3NV0A

Crystal structure and mutational analysis of the nxf2/nxt1 heterodimeric complex from caenorhabditis elegans at 1.84 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
MFRNGYYGSDEVRTLVEEFIITYYKIYDGADGQQTRKQLLDAYDTNNSTFTHTVVCLWDPIKFVMYPDSESYRMYLRTSHNVLNQEYFAANRASRISHGAMDIVVALSRLPATIHLMDTFVVDVFLVSATLLGFTLHGTFRDGPSAIKPENTEEHDNYFTRTFMVAPRGEGKVAIVSDQLFISSMSKRRGDQYRML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear RNA export factor 2
publication title The structure of the NXF2/NXT1 heterodimeric complex reveals the combined specificity and versatility of the NTF2-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding/protein transport
total genus 63
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nv0A00
3FLJA 4HM8B 5JPUA 4H3UA 4K1VA 3WMDA 2Z76A 1OCVA 2K54A 4R9KA 5CXOA 3GRDA 5CF2A 5KP4A 4HM1B 3OV4A 2IMJA 3OX9A 5BVBA 3GZXB 3DM8A 1QMAA 1OHSA 5D83A 3GZRA 4LGQA 4WYKB 8CHOA 4HM6B 3FF2A 1ZO2A 3HX8A 4FCJA 3NM2A 4X2HA 5CLKA 1JB5A 3ECFA 3MG1A 1JN5A 4XBXA 1O7GB 2OWPA 4LMIA 1NWWA 2XSOB 5AIFA 2F98A 5DREA 1OGXA 3S5CA 3NUVA 2STDA 3VGNA 4I4KA 3H3HA 4XM4A 4XBTA 4J9AA 3JUNA 2XR8B 1E97A 3GZBA 1OH0A 1OF5A 3MG3A 3SOYA 4R9LA 1ASKA 4HM2B 1DMQA 1OGZA 3HK4A 3F7SA 3OXAA 4L8OA 1GY5A 2INXA 3LZAA 1JN5B 2HMLB 1EA2A 3DMCA 1E3RA 5AEUB 1EG9B 2GEYA 1VZZA 5DRVA 1OHPA 3T8UA 4PEJA 1DMNA 2GEXA 4KVHA 3CPOA 3OWUA 3CU3A 3G0KA 3DZLA 3IPTA 4FCMA 4WYKA 4K1UA 2HMJB 3MYTA 3NXJA 4X2OA 5IG0A 3UJMA 2A15A 4Q53A 3NBRA 4N3VA 1OF5B 2B24B 3JUPA 3OWYA 5CK6A 5AIIA 2RGQA 3F14A 1TUHA 2BMQB 4L7KA 2UX0A 1S5AA 1O7PB 3JUQA 4MJDA 1STDA 1UUVB 4J8TA 4XDWA 2YFJB 3RGRA 3D9RA 1ULJB 2BNGA 1NDOB 1CQSA 5AI1A 3LYGA 1OPYA 1SJWA 3H51A 3OWSA 1ULIB 4IIAA 2XRXB 4GB5A 4HM0B 3KSPA 3EC9A 3B4PA 3JUMA 3MSOA 2HMKB 1HKXA 5BXQA 3FSDA 1OHOA 4HM5B 2W2CA 3F9SA 1W01A 3ER7A 1ISKA 5KP1A 1AR0A 4L8PA 2QGUA 1JKGB 3E99A 5IENA 1W02A 1O7MB 4HVNA 5HGRA 3UNLA 1DMMA 4RZMA 1O7WB 2F86B 3NV0A 2XSHB 4XBYA 4OUQA 4XDVA 5IF6A 3K0ZA 3NHXA 3F8XA 1Q40B 3B4OA 3GWRA 1O7NB 4XB5A 2QIYA 2YFLB 2HMOB 2HMNB 3I0YA 5CF1A 5KP3A 3FKAA 2BMRB 1UUWB 4WP5A 3MHEA 3HZPA 4R1KA 3EBTA 2RFRA 3NV0B 5AEWB 1A2KA 3CNXA 1JB2A 3EN1B 3ROBA 1ZX2A 2YFIB 3SEDA 1JKGA 1W00A 4HM4B 4U13A 4CDLA 3MKIA 1U5OA 5IG3A 3RGAA 2GBWB 3G16A 3CNMA 3STDA 1GY7A 3DUKA 5D82A 1E3VA 3MG2A 2Z77A 3EF8A 4HM3B 1Q40A 5G2GA 5IG4A 1C7HA 1Q42A 2PZVA 3Q90A 3GZYB 3VSYA 4HZ9B 4OVMA 1IDPA 3EN8A 3SOAA 2Z7AA 2BMOB 2R4IA 3FGYA 3FH1A 2GXFA 3KKGA 3A76A 3EJVA 2I9WA 3FZWA 3M8CA 4WWUC 1OUNA 3F40A 5STDA 2B1XB 1TP6A 4HM7B 3KZTA 4HJLB 2GBXB 4LEHA 1K41A 5AIHA 3EBYA 5IG5A 1BUQA 1Z1SA 7STDA 5D81A 2JQ5A 5TGNA 2F99A 5JPPA 2RCDA 5IERA 3T8NA 5IEOA 1NU3A 1QJGA 3K7CA 3B8LA 4HZBB 5AIGA 1GY6A 3B7CA 1GS3A 3DXOA 3F8HA 3BB9A 2CHCA 3G8ZA 5EVHA 3KE7A 3JUOA 5FW5A 3BLZA 3EX9A 6STDA 3F7XA 4HKVB 2CKFB 5IEPA 1W6YA 1O7HB 1JB4A 1WQLB 2HMMB 1GYBA 4ORLA 3EHCA 3FF0A 3EQQB 4STDA
chains in the Genus database with same CATH superfamily
3AGNA 3FLJA 4HM8B 5JPUA 1BNEA 3K5TA 4H3UA 4K1VA 3WMDA 2Z76A 1Q9EA 1OCVA 3ZG5A 4AEQA 4FMBA 1IU7A 3NQYA 1BRSA 4FCZA 2K54A 4GL6A 4NHFA 4R9KA 2CFKA 4RBNA 5CXOA 1TIJA 3GRDA 1GMQA 5CF2A 1I2FA 3HI7A 5KP4A 4HM1B 2P0XA 1LOWA 2W56B 1GOYA 3OV4A 4MMZB 1OACA 1US1A 2IMJA 3OX9A 2O9UX 2J8XB 5A0OB 4LSOA 3GZXB 5BVBA 5RNTA 3J7Yd 3DM8A 1QMAA 4R80A 1W7CA 3FG4A 1OHSA 5D83A 3GZRA 1LOYA 4LGQA 1N5HA 1UCIA 3BNCA 5LC7A 3S29A 1B27A 4WYKB 8CHOA 1IVXA 4HM6B 3FF2A 1ZO2A 1YHQ3 3HX8A 4FCJA 2K0MA 3NM7A 3NM2A 4X2HA 3PCRA 5CLKA 1JBRA 2OQEC 1JB5A 1VQ73 1C54A 3ECFA 3CCM3 1FUWA 1VQ43 3MG1A 1RNTA 1JN5A 3DGOA 4XBXA 1B21A 1O7GB 3N9HA 1LVNA 2BHMA 2OWPA 1F8NA 4LMIA 2XH9A 1NWWA 2XSOB 2ZL8A 2C4BA 5AIFA 3AHSA 3CPW2 1KD14 1AVLA 2F98A 4RNTA 2IYJA 5DREA 3OW22 3IMAB 3Q1CA 1DVCA 1OGXA 2CIUA 4O3VA 1RGKA 3RNTA 3NUVA 3S5CA 3CCR3 4BU4A 1B2SA 2STDA 1X1YA 1RDSA 3VGNA 2XGNA 4I4KA 1WMPA 1BNGA 1NO3A 1I0XA 1Q7HA 3H3HA 4XM4A 1M904 4CCVA 4XBTA 1VQM3 1SIHA 4J9AA 2SARA 3JUNA 2XR8B 4FMAA 1BSEA 1E97A 1LNIA 4H61A 3A5EA 3LXUX 1BRIA 3S28A 3SYUA 4QWTA 3GZBA 2P38A 1OH0A 1CEWI 1PYLA 1B3SA 1BNSA 1IVUA 1OF5A 3MG3A 4BL3A 4BL2A 2D42A 3NBBA 3SOYA 3Q3FA 1VQK3 4DKIA 2OTL3 4EYCA 1FYSA 3DGLA 4R9LA 1J2BA 2CW9A 1ASKA 1UW1A 3CCQ3 3LTCA 4HM2B 3CC23 4AKYA 1DMQA 1FGOA 1OGZA 1I70A 1KQS2 2WO0A 1I8VA 3D79A 3AHWA 4O2HA 3HK4A 3F7SA 3WR2A 1KSIA 3OXAA 1YJ93 1IQYA 1BNFA 1NNVA 4L8OA 6RNTA 2SBLA 1JNQA 1U8CB 1JBTA 3CD63 1MOLA 1Q864 3LTDA 1BVIA 1GY5A 2INXA 3LZAA 2YX9A 1JN5B 3U1WA 3X41A 1EUIC 2HMLB 1EA2A 1N9EA 3DMCA 3SX1A 1RN1A 1E3RA 3S67A 3SXXA 4WFOA 5AEUB 1EG9B 2WOFA 1BSDA 1VZZA 2GEYA 1FUSA 1OHPA 2AADA 2KXGA 2W04A 4PEJA 1DMNA 2GEXA 3NX0A 1MWTA 4KVHA 3T8UA 3CPOA 1RGEA 3OWUA 4NREA 4RNYA 2OOVA 3UB1A 4O02B 3CCS3 2OCTA 2FNQA 3CU3A 3G0KA 3I553 1B2MA 3DZLA 3IPTA 1BSBA 4FCMA 4WYKA 1W2B2 4GHOA 4EC6A 4K1UA 1EQKA 1CYUA 2IUKA 2HMJB 1PU4A 4N6V0 4G1MB 3CC43 3MYTA 3NXJA 7GSPA 1NB3I 4FMDA 4X2OA 4KFEA 5IG0A 3UJMA 4R4KA 4AKZA 2A15A 1MWRA 4Q53A 3NBRA 1K734 4N3VA 1RN4A 3CME3 1FGQA 1OF5B 1BNIA 2B24B 2F4YA 2AAEA 4IT7A 9RNTA 1QAFA 3WA3A 1M1K4 2RBIA 2LYXA 2WGQA 1GMRA 3JUPA 3X3ZA 1RGLA 3OWYA 2V1LA 1RHLA 5CK6A 3SVAA 5AIIA 3HIIA 2MC8A 1RJOA 2PNCA 2RGQA 3F14A 1TUHA 2BMQB 1Q7Y4 1BANA 2K3DA 3IJEB 4L7KA 2UX0A 2KF5A 3HOHA 1S5AA 1Q814 1O7PB 1T3BA 2Y74A 3JUQA 6GSPA 5M1AA 1JBSA 4MJDA 2L1SA 3D5GA 2CG0A 1W5ZA 1DETA 1LQMB 2KF3A 1STDA 1UUVB 1R4YA 4J8TA 4XDWA 2YFJB 5M18A 3RGRA 3PS8A 3D9RA 1ULJB 3LOYA 1IVWA 1NDOB 2BNGA 1UI7A 1IQXA 1CQSA 3LT9A 5AI1A 2HOHA 3LYGA 1OPYA 2XFTA 3K9MC 1SJWA 4KT3B 1MGWA 4I5QA 3LTAA 3H51A 4J5GA 1S723 1TTOA 1G96A 3X42A 5JBSA 2F56A 2XF3A 1FZUA 1NB5I 4KFFA 1RRLA 2GU3A 1KC84 2XEPA 3OWSA 1ULIB 3T0UA 3BNEA 4RNZA 2CX1A 1YGWA 1BRKA 1RRHA 4IPBA 4IIAA 2XRXB 1RNBA 4GB5A 4HM0B 3KSPA 3EC9A 1RCKA 1A2VA 3B4PA 2CG1A 3JUMA 1B20A 5I97A 4OK0A 3WA2X 2E2UA 3MSOA 1EKMA 2HMKB 3NBJA 1VQL3 1HKXA 4N6LA 1TFOA 5BXQA 2OTJ3 3EB8A 1IV7A 3FSDA 1OHOA 3L0RA 2D1WA 3HIGA 3EE1A 1BRHA 2M7OA 1WMNA 1YVBI 4HM5B 1RCLA 4K90B 3CMA3 3N8BA 2W2CA 3F9SA 1FW7A 1BSCA 1W01A 1GSPA 4TX4A 3CXC2 3CCJ3 3ER7A 2CFWA 1ISKA 5KP1A 1AR0A 1M1XB 3DH2A 3MWZA 3BIRA 4L8PA 1UUGB 1YVSA 2QGUA 1JKGB 1I0VA 3X3XA 4EXRA 3E99A 1QALA 2KCDA 3D4AA 1RGCA 1SPUA 5IENA 3WOFB 1W02A 4N6NB 1O7MB 4HVNA 2C10A 2IA7A 5IW9A 5HGRA 1PFPA 3GSPA 1BAOA 3UNLA 7RNTA 2CWVA 2ZA4A 1BNRA 1DMMA 4RZMA 3I563 2L4VA 1O7WB 2F86B 3NV0A 2IY2A 2XSHB 1BRGA 1HU9A 4XBYA 5ELJA 4EV2A 3KN4A 4N6UA 1BIRA 1VQ83 1I2GA 3ZG0A 1RLSA 4OUQA 2H0GA 1RGAA 2O3OA 4J5KA 2CH9A 1GD4A 8RNTA 3CCE3 1SARA 4XDVA 4GSPA 1A67A 3CCL3 3V99A 5IF6A 3K0ZA 1D6YA 3Q2PA 3KIIA 1EEJA 3NHXA 4EW5A 4MEIA 1SQWA 3F8XA 2RNTA 2CFLA 1LOVA 2W6JH 1NJI4 1Q40B 2JDIH 2RSXA 3BNDA 1MWUA 1M9GA 2CWUA 1TJDA 3PYJA 2CX0A 1BU4A 1RGHA 5HOHA 1I3IA 1A90A 3B4OA 4BTWA 3GWRA 1O7NB 1LQGC 2BU4A 1D6UA 1YGEA 4XB5A 2QIYA 2UUGC 1HYFA 2H0HA 2YFLB 2W9PA 2HMOB 1X1WA 2HMNB 2Q07A 3I0YA 1W4NA 2F5WA 3CCU3 3UL6A 5CF1A 1LNHA 1JZDA 5ELUA 5KP3A 4N6TA 2CFGA 2XGLA 2BMRB 1TFKA 1UUWB 3FKAA 4WP5A 3MHEA 3S27A 1FA3A 5G1KA 5FGOA 3BU4A 3G6E3 1IK3A 1RSNA 2W03A 1Q824 2OOVC 1STFI 3DY5A 3HZPA 3PGBA 4R1KA 1AQZA 3U97A 2LQVA 3BNBA 5G1LA 3WOEB 1RTUA 1SIIA 3KCHA 4N6OB 1TRQA 2R41A 3EBTA 3PCSA 4EV5A 1ROVA 1UCLA 4O8SA 1K9M4 2IUJA 1W6GA 3LTBA 2RFRA 3NV0B 1UGIA 5DRVA 3AGOA 5AEWB 1D6ZA 3X40A 1I2EA 1A2KA 3CNXA 1W6CA 1JB2A 3EN1B 4LYLB 4CPKA 4BIRA 3LMLA 3ROBA 1ZX2A 2E2TA 1B2UA 1VQN3 2YFIB 3SEDA 5LC6A 1RGFA 1HZ1A 1JKGA 3ALAA 3QK9A 3MPHA 4FMCA 1B2ZA 1QVG2 1W00A 2BT3A 2P09A 4HM4B 4U13A 2QA43 3DGNA 5EEOA 4CDLA 2MF7A 4BTXA 3MKIA 3WDGB 1U5OA 1FGRA 1G02A 1K28A 1N8QA 1T2IA 3AMOA 5IG3A 3RGAA 2GU1A 1YIT3 1YJW3 1UGHI 2GBWB 3G16A 3JVCA 2OQEA 3CNMA 4HOHA 3PZWA 3STDA 1WMOA 1GY7A 2CK3H 2BIRA 3DUKA 2F5MA 1YNVX 5AYSC 3WODG 1DYUA 5D82A 3SLUA 1YJN3 2QEX3 2UGIA 1FGTA 2ZHXB 1WTHA 1E3VA 4JRFA 3MG2A 5BU4A 2E2VA 1IQ8A 1GOVA 2Z77A 1PY3A 1IT7A 2FGTA 2Z6BA 3EF8A 1ZS7A 2XFSA 4HM3B 1Q40A 3QRDA 1N9JA 1UCKA 3GAXA 1V58A 1RN7A 1V57A 1QVF2 5G2GA 3FG3A 5IG4A 1C7HA 4MMXB 1IYYA 1Q42A 2PZVA 3LT8A 3Q90A 2CWTA 1BRNL 3GZYB 3VSYA 1A2PA 4CJNA 4EBGA 4HZ9B 1GMPA 1IDPA 2CC3A 3EN8A 4OVMA 1BSAA 3SOAA 4WHAA 2Z7AA 2BMOB 4KFDA 2R4IA 4BTYA 4HBRA 3FGYA 1AVKA 3FH1A 2GXFA 2GSPA 3KKGA 3A76A 3DGMA 3EJVA 4JF8A 4ZM8A 1UCJA 3KFQC 2I9WA 2WOHA 3FZWA 1JRQA 3M8CA 1VQO3 3CCV3 1X1UA 4WWUC 5EQLA 1FUTA 1IVVA 3RDEA 1OUNA 1AY7A 1UI8A 3F40A 1MNLA 5STDA 3O8YA 1UDII 1TP6A 1WNHA 2B1XB 2P05A 1G0TA 3KZTA 4HJLB 4HM7B 1L5GB 1X1XA 3AMOB 3D5IA 3VF1A 1LOXA 2GBXB 4LEHA 1K41A 5AIHA 3EBYA 3LH4A 5BIRA 1V74A 2ML5A 5IG5A 1BRJA 4LZIA 4HAAA 1BUQA 3ZFZA 4KZ1A 1Z1SA 1CYVA 7STDA 1GD3A 1RGGA 1DVDA 1CH0A 1B2XA 2JQ5A 5D81A 3TDGA 2ML6A 1YI23 5TGNA 1MWSA 1KWIA 2F99A 5JPPA 2KRTA 4MMYB 2CFDA 1YIJ3 3DGYA 1LRAA 4ILFA 2RCDA 5IERA 1IT8A 1VQ53 3WHOA 3T8NA 3UL5A 1AV4A 1FGMA 5IEOA 3PXMA 1T5YA 3V92A 1NU3A 1QJGA 1W2ZA 1GOUA 3URPA 3K7CA 1I3FA 1BUJA 3B8LA 1JJ22 3FCSB 4HZBB 3X3YA 2FXTA 2KAAA 3G713 3FG1A 1QAKA 2H0IA 5AIGA 1ROAA 1LXEA 1GY6A 3B7CA 2W56A 5AYRB 1GS3A 1N5PA 5M19A 3DXOA 3F8HA 3D3LA 3K63A 1N8R4 1JV2B 1RMSA 1IV9A 3BB9A 5GSPA 1VQP3 2CHCA 3G8ZA 3N54B 4K61A 4N6MA 5EVHA 1VQ93 2W9QA 1JZOA 1BOXA 3KE7A 2KF6A 3JUOA 5FW5A 3BLZA 2W0QA 3EX9A 1K8A4 6STDA 1T2HA 1BGSA 2C11A 3F7XA 1MGRA 4FR9A 4HKVB 3V98A 2CKFB 4NPBA 2Y73A 1BNJA 1VQQA 1R4CA 5IEPA 3G4S3 1W6YA 3CC73 1O7HB 1RKYA 2BO9B 2P0MA 1JB4A 1ZGXA 1WQLB 2HMMB 3NQZA 1GYBA 4ORLA 2KF4A 2ZDJA 1TU5A 1VQ63 1Y4KA 1DE3A 2WGOA 3KSED 4HYZA 3EHCA 3FF0A 3EQQB 4STDA 1TRPA
chains in the Genus database with same CATH topology
3FLJA 4HM8B 5JPUA 4H3UA 3K5TA 4K1VA 3WMDA 2Z76A 1OCVA 4AEQA 4FMBA 1IU7A 3NQYA 4FCZA 2K54A 4GL6A 4NHFA 4R9KA 2CFKA 4RBNA 5CXOA 1TIJA 3GRDA 5CF2A 3HI7A 5KP4A 4HM1B 2P0XA 2W56B 3OV4A 4MMZB 1OACA 1US1A 2IMJA 3OX9A 2O9UX 5A0OB 5BVBA 4LSOA 3GZXB 3J7Yd 3DM8A 1QMAA 4R80A 1W7CA 3FG4A 1OHSA 5D83A 3GZRA 4LGQA 1N5HA 3S29A 3BNCA 5LC7A 4WYKB 8CHOA 1IVXA 4HM6B 3FF2A 1ZO2A 1YHQ3 3HX8A 4FCJA 2K0MA 3NM7A 3NM2A 4X2HA 3PCRA 5CLKA 2OQEC 1JB5A 1VQ73 3ECFA 3CCM3 1FUWA 1VQ43 3MG1A 1JN5A 3DGOA 4XBXA 1O7GB 3N9HA 1LVNA 2BHMA 2OWPA 1F8NA 4LMIA 2XH9A 1NWWA 2XSOB 2ZL8A 5AIFA 3CPW2 1KD14 1AVLA 2F98A 5DREA 3OW22 3IMAB 3Q1CA 1DVCA 1OGXA 2CIUA 4O3VA 3S5CA 3NUVA 3CCR3 2STDA 3VGNA 2XGNA 4I4KA 1NO3A 1WMPA 3H3HA 4XM4A 1M904 4CCVA 4XBTA 1VQM3 1SIHA 4J9AA 3JUNA 2XR8B 4FMAA 1E97A 4H61A 3LXUX 3S28A 4QWTA 3GZBA 2P38A 1OH0A 1CEWI 1IVUA 1OF5A 3MG3A 2D42A 3NBBA 3SOYA 1VQK3 2OTL3 4EYCA 3DGLA 4R9LA 1J2BA 2CW9A 1ASKA 1UW1A 3CCQ3 3LTCA 4HM2B 3CC23 4AKYA 1DMQA 1FGOA 1OGZA 1KQS2 2WO0A 4O2HA 3HK4A 3F7SA 1KSIA 3OXAA 1YJ93 1IQYA 4L8OA 2SBLA 1JNQA 1U8CB 3CD63 1MOLA 1Q864 3LTDA 1GY5A 2INXA 3LZAA 2YX9A 1JN5B 3U1WA 3X41A 2HMLB 1EA2A 1N9EA 3DMCA 3SX1A 1E3RA 3S67A 3SXXA 4WFOA 5AEUB 1EG9B 2WOFA 2GEYA 1VZZA 5DRVA 2W04A 1OHPA 2KXGA 4PEJA 3T8UA 1DMNA 2GEXA 3NX0A 4KVHA 3CPOA 3OWUA 4NREA 4RNYA 2OOVA 3UB1A 4O02B 3CCS3 2OCTA 2FNQA 3CU3A 3G0KA 3I553 3DZLA 3IPTA 4FCMA 4WYKA 1W2B2 4EC6A 4K1UA 1EQKA 1CYUA 2IUKA 2HMJB 1PU4A 4N6V0 4G1MB 3CC43 3MYTA 3NXJA 1NB3I 4FMDA 4X2OA 4KFEA 5IG0A 3UJMA 4R4KA 4AKZA 2A15A 4Q53A 3NBRA 1K734 4N3VA 3CME3 1FGQA 1OF5B 2B24B 4IT7A 3WA3A 1QAFA 1M1K4 2LYXA 2WGQA 3JUPA 3X3ZA 3OWYA 2V1LA 5CK6A 3SVAA 5AIIA 3HIIA 2MC8A 1RJOA 2PNCA 2RGQA 3F14A 1TUHA 2BMQB 1Q7Y4 3IJEB 4L7KA 2UX0A 1Q814 1S5AA 1O7PB 3JUQA 2Y74A 4MJDA 2CG0A 1W5ZA 1STDA 1UUVB 4J8TA 4XDWA 2YFJB 3RGRA 3PS8A 3D9RA 1ULJB 3LOYA 1IVWA 1NDOB 2BNGA 1UI7A 1IQXA 1CQSA 3LT9A 5AI1A 3LYGA 1OPYA 2XFTA 3K9MC 1SJWA 3LTAA 3H51A 1S723 1G96A 3X42A 5JBSA 2XF3A 1NB5I 4KFFA 1RRLA 2GU3A 1KC84 2XEPA 3OWSA 1ULIB 3T0UA 3BNEA 4RNZA 1RRHA 4IPBA 4IIAA 2XRXB 4GB5A 4HM0B 3KSPA 3EC9A 1A2VA 3B4PA 2CG1A 3JUMA 5I97A 4OK0A 3WA2X 2E2UA 3MSOA 1EKMA 2HMKB 3NBJA 1VQL3 1HKXA 4N6LA 1TFOA 5BXQA 2OTJ3 3EB8A 1IV7A 3FSDA 1OHOA 3L0RA 2D1WA 3HIGA 3EE1A 2M7OA 1WMNA 1YVBI 4HM5B 4K90B 3CMA3 3N8BA 2W2CA 3F9SA 1W01A 3CXC2 4TX4A 3CCJ3 3ER7A 2CFWA 1ISKA 5KP1A 1AR0A 1M1XB 3MWZA 4L8PA 2QGUA 3X3XA 4EXRA 1JKGB 3E99A 1QALA 2KCDA 1SPUA 5IENA 3WOFB 1W02A 4N6NB 1O7MB 4HVNA 2C10A 2IA7A 5IW9A 5HGRA 1PFPA 3UNLA 2CWVA 1DMMA 4RZMA 3I563 2L4VA 1O7WB 2F86B 3NV0A 5ELJA 2XSHB 1HU9A 4XBYA 4EV2A 3KN4A 4N6UA 1VQ83 4OUQA 2O3OA 2CH9A 1GD4A 3CCE3 1A67A 4XDVA 3CCL3 3V99A 5IF6A 3K0ZA 1D6YA 3Q2PA 3KIIA 3NHXA 4MEIA 1SQWA 3F8XA 2CFLA 2W6JH 1NJI4 1Q40B 2JDIH 2RSXA 3BNDA 1M9GA 2CWUA 3PYJA 1A90A 3B4OA 4BTWA 3GWRA 1O7NB 4XB5A 1D6UA 1YGEA 2QIYA 2YFLB 2W9PA 2HMOB 2HMNB 2Q07A 3I0YA 1W4NA 3CCU3 3UL6A 5CF1A 1LNHA 5ELUA 5KP3A 4N6TA 2CFGA 2XGLA 2BMRB 1TFKA 1UUWB 3FKAA 4WP5A 3MHEA 3S27A 1FA3A 5FGOA 3G6E3 1IK3A 2W03A 1Q824 2OOVC 1STFI 3DY5A 3HZPA 3PGBA 4R1KA 3U97A 2LQVA 3BNBA 3WOEB 1SIIA 4N6OB 3EBTA 3PCSA 4EV5A 1ROVA 4O8SA 1K9M4 2IUJA 1W6GA 3LTBA 2RFRA 3NV0B 5AEWB 1D6ZA 3X40A 1A2KA 3CNXA 1W6CA 1JB2A 3EN1B 3LMLA 3ROBA 1ZX2A 2E2TA 1VQN3 2YFIB 3SEDA 5LC6A 1JKGA 3ALAA 3QK9A 3MPHA 4FMCA 1QVG2 1W00A 2BT3A 2P09A 4HM4B 4U13A 2QA43 3DGNA 5EEOA 4CDLA 2MF7A 4BTXA 3MKIA 3WDGB 1U5OA 1FGRA 1N8QA 1K28A 3AMOA 5IG3A 3RGAA 2GU1A 1YIT3 1YJW3 2GBWB 3G16A 3JVCA 2OQEA 3CNMA 3PZWA 3STDA 1WMOA 1GY7A 2CK3H 3DUKA 5AYSC 3WODG 1DYUA 5D82A 3SLUA 1YJN3 2QEX3 1FGTA 1WTHA 1E3VA 4JRFA 3MG2A 2E2VA 1IQ8A 2Z77A 2Z6BA 1IT7A 2FGTA 3EF8A 2XFSA 4HM3B 1Q40A 3QRDA 1N9JA 3GAXA 1QVF2 1RN7A 5G2GA 3FG3A 5IG4A 1C7HA 4MMXB 1Q42A 2PZVA 3LT8A 3Q90A 2CWTA 3GZYB 3VSYA 4EBGA 4HZ9B 2CC3A 1IDPA 3EN8A 4OVMA 3SOAA 4WHAA 2Z7AA 2BMOB 4KFDA 2R4IA 4BTYA 4HBRA 3FGYA 1AVKA 3FH1A 2GXFA 3KKGA 3A76A 3DGMA 3EJVA 4JF8A 4ZM8A 3KFQC 2I9WA 2WOHA 3FZWA 1JRQA 3M8CA 1VQO3 3CCV3 4WWUC 5EQLA 3RDEA 1IVVA 1OUNA 1UI8A 3F40A 1MNLA 5STDA 3O8YA 2B1XB 1TP6A 1WNHA 4HM7B 2P05A 1L5GB 3KZTA 4HJLB 3AMOB 3VF1A 1LOXA 2GBXB 4LEHA 1K41A 5AIHA 3EBYA 3LH4A 1V74A 2ML5A 5IG5A 4LZIA 1BUQA 4KZ1A 1Z1SA 1CYVA 7STDA 1GD3A 1DVDA 2JQ5A 5D81A 3TDGA 2ML6A 1YI23 5TGNA 1KWIA 2F99A 5JPPA 2KRTA 4MMYB 2CFDA 1YIJ3 2RCDA 5IERA 1IT8A 1VQ53 3T8NA 3UL5A 1AV4A 1FGMA 5IEOA 3PXMA 1T5YA 3V92A 1NU3A 1QJGA 1W2ZA 3K7CA 3B8LA 1JJ22 3FCSB 4HZBB 3X3YA 2FXTA 3G713 3FG1A 1QAKA 5AIGA 1ROAA 1LXEA 1GY6A 3B7CA 2W56A 5AYRB 1GS3A 1N5PA 3DXOA 3F8HA 3D3LA 3K63A 1N8R4 1JV2B 1IV9A 3BB9A 1VQP3 2CHCA 3G8ZA 3N54B 4K61A 4N6MA 5EVHA 1VQ93 2W9QA 3KE7A 3JUOA 5FW5A 3BLZA 2W0QA 3EX9A 1K8A4 6STDA 2C11A 3F7XA 4FR9A 4HKVB 3V98A 2CKFB 2Y73A 1R4CA 5IEPA 3G4S3 1W6YA 3CC73 1O7HB 1RKYA 2BO9B 2P0MA 1JB4A 1WQLB 2HMMB 3NQZA 1GYBA 4ORLA 2ZDJA 1TU5A 1VQ63 1Y4KA 2WGOA 3KSED 4HYZA 3EHCA 3FF0A 3EQQB 4STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FLJ A;  4HM8 B;  5JPU A;  4H3U A;  4K1V A;  3WMD A;  2Z76 A;  1OCV A;  2K54 A;  4R9K A;  5CXO A;  3GRD A;  5CF2 A;  5KP4 A;  4HM1 B;  3OV4 A;  2IMJ A;  3OX9 A;  5BVB A;  3GZX B;  3DM8 A;  1QMA A;  1OHS A;  5D83 A;  3GZR A;  4LGQ A;  4WYK B;  8CHO A;  4HM6 B;  3FF2 A;  1ZO2 A;  3HX8 A;  4FCJ A;  3NM2 A;  4X2H A;  5CLK A;  1JB5 A;  3ECF A;  3MG1 A;  1JN5 A;  4XBX A;  1O7G B;  2OWP A;  4LMI A;  1NWW A;  2XSO B;  5AIF A;  2F98 A;  5DRE A;  1OGX A;  3S5C A;  3NUV A;  2STD A;  3VGN A;  4I4K A;  3H3H A;  4XM4 A;  4XBT A;  4J9A A;  3JUN A;  2XR8 B;  1E97 A;  3GZB A;  1OH0 A;  1OF5 A;  3MG3 A;  3SOY A;  4R9L A;  1ASK A;  4HM2 B;  1DMQ A;  1OGZ A;  3HK4 A;  3F7S A;  3OXA A;  4L8O A;  1GY5 A;  2INX A;  3LZA A;  1JN5 B;  2HML B;  1EA2 A;  3DMC A;  1E3R A;  5AEU B;  1EG9 B;  2GEY A;  1VZZ A;  5DRV A;  1OHP A;  3T8U A;  4PEJ A;  1DMN A;  2GEX A;  4KVH A;  3CPO A;  3OWU A;  3CU3 A;  3G0K A;  3DZL A;  3IPT A;  4FCM A;  4WYK A;  4K1U A;  2HMJ B;  3MYT A;  3NXJ A;  4X2O A;  5IG0 A;  3UJM A;  2A15 A;  4Q53 A;  3NBR A;  4N3V A;  1OF5 B;  2B24 B;  3JUP A;  3OWY A;  5CK6 A;  5AII A;  2RGQ A;  3F14 A;  1TUH A;  2BMQ B;  4L7K A;  2UX0 A;  1S5A A;  1O7P B;  3JUQ A;  4MJD A;  1STD A;  1UUV B;  4J8T A;  4XDW A;  2YFJ B;  3RGR A;  3D9R A;  1ULJ B;  2BNG A;  1NDO B;  1CQS A;  5AI1 A;  3LYG A;  1OPY A;  1SJW A;  3H51 A;  3OWS A;  1ULI B;  4IIA A;  2XRX B;  4GB5 A;  4HM0 B;  3KSP A;  3EC9 A;  3B4P A;  3JUM A;  3MSO A;  2HMK B;  1HKX A;  5BXQ A;  3FSD A;  1OHO A;  4HM5 B;  2W2C A;  3F9S A;  1W01 A;  3ER7 A;  1ISK A;  5KP1 A;  1AR0 A;  4L8P A;  2QGU A;  1JKG B;  3E99 A;  5IEN A;  1W02 A;  1O7M B;  4HVN A;  5HGR A;  3UNL A;  1DMM A;  4RZM A;  1O7W B;  2F86 B;  3NV0 A;  2XSH B;  4XBY A;  4OUQ A;  4XDV A;  5IF6 A;  3K0Z A;  3NHX A;  3F8X A;  1Q40 B;  3B4O A;  3GWR A;  1O7N B;  4XB5 A;  2QIY A;  2YFL B;  2HMO B;  2HMN B;  3I0Y A;  5CF1 A;  5KP3 A;  3FKA A;  2BMR B;  1UUW B;  4WP5 A;  3MHE A;  3HZP A;  4R1K A;  3EBT A;  2RFR A;  3NV0 B;  5AEW B;  1A2K A;  3CNX A;  1JB2 A;  3EN1 B;  3ROB A;  1ZX2 A;  2YFI B;  3SED A;  1JKG A;  1W00 A;  4HM4 B;  4U13 A;  4CDL A;  3MKI A;  1U5O A;  5IG3 A;  3RGA A;  2GBW B;  3G16 A;  3CNM A;  3STD A;  1GY7 A;  3DUK A;  5D82 A;  1E3V A;  3MG2 A;  2Z77 A;  3EF8 A;  4HM3 B;  1Q40 A;  5G2G A;  5IG4 A;  1C7H A;  1Q42 A;  2PZV A;  3Q90 A;  3GZY B;  3VSY A;  4HZ9 B;  4OVM A;  1IDP A;  3EN8 A;  3SOA A;  2Z7A A;  2BMO B;  2R4I A;  3FGY A;  3FH1 A;  2GXF A;  3KKG A;  3A76 A;  3EJV A;  2I9W A;  3FZW A;  3M8C A;  4WWU C;  1OUN A;  3F40 A;  5STD A;  2B1X B;  1TP6 A;  4HM7 B;  3KZT A;  4HJL B;  2GBX B;  4LEH A;  1K41 A;  5AIH A;  3EBY A;  5IG5 A;  1BUQ A;  1Z1S A;  7STD A;  5D81 A;  2JQ5 A;  5TGN A;  2F99 A;  5JPP A;  2RCD A;  5IER A;  3T8N A;  5IEO A;  1NU3 A;  1QJG A;  3K7C A;  3B8L A;  4HZB B;  5AIG A;  1GY6 A;  3B7C A;  1GS3 A;  3DXO A;  3F8H A;  3BB9 A;  2CHC A;  3G8Z A;  5EVH A;  3KE7 A;  3JUO A;  5FW5 A;  3BLZ A;  3EX9 A;  6STD A;  3F7X A;  4HKV B;  2CKF B;  5IEP A;  1W6Y A;  1O7H B;  1JB4 A;  1WQL B;  2HMM B;  1GYB A;  4ORL A;  3EHC A;  3FF0 A;  3EQQ B;  4STD A; 
#chains in the Genus database with same CATH topology
 3AGN A;  3FLJ A;  4HM8 B;  5JPU A;  1BNE A;  3K5T A;  4H3U A;  4K1V A;  3WMD A;  2Z76 A;  1Q9E A;  1OCV A;  3ZG5 A;  4AEQ A;  4FMB A;  1IU7 A;  3NQY A;  1BRS A;  4FCZ A;  2K54 A;  4GL6 A;  4NHF A;  4R9K A;  2CFK A;  4RBN A;  5CXO A;  1TIJ A;  3GRD A;  1GMQ A;  5CF2 A;  1I2F A;  3HI7 A;  5KP4 A;  4HM1 B;  2P0X A;  1LOW A;  2W56 B;  1GOY A;  3OV4 A;  4MMZ B;  1OAC A;  1US1 A;  2IMJ A;  3OX9 A;  2O9U X;  2J8X B;  5A0O B;  4LSO A;  3GZX B;  5BVB A;  5RNT A;  3J7Y d;  3DM8 A;  1QMA A;  4R80 A;  1W7C A;  3FG4 A;  1OHS A;  5D83 A;  3GZR A;  1LOY A;  4LGQ A;  1N5H A;  1UCI A;  3BNC A;  5LC7 A;  3S29 A;  1B27 A;  4WYK B;  8CHO A;  1IVX A;  4HM6 B;  3FF2 A;  1ZO2 A;  1YHQ 3;  3HX8 A;  4FCJ A;  2K0M A;  3NM7 A;  3NM2 A;  4X2H A;  3PCR A;  5CLK A;  1JBR A;  2OQE C;  1JB5 A;  1VQ7 3;  1C54 A;  3ECF A;  3CCM 3;  1FUW A;  1VQ4 3;  3MG1 A;  1RNT A;  1JN5 A;  3DGO A;  4XBX A;  1B21 A;  1O7G B;  3N9H A;  1LVN A;  2BHM A;  2OWP A;  1F8N A;  4LMI A;  2XH9 A;  1NWW A;  2XSO B;  2ZL8 A;  2C4B A;  5AIF A;  3AHS A;  3CPW 2;  1KD1 4;  1AVL A;  2F98 A;  4RNT A;  2IYJ A;  5DRE A;  3OW2 2;  3IMA B;  3Q1C A;  1DVC A;  1OGX A;  2CIU A;  4O3V A;  1RGK A;  3RNT A;  3NUV A;  3S5C A;  3CCR 3;  4BU4 A;  1B2S A;  2STD A;  1X1Y A;  1RDS A;  3VGN A;  2XGN A;  4I4K A;  1WMP A;  1BNG A;  1NO3 A;  1I0X A;  1Q7H A;  3H3H A;  4XM4 A;  1M90 4;  4CCV A;  4XBT A;  1VQM 3;  1SIH A;  4J9A A;  2SAR A;  3JUN A;  2XR8 B;  4FMA A;  1BSE A;  1E97 A;  1LNI A;  4H61 A;  3A5E A;  3LXU X;  1BRI A;  3S28 A;  3SYU A;  4QWT A;  3GZB A;  2P38 A;  1OH0 A;  1CEW I;  1PYL A;  1B3S A;  1BNS A;  1IVU A;  1OF5 A;  3MG3 A;  4BL3 A;  4BL2 A;  2D42 A;  3NBB A;  3SOY A;  3Q3F A;  1VQK 3;  4DKI A;  2OTL 3;  4EYC A;  1FYS A;  3DGL A;  4R9L A;  1J2B A;  2CW9 A;  1ASK A;  1UW1 A;  3CCQ 3;  3LTC A;  4HM2 B;  3CC2 3;  4AKY A;  1DMQ A;  1FGO A;  1OGZ A;  1I70 A;  1KQS 2;  2WO0 A;  1I8V A;  3D79 A;  3AHW A;  4O2H A;  3HK4 A;  3F7S A;  3WR2 A;  1KSI A;  3OXA A;  1YJ9 3;  1IQY A;  1BNF A;  1NNV A;  4L8O A;  6RNT A;  2SBL A;  1JNQ A;  1U8C B;  1JBT A;  3CD6 3;  1MOL A;  1Q86 4;  3LTD A;  1BVI A;  1GY5 A;  2INX A;  3LZA A;  2YX9 A;  1JN5 B;  3U1W A;  3X41 A;  1EUI C;  2HML B;  1EA2 A;  1N9E A;  3DMC A;  3SX1 A;  1RN1 A;  1E3R A;  3S67 A;  3SXX A;  4WFO A;  5AEU B;  1EG9 B;  2WOF A;  1BSD A;  1VZZ A;  2GEY A;  1FUS A;  1OHP A;  2AAD A;  2KXG A;  2W04 A;  4PEJ A;  1DMN A;  2GEX A;  3NX0 A;  1MWT A;  4KVH A;  3T8U A;  3CPO A;  1RGE A;  3OWU A;  4NRE A;  4RNY A;  2OOV A;  3UB1 A;  4O02 B;  3CCS 3;  2OCT A;  2FNQ A;  3CU3 A;  3G0K A;  3I55 3;  1B2M A;  3DZL A;  3IPT A;  1BSB A;  4FCM A;  4WYK A;  1W2B 2;  4GHO A;  4EC6 A;  4K1U A;  1EQK A;  1CYU A;  2IUK A;  2HMJ B;  1PU4 A;  4N6V 0;  4G1M B;  3CC4 3;  3MYT A;  3NXJ A;  7GSP A;  1NB3 I;  4FMD A;  4X2O A;  4KFE A;  5IG0 A;  3UJM A;  4R4K A;  4AKZ A;  2A15 A;  1MWR A;  4Q53 A;  3NBR A;  1K73 4;  4N3V A;  1RN4 A;  3CME 3;  1FGQ A;  1OF5 B;  1BNI A;  2B24 B;  2F4Y A;  2AAE A;  4IT7 A;  9RNT A;  1QAF A;  3WA3 A;  1M1K 4;  2RBI A;  2LYX A;  2WGQ A;  1GMR A;  3JUP A;  3X3Z A;  1RGL A;  3OWY A;  2V1L A;  1RHL A;  5CK6 A;  3SVA A;  5AII A;  3HII A;  2MC8 A;  1RJO A;  2PNC A;  2RGQ A;  3F14 A;  1TUH A;  2BMQ B;  1Q7Y 4;  1BAN A;  2K3D A;  3IJE B;  4L7K A;  2UX0 A;  2KF5 A;  3HOH A;  1S5A A;  1Q81 4;  1O7P B;  1T3B A;  2Y74 A;  3JUQ A;  6GSP A;  5M1A A;  1JBS A;  4MJD A;  2L1S A;  3D5G A;  2CG0 A;  1W5Z A;  1DET A;  1LQM B;  2KF3 A;  1STD A;  1UUV B;  1R4Y A;  4J8T A;  4XDW A;  2YFJ B;  5M18 A;  3RGR A;  3PS8 A;  3D9R A;  1ULJ B;  3LOY A;  1IVW A;  1NDO B;  2BNG A;  1UI7 A;  1IQX A;  1CQS A;  3LT9 A;  5AI1 A;  2HOH A;  3LYG A;  1OPY A;  2XFT A;  3K9M C;  1SJW A;  4KT3 B;  1MGW A;  4I5Q A;  3LTA A;  3H51 A;  4J5G A;  1S72 3;  1TTO A;  1G96 A;  3X42 A;  5JBS A;  2F56 A;  2XF3 A;  1FZU A;  1NB5 I;  4KFF A;  1RRL A;  2GU3 A;  1KC8 4;  2XEP A;  3OWS A;  1ULI B;  3T0U A;  3BNE A;  4RNZ A;  2CX1 A;  1YGW A;  1BRK A;  1RRH A;  4IPB A;  4IIA A;  2XRX B;  1RNB A;  4GB5 A;  4HM0 B;  3KSP A;  3EC9 A;  1RCK A;  1A2V A;  3B4P A;  2CG1 A;  3JUM A;  1B20 A;  5I97 A;  4OK0 A;  3WA2 X;  2E2U A;  3MSO A;  1EKM A;  2HMK B;  3NBJ A;  1VQL 3;  1HKX A;  4N6L A;  1TFO A;  5BXQ A;  2OTJ 3;  3EB8 A;  1IV7 A;  3FSD A;  1OHO A;  3L0R A;  2D1W A;  3HIG A;  3EE1 A;  1BRH A;  2M7O A;  1WMN A;  1YVB I;  4HM5 B;  1RCL A;  4K90 B;  3CMA 3;  3N8B A;  2W2C A;  3F9S A;  1FW7 A;  1BSC A;  1W01 A;  1GSP A;  4TX4 A;  3CXC 2;  3CCJ 3;  3ER7 A;  2CFW A;  1ISK A;  5KP1 A;  1AR0 A;  1M1X B;  3DH2 A;  3MWZ A;  3BIR A;  4L8P A;  1UUG B;  1YVS A;  2QGU A;  1JKG B;  1I0V A;  3X3X A;  4EXR A;  3E99 A;  1QAL A;  2KCD A;  3D4A A;  1RGC A;  1SPU A;  5IEN A;  3WOF B;  1W02 A;  4N6N B;  1O7M B;  4HVN A;  2C10 A;  2IA7 A;  5IW9 A;  5HGR A;  1PFP A;  3GSP A;  1BAO A;  3UNL A;  7RNT A;  2CWV A;  2ZA4 A;  1BNR A;  1DMM A;  4RZM A;  3I56 3;  2L4V A;  1O7W B;  2F86 B;  3NV0 A;  2IY2 A;  2XSH B;  1BRG A;  1HU9 A;  4XBY A;  5ELJ A;  4EV2 A;  3KN4 A;  4N6U A;  1BIR A;  1VQ8 3;  1I2G A;  3ZG0 A;  1RLS A;  4OUQ A;  2H0G A;  1RGA A;  2O3O A;  4J5K A;  2CH9 A;  1GD4 A;  8RNT A;  3CCE 3;  1SAR A;  4XDV A;  4GSP A;  1A67 A;  3CCL 3;  3V99 A;  5IF6 A;  3K0Z A;  1D6Y A;  3Q2P A;  3KII A;  1EEJ A;  3NHX A;  4EW5 A;  4MEI A;  1SQW A;  3F8X A;  2RNT A;  2CFL A;  1LOV A;  2W6J H;  1NJI 4;  1Q40 B;  2JDI H;  2RSX A;  3BND A;  1MWU A;  1M9G A;  2CWU A;  1TJD A;  3PYJ A;  2CX0 A;  1BU4 A;  1RGH A;  5HOH A;  1I3I A;  1A90 A;  3B4O A;  4BTW A;  3GWR A;  1O7N B;  1LQG C;  2BU4 A;  1D6U A;  1YGE A;  4XB5 A;  2QIY A;  2UUG C;  1HYF A;  2H0H A;  2YFL B;  2W9P A;  2HMO B;  1X1W A;  2HMN B;  2Q07 A;  3I0Y A;  1W4N A;  2F5W A;  3CCU 3;  3UL6 A;  5CF1 A;  1LNH A;  1JZD A;  5ELU A;  5KP3 A;  4N6T A;  2CFG A;  2XGL A;  2BMR B;  1TFK A;  1UUW B;  3FKA A;  4WP5 A;  3MHE A;  3S27 A;  1FA3 A;  5G1K A;  5FGO A;  3BU4 A;  3G6E 3;  1IK3 A;  1RSN A;  2W03 A;  1Q82 4;  2OOV C;  1STF I;  3DY5 A;  3HZP A;  3PGB A;  4R1K A;  1AQZ A;  3U97 A;  2LQV A;  3BNB A;  5G1L A;  3WOE B;  1RTU A;  1SII A;  3KCH A;  4N6O B;  1TRQ A;  2R41 A;  3EBT A;  3PCS A;  4EV5 A;  1ROV A;  1UCL A;  4O8S A;  1K9M 4;  2IUJ A;  1W6G A;  3LTB A;  2RFR A;  3NV0 B;  1UGI A;  5DRV A;  3AGO A;  5AEW B;  1D6Z A;  3X40 A;  1I2E A;  1A2K A;  3CNX A;  1W6C A;  1JB2 A;  3EN1 B;  4LYL B;  4CPK A;  4BIR A;  3LML A;  3ROB A;  1ZX2 A;  2E2T A;  1B2U A;  1VQN 3;  2YFI B;  3SED A;  5LC6 A;  1RGF A;  1HZ1 A;  1JKG A;  3ALA A;  3QK9 A;  3MPH A;  4FMC A;  1B2Z A;  1QVG 2;  1W00 A;  2BT3 A;  2P09 A;  4HM4 B;  4U13 A;  2QA4 3;  3DGN A;  5EEO A;  4CDL A;  2MF7 A;  4BTX A;  3MKI A;  3WDG B;  1U5O A;  1FGR A;  1G02 A;  1K28 A;  1N8Q A;  1T2I A;  3AMO A;  5IG3 A;  3RGA A;  2GU1 A;  1YIT 3;  1YJW 3;  1UGH I;  2GBW B;  3G16 A;  3JVC A;  2OQE A;  3CNM A;  4HOH A;  3PZW A;  3STD A;  1WMO A;  1GY7 A;  2CK3 H;  2BIR A;  3DUK A;  2F5M A;  1YNV X;  5AYS C;  3WOD G;  1DYU A;  5D82 A;  3SLU A;  1YJN 3;  2QEX 3;  2UGI A;  1FGT A;  2ZHX B;  1WTH A;  1E3V A;  4JRF A;  3MG2 A;  5BU4 A;  2E2V A;  1IQ8 A;  1GOV A;  2Z77 A;  1PY3 A;  1IT7 A;  2FGT A;  2Z6B A;  3EF8 A;  1ZS7 A;  2XFS A;  4HM3 B;  1Q40 A;  3QRD A;  1N9J A;  1UCK A;  3GAX A;  1V58 A;  1RN7 A;  1V57 A;  1QVF 2;  5G2G A;  3FG3 A;  5IG4 A;  1C7H A;  4MMX B;  1IYY A;  1Q42 A;  2PZV A;  3LT8 A;  3Q90 A;  2CWT A;  1BRN L;  3GZY B;  3VSY A;  1A2P A;  4CJN A;  4EBG A;  4HZ9 B;  1GMP A;  1IDP A;  2CC3 A;  3EN8 A;  4OVM A;  1BSA A;  3SOA A;  4WHA A;  2Z7A A;  2BMO B;  4KFD A;  2R4I A;  4BTY A;  4HBR A;  3FGY A;  1AVK A;  3FH1 A;  2GXF A;  2GSP A;  3KKG A;  3A76 A;  3DGM A;  3EJV A;  4JF8 A;  4ZM8 A;  1UCJ A;  3KFQ C;  2I9W A;  2WOH A;  3FZW A;  1JRQ A;  3M8C A;  1VQO 3;  3CCV 3;  1X1U A;  4WWU C;  5EQL A;  1FUT A;  1IVV A;  3RDE A;  1OUN A;  1AY7 A;  1UI8 A;  3F40 A;  1MNL A;  5STD A;  3O8Y A;  1UDI I;  1TP6 A;  1WNH A;  2B1X B;  2P05 A;  1G0T A;  3KZT A;  4HJL B;  4HM7 B;  1L5G B;  1X1X A;  3AMO B;  3D5I A;  3VF1 A;  1LOX A;  2GBX B;  4LEH A;  1K41 A;  5AIH A;  3EBY A;  3LH4 A;  5BIR A;  1V74 A;  2ML5 A;  5IG5 A;  1BRJ A;  4LZI A;  4HAA A;  1BUQ A;  3ZFZ A;  4KZ1 A;  1Z1S A;  1CYV A;  7STD A;  1GD3 A;  1RGG A;  1DVD A;  1CH0 A;  1B2X A;  2JQ5 A;  5D81 A;  3TDG A;  2ML6 A;  1YI2 3;  5TGN A;  1MWS A;  1KWI A;  2F99 A;  5JPP A;  2KRT A;  4MMY B;  2CFD A;  1YIJ 3;  3DGY A;  1LRA A;  4ILF A;  2RCD A;  5IER A;  1IT8 A;  1VQ5 3;  3WHO A;  3T8N A;  3UL5 A;  1AV4 A;  1FGM A;  5IEO A;  3PXM A;  1T5Y A;  3V92 A;  1NU3 A;  1QJG A;  1W2Z A;  1GOU A;  3URP A;  3K7C A;  1I3F A;  1BUJ A;  3B8L A;  1JJ2 2;  3FCS B;  4HZB B;  3X3Y A;  2FXT A;  2KAA A;  3G71 3;  3FG1 A;  1QAK A;  2H0I A;  5AIG A;  1ROA A;  1LXE A;  1GY6 A;  3B7C A;  2W56 A;  5AYR B;  1GS3 A;  1N5P A;  5M19 A;  3DXO A;  3F8H A;  3D3L A;  3K63 A;  1N8R 4;  1JV2 B;  1RMS A;  1IV9 A;  3BB9 A;  5GSP A;  1VQP 3;  2CHC A;  3G8Z A;  3N54 B;  4K61 A;  4N6M A;  5EVH A;  1VQ9 3;  2W9Q A;  1JZO A;  1BOX A;  3KE7 A;  2KF6 A;  3JUO A;  5FW5 A;  3BLZ A;  2W0Q A;  3EX9 A;  1K8A 4;  6STD A;  1T2H A;  1BGS A;  2C11 A;  3F7X A;  1MGR A;  4FR9 A;  4HKV B;  3V98 A;  2CKF B;  4NPB A;  2Y73 A;  1BNJ A;  1VQQ A;  1R4C A;  5IEP A;  3G4S 3;  1W6Y A;  3CC7 3;  1O7H B;  1RKY A;  2BO9 B;  2P0M A;  1JB4 A;  1ZGX A;  1WQL B;  2HMM B;  3NQZ A;  1GYB A;  4ORL A;  2KF4 A;  2ZDJ A;  1TU5 A;  1VQ6 3;  1Y4K A;  1DE3 A;  2WGO A;  3KSE D;  4HYZ A;  3EHC A;  3FF0 A;  3EQQ B;  4STD A;  1TRP A; 
#chains in the Genus database with same CATH homology
 3FLJ A;  4HM8 B;  5JPU A;  4H3U A;  3K5T A;  4K1V A;  3WMD A;  2Z76 A;  1OCV A;  4AEQ A;  4FMB A;  1IU7 A;  3NQY A;  4FCZ A;  2K54 A;  4GL6 A;  4NHF A;  4R9K A;  2CFK A;  4RBN A;  5CXO A;  1TIJ A;  3GRD A;  5CF2 A;  3HI7 A;  5KP4 A;  4HM1 B;  2P0X A;  2W56 B;  3OV4 A;  4MMZ B;  1OAC A;  1US1 A;  2IMJ A;  3OX9 A;  2O9U X;  5A0O B;  5BVB A;  4LSO A;  3GZX B;  3J7Y d;  3DM8 A;  1QMA A;  4R80 A;  1W7C A;  3FG4 A;  1OHS A;  5D83 A;  3GZR A;  4LGQ A;  1N5H A;  3S29 A;  3BNC A;  5LC7 A;  4WYK B;  8CHO A;  1IVX A;  4HM6 B;  3FF2 A;  1ZO2 A;  1YHQ 3;  3HX8 A;  4FCJ A;  2K0M A;  3NM7 A;  3NM2 A;  4X2H A;  3PCR A;  5CLK A;  2OQE C;  1JB5 A;  1VQ7 3;  3ECF A;  3CCM 3;  1FUW A;  1VQ4 3;  3MG1 A;  1JN5 A;  3DGO A;  4XBX A;  1O7G B;  3N9H A;  1LVN A;  2BHM A;  2OWP A;  1F8N A;  4LMI A;  2XH9 A;  1NWW A;  2XSO B;  2ZL8 A;  5AIF A;  3CPW 2;  1KD1 4;  1AVL A;  2F98 A;  5DRE A;  3OW2 2;  3IMA B;  3Q1C A;  1DVC A;  1OGX A;  2CIU A;  4O3V A;  3S5C A;  3NUV A;  3CCR 3;  2STD A;  3VGN A;  2XGN A;  4I4K A;  1NO3 A;  1WMP A;  3H3H A;  4XM4 A;  1M90 4;  4CCV A;  4XBT A;  1VQM 3;  1SIH A;  4J9A A;  3JUN A;  2XR8 B;  4FMA A;  1E97 A;  4H61 A;  3LXU X;  3S28 A;  4QWT A;  3GZB A;  2P38 A;  1OH0 A;  1CEW I;  1IVU A;  1OF5 A;  3MG3 A;  2D42 A;  3NBB A;  3SOY A;  1VQK 3;  2OTL 3;  4EYC A;  3DGL A;  4R9L A;  1J2B A;  2CW9 A;  1ASK A;  1UW1 A;  3CCQ 3;  3LTC A;  4HM2 B;  3CC2 3;  4AKY A;  1DMQ A;  1FGO A;  1OGZ A;  1KQS 2;  2WO0 A;  4O2H A;  3HK4 A;  3F7S A;  1KSI A;  3OXA A;  1YJ9 3;  1IQY A;  4L8O A;  2SBL A;  1JNQ A;  1U8C B;  3CD6 3;  1MOL A;  1Q86 4;  3LTD A;  1GY5 A;  2INX A;  3LZA A;  2YX9 A;  1JN5 B;  3U1W A;  3X41 A;  2HML B;  1EA2 A;  1N9E A;  3DMC A;  3SX1 A;  1E3R A;  3S67 A;  3SXX A;  4WFO A;  5AEU B;  1EG9 B;  2WOF A;  2GEY A;  1VZZ A;  5DRV A;  2W04 A;  1OHP A;  2KXG A;  4PEJ A;  3T8U A;  1DMN A;  2GEX A;  3NX0 A;  4KVH A;  3CPO A;  3OWU A;  4NRE A;  4RNY A;  2OOV A;  3UB1 A;  4O02 B;  3CCS 3;  2OCT A;  2FNQ A;  3CU3 A;  3G0K A;  3I55 3;  3DZL A;  3IPT A;  4FCM A;  4WYK A;  1W2B 2;  4EC6 A;  4K1U A;  1EQK A;  1CYU A;  2IUK A;  2HMJ B;  1PU4 A;  4N6V 0;  4G1M B;  3CC4 3;  3MYT A;  3NXJ A;  1NB3 I;  4FMD A;  4X2O A;  4KFE A;  5IG0 A;  3UJM A;  4R4K A;  4AKZ A;  2A15 A;  4Q53 A;  3NBR A;  1K73 4;  4N3V A;  3CME 3;  1FGQ A;  1OF5 B;  2B24 B;  4IT7 A;  3WA3 A;  1QAF A;  1M1K 4;  2LYX A;  2WGQ A;  3JUP A;  3X3Z A;  3OWY A;  2V1L A;  5CK6 A;  3SVA A;  5AII A;  3HII A;  2MC8 A;  1RJO A;  2PNC A;  2RGQ A;  3F14 A;  1TUH A;  2BMQ B;  1Q7Y 4;  3IJE B;  4L7K A;  2UX0 A;  1Q81 4;  1S5A A;  1O7P B;  3JUQ A;  2Y74 A;  4MJD A;  2CG0 A;  1W5Z A;  1STD A;  1UUV B;  4J8T A;  4XDW A;  2YFJ B;  3RGR A;  3PS8 A;  3D9R A;  1ULJ B;  3LOY A;  1IVW A;  1NDO B;  2BNG A;  1UI7 A;  1IQX A;  1CQS A;  3LT9 A;  5AI1 A;  3LYG A;  1OPY A;  2XFT A;  3K9M C;  1SJW A;  3LTA A;  3H51 A;  1S72 3;  1G96 A;  3X42 A;  5JBS A;  2XF3 A;  1NB5 I;  4KFF A;  1RRL A;  2GU3 A;  1KC8 4;  2XEP A;  3OWS A;  1ULI B;  3T0U A;  3BNE A;  4RNZ A;  1RRH A;  4IPB A;  4IIA A;  2XRX B;  4GB5 A;  4HM0 B;  3KSP A;  3EC9 A;  1A2V A;  3B4P A;  2CG1 A;  3JUM A;  5I97 A;  4OK0 A;  3WA2 X;  2E2U A;  3MSO A;  1EKM A;  2HMK B;  3NBJ A;  1VQL 3;  1HKX A;  4N6L A;  1TFO A;  5BXQ A;  2OTJ 3;  3EB8 A;  1IV7 A;  3FSD A;  1OHO A;  3L0R A;  2D1W A;  3HIG A;  3EE1 A;  2M7O A;  1WMN A;  1YVB I;  4HM5 B;  4K90 B;  3CMA 3;  3N8B A;  2W2C A;  3F9S A;  1W01 A;  3CXC 2;  4TX4 A;  3CCJ 3;  3ER7 A;  2CFW A;  1ISK A;  5KP1 A;  1AR0 A;  1M1X B;  3MWZ A;  4L8P A;  2QGU A;  3X3X A;  4EXR A;  1JKG B;  3E99 A;  1QAL A;  2KCD A;  1SPU A;  5IEN A;  3WOF B;  1W02 A;  4N6N B;  1O7M B;  4HVN A;  2C10 A;  2IA7 A;  5IW9 A;  5HGR A;  1PFP A;  3UNL A;  2CWV A;  1DMM A;  4RZM A;  3I56 3;  2L4V A;  1O7W B;  2F86 B;  3NV0 A;  5ELJ A;  2XSH B;  1HU9 A;  4XBY A;  4EV2 A;  3KN4 A;  4N6U A;  1VQ8 3;  4OUQ A;  2O3O A;  2CH9 A;  1GD4 A;  3CCE 3;  1A67 A;  4XDV A;  3CCL 3;  3V99 A;  5IF6 A;  3K0Z A;  1D6Y A;  3Q2P A;  3KII A;  3NHX A;  4MEI A;  1SQW A;  3F8X A;  2CFL A;  2W6J H;  1NJI 4;  1Q40 B;  2JDI H;  2RSX A;  3BND A;  1M9G A;  2CWU A;  3PYJ A;  1A90 A;  3B4O A;  4BTW A;  3GWR A;  1O7N B;  4XB5 A;  1D6U A;  1YGE A;  2QIY A;  2YFL B;  2W9P A;  2HMO B;  2HMN B;  2Q07 A;  3I0Y A;  1W4N A;  3CCU 3;  3UL6 A;  5CF1 A;  1LNH A;  5ELU A;  5KP3 A;  4N6T A;  2CFG A;  2XGL A;  2BMR B;  1TFK A;  1UUW B;  3FKA A;  4WP5 A;  3MHE A;  3S27 A;  1FA3 A;  5FGO A;  3G6E 3;  1IK3 A;  2W03 A;  1Q82 4;  2OOV C;  1STF I;  3DY5 A;  3HZP A;  3PGB A;  4R1K A;  3U97 A;  2LQV A;  3BNB A;  3WOE B;  1SII A;  4N6O B;  3EBT A;  3PCS A;  4EV5 A;  1ROV A;  4O8S A;  1K9M 4;  2IUJ A;  1W6G A;  3LTB A;  2RFR A;  3NV0 B;  5AEW B;  1D6Z A;  3X40 A;  1A2K A;  3CNX A;  1W6C A;  1JB2 A;  3EN1 B;  3LML A;  3ROB A;  1ZX2 A;  2E2T A;  1VQN 3;  2YFI B;  3SED A;  5LC6 A;  1JKG A;  3ALA A;  3QK9 A;  3MPH A;  4FMC A;  1QVG 2;  1W00 A;  2BT3 A;  2P09 A;  4HM4 B;  4U13 A;  2QA4 3;  3DGN A;  5EEO A;  4CDL A;  2MF7 A;  4BTX A;  3MKI A;  3WDG B;  1U5O A;  1FGR A;  1N8Q A;  1K28 A;  3AMO A;  5IG3 A;  3RGA A;  2GU1 A;  1YIT 3;  1YJW 3;  2GBW B;  3G16 A;  3JVC A;  2OQE A;  3CNM A;  3PZW A;  3STD A;  1WMO A;  1GY7 A;  2CK3 H;  3DUK A;  5AYS C;  3WOD G;  1DYU A;  5D82 A;  3SLU A;  1YJN 3;  2QEX 3;  1FGT A;  1WTH A;  1E3V A;  4JRF A;  3MG2 A;  2E2V A;  1IQ8 A;  2Z77 A;  2Z6B A;  1IT7 A;  2FGT A;  3EF8 A;  2XFS A;  4HM3 B;  1Q40 A;  3QRD A;  1N9J A;  3GAX A;  1QVF 2;  1RN7 A;  5G2G A;  3FG3 A;  5IG4 A;  1C7H A;  4MMX B;  1Q42 A;  2PZV A;  3LT8 A;  3Q90 A;  2CWT A;  3GZY B;  3VSY A;  4EBG A;  4HZ9 B;  2CC3 A;  1IDP A;  3EN8 A;  4OVM A;  3SOA A;  4WHA A;  2Z7A A;  2BMO B;  4KFD A;  2R4I A;  4BTY A;  4HBR A;  3FGY A;  1AVK A;  3FH1 A;  2GXF A;  3KKG A;  3A76 A;  3DGM A;  3EJV A;  4JF8 A;  4ZM8 A;  3KFQ C;  2I9W A;  2WOH A;  3FZW A;  1JRQ A;  3M8C A;  1VQO 3;  3CCV 3;  4WWU C;  5EQL A;  3RDE A;  1IVV A;  1OUN A;  1UI8 A;  3F40 A;  1MNL A;  5STD A;  3O8Y A;  2B1X B;  1TP6 A;  1WNH A;  4HM7 B;  2P05 A;  1L5G B;  3KZT A;  4HJL B;  3AMO B;  3VF1 A;  1LOX A;  2GBX B;  4LEH A;  1K41 A;  5AIH A;  3EBY A;  3LH4 A;  1V74 A;  2ML5 A;  5IG5 A;  4LZI A;  1BUQ A;  4KZ1 A;  1Z1S A;  1CYV A;  7STD A;  1GD3 A;  1DVD A;  2JQ5 A;  5D81 A;  3TDG A;  2ML6 A;  1YI2 3;  5TGN A;  1KWI A;  2F99 A;  5JPP A;  2KRT A;  4MMY B;  2CFD A;  1YIJ 3;  2RCD A;  5IER A;  1IT8 A;  1VQ5 3;  3T8N A;  3UL5 A;  1AV4 A;  1FGM A;  5IEO A;  3PXM A;  1T5Y A;  3V92 A;  1NU3 A;  1QJG A;  1W2Z A;  3K7C A;  3B8L A;  1JJ2 2;  3FCS B;  4HZB B;  3X3Y A;  2FXT A;  3G71 3;  3FG1 A;  1QAK A;  5AIG A;  1ROA A;  1LXE A;  1GY6 A;  3B7C A;  2W56 A;  5AYR B;  1GS3 A;  1N5P A;  3DXO A;  3F8H A;  3D3L A;  3K63 A;  1N8R 4;  1JV2 B;  1IV9 A;  3BB9 A;  1VQP 3;  2CHC A;  3G8Z A;  3N54 B;  4K61 A;  4N6M A;  5EVH A;  1VQ9 3;  2W9Q A;  3KE7 A;  3JUO A;  5FW5 A;  3BLZ A;  2W0Q A;  3EX9 A;  1K8A 4;  6STD A;  2C11 A;  3F7X A;  4FR9 A;  4HKV B;  3V98 A;  2CKF B;  2Y73 A;  1R4C A;  5IEP A;  3G4S 3;  1W6Y A;  3CC7 3;  1O7H B;  1RKY A;  2BO9 B;  2P0M A;  1JB4 A;  1WQL B;  2HMM B;  3NQZ A;  1GYB A;  4ORL A;  2ZDJ A;  1TU5 A;  1VQ6 3;  1Y4K A;  2WGO A;  3KSE D;  4HYZ A;  3EHC A;  3FF0 A;  3EQQ B;  4STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...