3NV0A

Crystal structure and mutational analysis of the nxf2/nxt1 heterodimeric complex from caenorhabditis elegans at 1.84 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
MFRNGYYGSDEVRTLVEEFIITYYKIYDGADGQQTRKQLLDAYDTNNSTFTHTVVCLWDPIKFVMYPDSESYRMYLRTSHNVLNQEYFAANRASRISHGAMDIVVALSRLPATIHLMDTFVVDVFLVSATLLGFTLHGTFRDGPSAIKPENTEEHDNYFTRTFMVAPRGEGKVAIVSDQLFISSMSKRRGDQYRML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding/protein transport
molecule keywords Nuclear RNA export factor 2
publication title The structure of the NXF2/NXT1 heterodimeric complex reveals the combined specificity and versatility of the NTF2-like fold.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 63
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2010-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nv0A00
1OHSA 1ASKA 4XDVA 1OF5A 3F9SA 2QGUA 1QJGA 3EC9A 5CLKA 1EG9B 1JKGB 3NBRA 3OXAA 3EJVA 1HKXA 2B24B 5AIFA 3IPTA 5D82A 5D81A 3HZPA 3KSPA 4XB5A 1JN5A 3JUMA 3NV0A 1W01A 4K1UA 3GZRA 3KE7A 1S5AA 3EN1B 5CXOA 4HM1B 1Q42A 4HJLB 1OGZA 4XBXA 3F40A 1OH0A 5CF1A 3SOAA 4Q53A 4HZBB 2STDA 3CPOA 3FLJA 5HGRA 2HMJB 3LYGA 4X2OA 2HMKB 2YFJB 3CNMA 2K54A 4HZ9B 4K1VA 3OX9A 1TUHA 4L8PA 4WYKA 1OGXA 4H3UA 2R4IA 1OF5B 4FCJA 2BNGA 3ER7A 2CKFB 1ULJB 3Q90A 5IG5A 2UX0A 3EBYA 4HM3B 5BXQA 1GS3A 8CHOA 2BMRB 3NUVA 3MG3A 4IIAA 1JN5B 1ISKA 1Q40A 5BVBA 2INXA 2PZVA 2XR8B 2W2CA 1IDPA 5JPUA 4R9KA 3B4PA 2GXFA 3F8XA 7STDA 1E3VA 3D9RA 5TGNA 1GY7A 3SOYA 3ECFA 2RGQA 1DMMA 3KKGA 1O7MB 3HX8A 2Z77A 2Z7AA 3FGYA 1O7HB 4HM0B 3SEDA 3LZAA 1WQLB 2XSHB 2OWPA 5G2GA 3DM8A 3JUNA 2F99A 1ZX2A 1W6YA 4HM6B 4WP5A 3OWUA 5D83A 3MSOA 1CQSA 3WMDA 2GBWB 1QMAA 5AIIA 1E97A 3EBTA 3UJMA 3OV4A 2YFLB 4WYKB 4HM7B 4N3VA 5KP4A 2CHCA 1O7NB 1NU3A 2RFRA 3DUKA 5DREA 3NHXA 3A76A 5AI1A 3RGRA 1GY6A 4HM8B 1OHOA 5KP3A 3MKIA 3B4OA 2IMJA 4L8OA 1DMNA 1UUWB 4LEHA 4RZMA 1Q40B 2GBXB 3DMCA 4U13A 4ORLA 2HMOB 4OUQA 1SJWA 1O7GB 1DMQA 2BMQB 1AR0A 3OWYA 3GZXB 1JKGA 2HMNB 3S5CA 1EA2A 5IF6A 3F7SA 2YFIB 4OVMA 1JB2A 4XDWA 3EX9A 5IERA 3EN8A 4XM4A 3DZLA 2GEXA 3GRDA 1U5OA 4WWUC 3NV0B 1BUQA 3E99A 4MJDA 3RGAA 6STDA 1JB4A 2HMLB 1STDA 5STDA 3BLZA 3H51A 1VZZA 2GEYA 1ZO2A 3GWRA 3JUOA 3NM2A 3MHEA 3FH1A 5IENA 1GYBA 3F8HA 1ULIB 1Z1SA 2RCDA 3ROBA 1TP6A 3FKAA 3EQQB 4PEJA 3K7CA 1W02A 4CDLA 5IG0A 1NWWA 3CNXA 3DXOA 4HM4B 5IEPA 1OPYA 3H3HA 3NXJA 2BMOB 3BB9A 3HK4A 1K41A 2HMMB 4R1KA 3M8CA 5IG3A 2B1XB 1O7WB 4HKVB 3UNLA 3VGNA 4STDA 4LMIA 4XBYA 3GZYB 3JUPA 5AEUB 3KZTA 4L7KA 5AEWB 3EF8A 4J8TA 3FF2A 3MYTA 3MG1A 4J9AA 2XRXB 3MG2A 3VSYA 3F14A 5FW5A 4HM2B 2Z76A 3OWSA 2F98A 2XSOB 1E3RA 1NDOB 4KVHA 2I9WA 5CF2A 5JPPA 4FCMA 3G8ZA 1OCVA 5EVHA 4R9LA 2QIYA 3JUQA 3T8UA 1GY5A 3F7XA 4GB5A 3G0KA 4I4KA 1OHPA 3FSDA 3GZBA 5AIGA 5KP1A 2JQ5A 1C7HA 4HM5B 4X2HA 1UUVB 3STDA 3I0YA 3FZWA 3CU3A 4LGQA 1JB5A 1O7PB 5DRVA 3FF0A 5CK6A 2F86B 4HVNA 1OUNA 2A15A 5IG4A 4XBTA 1A2KA 1W00A 5IEOA 5AIHA 3B8LA 3K0ZA 3G16A 3B7CA 3T8NA 3EHCA
chains in the Genus database with same CATH superfamily
1OHSA 1ASKA 2PNCA 3LT8A 2Z6BA 1OF5A 4XDVA 5HGRA 1MWTA 4ZM8A 1M1K4 3F9SA 3K5TA 3BNEA 1I3FA 3CCE3 2QGUA 1QJGA 1WMNA 1IU7A 2YX9A 1JBRA 1VQ83 3K63A 5FGOA 1G96A 3SYUA 4DKIA 1M904 3EC9A 5CLKA 1W6CA 1EG9B 1RGHA 3V99A 1BRGA 1RGAA 1I2GA 1JKGB 2ZL8A 3NBRA 3OXAA 3EJVA 1HKXA 1V57A 2B24B 2KF4A 1B3SA 2KAAA 3AGOA 1GMPA 3IPTA 5AIFA 5D81A 5D82A 5I97A 3G713 3HZPA 3FCSB 3KSPA 4XB5A 1JN5A 2CFDA 3NM7A 2WGQA 2HOHA 1RGFA 3JUMA 1W01A 1KSIA 1LOXA 3NV0A 4FMAA 4GHOA 4K1UA 1RNBA 1MGRA 3GZRA 3KN4A 2IA7A 1IQYA 4MMYB 2BHMA 9RNTA 1K734 1BGSA 1S723 1W5ZA 1V58A 2CG0A 2QA43 2F5MA 1S5AA 3KE7A 3EN1B 3LMLA 5CXOA 1IVXA 1ZGXA 3CMA3 4CCVA 1W2ZA 4HM1B 1Q42A 1RNTA 1OGZA 2P05A 4HJLB 4XBXA 3G4S3 3F40A 5JBSA 1OH0A 3IMAB 2XEPA 4I5QA 1RLSA 5CF1A 3SOAA 1WNHA 2V1LA 1I0VA 4Q53A 4HZBB 2STDA 3CPOA 1AVKA 3AHSA 1BRIA 2W9QA 3FLJA 1B2ZA 1JNQA 1N9JA 1BNGA 1LQMB 1R4YA 1BNJA 1SQWA 1B27A 2HMJB 3LYGA 3PS8A 2H0GA 3PZWA 4H61A 1ROAA 3AMOA 4K90B 2C11A 4X2OA 3ZG0A 2HMKB 1L5GB 1LXEA 1UCIA 1K9M4 1RN1A 1W4NA 1AV4A 2YFJB 3BNDA 4FR9A 1K8A4 4AEQA 1A2VA 4O3VA 3CNMA 2K54A 2ML6A 1RJOA 4HZ9B 4HYZA 4K1VA 3VF1A 1CH0A 3S28A 1PFPA 1TTOA 3OX9A 1JBSA 1TUHA 1VQN3 4L8PA 3U1WA 3I563 1VQ73 4NREA 2BT3A 3RDEA 2RSXA 4N6MA 2IY2A 3Q1CA 4EV5A 4WYKA 1BIRA 1UCKA 1OGXA 4FCZA 4H3UA 2R4IA 1JRQA 2ZDJA 4N6TA 4IPBA 7RNTA 1N5HA 1OF5B 1N5PA 4FCJA 3DGNA 2WOFA 5ELUA 1D6ZA 1WMOA 4FMDA 3LH4A 5EQLA 3PYJA 3CCJ3 1STFI 2BNGA 1YGWA 3ER7A 2CKFB 1ULJB 2KF3A 2W04A 3LT9A 3NQZA 3Q90A 5IG5A 1BANA 2F4YA 3TDGA 1N8R4 2CWVA 1I2FA 2AAEA 1FGRA 2UX0A 3EBYA 1BNIA 3FG4A 4HM3B 1IYYA 2ZHXB 1NNVA 1X1UA 1T5YA 3KIIA 1GS3A 5BXQA 3O8YA 3A5EA 4O8SA 8CHOA 2BMRB 2K0MA 2W03A 3NUVA 3MG3A 4IIAA 1B2SA 1JN5B 1RGLA 2CK3H 4K61A 3CD63 1ISKA 1Q40A 5BVBA 2INXA 1KQS2 2XGNA 2PZVA 2XR8B 3PGBA 1BSEA 2KXGA 2C4BA 4EC6A 1IVWA 2P0XA 1IDPA 2W2CA 4MMXB 5JPUA 2WOHA 5G1KA 1RCLA 1YJW3 2O9UX 4R9KA 3B4PA 5LC6A 2GXFA 1BAOA 2CWUA 1DETA 3F8XA 3BU4A 1RN4A 1E3VA 7STDA 1TIJA 5HOHA 3D9RA 5TGNA 2KF6A 1GY7A 3UB1A 1GD4A 3SOYA 3D79A 3ECFA 5EEOA 6RNTA 2LQVA 1YJ93 2RGQA 1DMMA 3KKGA 1O7MB 1HYFA 3HX8A 1AVLA 1DYUA 4KZ1A 1CYUA 2Z77A 2Z7AA 1GOVA 2SARA 3FGYA 3G6E3 2D42A 1RKYA 1QALA 1O7HB 4HM0B 3SEDA 1UI8A 3LZAA 4BTXA 1WQLB 2XSHB 1RGEA 1UW1A 2W9PA 2OWPA 1X1XA 3MWZA 3CC23 2LYXA 4RNZA 1BOXA 1M9GA 1UGIA 5G2GA 3CCU3 1VQ63 1IT7A 3LTBA 3AMOB 1BU4A 3DM8A 3JUNA 2F99A 1AQZA 1GOUA 2WO0A 1ZX2A 4J5KA 1RHLA 1X1WA 4CJNA 1W6YA 4HM6B 4WP5A 3OWUA 1Q864 3KSED 4NPBA 2K3DA 1BRSA 2OQEC 5D83A 3S29A 4R4KA 1IT8A 2KCDA 3MSOA 1J2BA 1CQSA 1AY7A 2CH9A 4N6UA 3WMDA 1VQ93 1TJDA 3GAXA 3FG3A 3FG1A 4RBNA 3X3XA 2GBWB 1QMAA 5AIIA 1E97A 1W2B2 2BU4A 3HIGA 4KFDA 3SLUA 1N9EA 1EUIC 3EBTA 3UJMA 3OV4A 2YFLB 3D5IA 4HM7B 4N3VA 4WYKB 5BU4A 1Q9EA 3DY5A 5KP4A 2UUGC 1RMSA 2CHCA 1O7NB 3EE1A 3PXMA 2CFGA 3BNCA 1NU3A 2CX0A 3ZG5A 1B2MA 5M18A 2RFRA 1NJI4 3DUKA 1DVCA 1FGTA 1IQ8A 5DREA 1YIT3 3NHXA 1IQXA 1GSPA 1KWIA 3A76A 3D4AA 4HBRA 5AI1A 3RGRA 1B20A 1GY6A 4HM8B 3NQYA 2OTL3 1OHOA 5KP3A 1B2XA 3HOHA 3MKIA 1Q7Y4 1RN7A 3B4OA 2F5WA 3WHOA 1F8NA 2IMJA 1NO3A 1RRLA 1BRHA 1DMNA 4L8OA 1UUWB 4LEHA 4RZMA 1Q40B 2GBXB 2CIUA 3DMCA 4U13A 4WFOA 4ORLA 2HMOB 1EEJA 4OUQA 1SJWA 3NX0A 3T0UA 2GU1A 1O7GB 5IW9A 1JZDA 1DMQA 1MWUA 2BMQB 2QEX3 1VQQA 1W6GA 1AR0A 2CFKA 3OWYA 3GZXB 3PCRA 2XGLA 4BU4A 1JKGA 2HMNB 2P0MA 4GL6A 1EA2A 3S5CA 5IF6A 2ML5A 4EW5A 5A0OB 1K28A 1G02A 3F7SA 4QWTA 2XF3A 2OOVC 1UDII 2YFIB 4OVMA 1LNIA 1NB5I 1JB2A 4XDWA 2E2TA 3EX9A 2OQEA 2CX1A 5IERA 1YNVX 3EN8A 3BNBA 4XM4A 4R80A 2IUKA 4BL3A 1PYLA 1FUSA 1RGGA 2OCTA 2CG1A 4TX4A 4FMBA 2RNTA 1DE3A 2C10A 3DZLA 1C54A 1QAFA 1CEWI 2FGTA 2GEXA 2W56A 3GRDA 1U5OA 4LYLB 3X41A 3CXC2 1UCJA 2IYJA 4WWUC 3ALAA 1VQP3 1T2HA 1FW7A 4N6OB 4EBGA 5AYSC 3NV0B 1LRAA 4O02B 1YVBI 2D1WA 4BL2A 1BUQA 5AYRB 3AHWA 2L4VA 1TFOA 3E99A 2XFTA 1FGMA 1GMRA 4MJDA 1FZUA 1X1YA 3RGAA 3WA2X 6STDA 1JB4A 1HZ1A 4IT7A 3X3ZA 3CCM3 1RCKA 2XFSA 2HMLB 1SIIA 1STDA 1YIJ3 4LZIA 1FGOA 3N9HA 3BLZA 5STDA 1RGKA 1TRPA 3H51A 1VZZA 2GEYA 2XH9A 3N54B 1ZO2A 3L0RA 5M1AA 1B2UA 3GWRA 3JUOA 3NM2A 1JZOA 1GMQA 1I3IA 1WMPA 3MHEA 1LOWA 2P38A 1FUTA 3FH1A 3KCHA 3SXXA 1LVNA 5IENA 1GYBA 1MNLA 2CW9A 2M7OA 3EB8A 1YHQ3 3JVCA 3F8HA 2KF5A 3KFQC 3CCL3 4ILFA 1ULIB 3CC43 1Z1SA 1BRJA 2RCDA 3WR2A 7GSPA 1T3BA 3CCV3 4BTWA 1Q824 3ROBA 1GOYA 1VQL3 3X40A 4OK0A 1TP6A 4AKYA 3Q2PA 2OOVA 1R4CA 1T2IA 1TRQA 4RNYA 1HU9A 3EQQB 3FKAA 2GU3A 4LSOA 4EXRA 1BRKA 4PEJA 3WA3A 5M19A 3K7CA 1W02A 2O3OA 1DVDA 4AKZA 1PY3A 4CDLA 2GSPA 1U8CB 2H0HA 1NWWA 5IG0A 3BIRA 3CNXA 1IV7A 1YGEA 4NHFA 8RNTA 3SVAA 3HI7A 3DGYA 1IV9A 2CC3A 3DXOA 3U97A 4N6LA 5ELJA 1BNFA 1MGWA 3LOYA 4HM4B 1FUWA 1G0TA 1MOLA 1A67A 1LNHA 5IEPA 1BSDA 1RDSA 2FNQA 4GSPA 1VQO3 3IJEB 3CCQ3 1ROVA 1Y4KA 1D6YA 1KD14 1OPYA 2AADA 1M1XB 3H3HA 3WOFB 3DH2A 2CWTA 1TU5A 1FA3A 1OACA 3NXJA 4BTYA 4RNTA 4HAAA 2BMOB 2L1SA 2J8XB 3BB9A 3PCSA 1EKMA 3HK4A 1K41A 3NBJA 2HMMB 4R1KA 3M8CA 4EYCA 1JV2B 3DGLA 2R41A 5IG3A 3X42A 3DGMA 1I2EA 1SPUA 2B1XB 2BIRA 2W56B 3UL5A 1O7WB 2Y73A 4HKVB 3UNLA 3NBBA 1SARA 4BIRA 1TFKA 1YVSA 3CME3 1US1A 1BSBA 3CC73 3VGNA 4STDA 5LC7A 4LMIA 4XBYA 6GSPA 3GZYB 1Q7HA 2CFLA 2MF7A 3JUPA 5AEUB 3KZTA 4L7KA 1BRNL 1IVVA 5AEWB 2E2VA 3EF8A 4J8TA 1BNRA 2H0IA 4HOHA 2CFWA 3FF2A 1LOVA 3MYTA 1UGHI 3V98A 3Q3FA 4KFFA 3MG1A 4J9AA 1BNEA 2XRXB 2KRTA 3MG2A 4MMZB 3VSYA 1LQGC 3CCR3 1YI23 3F14A 3WDGB 3RNTA 4CPKA 5FW5A 4HM2B 4JRFA 2Z76A 3GSPA 3OWSA 1QVF2 1UCLA 2F98A 1W7CA 3LTCA 4O2HA 2IUJA 2XSOB 1N8QA 1E3RA 3DGOA 3D3LA 3S67A 1MWRA 2P09A 1EQKA 1B21A 1A2PA 1I70A 1NDOB 4KVHA 2I9WA 5CF2A 5JPPA 1Q814 4G1MB 1BUJA 4FCMA 3LXUX 3G8ZA 3V92A 1VQM3 5BIRA 4J5GA 1OCVA 3OW22 2WGOA 5EVHA 4R9LA 2QIYA 1VQ43 1JJ22 1BVIA 3JUQA 3T8UA 1WTHA 1GY5A 1MWSA 1RGCA 4JF8A 2MC8A 3SX1A 1PU4A 3F7XA 4GB5A 3G0KA 3X3YA 1BNSA 4I4KA 3LTDA 1FYSA 1OHPA 5GSPA 3FSDA 3LTAA 4EV2A 1I8VA 2W0QA 1LOYA 3GZBA 5AIGA 1I0XA 2E2UA 2ZA4A 5G1LA 3S27A 3URPA 5KP1A 1IK3A 2JQ5A 1YJN3 1C7HA 4HM5B 4X2HA 1UUVB 1BSCA 4MEIA 3AGNA 3QRDA 3ZFZA 3J7Yd 2Y74A 3MPHA 3STDA 3CPW2 1RRHA 3I0YA 1JBTA 2F56A 3N8BA 2OTJ3 3FZWA 2BO9B 3CU3A 4FMCA 1VQK3 1D6UA 1SIHA 4LGQA 1UUGB 1QVG2 1UI7A 1JB5A 1FGQA 1CYVA 4KT3B 3I553 1O7PB 1BSAA 3UL6A 5DRVA 3FF0A 5CK6A 2F86B 4HVNA 4WHAA 1OUNA 2A15A 4N6V0 1NB3I 4XBTA 5IG4A 1A2KA 1IVUA 1GD3A 1RTUA 5RNTA 1RSNA 1W00A 1VQ53 5IEOA 3HIIA 3QK9A 2SBLA 1A90A 3CCS3 2JDIH 5AIHA 4KFEA 3B8LA 3K9MC 3WOEB 4N6NB 3K0ZA 2RBIA 1KC84 1QAKA 3G16A 2W6JH 3B7CA 2FXTA 2UGIA 1ZS7A 2Q07A 3D5GA 3WODG 3T8NA 3EHCA 1V74A
chains in the Genus database with same CATH topology
1OHSA 1ASKA 2PNCA 3LT8A 2Z6BA 1OF5A 4XDVA 4ZM8A 1M1K4 3F9SA 3K5TA 3BNEA 3CCE3 2QGUA 1QJGA 1WMNA 1IU7A 2YX9A 1VQ83 3K63A 5FGOA 1G96A 1M904 3EC9A 5CLKA 1W6CA 1EG9B 3V99A 1JKGB 2ZL8A 3NBRA 3OXAA 3EJVA 1HKXA 2B24B 5I97A 5AIFA 3IPTA 5D82A 5D81A 3G713 3HZPA 3FCSB 3KSPA 4XB5A 1JN5A 2CFDA 3NM7A 2WGQA 3JUMA 3NV0A 1W01A 1KSIA 1LOXA 4FMAA 4K1UA 3GZRA 3KN4A 2IA7A 1IQYA 4MMYB 2BHMA 1K734 1S723 1W5ZA 2CG0A 2QA43 3KE7A 1S5AA 3EN1B 3LMLA 5CXOA 1IVXA 3CMA3 4CCVA 1W2ZA 4HM1B 1Q42A 4HJLB 1OGZA 2P05A 4XBXA 3G4S3 3F40A 5JBSA 1OH0A 3IMAB 2XEPA 5CF1A 3SOAA 1WNHA 2V1LA 4Q53A 4HZBB 2STDA 3CPOA 1AVKA 2W9QA 3FLJA 1JNQA 1N9JA 1SQWA 5HGRA 2HMJB 3CME3 3LYGA 3PS8A 3PZWA 4H61A 4X2OA 1ROAA 3AMOA 4K90B 2C11A 2HMKB 1L5GB 1LXEA 1K9M4 1W4NA 1AV4A 2YFJB 3BNDA 4FR9A 1K8A4 4AEQA 1A2VA 4O3VA 3CNMA 2K54A 2ML6A 1RJOA 4HZ9B 4HYZA 4K1VA 3VF1A 3S28A 1PFPA 3OX9A 1TUHA 1VQN3 4L8PA 3U1WA 3I563 1VQ73 4NREA 2BT3A 3RDEA 2RSXA 4N6MA 3Q1CA 4EV5A 4WYKA 1OGXA 4FCZA 4H3UA 2R4IA 1JRQA 2ZDJA 4N6TA 4IPBA 1N5HA 1OF5B 1N5PA 4FCJA 3DGNA 2WOFA 5ELUA 1D6ZA 1WMOA 4FMDA 3LH4A 5EQLA 3PYJA 3CCJ3 1STFI 2BNGA 3ER7A 2CKFB 1ULJB 2W04A 3LT9A 3NQZA 3Q90A 5IG5A 3TDGA 1N8R4 2CWVA 2UX0A 1FGRA 3EBYA 3FG4A 4HM3B 1T5YA 3KIIA 1GS3A 5BXQA 3O8YA 4O8SA 8CHOA 2BMRB 2K0MA 2W03A 3NUVA 3MG3A 4IIAA 1JN5B 2CK3H 4K61A 3CD63 1ISKA 1Q40A 5BVBA 2INXA 1KQS2 2XGNA 2PZVA 2XR8B 3PGBA 2KXGA 4EC6A 1IVWA 2P0XA 1IDPA 2W2CA 4MMXB 5JPUA 2WOHA 1YJW3 2O9UX 4R9KA 3B4PA 5LC6A 2GXFA 2CWUA 3F8XA 7STDA 1E3VA 1TIJA 3D9RA 5TGNA 1GY7A 3UB1A 1GD4A 3SOYA 3ECFA 5EEOA 1YJ93 2LQVA 2RGQA 1DMMA 3KKGA 1O7MB 3HX8A 1AVLA 1DYUA 4KZ1A 1CYUA 2Z77A 2Z7AA 3FGYA 3G6E3 2D42A 1RKYA 1QALA 1O7HB 4HM0B 3SEDA 1UI8A 3LZAA 4BTXA 1WQLB 2XSHB 2W9PA 1UW1A 2OWPA 3MWZA 3CC23 2LYXA 4RNZA 1M9GA 5G2GA 3CCU3 1VQ63 1IT7A 3LTBA 3AMOB 3DM8A 3JUNA 2F99A 2WO0A 1ZX2A 1W6YA 4HM6B 4WP5A 3OWUA 1Q864 3KSED 2OQEC 5D83A 3S29A 4R4KA 1IT8A 2KCDA 3MSOA 1J2BA 1CQSA 2CH9A 4N6UA 3WMDA 1VQ93 3GAXA 3FG3A 3FG1A 4RBNA 3X3XA 2GBWB 1QMAA 5AIIA 1E97A 1W2B2 3HIGA 3SLUA 4KFDA 1N9EA 3EBTA 3UJMA 3OV4A 2YFLB 4WYKB 4HM7B 4N3VA 3DY5A 5KP4A 2CHCA 1O7NB 3EE1A 3PXMA 2CFGA 3BNCA 1NU3A 2RFRA 1NJI4 3DUKA 1DVCA 1FGTA 1IQ8A 5DREA 1YIT3 3NHXA 1IQXA 1KWIA 3A76A 4HBRA 5AI1A 3RGRA 1GY6A 4HM8B 3NQYA 2OTL3 1OHOA 5KP3A 3MKIA 1Q7Y4 1RN7A 3B4OA 1F8NA 2IMJA 1NO3A 1RRLA 4L8OA 1DMNA 1UUWB 4LEHA 4RZMA 1Q40B 2GBXB 2CIUA 3DMCA 4U13A 4WFOA 4ORLA 2HMOB 4OUQA 1SJWA 3NX0A 3T0UA 2GU1A 1O7GB 5IW9A 1DMQA 2BMQB 2QEX3 1W6GA 1AR0A 2CFKA 3OWYA 3GZXB 3PCRA 2XGLA 1JKGA 2HMNB 2P0MA 4GL6A 1EA2A 3S5CA 5IF6A 2ML5A 5A0OB 1K28A 3F7SA 4QWTA 2XF3A 2OOVC 2YFIB 4OVMA 1NB5I 1JB2A 4XDWA 2E2TA 3EX9A 2OQEA 5IERA 3EN8A 3BNBA 4XM4A 4R80A 2IUKA 2OCTA 2CG1A 4TX4A 4FMBA 2C10A 3DZLA 1QAFA 1CEWI 2FGTA 2GEXA 2W56A 3GRDA 1U5OA 3X41A 3CXC2 4WWUC 3ALAA 1VQP3 4N6OB 4EBGA 5AYSC 3NV0B 4O02B 1YVBI 2D1WA 1BUQA 5AYRB 2L4VA 1TFOA 3E99A 2XFTA 1FGMA 4MJDA 3RGAA 6STDA 3WA2X 1JB4A 4IT7A 3X3ZA 3CCM3 2XFSA 2HMLB 1SIIA 1STDA 1YIJ3 4LZIA 1FGOA 3N9HA 3BLZA 5STDA 3H51A 1VZZA 2GEYA 2XH9A 3N54B 1ZO2A 3L0RA 3GWRA 3JUOA 3NM2A 1WMPA 3MHEA 2P38A 3FH1A 3SXXA 1LVNA 5IENA 1GYBA 1MNLA 2CW9A 2M7OA 3EB8A 1YHQ3 3JVCA 3F8HA 3CCL3 3KFQC 1ULIB 3CC43 1Z1SA 2RCDA 3CCV3 4BTWA 1Q824 3ROBA 1VQL3 3X40A 4OK0A 1TP6A 4AKYA 3Q2PA 2OOVA 1R4CA 4RNYA 1HU9A 3EQQB 3FKAA 2GU3A 4LSOA 4EXRA 4PEJA 3WA3A 3K7CA 1W02A 2O3OA 1DVDA 4AKZA 4CDLA 1U8CB 5IG0A 1NWWA 3CNXA 1IV7A 1YGEA 4NHFA 3SVAA 3HI7A 1IV9A 2CC3A 3DXOA 3U97A 4N6LA 5ELJA 4HM4B 3LOYA 1FUWA 1MOLA 1A67A 1LNHA 5IEPA 1VQO3 2FNQA 3IJEB 3CCQ3 1ROVA 1Y4KA 1D6YA 1KD14 1OPYA 3H3HA 1M1XB 3WOFB 2CWTA 1TU5A 1FA3A 1OACA 3NXJA 4BTYA 2BMOB 3BB9A 3PCSA 1EKMA 3HK4A 1K41A 3NBJA 2HMMB 4R1KA 3M8CA 4EYCA 1JV2B 3DGLA 5IG3A 3X42A 3DGMA 1SPUA 2B1XB 2W56B 3UL5A 1O7WB 2Y73A 4HKVB 3UNLA 3NBBA 1TFKA 3CC73 1US1A 3VGNA 4STDA 5LC7A 4LMIA 4XBYA 3GZYB 2CFLA 2MF7A 3JUPA 5AEUB 3KZTA 4L7KA 1IVVA 5AEWB 2E2VA 3EF8A 4J8TA 2CFWA 3FF2A 3MYTA 3V98A 4KFFA 3MG1A 4J9AA 2XRXB 3MG2A 2KRTA 4MMZB 3VSYA 3CCR3 1YI23 3F14A 3WDGB 5FW5A 4HM2B 4JRFA 2Z76A 3OWSA 1QVF2 3LTCA 2F98A 1W7CA 4O2HA 2IUJA 2XSOB 1N8QA 1E3RA 3DGOA 3D3LA 3S67A 2P09A 1EQKA 1NDOB 1Q814 4KVHA 2I9WA 5CF2A 5JPPA 4G1MB 4FCMA 3LXUX 3G8ZA 3V92A 1VQM3 1OCVA 3OW22 2WGOA 5EVHA 4R9LA 2QIYA 1VQ43 1JJ22 3JUQA 3T8UA 1WTHA 1GY5A 4JF8A 1PU4A 2MC8A 3SX1A 3F7XA 4GB5A 3G0KA 3X3YA 4I4KA 3LTDA 1OHPA 3FSDA 3LTAA 4EV2A 2W0QA 3GZBA 5AIGA 2E2UA 3S27A 1IK3A 1YJN3 5KP1A 2JQ5A 1C7HA 4HM5B 4X2HA 1UUVB 4MEIA 3QRDA 3J7Yd 2Y74A 3MPHA 3STDA 3CPW2 1RRHA 3I0YA 3N8BA 2OTJ3 3FZWA 2BO9B 3CU3A 4FMCA 1VQK3 1D6UA 1SIHA 4LGQA 1QVG2 1UI7A 1JB5A 1FGQA 1CYVA 3I553 1O7PB 3UL6A 5DRVA 3FF0A 5CK6A 2F86B 4HVNA 4WHAA 1OUNA 2A15A 4N6V0 1NB3I 4XBTA 5IG4A 1IVUA 1A2KA 1GD3A 1W00A 1VQ53 5IEOA 3HIIA 3QK9A 2SBLA 1A90A 3CCS3 2JDIH 5AIHA 4KFEA 3B8LA 3K9MC 3WOEB 4N6NB 3K0ZA 1KC84 1QAKA 3G16A 2W6JH 3B7CA 2FXTA 2Q07A 3WODG 3T8NA 3EHCA 1V74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHS A;  1ASK A;  4XDV A;  1OF5 A;  3F9S A;  2QGU A;  1QJG A;  3EC9 A;  5CLK A;  1EG9 B;  1JKG B;  3NBR A;  3OXA A;  3EJV A;  1HKX A;  2B24 B;  5AIF A;  3IPT A;  5D82 A;  5D81 A;  3HZP A;  3KSP A;  4XB5 A;  1JN5 A;  3JUM A;  3NV0 A;  1W01 A;  4K1U A;  3GZR A;  3KE7 A;  1S5A A;  3EN1 B;  5CXO A;  4HM1 B;  1Q42 A;  4HJL B;  1OGZ A;  4XBX A;  3F40 A;  1OH0 A;  5CF1 A;  3SOA A;  4Q53 A;  4HZB B;  2STD A;  3CPO A;  3FLJ A;  5HGR A;  2HMJ B;  3LYG A;  4X2O A;  2HMK B;  2YFJ B;  3CNM A;  2K54 A;  4HZ9 B;  4K1V A;  3OX9 A;  1TUH A;  4L8P A;  4WYK A;  1OGX A;  4H3U A;  2R4I A;  1OF5 B;  4FCJ A;  2BNG A;  3ER7 A;  2CKF B;  1ULJ B;  3Q90 A;  5IG5 A;  2UX0 A;  3EBY A;  4HM3 B;  5BXQ A;  1GS3 A;  8CHO A;  2BMR B;  3NUV A;  3MG3 A;  4IIA A;  1JN5 B;  1ISK A;  1Q40 A;  5BVB A;  2INX A;  2PZV A;  2XR8 B;  2W2C A;  1IDP A;  5JPU A;  4R9K A;  3B4P A;  2GXF A;  3F8X A;  7STD A;  1E3V A;  3D9R A;  5TGN A;  1GY7 A;  3SOY A;  3ECF A;  2RGQ A;  1DMM A;  3KKG A;  1O7M B;  3HX8 A;  2Z77 A;  2Z7A A;  3FGY A;  1O7H B;  4HM0 B;  3SED A;  3LZA A;  1WQL B;  2XSH B;  2OWP A;  5G2G A;  3DM8 A;  3JUN A;  2F99 A;  1ZX2 A;  1W6Y A;  4HM6 B;  4WP5 A;  3OWU A;  5D83 A;  3MSO A;  1CQS A;  3WMD A;  2GBW B;  1QMA A;  5AII A;  1E97 A;  3EBT A;  3UJM A;  3OV4 A;  2YFL B;  4WYK B;  4HM7 B;  4N3V A;  5KP4 A;  2CHC A;  1O7N B;  1NU3 A;  2RFR A;  3DUK A;  5DRE A;  3NHX A;  3A76 A;  5AI1 A;  3RGR A;  1GY6 A;  4HM8 B;  1OHO A;  5KP3 A;  3MKI A;  3B4O A;  2IMJ A;  4L8O A;  1DMN A;  1UUW B;  4LEH A;  4RZM A;  1Q40 B;  2GBX B;  3DMC A;  4U13 A;  4ORL A;  2HMO B;  4OUQ A;  1SJW A;  1O7G B;  1DMQ A;  2BMQ B;  1AR0 A;  3OWY A;  3GZX B;  1JKG A;  2HMN B;  3S5C A;  1EA2 A;  5IF6 A;  3F7S A;  2YFI B;  4OVM A;  1JB2 A;  4XDW A;  3EX9 A;  5IER A;  3EN8 A;  4XM4 A;  3DZL A;  2GEX A;  3GRD A;  1U5O A;  4WWU C;  3NV0 B;  1BUQ A;  3E99 A;  4MJD A;  3RGA A;  6STD A;  1JB4 A;  2HML B;  1STD A;  5STD A;  3BLZ A;  3H51 A;  1VZZ A;  2GEY A;  1ZO2 A;  3GWR A;  3JUO A;  3NM2 A;  3MHE A;  3FH1 A;  5IEN A;  1GYB A;  3F8H A;  1ULI B;  1Z1S A;  2RCD A;  3ROB A;  1TP6 A;  3FKA A;  3EQQ B;  4PEJ A;  3K7C A;  1W02 A;  4CDL A;  5IG0 A;  1NWW A;  3CNX A;  3DXO A;  4HM4 B;  5IEP A;  1OPY A;  3H3H A;  3NXJ A;  2BMO B;  3BB9 A;  3HK4 A;  1K41 A;  2HMM B;  4R1K A;  3M8C A;  5IG3 A;  2B1X B;  1O7W B;  4HKV B;  3UNL A;  3VGN A;  4STD A;  4LMI A;  4XBY A;  3GZY B;  3JUP A;  5AEU B;  3KZT A;  4L7K A;  5AEW B;  3EF8 A;  4J8T A;  3FF2 A;  3MYT A;  3MG1 A;  4J9A A;  2XRX B;  3MG2 A;  3VSY A;  3F14 A;  5FW5 A;  4HM2 B;  2Z76 A;  3OWS A;  2F98 A;  2XSO B;  1E3R A;  1NDO B;  4KVH A;  2I9W A;  5CF2 A;  5JPP A;  4FCM A;  3G8Z A;  1OCV A;  5EVH A;  4R9L A;  2QIY A;  3JUQ A;  3T8U A;  1GY5 A;  3F7X A;  4GB5 A;  3G0K A;  4I4K A;  1OHP A;  3FSD A;  3GZB A;  5AIG A;  5KP1 A;  2JQ5 A;  1C7H A;  4HM5 B;  4X2H A;  1UUV B;  3STD A;  3I0Y A;  3FZW A;  3CU3 A;  4LGQ A;  1JB5 A;  1O7P B;  5DRV A;  3FF0 A;  5CK6 A;  2F86 B;  4HVN A;  1OUN A;  2A15 A;  5IG4 A;  4XBT A;  1A2K A;  1W00 A;  5IEO A;  5AIH A;  3B8L A;  3K0Z A;  3G16 A;  3B7C A;  3T8N A;  3EHC A; 
#chains in the Genus database with same CATH topology
 1OHS A;  1ASK A;  2PNC A;  3LT8 A;  2Z6B A;  1OF5 A;  4XDV A;  5HGR A;  1MWT A;  4ZM8 A;  1M1K 4;  3F9S A;  3K5T A;  3BNE A;  1I3F A;  3CCE 3;  2QGU A;  1QJG A;  1WMN A;  1IU7 A;  2YX9 A;  1JBR A;  1VQ8 3;  3K63 A;  5FGO A;  1G96 A;  3SYU A;  4DKI A;  1M90 4;  3EC9 A;  5CLK A;  1W6C A;  1EG9 B;  1RGH A;  3V99 A;  1BRG A;  1RGA A;  1I2G A;  1JKG B;  2ZL8 A;  3NBR A;  3OXA A;  3EJV A;  1HKX A;  1V57 A;  2B24 B;  2KF4 A;  1B3S A;  2KAA A;  3AGO A;  1GMP A;  3IPT A;  5AIF A;  5D81 A;  5D82 A;  5I97 A;  3G71 3;  3HZP A;  3FCS B;  3KSP A;  4XB5 A;  1JN5 A;  2CFD A;  3NM7 A;  2WGQ A;  2HOH A;  1RGF A;  3JUM A;  1W01 A;  1KSI A;  1LOX A;  3NV0 A;  4FMA A;  4GHO A;  4K1U A;  1RNB A;  1MGR A;  3GZR A;  3KN4 A;  2IA7 A;  1IQY A;  4MMY B;  2BHM A;  9RNT A;  1K73 4;  1BGS A;  1S72 3;  1W5Z A;  1V58 A;  2CG0 A;  2QA4 3;  2F5M A;  1S5A A;  3KE7 A;  3EN1 B;  3LML A;  5CXO A;  1IVX A;  1ZGX A;  3CMA 3;  4CCV A;  1W2Z A;  4HM1 B;  1Q42 A;  1RNT A;  1OGZ A;  2P05 A;  4HJL B;  4XBX A;  3G4S 3;  3F40 A;  5JBS A;  1OH0 A;  3IMA B;  2XEP A;  4I5Q A;  1RLS A;  5CF1 A;  3SOA A;  1WNH A;  2V1L A;  1I0V A;  4Q53 A;  4HZB B;  2STD A;  3CPO A;  1AVK A;  3AHS A;  1BRI A;  2W9Q A;  3FLJ A;  1B2Z A;  1JNQ A;  1N9J A;  1BNG A;  1LQM B;  1R4Y A;  1BNJ A;  1SQW A;  1B27 A;  2HMJ B;  3LYG A;  3PS8 A;  2H0G A;  3PZW A;  4H61 A;  1ROA A;  3AMO A;  4K90 B;  2C11 A;  4X2O A;  3ZG0 A;  2HMK B;  1L5G B;  1LXE A;  1UCI A;  1K9M 4;  1RN1 A;  1W4N A;  1AV4 A;  2YFJ B;  3BND A;  4FR9 A;  1K8A 4;  4AEQ A;  1A2V A;  4O3V A;  3CNM A;  2K54 A;  2ML6 A;  1RJO A;  4HZ9 B;  4HYZ A;  4K1V A;  3VF1 A;  1CH0 A;  3S28 A;  1PFP A;  1TTO A;  3OX9 A;  1JBS A;  1TUH A;  1VQN 3;  4L8P A;  3U1W A;  3I56 3;  1VQ7 3;  4NRE A;  2BT3 A;  3RDE A;  2RSX A;  4N6M A;  2IY2 A;  3Q1C A;  4EV5 A;  4WYK A;  1BIR A;  1UCK A;  1OGX A;  4FCZ A;  4H3U A;  2R4I A;  1JRQ A;  2ZDJ A;  4N6T A;  4IPB A;  7RNT A;  1N5H A;  1OF5 B;  1N5P A;  4FCJ A;  3DGN A;  2WOF A;  5ELU A;  1D6Z A;  1WMO A;  4FMD A;  3LH4 A;  5EQL A;  3PYJ A;  3CCJ 3;  1STF I;  2BNG A;  1YGW A;  3ER7 A;  2CKF B;  1ULJ B;  2KF3 A;  2W04 A;  3LT9 A;  3NQZ A;  3Q90 A;  5IG5 A;  1BAN A;  2F4Y A;  3TDG A;  1N8R 4;  2CWV A;  1I2F A;  2AAE A;  1FGR A;  2UX0 A;  3EBY A;  1BNI A;  3FG4 A;  4HM3 B;  1IYY A;  2ZHX B;  1NNV A;  1X1U A;  1T5Y A;  3KII A;  1GS3 A;  5BXQ A;  3O8Y A;  3A5E A;  4O8S A;  8CHO A;  2BMR B;  2K0M A;  2W03 A;  3NUV A;  3MG3 A;  4IIA A;  1B2S A;  1JN5 B;  1RGL A;  2CK3 H;  4K61 A;  3CD6 3;  1ISK A;  1Q40 A;  5BVB A;  2INX A;  1KQS 2;  2XGN A;  2PZV A;  2XR8 B;  3PGB A;  1BSE A;  2KXG A;  2C4B A;  4EC6 A;  1IVW A;  2P0X A;  1IDP A;  2W2C A;  4MMX B;  5JPU A;  2WOH A;  5G1K A;  1RCL A;  1YJW 3;  2O9U X;  4R9K A;  3B4P A;  5LC6 A;  2GXF A;  1BAO A;  2CWU A;  1DET A;  3F8X A;  3BU4 A;  1RN4 A;  1E3V A;  7STD A;  1TIJ A;  5HOH A;  3D9R A;  5TGN A;  2KF6 A;  1GY7 A;  3UB1 A;  1GD4 A;  3SOY A;  3D79 A;  3ECF A;  5EEO A;  6RNT A;  2LQV A;  1YJ9 3;  2RGQ A;  1DMM A;  3KKG A;  1O7M B;  1HYF A;  3HX8 A;  1AVL A;  1DYU A;  4KZ1 A;  1CYU A;  2Z77 A;  2Z7A A;  1GOV A;  2SAR A;  3FGY A;  3G6E 3;  2D42 A;  1RKY A;  1QAL A;  1O7H B;  4HM0 B;  3SED A;  1UI8 A;  3LZA A;  4BTX A;  1WQL B;  2XSH B;  1RGE A;  1UW1 A;  2W9P A;  2OWP A;  1X1X A;  3MWZ A;  3CC2 3;  2LYX A;  4RNZ A;  1BOX A;  1M9G A;  1UGI A;  5G2G A;  3CCU 3;  1VQ6 3;  1IT7 A;  3LTB A;  3AMO B;  1BU4 A;  3DM8 A;  3JUN A;  2F99 A;  1AQZ A;  1GOU A;  2WO0 A;  1ZX2 A;  4J5K A;  1RHL A;  1X1W A;  4CJN A;  1W6Y A;  4HM6 B;  4WP5 A;  3OWU A;  1Q86 4;  3KSE D;  4NPB A;  2K3D A;  1BRS A;  2OQE C;  5D83 A;  3S29 A;  4R4K A;  1IT8 A;  2KCD A;  3MSO A;  1J2B A;  1CQS A;  1AY7 A;  2CH9 A;  4N6U A;  3WMD A;  1VQ9 3;  1TJD A;  3GAX A;  3FG3 A;  3FG1 A;  4RBN A;  3X3X A;  2GBW B;  1QMA A;  5AII A;  1E97 A;  1W2B 2;  2BU4 A;  3HIG A;  4KFD A;  3SLU A;  1N9E A;  1EUI C;  3EBT A;  3UJM A;  3OV4 A;  2YFL B;  3D5I A;  4HM7 B;  4N3V A;  4WYK B;  5BU4 A;  1Q9E A;  3DY5 A;  5KP4 A;  2UUG C;  1RMS A;  2CHC A;  1O7N B;  3EE1 A;  3PXM A;  2CFG A;  3BNC A;  1NU3 A;  2CX0 A;  3ZG5 A;  1B2M A;  5M18 A;  2RFR A;  1NJI 4;  3DUK A;  1DVC A;  1FGT A;  1IQ8 A;  5DRE A;  1YIT 3;  3NHX A;  1IQX A;  1GSP A;  1KWI A;  3A76 A;  3D4A A;  4HBR A;  5AI1 A;  3RGR A;  1B20 A;  1GY6 A;  4HM8 B;  3NQY A;  2OTL 3;  1OHO A;  5KP3 A;  1B2X A;  3HOH A;  3MKI A;  1Q7Y 4;  1RN7 A;  3B4O A;  2F5W A;  3WHO A;  1F8N A;  2IMJ A;  1NO3 A;  1RRL A;  1BRH A;  1DMN A;  4L8O A;  1UUW B;  4LEH A;  4RZM A;  1Q40 B;  2GBX B;  2CIU A;  3DMC A;  4U13 A;  4WFO A;  4ORL A;  2HMO B;  1EEJ A;  4OUQ A;  1SJW A;  3NX0 A;  3T0U A;  2GU1 A;  1O7G B;  5IW9 A;  1JZD A;  1DMQ A;  1MWU A;  2BMQ B;  2QEX 3;  1VQQ A;  1W6G A;  1AR0 A;  2CFK A;  3OWY A;  3GZX B;  3PCR A;  2XGL A;  4BU4 A;  1JKG A;  2HMN B;  2P0M A;  4GL6 A;  1EA2 A;  3S5C A;  5IF6 A;  2ML5 A;  4EW5 A;  5A0O B;  1K28 A;  1G02 A;  3F7S A;  4QWT A;  2XF3 A;  2OOV C;  1UDI I;  2YFI B;  4OVM A;  1LNI A;  1NB5 I;  1JB2 A;  4XDW A;  2E2T A;  3EX9 A;  2OQE A;  2CX1 A;  5IER A;  1YNV X;  3EN8 A;  3BNB A;  4XM4 A;  4R80 A;  2IUK A;  4BL3 A;  1PYL A;  1FUS A;  1RGG A;  2OCT A;  2CG1 A;  4TX4 A;  4FMB A;  2RNT A;  1DE3 A;  2C10 A;  3DZL A;  1C54 A;  1QAF A;  1CEW I;  2FGT A;  2GEX A;  2W56 A;  3GRD A;  1U5O A;  4LYL B;  3X41 A;  3CXC 2;  1UCJ A;  2IYJ A;  4WWU C;  3ALA A;  1VQP 3;  1T2H A;  1FW7 A;  4N6O B;  4EBG A;  5AYS C;  3NV0 B;  1LRA A;  4O02 B;  1YVB I;  2D1W A;  4BL2 A;  1BUQ A;  5AYR B;  3AHW A;  2L4V A;  1TFO A;  3E99 A;  2XFT A;  1FGM A;  1GMR A;  4MJD A;  1FZU A;  1X1Y A;  3RGA A;  3WA2 X;  6STD A;  1JB4 A;  1HZ1 A;  4IT7 A;  3X3Z A;  3CCM 3;  1RCK A;  2XFS A;  2HML B;  1SII A;  1STD A;  1YIJ 3;  4LZI A;  1FGO A;  3N9H A;  3BLZ A;  5STD A;  1RGK A;  1TRP A;  3H51 A;  1VZZ A;  2GEY A;  2XH9 A;  3N54 B;  1ZO2 A;  3L0R A;  5M1A A;  1B2U A;  3GWR A;  3JUO A;  3NM2 A;  1JZO A;  1GMQ A;  1I3I A;  1WMP A;  3MHE A;  1LOW A;  2P38 A;  1FUT A;  3FH1 A;  3KCH A;  3SXX A;  1LVN A;  5IEN A;  1GYB A;  1MNL A;  2CW9 A;  2M7O A;  3EB8 A;  1YHQ 3;  3JVC A;  3F8H A;  2KF5 A;  3KFQ C;  3CCL 3;  4ILF A;  1ULI B;  3CC4 3;  1Z1S A;  1BRJ A;  2RCD A;  3WR2 A;  7GSP A;  1T3B A;  3CCV 3;  4BTW A;  1Q82 4;  3ROB A;  1GOY A;  1VQL 3;  3X40 A;  4OK0 A;  1TP6 A;  4AKY A;  3Q2P A;  2OOV A;  1R4C A;  1T2I A;  1TRQ A;  4RNY A;  1HU9 A;  3EQQ B;  3FKA A;  2GU3 A;  4LSO A;  4EXR A;  1BRK A;  4PEJ A;  3WA3 A;  5M19 A;  3K7C A;  1W02 A;  2O3O A;  1DVD A;  4AKZ A;  1PY3 A;  4CDL A;  2GSP A;  1U8C B;  2H0H A;  1NWW A;  5IG0 A;  3BIR A;  3CNX A;  1IV7 A;  1YGE A;  4NHF A;  8RNT A;  3SVA A;  3HI7 A;  3DGY A;  1IV9 A;  2CC3 A;  3DXO A;  3U97 A;  4N6L A;  5ELJ A;  1BNF A;  1MGW A;  3LOY A;  4HM4 B;  1FUW A;  1G0T A;  1MOL A;  1A67 A;  1LNH A;  5IEP A;  1BSD A;  1RDS A;  2FNQ A;  4GSP A;  1VQO 3;  3IJE B;  3CCQ 3;  1ROV A;  1Y4K A;  1D6Y A;  1KD1 4;  1OPY A;  2AAD A;  1M1X B;  3H3H A;  3WOF B;  3DH2 A;  2CWT A;  1TU5 A;  1FA3 A;  1OAC A;  3NXJ A;  4BTY A;  4RNT A;  4HAA A;  2BMO B;  2L1S A;  2J8X B;  3BB9 A;  3PCS A;  1EKM A;  3HK4 A;  1K41 A;  3NBJ A;  2HMM B;  4R1K A;  3M8C A;  4EYC A;  1JV2 B;  3DGL A;  2R41 A;  5IG3 A;  3X42 A;  3DGM A;  1I2E A;  1SPU A;  2B1X B;  2BIR A;  2W56 B;  3UL5 A;  1O7W B;  2Y73 A;  4HKV B;  3UNL A;  3NBB A;  1SAR A;  4BIR A;  1TFK A;  1YVS A;  3CME 3;  1US1 A;  1BSB A;  3CC7 3;  3VGN A;  4STD A;  5LC7 A;  4LMI A;  4XBY A;  6GSP A;  3GZY B;  1Q7H A;  2CFL A;  2MF7 A;  3JUP A;  5AEU B;  3KZT A;  4L7K A;  1BRN L;  1IVV A;  5AEW B;  2E2V A;  3EF8 A;  4J8T A;  1BNR A;  2H0I A;  4HOH A;  2CFW A;  3FF2 A;  1LOV A;  3MYT A;  1UGH I;  3V98 A;  3Q3F A;  4KFF A;  3MG1 A;  4J9A A;  1BNE A;  2XRX B;  2KRT A;  3MG2 A;  4MMZ B;  3VSY A;  1LQG C;  3CCR 3;  1YI2 3;  3F14 A;  3WDG B;  3RNT A;  4CPK A;  5FW5 A;  4HM2 B;  4JRF A;  2Z76 A;  3GSP A;  3OWS A;  1QVF 2;  1UCL A;  2F98 A;  1W7C A;  3LTC A;  4O2H A;  2IUJ A;  2XSO B;  1N8Q A;  1E3R A;  3DGO A;  3D3L A;  3S67 A;  1MWR A;  2P09 A;  1EQK A;  1B21 A;  1A2P A;  1I70 A;  1NDO B;  4KVH A;  2I9W A;  5CF2 A;  5JPP A;  1Q81 4;  4G1M B;  1BUJ A;  4FCM A;  3LXU X;  3G8Z A;  3V92 A;  1VQM 3;  5BIR A;  4J5G A;  1OCV A;  3OW2 2;  2WGO A;  5EVH A;  4R9L A;  2QIY A;  1VQ4 3;  1JJ2 2;  1BVI A;  3JUQ A;  3T8U A;  1WTH A;  1GY5 A;  1MWS A;  1RGC A;  4JF8 A;  2MC8 A;  3SX1 A;  1PU4 A;  3F7X A;  4GB5 A;  3G0K A;  3X3Y A;  1BNS A;  4I4K A;  3LTD A;  1FYS A;  1OHP A;  5GSP A;  3FSD A;  3LTA A;  4EV2 A;  1I8V A;  2W0Q A;  1LOY A;  3GZB A;  5AIG A;  1I0X A;  2E2U A;  2ZA4 A;  5G1L A;  3S27 A;  3URP A;  5KP1 A;  1IK3 A;  2JQ5 A;  1YJN 3;  1C7H A;  4HM5 B;  4X2H A;  1UUV B;  1BSC A;  4MEI A;  3AGN A;  3QRD A;  3ZFZ A;  3J7Y d;  2Y74 A;  3MPH A;  3STD A;  3CPW 2;  1RRH A;  3I0Y A;  1JBT A;  2F56 A;  3N8B A;  2OTJ 3;  3FZW A;  2BO9 B;  3CU3 A;  4FMC A;  1VQK 3;  1D6U A;  1SIH A;  4LGQ A;  1UUG B;  1QVG 2;  1UI7 A;  1JB5 A;  1FGQ A;  1CYV A;  4KT3 B;  3I55 3;  1O7P B;  1BSA A;  3UL6 A;  5DRV A;  3FF0 A;  5CK6 A;  2F86 B;  4HVN A;  4WHA A;  1OUN A;  2A15 A;  4N6V 0;  1NB3 I;  4XBT A;  5IG4 A;  1A2K A;  1IVU A;  1GD3 A;  1RTU A;  5RNT A;  1RSN A;  1W00 A;  1VQ5 3;  5IEO A;  3HII A;  3QK9 A;  2SBL A;  1A90 A;  3CCS 3;  2JDI H;  5AIH A;  4KFE A;  3B8L A;  3K9M C;  3WOE B;  4N6N B;  3K0Z A;  2RBI A;  1KC8 4;  1QAK A;  3G16 A;  2W6J H;  3B7C A;  2FXT A;  2UGI A;  1ZS7 A;  2Q07 A;  3D5G A;  3WOD G;  3T8N A;  3EHC A;  1V74 A; 
#chains in the Genus database with same CATH homology
 1OHS A;  1ASK A;  2PNC A;  3LT8 A;  2Z6B A;  1OF5 A;  4XDV A;  4ZM8 A;  1M1K 4;  3F9S A;  3K5T A;  3BNE A;  3CCE 3;  2QGU A;  1QJG A;  1WMN A;  1IU7 A;  2YX9 A;  1VQ8 3;  3K63 A;  5FGO A;  1G96 A;  1M90 4;  3EC9 A;  5CLK A;  1W6C A;  1EG9 B;  3V99 A;  1JKG B;  2ZL8 A;  3NBR A;  3OXA A;  3EJV A;  1HKX A;  2B24 B;  5I97 A;  5AIF A;  3IPT A;  5D82 A;  5D81 A;  3G71 3;  3HZP A;  3FCS B;  3KSP A;  4XB5 A;  1JN5 A;  2CFD A;  3NM7 A;  2WGQ A;  3JUM A;  3NV0 A;  1W01 A;  1KSI A;  1LOX A;  4FMA A;  4K1U A;  3GZR A;  3KN4 A;  2IA7 A;  1IQY A;  4MMY B;  2BHM A;  1K73 4;  1S72 3;  1W5Z A;  2CG0 A;  2QA4 3;  3KE7 A;  1S5A A;  3EN1 B;  3LML A;  5CXO A;  1IVX A;  3CMA 3;  4CCV A;  1W2Z A;  4HM1 B;  1Q42 A;  4HJL B;  1OGZ A;  2P05 A;  4XBX A;  3G4S 3;  3F40 A;  5JBS A;  1OH0 A;  3IMA B;  2XEP A;  5CF1 A;  3SOA A;  1WNH A;  2V1L A;  4Q53 A;  4HZB B;  2STD A;  3CPO A;  1AVK A;  2W9Q A;  3FLJ A;  1JNQ A;  1N9J A;  1SQW A;  5HGR A;  2HMJ B;  3CME 3;  3LYG A;  3PS8 A;  3PZW A;  4H61 A;  4X2O A;  1ROA A;  3AMO A;  4K90 B;  2C11 A;  2HMK B;  1L5G B;  1LXE A;  1K9M 4;  1W4N A;  1AV4 A;  2YFJ B;  3BND A;  4FR9 A;  1K8A 4;  4AEQ A;  1A2V A;  4O3V A;  3CNM A;  2K54 A;  2ML6 A;  1RJO A;  4HZ9 B;  4HYZ A;  4K1V A;  3VF1 A;  3S28 A;  1PFP A;  3OX9 A;  1TUH A;  1VQN 3;  4L8P A;  3U1W A;  3I56 3;  1VQ7 3;  4NRE A;  2BT3 A;  3RDE A;  2RSX A;  4N6M A;  3Q1C A;  4EV5 A;  4WYK A;  1OGX A;  4FCZ A;  4H3U A;  2R4I A;  1JRQ A;  2ZDJ A;  4N6T A;  4IPB A;  1N5H A;  1OF5 B;  1N5P A;  4FCJ A;  3DGN A;  2WOF A;  5ELU A;  1D6Z A;  1WMO A;  4FMD A;  3LH4 A;  5EQL A;  3PYJ A;  3CCJ 3;  1STF I;  2BNG A;  3ER7 A;  2CKF B;  1ULJ B;  2W04 A;  3LT9 A;  3NQZ A;  3Q90 A;  5IG5 A;  3TDG A;  1N8R 4;  2CWV A;  2UX0 A;  1FGR A;  3EBY A;  3FG4 A;  4HM3 B;  1T5Y A;  3KII A;  1GS3 A;  5BXQ A;  3O8Y A;  4O8S A;  8CHO A;  2BMR B;  2K0M A;  2W03 A;  3NUV A;  3MG3 A;  4IIA A;  1JN5 B;  2CK3 H;  4K61 A;  3CD6 3;  1ISK A;  1Q40 A;  5BVB A;  2INX A;  1KQS 2;  2XGN A;  2PZV A;  2XR8 B;  3PGB A;  2KXG A;  4EC6 A;  1IVW A;  2P0X A;  1IDP A;  2W2C A;  4MMX B;  5JPU A;  2WOH A;  1YJW 3;  2O9U X;  4R9K A;  3B4P A;  5LC6 A;  2GXF A;  2CWU A;  3F8X A;  7STD A;  1E3V A;  1TIJ A;  3D9R A;  5TGN A;  1GY7 A;  3UB1 A;  1GD4 A;  3SOY A;  3ECF A;  5EEO A;  1YJ9 3;  2LQV A;  2RGQ A;  1DMM A;  3KKG A;  1O7M B;  3HX8 A;  1AVL A;  1DYU A;  4KZ1 A;  1CYU A;  2Z77 A;  2Z7A A;  3FGY A;  3G6E 3;  2D42 A;  1RKY A;  1QAL A;  1O7H B;  4HM0 B;  3SED A;  1UI8 A;  3LZA A;  4BTX A;  1WQL B;  2XSH B;  2W9P A;  1UW1 A;  2OWP A;  3MWZ A;  3CC2 3;  2LYX A;  4RNZ A;  1M9G A;  5G2G A;  3CCU 3;  1VQ6 3;  1IT7 A;  3LTB A;  3AMO B;  3DM8 A;  3JUN A;  2F99 A;  2WO0 A;  1ZX2 A;  1W6Y A;  4HM6 B;  4WP5 A;  3OWU A;  1Q86 4;  3KSE D;  2OQE C;  5D83 A;  3S29 A;  4R4K A;  1IT8 A;  2KCD A;  3MSO A;  1J2B A;  1CQS A;  2CH9 A;  4N6U A;  3WMD A;  1VQ9 3;  3GAX A;  3FG3 A;  3FG1 A;  4RBN A;  3X3X A;  2GBW B;  1QMA A;  5AII A;  1E97 A;  1W2B 2;  3HIG A;  3SLU A;  4KFD A;  1N9E A;  3EBT A;  3UJM A;  3OV4 A;  2YFL B;  4WYK B;  4HM7 B;  4N3V A;  3DY5 A;  5KP4 A;  2CHC A;  1O7N B;  3EE1 A;  3PXM A;  2CFG A;  3BNC A;  1NU3 A;  2RFR A;  1NJI 4;  3DUK A;  1DVC A;  1FGT A;  1IQ8 A;  5DRE A;  1YIT 3;  3NHX A;  1IQX A;  1KWI A;  3A76 A;  4HBR A;  5AI1 A;  3RGR A;  1GY6 A;  4HM8 B;  3NQY A;  2OTL 3;  1OHO A;  5KP3 A;  3MKI A;  1Q7Y 4;  1RN7 A;  3B4O A;  1F8N A;  2IMJ A;  1NO3 A;  1RRL A;  4L8O A;  1DMN A;  1UUW B;  4LEH A;  4RZM A;  1Q40 B;  2GBX B;  2CIU A;  3DMC A;  4U13 A;  4WFO A;  4ORL A;  2HMO B;  4OUQ A;  1SJW A;  3NX0 A;  3T0U A;  2GU1 A;  1O7G B;  5IW9 A;  1DMQ A;  2BMQ B;  2QEX 3;  1W6G A;  1AR0 A;  2CFK A;  3OWY A;  3GZX B;  3PCR A;  2XGL A;  1JKG A;  2HMN B;  2P0M A;  4GL6 A;  1EA2 A;  3S5C A;  5IF6 A;  2ML5 A;  5A0O B;  1K28 A;  3F7S A;  4QWT A;  2XF3 A;  2OOV C;  2YFI B;  4OVM A;  1NB5 I;  1JB2 A;  4XDW A;  2E2T A;  3EX9 A;  2OQE A;  5IER A;  3EN8 A;  3BNB A;  4XM4 A;  4R80 A;  2IUK A;  2OCT A;  2CG1 A;  4TX4 A;  4FMB A;  2C10 A;  3DZL A;  1QAF A;  1CEW I;  2FGT A;  2GEX A;  2W56 A;  3GRD A;  1U5O A;  3X41 A;  3CXC 2;  4WWU C;  3ALA A;  1VQP 3;  4N6O B;  4EBG A;  5AYS C;  3NV0 B;  4O02 B;  1YVB I;  2D1W A;  1BUQ A;  5AYR B;  2L4V A;  1TFO A;  3E99 A;  2XFT A;  1FGM A;  4MJD A;  3RGA A;  6STD A;  3WA2 X;  1JB4 A;  4IT7 A;  3X3Z A;  3CCM 3;  2XFS A;  2HML B;  1SII A;  1STD A;  1YIJ 3;  4LZI A;  1FGO A;  3N9H A;  3BLZ A;  5STD A;  3H51 A;  1VZZ A;  2GEY A;  2XH9 A;  3N54 B;  1ZO2 A;  3L0R A;  3GWR A;  3JUO A;  3NM2 A;  1WMP A;  3MHE A;  2P38 A;  3FH1 A;  3SXX A;  1LVN A;  5IEN A;  1GYB A;  1MNL A;  2CW9 A;  2M7O A;  3EB8 A;  1YHQ 3;  3JVC A;  3F8H A;  3CCL 3;  3KFQ C;  1ULI B;  3CC4 3;  1Z1S A;  2RCD A;  3CCV 3;  4BTW A;  1Q82 4;  3ROB A;  1VQL 3;  3X40 A;  4OK0 A;  1TP6 A;  4AKY A;  3Q2P A;  2OOV A;  1R4C A;  4RNY A;  1HU9 A;  3EQQ B;  3FKA A;  2GU3 A;  4LSO A;  4EXR A;  4PEJ A;  3WA3 A;  3K7C A;  1W02 A;  2O3O A;  1DVD A;  4AKZ A;  4CDL A;  1U8C B;  5IG0 A;  1NWW A;  3CNX A;  1IV7 A;  1YGE A;  4NHF A;  3SVA A;  3HI7 A;  1IV9 A;  2CC3 A;  3DXO A;  3U97 A;  4N6L A;  5ELJ A;  4HM4 B;  3LOY A;  1FUW A;  1MOL A;  1A67 A;  1LNH A;  5IEP A;  1VQO 3;  2FNQ A;  3IJE B;  3CCQ 3;  1ROV A;  1Y4K A;  1D6Y A;  1KD1 4;  1OPY A;  3H3H A;  1M1X B;  3WOF B;  2CWT A;  1TU5 A;  1FA3 A;  1OAC A;  3NXJ A;  4BTY A;  2BMO B;  3BB9 A;  3PCS A;  1EKM A;  3HK4 A;  1K41 A;  3NBJ A;  2HMM B;  4R1K A;  3M8C A;  4EYC A;  1JV2 B;  3DGL A;  5IG3 A;  3X42 A;  3DGM A;  1SPU A;  2B1X B;  2W56 B;  3UL5 A;  1O7W B;  2Y73 A;  4HKV B;  3UNL A;  3NBB A;  1TFK A;  3CC7 3;  1US1 A;  3VGN A;  4STD A;  5LC7 A;  4LMI A;  4XBY A;  3GZY B;  2CFL A;  2MF7 A;  3JUP A;  5AEU B;  3KZT A;  4L7K A;  1IVV A;  5AEW B;  2E2V A;  3EF8 A;  4J8T A;  2CFW A;  3FF2 A;  3MYT A;  3V98 A;  4KFF A;  3MG1 A;  4J9A A;  2XRX B;  3MG2 A;  2KRT A;  4MMZ B;  3VSY A;  3CCR 3;  1YI2 3;  3F14 A;  3WDG B;  5FW5 A;  4HM2 B;  4JRF A;  2Z76 A;  3OWS A;  1QVF 2;  3LTC A;  2F98 A;  1W7C A;  4O2H A;  2IUJ A;  2XSO B;  1N8Q A;  1E3R A;  3DGO A;  3D3L A;  3S67 A;  2P09 A;  1EQK A;  1NDO B;  1Q81 4;  4KVH A;  2I9W A;  5CF2 A;  5JPP A;  4G1M B;  4FCM A;  3LXU X;  3G8Z A;  3V92 A;  1VQM 3;  1OCV A;  3OW2 2;  2WGO A;  5EVH A;  4R9L A;  2QIY A;  1VQ4 3;  1JJ2 2;  3JUQ A;  3T8U A;  1WTH A;  1GY5 A;  4JF8 A;  1PU4 A;  2MC8 A;  3SX1 A;  3F7X A;  4GB5 A;  3G0K A;  3X3Y A;  4I4K A;  3LTD A;  1OHP A;  3FSD A;  3LTA A;  4EV2 A;  2W0Q A;  3GZB A;  5AIG A;  2E2U A;  3S27 A;  1IK3 A;  1YJN 3;  5KP1 A;  2JQ5 A;  1C7H A;  4HM5 B;  4X2H A;  1UUV B;  4MEI A;  3QRD A;  3J7Y d;  2Y74 A;  3MPH A;  3STD A;  3CPW 2;  1RRH A;  3I0Y A;  3N8B A;  2OTJ 3;  3FZW A;  2BO9 B;  3CU3 A;  4FMC A;  1VQK 3;  1D6U A;  1SIH A;  4LGQ A;  1QVG 2;  1UI7 A;  1JB5 A;  1FGQ A;  1CYV A;  3I55 3;  1O7P B;  3UL6 A;  5DRV A;  3FF0 A;  5CK6 A;  2F86 B;  4HVN A;  4WHA A;  1OUN A;  2A15 A;  4N6V 0;  1NB3 I;  4XBT A;  5IG4 A;  1IVU A;  1A2K A;  1GD3 A;  1W00 A;  1VQ5 3;  5IEO A;  3HII A;  3QK9 A;  2SBL A;  1A90 A;  3CCS 3;  2JDI H;  5AIH A;  4KFE A;  3B8L A;  3K9M C;  3WOE B;  4N6N B;  3K0Z A;  1KC8 4;  1QAK A;  3G16 A;  2W6J H;  3B7C A;  2FXT A;  2Q07 A;  3WOD G;  3T8N A;  3EHC A;  1V74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...