1UI7A 4K1UA 3IMAB 2QA43 5D82A 1LVNA 5I97A 3HX8A 3L0RA 2QGUA 1LOXA 4N6UA 3DGOA 4OK0A 1VQO3 1NU3A 1O7GB 1RN7A 3G8ZA 1DYUA 4GL6A 1CYVA 3LMLA 1IT7A 3G713 5D81A 1MOLA 2XRXB 3OWYA 1OHOA 3MHEA 1D6YA 4FMCA 4OVMA 1DVCA 1JN5A 3F7SA 2IUJA 5KP3A 3RGRA 1Q40A 3FF2A 4TX4A 5ELUA 3X3YA 3UB1A 3PCSA 4WYKB 1SJWA 1JB5A 1SIHA 4WFOA 3DUKA 4EYCA 1OGXA 1D6UA 1IT8A 1STDA 1DMMA 2F99A 3LTBA 1NB3I 1NDOB 3OV4A 4O02B 2ZL8A 3LOYA 3H51A 4KZ1A 3G6E3 4PEJA 3CD63 1WTHA 2RFRA 4WYKA 3EB8A 1VQL3 1HU9A 2C10A 2W6JH 5TGNA 1YIT3 4MMYB 5LC7A 2ZDJA 3EBTA 4FMDA 3NV0B 1GD3A 3LH4A 2A15A 3MG2A 2FNQA 3MSOA 4AKYA 1WNHA 1CQSA 1W6YA 1O7PB 2IA7A 3X40A 3OW22 4NREA 3GZRA 3TDGA 4O3VA 2BO9B 3JUMA 1K28A 7STDA 2OOVC 5IEOA 2WGQA 4HBRA 5AIIA 3RGAA 3PYJA 5DRVA 3N8BA 3KZTA 2MC8A 2E2VA 1A90A 1GD4A 3FG1A 1FGOA 2CH9A 4CDLA 2LQVA 4HJLB 1RRLA 1W4NA 4MMZB 1A67A 2FXTA 4IT7A 2YFLB 4IPBA 1HKXA 2M7OA 1L5GB 3K0ZA 3LZAA 1VQM3 3HK4A 2YFIB 3EN1B 3UL5A 1M1K4 2YFJB 4ZM8A 5IF6A 3CMA3 2RCDA 1N9JA 2W04A 4FCJA 4KFFA 4HM6B 3GWRA 4IIAA 1OCVA 3DZLA 1M1XB 4H61A 3EX9A 3CXC2 1OHPA 4XBTA 4N6LA 3CCR3 3CU3A 5IG3A 2XSOB 1IVVA 3NQZA 1VQP3 3NXJA 3I563 3LTDA 2F98A 3KE7A 1K41A 2B1XB 3BNBA 1EKMA 1W00A 3JVCA 5IENA 4U13A 4L7KA 2W9PA 1N9EA 2OTL3 3AMOA 3SOYA 1Q814 3BLZA 1E3RA 5ELJA 8CHOA 1W5ZA 2KRTA 2K0MA 5IG5A 1RKYA 1K9M4 3D9RA 2PNCA 1JNQA 2OOVA 1QVG2 4EC6A 1VQN3 2HMJB 2GBWB 4ORLA 2W03A 3FG3A 2CWUA 3F14A 2QEX3 3S27A 1WMPA 1QAFA 3CNXA 3NBJA 3SVAA 3HZPA 3FKAA 4XDWA 1W7CA 3V98A 3SEDA 3EE1A 3F7XA 3NM2A 3CC73 1EA2A 1LXEA 3G16A 1DVDA 2BMRB 3OWUA 4HM2B 3FH1A 3CCQ3 1VQ63 1YJ93 1ZX2A 1Q7Y4 3FF0A 3FCSB 3NX0A 3BNEA 3FSDA 5D83A 3LT8A 1JN5B 1ULJB 1GS3A 1YJW3 1Q40B 4JRFA 3NQYA 3CCS3 1DMQA 1T5YA 5JPPA 3K63A 3N9HA 4LGQA 1YJN3 5AIFA 3K7CA 3S5CA 2BMQB 2LYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGL A;  3DGM A;  3LT9 A;  3LTC A;  3LTD A;  3DGN A;  1UW1 A;  3DGO A;  2P09 A;  3LTA A;  2P0X A;  3LT8 A;  3LTB A;  2P05 A; 
#chains in the Genus database with same CATH topology
 2BNG A;  1E97 A;  2GEX A;  3HI7 A;  4MJD A;  4O8S A;  1IU7 A;  1AQZ A;  4HZB B;  5IW9 A;  5IEP A;  5EQL A;  1RGK A;  3BIR A;  2XH9 A;  2HMM B;  2XFT A;  2ZHX B;  1RDS A;  3EJV A;  4HM1 B;  1LOV A;  2BMO B;  1UUV B;  1BRH A;  1BVI A;  4STD A;  1NB5 I;  4N6V 0;  1NNV A;  1FUW A;  1W2Z A;  5CF1 A;  1RHL A;  1W2B 2;  2OWP A;  1JV2 B;  2GU1 A;  2W9Q A;  1RJO A;  1BSB A;  1S72 3;  4HM5 B;  4H3U A;  3ECF A;  2CFL A;  1RNB A;  3K9M C;  4L8O A;  3S29 A;  4HVN A;  4CJN A;  3H3H A;  1TUH A;  4N6N B;  3SX1 A;  3CC2 3;  2W2C A;  1X1Y A;  1Z1S A;  7GSP A;  2GU3 A;  1CYU A;  4G1M B;  4N6M A;  3JUP A;  4EW5 A;  1OHS A;  4GSP A;  2GEY A;  5AYS C;  5CF2 A;  1IQY A;  1T2I A;  4BL2 A;  3NBB A;  2ML6 A;  1RCL A;  4JF8 A;  1OUN A;  1FGQ A;  1IQX A;  3E99 A;  8RNT A;  1SPU A;  2OTJ 3;  1OAC A;  3EQQ B;  3NHX A;  3CPW 2;  3MPH A;  3OXA A;  2GXF A;  2R4I A;  1GOU A;  4KFD A;  3ZG0 A;  1UCK A;  4MEI A;  2W0Q A;  1JKG B;  1YNV X;  5JPU A;  2CHC A;  1IVU A;  2KXG A;  2Y74 A;  3JUQ A;  5IER A;  3LXU X;  3WMD A;  3GAX A;  1NO3 A;  1A2P A;  2C4B A;  4RNZ A;  4HOH A;  3CCU 3;  3WOD G;  4HYZ A;  5BVB A;  3D4A A;  3MG3 A;  4RNY A;  1IV7 A;  2CG0 A;  1TRQ A;  3UL6 A;  2CFG A;  3OWS A;  3CME 3;  1AV4 A;  5AEU B;  3B4O A;  4FR9 A;  4HM8 B;  3KSE D;  1TRP A;  2OCT A;  3OX9 A;  4HM7 B;  2RNT A;  3KN4 A;  3KII A;  1Q9E A;  2P0X A;  3CPO A;  4FMB A;  1I2F A;  4J9A A;  5KP1 A;  3B8L A;  3NUV A;  1JKG A;  1JZO A;  4KFE A;  4AKZ A;  3LT9 A;  1RGF A;  1VZZ A;  2R41 A;  1RMS A;  2CK3 H;  5EEO A;  2XSH B;  3AMO B;  1OPY A;  1OH0 A;  2IYJ A;  4KVH A;  5FGO A;  1VQ8 3;  6STD A;  1MWS A;  1B2S A;  1BSC A;  3KSP A;  2O3O A;  3V92 A;  5A0O B;  1J2B A;  1F8N A;  1KC8 4;  3CCM 3;  1TJD A;  5LC6 A;  1UUW B;  1FUS A;  1RGG A;  1A2V A;  3LTC A;  5AIG A;  1VQ7 3;  4EXR A;  1LOY A;  1BNS A;  1SAR A;  1BUQ A;  4XM4 A;  5AI1 A;  1QAK A;  1TP6 A;  4NHF A;  1I0V A;  2D1W A;  3BND A;  4LSO A;  2D42 A;  3PXM A;  2Z6B A;  1TIJ A;  1W01 A;  1Q86 4;  3U97 A;  2CKF B;  6GSP A;  1GY6 A;  1RSN A;  3DGM A;  3VSY A;  3G4S 3;  2CX0 A;  1O7M B;  1N8R 4;  1BSA A;  3NBR A;  4OUQ A;  2E2U A;  1B2X A;  1MWU A;  2P05 A;  4XB5 A;  1BNG A;  3AHS A;  3AHW A;  4LEH A;  3V99 A;  5IG4 A;  3IJE B;  3DGN A;  4XBX A;  1BNR A;  3J7Y d;  3FLJ A;  2JQ5 A;  3U1W A;  3DMC A;  1EEJ A;  3X42 A;  3Q1C A;  1FUT A;  5CK6 A;  1PY3 A;  2XR8 B;  4R9K A;  4X2O A;  5EVH A;  1Q7H A;  2ZA4 A;  4BTY A;  4BU4 A;  1FGR A;  2Y73 A;  4FMA A;  1AVL A;  3WDG B;  4EBG A;  1W6C A;  1QVF 2;  1IQ8 A;  1AVK A;  2P0M A;  4AEQ A;  1Q82 4;  1QJG A;  3X3Z A;  3GZX B;  1Q42 A;  3PS8 A;  1YHQ 3;  2E2T A;  4WWU C;  1IV9 A;  1BRN L;  4RBN A;  3EBY A;  1BRJ A;  1RGA A;  2OQE C;  2P09 A;  2O9U X;  2CFW A;  3HIG A;  2XF3 A;  2STD A;  3AGO A;  4FCZ A;  2P38 A;  1VQK 3;  2K3D A;  1V57 A;  2IMJ A;  3BB9 A;  1GMQ A;  1OF5 A;  3DM8 A;  1PFP A;  4BTW A;  2BMQ B;  1IDP A;  3ALA A;  4BTX A;  1BNF A;  3A5E A;  1KSI A;  1C54 A;  1YVS A;  3DGL A;  4N6O B;  1W6G A;  1DE3 A;  1DMN A;  1JJ2 2;  2F5W A;  1JBS A;  3T8N A;  1MWR A;  3SXX A;  1VQ4 3;  2KF6 A;  1K73 4;  5G2G A;  2HMK B;  4R1K A;  1T2H A;  5DRE A;  1MWT A;  1EG9 B;  3K5T A;  5G1K A;  2J8X B;  3B4P A;  3UJM A;  7RNT A;  2XGN A;  3MYT A;  1FGM A;  1BNE A;  3FZW A;  4R80 A;  2UGI A;  1N5H A;  3F40 A;  1QAL A;  4X2H A;  4LZI A;  2HML B;  1UGI A;  3T0U A;  4HM3 B;  2MF7 A;  5KP4 A;  3I0Y A;  4O2H A;  5HGR A;  2XGL A;  2CFK A;  1UW1 A;  1FYS A;  2W56 B;  4FCM A;  1ROV A;  1YI2 3;  4Q53 A;  1WQL B;  2Z77 A;  4HKV B;  2V1L A;  3X41 A;  1D6Z A;  5FW5 A;  2AAD A;  2CW9 A;  1ROA A;  2CWV A;  3CNM A;  3F8X A;  3PZW A;  1WMO A;  3QK9 A;  3PGB A;  3T8U A;  3M8C A;  4L8P A;  1ASK A;  1US1 A;  2I9W A;  4HM0 B;  4R9L A;  2SBL A;  4J5K A;  1RNT A;  1G02 A;  1O7W B;  1I2G A;  1TTO A;  3G0K A;  2HOH A;  3O8Y A;  2OQE A;  3LYG A;  3IPT A;  3GRD A;  3ER7 A;  3NM7 A;  2W56 A;  5M1A A;  3CCE 3;  4QWT A;  3PCR A;  4GB5 A;  3DGY A;  3MKI A;  3MWZ A;  2AAE A;  2CX1 A;  3EC9 A;  1UDI I;  1BAN A;  3S67 A;  4CCV A;  1M90 4;  2RGQ A;  1N8Q A;  1NWW A;  3MG1 A;  2FGT A;  5BXQ A;  1IVX A;  1STF I;  2Z7A A;  1ZO2 A;  2XEP A;  1O7H B;  3GZB A;  3RDE A;  5HOH A;  1A2K A;  2Z76 A;  1BSD A;  3DY5 A;  3FG4 A;  3WR2 A;  1O7N B;  1V58 A;  3D79 A;  1UCL A;  1UI8 A;  3JUN A;  4XDV A;  1BRG A;  3CC4 3;  1G96 A;  1X1U A;  1ZS7 A;  3KCH A;  1BNI A;  1ZGX A;  1EQK A;  4EV2 A;  1K8A 4;  1JBT A;  1GMR A;  1NJI 4;  1FGT A;  1V74 A;  2F56 A;  3HII A;  3SLU A;  1KD1 4;  1RN1 A;  2QIY A;  2GSP A;  3QRD A;  1C7H A;  9RNT A;  2CIU A;  3ROB A;  3SOA A;  1JB4 A;  1E3V A;  1LNH A;  1RGL A;  2UUG C;  1RGE A;  2HMN B;  2WGO A;  1RLS A;  3KFQ C;  1U8C B;  2HMO B;  2RSX A;  5IG0 A;  2YX9 A;  3S28 A;  1WMN A;  1YVB I;  1TU5 A;  1S5A A;  4R4K A;  1G0T A;  4I4K A;  1UUG B;  1IVW A;  1I3I A;  1KWI A;  1W02 A;  2WO0 A;  1IK3 A;  1ULI B;  3A76 A;  2JDI H;  3NV0 A;  3BNC A;  6RNT A;  1FA3 A;  1U5O A;  3DXO A;  3WA2 X;  1B2U A;  1I70 A;  3X3X A;  1TFK A;  2Q07 A;  1JRQ A;  2L4V A;  3CCL 3;  3F8H A;  4RZM A;  3KKG A;  1FW7 A;  4ILF A;  1KQS 2;  5AYR B;  3GZY B;  1I8V A;  1EUI C;  3Q90 A;  4N3V A;  5BIR A;  2BU4 A;  4EV5 A;  4XBY A;  2F86 B;  1B2Z A;  1AR0 A;  3JUO A;  3Q2P A;  1SII A;  4K90 B;  1N5P A;  2CG1 A;  1PU4 A;  1ISK A;  1YGE A;  1BRI A;  2INX A;  2WOH A;  4K1V A;  2CFD A;  3LTA A;  1LQM B;  2B24 B;  2H0H A;  1BIR A;  2C11 A;  1RN4 A;  3D3L A;  1RRH A;  1B3S A;  1OF5 B;  2XFS A;  4HM4 B;  2PZV A;  5CLK A;  4J5G A;  4BL3 A;  3UNL A;  1B2M A;  3CCV 3;  1CH0 A;  2GBX B;  4J8T A;  2F5M A;  4HZ9 B;  1BOX A;  2KCD A;  4N6T A;  3N54 B;  3WA3 A;  1FZU A;  2CWT A;  1GY7 A;  3EN8 A;  3EHC A;  1YIJ 3;  2ML5 A;  3CCJ 3;  4BIR A;  4LMI A;  3B7C A;  2UX0 A;  5CXO A;  4CPK A;  5JBS A;  1BRS A;  4K61 A;  3FGY A;  3STD A;  1QMA A;  1VQ9 3;  1JB2 A;  1OGZ A;  1RCK A;  1MGR A;  1VQ5 3;  3VF1 A;  1UCI A;  1TFO A;  4MMX B;  1GY5 A;  1SQW A;  3GSP A;  2K54 A;  3EF8 A;  1R4Y A;  3F9S A;  2H0I A;  3VGN A;  2BT3 A;  1BNJ A;  2CC3 A;  1GYB A;  1Y4K A;  4WP5 A;  4WHA A;  5AIH A;  3I55 3;  3WOF B;  1BGS A;  1M9G A;  5STD A;  5AEW B;  2KF3 A;  3WOE B;  2WOF A;  3SYU A;  1CEW I;  5RNT A;  2KF5 A;  1GOV A;  1MNL A;  4GHO A;  3ZFZ A;  1R4C A;  2IUK A;  1UI7 A;  4K1U A;  3IMA B;  1GMP A;  2QA4 3;  5D82 A;  1LVN A;  5I97 A;  1UGH I;  3HX8 A;  1AY7 A;  3L0R A;  2SAR A;  2QGU A;  1LOX A;  4N6U A;  1BAO A;  4NPB A;  3DGO A;  4OK0 A;  1VQO 3;  1NU3 A;  1O7G B;  1RN7 A;  3G8Z A;  1DYU A;  1GSP A;  1CYV A;  3DH2 A;  3LML A;  4GL6 A;  1IT7 A;  2F4Y A;  3G71 3;  5D81 A;  1MOL A;  2XRX B;  1IYY A;  3OWY A;  1OHO A;  3HOH A;  3MHE A;  1D6Y A;  4FMC A;  4OVM A;  1DVC A;  1JN5 A;  3F7S A;  2IUJ A;  5KP3 A;  4HAA A;  3RGR A;  1Q40 A;  3FF2 A;  4TX4 A;  5ELU A;  3X3Y A;  4DKI A;  3UB1 A;  3PCS A;  4WYK B;  1SJW A;  1JB5 A;  1SIH A;  1T3B A;  4WFO A;  3DUK A;  4EYC A;  4I5Q A;  3URP A;  1OGX A;  1D6U A;  1IT8 A;  1STD A;  1DMM A;  2F99 A;  5BU4 A;  1UCJ A;  5M19 A;  1PYL A;  3LTB A;  1NB3 I;  1B21 A;  1X1X A;  3AGN A;  1NDO B;  3OV4 A;  4O02 B;  2ZL8 A;  3LOY A;  3H51 A;  4KZ1 A;  3G6E 3;  4PEJ A;  3CD6 3;  1WTH A;  2RFR A;  4WYK A;  3EB8 A;  1VQL 3;  1HU9 A;  2C10 A;  2W6J H;  3D5I A;  5TGN A;  1YIT 3;  4MMY B;  5LC7 A;  2ZDJ A;  3EBT A;  4FMD A;  3NV0 B;  1GD3 A;  3LH4 A;  2A15 A;  3MG2 A;  1I0X A;  2FNQ A;  1BRK A;  1LQG C;  1RGH A;  3MSO A;  4LYL B;  1WNH A;  5G1L A;  4AKY A;  1CQS A;  1W6Y A;  1O7P B;  2IA7 A;  3X40 A;  3OW2 2;  4NRE A;  3GZR A;  3TDG A;  3BU4 A;  4O3V A;  2BO9 B;  3JUM A;  1K28 A;  7STD A;  2OOV C;  5IEO A;  2WGQ A;  1JZD A;  4HBR A;  5AII A;  3RGA A;  2KAA A;  3D5G A;  3PYJ A;  5DRV A;  3N8B A;  2KF4 A;  3KZT A;  2MC8 A;  2E2V A;  1A90 A;  1GD4 A;  3FG1 A;  1FGO A;  5M18 A;  2CH9 A;  4CDL A;  2LQV A;  4HJL B;  1RRL A;  1W4N A;  4MMZ B;  1A67 A;  1LRA A;  2FXT A;  4IT7 A;  2L1S A;  1X1W A;  2YFL B;  4IPB A;  1HKX A;  3RNT A;  2M7O A;  1L5G B;  3K0Z A;  3LZA A;  1VQM 3;  3HK4 A;  2YFI B;  3EN1 B;  3UL5 A;  1M1K 4;  2YFJ B;  4ZM8 A;  5IF6 A;  3CMA 3;  2RCD A;  1N9J A;  2W04 A;  4FCJ A;  4RNT A;  4KFF A;  4HM6 B;  3GWR A;  4IIA A;  1OCV A;  3DZL A;  1M1X B;  4H61 A;  3EX9 A;  3CXC 2;  1OHP A;  1RGC A;  4XBT A;  4N6L A;  3CCR 3;  1BU4 A;  3CU3 A;  5IG3 A;  2XSO B;  2H0G A;  1IVV A;  3NQZ A;  1VQP 3;  3NXJ A;  3I56 3;  3LTD A;  2F98 A;  3KE7 A;  1K41 A;  2B1X B;  3BNB A;  1EKM A;  1W00 A;  1B27 A;  3JVC A;  1LNI A;  2RBI A;  4U13 A;  4L7K A;  2W9P A;  1N9E A;  5IEN A;  2OTL 3;  3AMO A;  3SOY A;  1Q81 4;  3BLZ A;  1E3R A;  1B20 A;  5ELJ A;  1BUJ A;  1YGW A;  8CHO A;  1W5Z A;  2KRT A;  2K0M A;  1VQQ A;  5IG5 A;  3Q3F A;  1RKY A;  3D9R A;  1K9M 4;  2PNC A;  4KT3 B;  1JNQ A;  1MGW A;  1I2E A;  2IY2 A;  2OOV A;  3WHO A;  4EC6 A;  1QVG 2;  1VQN 3;  2HMJ B;  2GBW B;  4ORL A;  2W03 A;  3FG3 A;  2CWU A;  1RTU A;  3F14 A;  1HZ1 A;  2QEX 3;  3S27 A;  2BIR A;  1QAF A;  1WMP A;  3CNX A;  3NBJ A;  3SVA A;  3HZP A;  3FKA A;  4XDW A;  1W7C A;  1DET A;  3SED A;  3V98 A;  3EE1 A;  3F7X A;  3NM2 A;  3CC7 3;  1EA2 A;  1GOY A;  1I3F A;  1LXE A;  3G16 A;  1DVD A;  2BMR B;  3OWU A;  4HM2 B;  3FH1 A;  3CCQ 3;  1VQ6 3;  1YJ9 3;  1ZX2 A;  1BSE A;  1Q7Y 4;  3FF0 A;  3FCS B;  3NX0 A;  3ZG5 A;  3BNE A;  3FSD A;  5D83 A;  3LT8 A;  1JN5 B;  1ULJ B;  5GSP A;  1JBR A;  1GS3 A;  1YJW 3;  1Q40 B;  4JRF A;  3NQY A;  1LOW A;  3CCS 3;  1DMQ A;  1T5Y A;  5JPP A;  3K63 A;  3N9H A;  4LGQ A;  1YJN 3;  1HYF A;  5AIF A;  3K7C A;  3S5C A;  2BHM A;  2LYX A; 
#chains in the Genus database with same CATH homology
 2BNG A;  1E97 A;  2GEX A;  3HI7 A;  4MJD A;  4O8S A;  1IU7 A;  4HZB B;  5IW9 A;  5IEP A;  5EQL A;  2XH9 A;  2HMM B;  2XFT A;  3EJV A;  4HM1 B;  2BMO B;  1UUV B;  4STD A;  1NB5 I;  4N6V 0;  1FUW A;  1W2Z A;  5CF1 A;  1W2B 2;  2OWP A;  1JV2 B;  2GU1 A;  2W9Q A;  1RJO A;  1S72 3;  4HM5 B;  4H3U A;  3ECF A;  2CFL A;  3K9M C;  4L8O A;  3S29 A;  4HVN A;  3H3H A;  1TUH A;  4N6N B;  3SX1 A;  3CC2 3;  2W2C A;  1Z1S A;  2GU3 A;  1CYU A;  4G1M B;  4N6M A;  3JUP A;  1OHS A;  2GEY A;  5AYS C;  5CF2 A;  1IQY A;  3NBB A;  2ML6 A;  4JF8 A;  1OUN A;  1FGQ A;  1IQX A;  3E99 A;  1SPU A;  2OTJ 3;  1OAC A;  3EQQ B;  3NHX A;  3CPW 2;  3MPH A;  3OXA A;  2GXF A;  2R4I A;  4KFD A;  4MEI A;  2W0Q A;  1JKG B;  5JPU A;  2CHC A;  1IVU A;  2KXG A;  2Y74 A;  3JUQ A;  5IER A;  3LXU X;  3WMD A;  3GAX A;  1NO3 A;  4RNZ A;  3CCU 3;  3WOD G;  4HYZ A;  5BVB A;  3MG3 A;  4RNY A;  1IV7 A;  2CG0 A;  3UL6 A;  2CFG A;  3OWS A;  3CME 3;  1AV4 A;  5AEU B;  3B4O A;  4FR9 A;  4HM8 B;  3KSE D;  2OCT A;  3OX9 A;  4HM7 B;  3KN4 A;  4J9A A;  3KII A;  3CPO A;  2P0X A;  4FMB A;  5KP1 A;  3B8L A;  3NUV A;  1JKG A;  4KFE A;  4AKZ A;  3LT9 A;  1VZZ A;  2CK3 H;  5EEO A;  2XSH B;  3AMO B;  1OPY A;  1OH0 A;  4KVH A;  5FGO A;  1VQ8 3;  6STD A;  3V92 A;  3KSP A;  2O3O A;  5A0O B;  1J2B A;  1F8N A;  1KC8 4;  3CCM 3;  5LC6 A;  1UUW B;  1A2V A;  3LTC A;  5AIG A;  1VQ7 3;  4EXR A;  1BUQ A;  4XM4 A;  5AI1 A;  1QAK A;  1TP6 A;  4NHF A;  2D1W A;  3BND A;  4LSO A;  2D42 A;  3PXM A;  2Z6B A;  1TIJ A;  1W01 A;  1Q86 4;  3U97 A;  2CKF B;  1GY6 A;  3DGM A;  3VSY A;  3G4S 3;  1O7M B;  1N8R 4;  3NBR A;  4OUQ A;  2E2U A;  2P05 A;  4XB5 A;  4LEH A;  5IG4 A;  3V99 A;  3IJE B;  3DGN A;  4XBX A;  3J7Y d;  3FLJ A;  2JQ5 A;  3U1W A;  3DMC A;  3X42 A;  3Q1C A;  5CK6 A;  2XR8 B;  4X2O A;  4R9K A;  5EVH A;  4BTY A;  1FGR A;  2Y73 A;  4FMA A;  1AVL A;  3WDG B;  4EBG A;  1W6C A;  1QVF 2;  1IQ8 A;  1AVK A;  2P0M A;  4AEQ A;  1Q82 4;  1QJG A;  3X3Z A;  3GZX B;  1Q42 A;  3PS8 A;  1YHQ 3;  2E2T A;  4WWU C;  1IV9 A;  4RBN A;  3EBY A;  2OQE C;  2P09 A;  2O9U X;  2CFW A;  3HIG A;  2XF3 A;  2STD A;  4FCZ A;  2P38 A;  1VQK 3;  2IMJ A;  3BB9 A;  3DM8 A;  1OF5 A;  1PFP A;  4BTW A;  1IDP A;  3ALA A;  4BTX A;  1KSI A;  4N6O B;  3DGL A;  1W6G A;  1DMN A;  1JJ2 2;  3T8N A;  3SXX A;  1VQ4 3;  1K73 4;  5G2G A;  2HMK B;  4R1K A;  5DRE A;  1EG9 B;  3K5T A;  3B4P A;  3UJM A;  2XGN A;  3MYT A;  1FGM A;  3FZW A;  4R80 A;  1N5H A;  3F40 A;  1QAL A;  4X2H A;  4LZI A;  2HML B;  3T0U A;  4HM3 B;  2MF7 A;  5KP4 A;  3I0Y A;  4O2H A;  5HGR A;  2XGL A;  2CFK A;  1UW1 A;  2W56 B;  1YI2 3;  4FCM A;  1ROV A;  4Q53 A;  1WQL B;  2Z77 A;  4HKV B;  2V1L A;  3X41 A;  1D6Z A;  5FW5 A;  2CW9 A;  1ROA A;  2CWV A;  3CNM A;  3F8X A;  3PZW A;  1WMO A;  3QK9 A;  3PGB A;  3T8U A;  3M8C A;  4L8P A;  1ASK A;  1US1 A;  2I9W A;  4HM0 B;  4R9L A;  2SBL A;  2BHM A;  1O7W B;  3G0K A;  3O8Y A;  2OQE A;  3LYG A;  3IPT A;  3GRD A;  3ER7 A;  3NM7 A;  2W56 A;  3CCE 3;  4QWT A;  3PCR A;  4GB5 A;  3MKI A;  3MWZ A;  3EC9 A;  1M90 4;  3S67 A;  4CCV A;  2RGQ A;  1N8Q A;  1NWW A;  3MG1 A;  2FGT A;  5BXQ A;  1IVX A;  1STF I;  2Z7A A;  1ZO2 A;  2XEP A;  1O7H B;  3GZB A;  3RDE A;  1A2K A;  2Z76 A;  3DY5 A;  3FG4 A;  1O7N B;  1UI8 A;  3JUN A;  4XDV A;  3CC4 3;  1G96 A;  1EQK A;  4EV2 A;  1K8A 4;  1NJI 4;  1FGT A;  1V74 A;  3HII A;  3SLU A;  1KD1 4;  2QIY A;  3QRD A;  1C7H A;  2CIU A;  3ROB A;  3SOA A;  1JB4 A;  1E3V A;  1LNH A;  2WGO A;  2HMN B;  3KFQ C;  1U8C B;  2HMO B;  2RSX A;  5IG0 A;  2YX9 A;  3S28 A;  1WMN A;  1YVB I;  1TU5 A;  1S5A A;  4R4K A;  4I4K A;  1IVW A;  1KWI A;  1W02 A;  2WO0 A;  1IK3 A;  1ULI B;  3A76 A;  2JDI H;  3NV0 A;  3BNC A;  1FA3 A;  1U5O A;  3DXO A;  3WA2 X;  3X3X A;  1TFK A;  2Q07 A;  1JRQ A;  2L4V A;  3CCL 3;  3F8H A;  4RZM A;  3KKG A;  1KQS 2;  5AYR B;  3GZY B;  3Q90 A;  4N3V A;  4EV5 A;  4XBY A;  2F86 B;  1AR0 A;  3JUO A;  3Q2P A;  4K90 B;  1SII A;  2CG1 A;  1N5P A;  1PU4 A;  1ISK A;  1YGE A;  2INX A;  2WOH A;  4K1V A;  2CFD A;  3LTA A;  2B24 B;  2C11 A;  3D3L A;  1RRH A;  1OF5 B;  2XFS A;  4HM4 B;  2PZV A;  5CLK A;  3UNL A;  3CCV 3;  2GBX B;  4J8T A;  4HZ9 B;  2KCD A;  4N6T A;  3N54 B;  3WA3 A;  2CWT A;  1GY7 A;  3EN8 A;  3EHC A;  1YIJ 3;  2ML5 A;  3CCJ 3;  4LMI A;  3B7C A;  2UX0 A;  5CXO A;  5JBS A;  4K61 A;  3FGY A;  3STD A;  1QMA A;  1VQ9 3;  1JB2 A;  1OGZ A;  1VQ5 3;  3VF1 A;  1TFO A;  4MMX B;  1GY5 A;  1SQW A;  2K54 A;  3EF8 A;  3F9S A;  3VGN A;  2BT3 A;  2CC3 A;  1GYB A;  1Y4K A;  4WP5 A;  4WHA A;  5AIH A;  3I55 3;  3WOF B;  1M9G A;  5STD A;  5AEW B;  3WOE B;  2WOF A;  1CEW I;  1MNL A;  1R4C A;  2IUK A;  1UI7 A;  4K1U A;  3IMA B;  2QA4 3;  5D82 A;  1LVN A;  5I97 A;  3HX8 A;  3L0R A;  2QGU A;  1LOX A;  4N6U A;  3DGO A;  4OK0 A;  1VQO 3;  1NU3 A;  1O7G B;  1RN7 A;  3G8Z A;  1DYU A;  4GL6 A;  1CYV A;  3LML A;  1IT7 A;  3G71 3;  5D81 A;  1MOL A;  2XRX B;  3OWY A;  1OHO A;  3MHE A;  1D6Y A;  4FMC A;  4OVM A;  1DVC A;  1JN5 A;  3F7S A;  2IUJ A;  5KP3 A;  3RGR A;  1Q40 A;  3FF2 A;  4TX4 A;  5ELU A;  3X3Y A;  3UB1 A;  3PCS A;  4WYK B;  1SJW A;  1JB5 A;  1SIH A;  4WFO A;  3DUK A;  4EYC A;  1OGX A;  1D6U A;  1IT8 A;  1STD A;  1DMM A;  2F99 A;  3LTB A;  1NB3 I;  1NDO B;  3OV4 A;  4O02 B;  2ZL8 A;  3LOY A;  3H51 A;  4KZ1 A;  3G6E 3;  4PEJ A;  3CD6 3;  1WTH A;  2RFR A;  4WYK A;  3EB8 A;  1VQL 3;  1HU9 A;  2C10 A;  2W6J H;  5TGN A;  1YIT 3;  4MMY B;  5LC7 A;  2ZDJ A;  3EBT A;  4FMD A;  3NV0 B;  1GD3 A;  3LH4 A;  2A15 A;  3MG2 A;  2FNQ A;  3MSO A;  4AKY A;  1WNH A;  1CQS A;  1W6Y A;  1O7P B;  2IA7 A;  3X40 A;  3OW2 2;  4NRE A;  3GZR A;  3TDG A;  4O3V A;  2BO9 B;  3JUM A;  1K28 A;  7STD A;  2OOV C;  5IEO A;  2WGQ A;  4HBR A;  5AII A;  3RGA A;  3PYJ A;  5DRV A;  3N8B A;  3KZT A;  2MC8 A;  2E2V A;  1A90 A;  1GD4 A;  3FG1 A;  1FGO A;  2CH9 A;  4CDL A;  2LQV A;  4HJL B;  1RRL A;  1W4N A;  4MMZ B;  1A67 A;  2FXT A;  4IT7 A;  2YFL B;  4IPB A;  1HKX A;  2M7O A;  1L5G B;  3K0Z A;  3LZA A;  1VQM 3;  3HK4 A;  2YFI B;  3EN1 B;  3UL5 A;  1M1K 4;  2YFJ B;  4ZM8 A;  5IF6 A;  3CMA 3;  2RCD A;  1N9J A;  2W04 A;  4FCJ A;  4KFF A;  4HM6 B;  3GWR A;  4IIA A;  1OCV A;  3DZL A;  1M1X B;  4H61 A;  3EX9 A;  3CXC 2;  1OHP A;  4XBT A;  4N6L A;  3CCR 3;  3CU3 A;  5IG3 A;  2XSO B;  1IVV A;  3NQZ A;  1VQP 3;  3NXJ A;  3I56 3;  3LTD A;  2F98 A;  3KE7 A;  1K41 A;  2B1X B;  3BNB A;  1EKM A;  1W00 A;  3JVC A;  5IEN A;  4U13 A;  4L7K A;  2W9P A;  1N9E A;  2OTL 3;  3AMO A;  3SOY A;  1Q81 4;  3BLZ A;  1E3R A;  5ELJ A;  8CHO A;  1W5Z A;  2KRT A;  2K0M A;  5IG5 A;  1RKY A;  1K9M 4;  3D9R A;  2PNC A;  1JNQ A;  2OOV A;  1QVG 2;  4EC6 A;  1VQN 3;  2HMJ B;  2GBW B;  4ORL A;  2W03 A;  3FG3 A;  2CWU A;  3F14 A;  2QEX 3;  3S27 A;  1WMP A;  1QAF A;  3CNX A;  3NBJ A;  3SVA A;  3HZP A;  3FKA A;  4XDW A;  1W7C A;  3V98 A;  3SED A;  3EE1 A;  3F7X A;  3NM2 A;  3CC7 3;  1EA2 A;  1LXE A;  3G16 A;  1DVD A;  2BMR B;  3OWU A;  4HM2 B;  3FH1 A;  3CCQ 3;  1VQ6 3;  1YJ9 3;  1ZX2 A;  1Q7Y 4;  3FF0 A;  3FCS B;  3NX0 A;  3BNE A;  3FSD A;  5D83 A;  3LT8 A;  1JN5 B;  1ULJ B;  1GS3 A;  1YJW 3;  1Q40 B;  4JRF A;  3NQY A;  3CCS 3;  1DMQ A;  1T5Y A;  5JPP A;  3K63 A;  3N9H A;  4LGQ A;  1YJN 3;  5AIF A;  3K7C A;  3S5C A;  2BMQ B;  2LYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...