3NXJA

Crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D99N from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nxjA00
2INXA 3OV4A 3HZPA 1Z1SA 5BXQA 3FKAA 4HZ9B 4CDLA 4N3VA 5EVHA 3STDA 4WWUC 5D81A 2HMNB 1S5AA 3OXAA 5AIIA 5AIHA 4HM4B 3OWUA 3GZXB 5AI1A 1Q40B 4STDA 3JUNA 1UUWB 1JB2A 5CF2A 2XSOB 2Z77A 3F8XA 5G2GA 3JUMA 3GRDA 5JPUA 1DMMA 1GY7A 4XB5A 2GEYA 4LMIA 1QJGA 1ZX2A 4HM1B 5CLKA 1K41A 3MYTA 5CK6A 1OHOA 5D83A 3H3HA 2F99A 1DMQA 3D9RA 3CNXA 3GZBA 2RGQA 4IIAA 3FF2A 1GY5A 3EX9A 3LZAA 3A76A 4HM2B 1NDOB 3T8UA 1JN5A 4PEJA 5IG3A 3EQQB 3IPTA 4HKVB 4J8TA 4K1VA 3EN1B 5STDA 1BUQA 1OUNA 3CU3A 1TUHA 1OH0A 2GBXB 4XBTA 3B4OA 4HM8B 3OWYA 4X2OA 5DREA 5IG5A 1Q40A 3VSYA 3F8HA 1A2KA 3M8CA 4R9LA 3OX9A 3KKGA 2K54A 1O7WB 1ASKA 2GXFA 5KP3A 3H51A 4L8PA 3GZRA 4I4KA 1NWWA 4FCMA 4K1UA 1C7HA 3MG2A 2BNGA 1OF5A 3NV0B 1GY6A 1JB5A 3DM8A 5IERA 1IDPA 5CXOA 1W00A 2YFJB 3KSPA 1O7NB 3EBYA 1AR0A 3BLZA 1O7GB 4RZMA 1O7MB 3WMDA 3GWRA 2F86B 4XDWA 3F14A 1NU3A 2BMOB 1O7HB 2XRXB 3GZYB 4XM4A 1TP6A 3F40A 1WQLB 5AEUB 1E3RA 3JUOA 2YFIB 1W6YA 3MSOA 2HMOB 2A15A 1E3VA 3NM2A 4U13A 2B1XB 1OF5B 2HMMB 3NHXA 4L8OA 7STDA 1OHPA 5TGNA 4XDVA 1EG9B 5CF1A 2YFLB 5HGRA 3EF8A 2HMJB 3DUKA 4Q53A 8CHOA 4R9KA 3RGAA 1E97A 1VZZA 3NV0A 4X2HA 4KVHA 1DMNA 5IEPA 3FZWA 3EBTA 2RFRA 1QMAA 4FCJA 2BMQB 2QGUA 2IMJA 3G16A 4GB5A 1OCVA 2CHCA 3G8ZA 3FH1A 2B24B 3CNMA 3MKIA 2RCDA 2I9WA 4HM0B 3EJVA 5D82A 2W2CA 4HM5B 2BMRB 3E99A 5AIGA 1Q42A 6STDA 5DRVA 3VGNA 2QIYA 4L7KA 4H3UA 1ZO2A 5IG0A 4XBXA 3EN8A 3I0YA 1STDA 1ULJB 4J9AA 2F98A 3FLJA 1SJWA 2JQ5A 5IF6A 3FF0A 5FW5A 5AIFA 1HKXA 4HM6B 3NBRA 4LEHA 1OPYA 2PZVA 3NXJA 4OUQA 3SOYA 5IEOA 4HVNA 5IENA 3MHEA 3KZTA 4XBYA 1W02A 3LYGA 2XSHB 5AEWB 2HMKB 3MG3A 5KP4A 3MG1A 2GEXA 3KE7A 5KP1A 3OWSA 3HX8A 3CPOA 1OGZA 4HZBB 3B8LA 4HJLB 3NUVA 3HK4A 3UJMA 3F7XA 2STDA 4WP5A 2R4IA 3ROBA 5IG4A 4WYKB 3JUQA 2Z76A 4MJDA 1EA2A 3DZLA 3DXOA 1U5OA 3F9SA 3JUPA 3EC9A 1W01A 3EHCA 4HM3B 3B7CA 2CKFB 5BVBA 5JPPA 1JKGA 1OHSA 3SOAA 2XR8B 1JB4A 1ULIB 3T8NA 1ISKA 2Z7AA 4HM7B 1GS3A 1UUVB 1GYBA 2GBWB 3S5CA 2UX0A 3ECFA 3RGRA 3UNLA 4R1KA 1OGXA 3G0KA 3B4PA 3DMCA 2HMLB 3Q90A 2OWPA 3F7SA 1O7PB 3BB9A 4OVMA 3ER7A 3K0ZA 3FGYA 3SEDA 1CQSA 4LGQA 3FSDA 3K7CA 1JN5B 4WYKA 4ORLA 1JKGB
chains in the Genus database with same CATH superfamily
1DETA 1T2HA 4CJNA 7GSPA 2INXA 5G1LA 2UGIA 3OV4A 3WA3A 1DVCA 3HZPA 1Z1SA 3NBJA 3WOFB 5BXQA 3FKAA 3HI7A 4HZ9B 1W2B2 4CDLA 4N3VA 5EVHA 3PS8A 7RNTA 1VQP3 1OACA 3WR2A 1TIJA 4LSOA 3K63A 3STDA 1B2UA 3VF1A 1TFOA 4WWUC 5D81A 1TJDA 1S5AA 2HMNB 3OXAA 1AVLA 5AIIA 5AIHA 2MC8A 3PYJA 4KFFA 3NX0A 3PCRA 3T0UA 2QEX3 1WMNA 4FMAA 3S29A 4HM4B 3OWUA 2P38A 2XGNA 3GZXB 5AI1A 4HOHA 4KFDA 1I8VA 1Q40B 1VQQA 4RBNA 1ROAA 2Y74A 1MWRA 3JUNA 4STDA 1UUWB 4K61A 1JB2A 5CF2A 2XSOB 2Z77A 1YI23 3F8XA 5G2GA 3DGYA 3JUMA 4HBRA 3GRDA 5JPUA 1CH0A 1IQYA 1DMMA 1N5HA 1GY7A 3ZG5A 3S28A 4XB5A 1VQ73 2GEYA 1BNGA 2V1LA 3FCSB 4LMIA 1HZ1A 1QJGA 1ZX2A 4HM1B 5CLKA 1M904 1RGCA 2W9QA 1K41A 1UUGB 3MYTA 3N9HA 5CK6A 3X41A 1RLSA 1OHOA 2WGOA 5D83A 1W6CA 1BNSA 1UCKA 3H3HA 1UCJA 1BSEA 3PGBA 3AMOA 1PY3A 2F99A 3Q2PA 1N9JA 3X42A 1TU5A 5I97A 1UCIA 1JZOA 3DGNA 4FCZA 1IV7A 1DMQA 1X1WA 1L5GB 3D9RA 1RN4A 2OQEA 1LQGC 3CCQ3 3X3XA 2E2TA 3CNXA 2XEPA 3GZBA 2RGQA 1YHQ3 1RN7A 4IIAA 3FF2A 1TFKA 3BNBA 1SPUA 5HOHA 3SX1A 1GY5A 1YJN3 3EX9A 5JBSA 3LZAA 2R41A 1UDII 1LOXA 3A76A 3V99A 1BU4A 4HM2B 3I553 3AHSA 1NDOB 3DGMA 2E2UA 4J5GA 1VQ93 3T8UA 1JN5A 4PEJA 5IG3A 4BL3A 4QWTA 3EQQB 4IPBA 1CEWI 1BUJA 5AYRB 3IPTA 4HKVB 4GL6A 2BU4A 4J8TA 1I70A 1X1XA 3SLUA 4K1VA 3EN1B 1B3SA 3Q3FA 5STDA 1RGEA 1BUQA 1HU9A 1OUNA 4CCVA 2JDIH 1AQZA 2RNTA 4NREA 4ZM8A 1JBTA 3CCL3 3BIRA 3CU3A 3ZG0A 5M19A 3X40A 2CK3H 1TUHA 1IVXA 1OH0A 2GBXB 1NO3A 4XBTA 3B4OA 2F56A 4HM8B 4N6UA 3V92A 1I0XA 4OK0A 3WODG 1IYYA 1BRSA 3OWYA 4O02B 4X2OA 5DREA 5IG5A 1G0TA 1GD3A 1Q40A 4EC6A 2W6JH 1PFPA 1SIIA 3VSYA 3RNTA 1DYUA 3F8HA 3WHOA 1BGSA 1A2KA 3M8CA 4R9LA 2IY2A 4BU4A 3IMAB 1FW7A 3OX9A 3KKGA 2KF6A 2K54A 1O7WB 3LT8A 2H0HA 4RNYA 2WO0A 1US1A 1ASKA 2P05A 2GXFA 3BNCA 5KP3A 3K5TA 2XH9A 1FYSA 1BNRA 1J2BA 1LVNA 3H51A 3GAXA 4L8PA 3GZRA 1RCLA 1BRJA 1LOVA 1Q824 1Q9EA 1NWWA 4I4KA 2GSPA 3O8YA 1RRLA 4JRFA 4FCMA 1KSIA 1C7HA 4K1UA 2KF4A 3MG2A 2BNGA 1OF5A 5BIRA 2CC3A 3KCHA 3AGNA 2ZHXB 3NV0B 3HOHA 2L1SA 2Q07A 1GY6A 1JB5A 3DM8A 5IERA 1RGHA 1IDPA 5CXOA 2CIUA 1W00A 2YFJB 1R4CA 3KSPA 1O7NB 3LXUX 3RDEA 1FUSA 3EBYA 1YNVX 1AR0A 1IQXA 3BLZA 3DY5A 1WMOA 4GSPA 3PXMA 3SVAA 1GOVA 2CFLA 3L0RA 2W03A 1O7GB 2OOVA 4RZMA 1GMRA 1O7MB 3WMDA 1IV9A 2P0XA 3V98A 1BRKA 1RNBA 1QALA 3GWRA 1VQ53 2W04A 1YGWA 1QVG2 4CPKA 1W6GA 4EBGA 3S67A 2F86B 2ZA4A 4XDWA 3F14A 1HYFA 1NU3A 3MPHA 2BMOB 2IUJA 1O7HB 3IJEB 4R4KA 1LRAA 1STFI 2H0GA 2KF3A 2OOVC 2XRXB 1I3IA 1TTOA 3GZYB 1N9EA 1BSAA 4XM4A 3CCJ3 2C10A 1TP6A 1KD14 2LQVA 3D4AA 1A2VA 3F40A 1WQLB 3WA2X 1BAOA 3D3LA 1E3RA 3LMLA 4BTXA 5AEUB 1YIJ3 1PYLA 1BSDA 3URPA 1MWTA 3JUOA 1VQL3 1LXEA 2YFIB 2C4BA 1I2GA 1W6YA 2LYXA 4HAAA 4KT3B 2O9UX 2HMOB 3MSOA 3Q1CA 4AKZA 1R4YA 2A15A 1E3VA 4KFEA 3NM2A 1VQO3 2CW9A 4LYLB 1BRGA 4U13A 3LH4A 2FGTA 2B1XB 1ROVA 1V57A 2W9PA 1OF5B 2HMMB 3NHXA 1D6UA 1JRQA 3QK9A 4L8OA 1FGMA 7STDA 1PU4A 1OHPA 3KIIA 2QA43 2Z6BA 5TGNA 2RBIA 1MNLA 3UL6A 3NQYA 1EG9B 4XDVA 5CF1A 1JV2B 2YFLB 5HGRA 2IA7A 6RNTA 1NNVA 1T5YA 1VQM3 2CG0A 3EF8A 3PZWA 4EXRA 1RJOA 2HMJB 3DUKA 1UI8A 3QRDA 1RCKA 4Q53A 3OW22 3LT9A 8CHOA 1RGLA 2OQEC 4R9KA 3RGAA 8RNTA 2BHMA 1E97A 4JF8A 4AKYA 1BNEA 1FUWA 4R80A 1VZZA 4RNTA 4EV5A 2GU1A 1WNHA 2XGLA 1NJI4 3NV0A 3WDGB 1I0VA 1NB3I 4X2HA 5G1KA 1VQ83 4NPBA 2D42A 4KVHA 2CX1A 1B27A 5A0OB 1D6ZA 1DMNA 2OCTA 5IEPA 2F5MA 1AVKA 3HIGA 1N8QA 1FGTA 1I2EA 3FZWA 1RGFA 3LOYA 3EBTA 2RFRA 1EUIC 1F8NA 1QMAA 3N8BA 4MMYB 4NHFA 9RNTA 4K90B 3LTBA 1A2PA 1IK3A 4FCJA 2BMQB 2QGUA 2IMJA 1QAFA 3LTDA 3G16A 1RTUA 1Q864 1N8R4 4O2HA 1VQ43 1RDSA 2AAEA 4GB5A 1OCVA 2CHCA 3G8ZA 1JBSA 3FH1A 1JBRA 1CYVA 1B2ZA 1WMPA 2C11A 2W0QA 2IYJA 4AEQA 2B24B 3CNMA 4J5KA 3CC73 1V74A 3MKIA 1SARA 2RCDA 5EEOA 2CWVA 2I9WA 4HM0B 3EJVA 3S27A 5D82A 1GMQA 2W2CA 4HM5B 4BTYA 2BMRB 4GHOA 1K8A4 3E99A 4KZ1A 3G713 5AIGA 1Q42A 6STDA 4H61A 5FGOA 5DRVA 1JZDA 1G96A 3VGNA 5IW9A 2QIYA 1D6YA 2F4YA 4FMCA 4BL2A 2XFSA 3CCM3 1TRQA 2CFWA 1BRHA 4L7KA 2ZDJA 3MWZA 3CCU3 1M1XB 2OTJ3 4H3UA 1ZO2A 5IG0A 3A5EA 4XBXA 2K0MA 3EN8A 3I0YA 1GOUA 1X1YA 1BANA 1STDA 4BIRA 4DKIA 2GU3A 1ULJB 3CD63 1EKMA 4WHAA 4J9AA 2P0MA 3SYUA 4G1MB 2H0IA 2F98A 3FLJA 1SJWA 1Q7HA 2JQ5A 5IF6A 4EW5A 1YIT3 3FF0A 3CC43 2BT3A 1RNTA 3CC23 2XF3A 5FW5A 5AIFA 3CCV3 1GOYA 4N6LA 3EB8A 2OTL3 1HKXA 1JNQA 1MOLA 1V58A 3CPW2 1BNFA 2FXTA 4HM6B 3NBRA 3DGOA 1U8CB 4HYZA 4LEHA 4O8SA 5LC6A 3SXXA 3X3YA 3G4S3 1DVDA 1OPYA 1UW1A 2PZVA 2XFTA 3NXJA 4OUQA 1B21A 2WGQA 1IVVA 2F5WA 3UL5A 3SOYA 1RSNA 5IEOA 4HVNA 5IENA 2MF7A 5AYSC 1RKYA 3MHEA 3KZTA 4XBYA 1SIHA 3CCR3 1W02A 3LYGA 1IVWA 1M1K4 2XSHB 2W56B 2ML6A 1RN1A 2PNCA 3LTAA 3WOEB 1ZGXA 1BSBA 3KN4A 2HMKB 1YVBI 5AEWB 2AADA 4BTWA 3MG3A 2CFGA 5KP4A 1VQK3 1UCLA 1W5ZA 1SQWA 4MEIA 3MG1A 2GEXA 3KE7A 2BIRA 3AGOA 5KP1A 3OWSA 3CMA3 1LNIA 3EE1A 3HX8A 4TX4A 5M18A 1YJ93 5ELJA 2P09A 3DH2A 1JJ22 3CPOA 1A67A 1OGZA 3GSPA 4HZBB 1FZUA 1K28A 1EQKA 1VQN3 3B8LA 4HJLB 5GSPA 1RHLA 1ZS7A 4FMDA 3NUVA 2YX9A 3HK4A 1TRPA 2IUKA 3F7XA 2WOHA 3UJMA 2Y73A 3D79A 4RNZA 3FG1A 3KSED 3NBBA 1X1UA 2STDA 3AHWA 1RRHA 3NQZA 1BVIA 4LZIA 1FGRA 4WP5A 1MGRA 1Q814 2CG1A 3ZFZA 2WOFA 1AV4A 2CWTA 2CFKA 2D1WA 3N54B 4MMXB 3D5GA 4N6V0 2KRTA 4N6TA 1IT8A 2R4IA 1K9M4 5LC7A 4IT7A 1W4NA 3J7Yd 3ROBA 1LOWA 3PCSA 3KFQC 1MGWA 4WYKB 5IG4A 1RMSA 3JUQA 2Z76A 4MJDA 1UGIA 1EA2A 3D5IA 4WFOA 3FG4A 3DZLA 3DXOA 1RGGA 3K9MC 3X3ZA 1U5OA 3F9SA 2BO9B 1A90A 1VQ63 1IVUA 1LNHA 3JUPA 1FGQA 4I5QA 1NB5I 3HIIA 3EC9A 2KAAA 1W01A 4ILFA 3U97A 1AY7A 3EHCA 1BRNL 4N6MA 4FR9A 3NM7A 5ELUA 4EYCA 1S723 4HM3B 5BU4A 1GD4A 1T2IA 4FMBA 3B7CA 3CCE3 1GSPA 2CKFB 2ML5A 6GSPA 1BRIA 1W2ZA 5BVBA 1BIRA 1C54A 1KC84 5JPPA 1JKGA 1OHSA 1B20A 2W56A 2XR8B 3SOAA 1JB4A 1BSCA 1IQ8A 1N5PA 1QAKA 2SBLA 1YJW3 1ULIB 1LOYA 1GMPA 1B2SA 1FGOA 2KXGA 2KF5A 3T8NA 3U1WA 1T3BA 1CYUA 1ISKA 2Z7AA 2E2VA 2KCDA 2UUGC 4HM7B 3G6E3 1GS3A 2L4VA 5EQLA 1UUVB 1GYBA 1RGAA 3I563 2M7OA 5RNTA 2FNQA 2CWUA 2GBWB 2RSXA 2ZL8A 2HOHA 1I3FA 1BOXA 3S5CA 2UX0A 2CFDA 2K3DA 3ECFA 3RGRA 3UNLA 1BNJA 1Q7Y4 3AMOB 1UI7A 3FG3A 4R1KA 3CME3 1M9GA 1FA3A 1UGHI 3CXC2 1OGXA 3BNDA 3DGLA 3G0KA 3B4PA 2O3OA 1IT7A 1W7CA 3DMCA 2HMLB 1KQS2 4N6OB 3BNEA 3Q90A 1B2MA 1IU7A 1I2FA 2OWPA 1EEJA 2CX0A 3F7SA 1O7PB 3BB9A 4N6NB 3UB1A 4OVMA 2CH9A 1KWIA 3ALAA 4MMZB 3ER7A 1MWSA 3JVCA 3K0ZA 3LTCA 3FGYA 4O3VA 4EV2A 3SEDA 1QVF2 1G02A 1CQSA 1RGKA 1FUTA 2J8XB 3BU4A 4LGQA 1DE3A 2SARA 3FSDA 1K734 1BNIA 1Y4KA 3K7CA 3CCS3 1MWUA 1B2XA 1YVSA 3TDGA 1YGEA 1LQMB 1JN5B 5M1AA 4WYKA 4ORLA 1WTHA 1JKGB
chains in the Genus database with same CATH topology
2INXA 3OV4A 3WA3A 1DVCA 3HZPA 1Z1SA 3NBJA 3WOFB 5BXQA 3FKAA 3HI7A 4HZ9B 1W2B2 4CDLA 4N3VA 5EVHA 3PS8A 1VQP3 1OACA 1TIJA 4LSOA 3K63A 3STDA 1TFOA 4WWUC 5D81A 2HMNB 1S5AA 3OXAA 5AIIA 1AVLA 5AIHA 3T0UA 2MC8A 3PYJA 4KFFA 3NX0A 3PCRA 3VF1A 2QEX3 1WMNA 4FMAA 3S29A 4HM4B 3OWUA 2P38A 2XGNA 3GZXB 5AI1A 4KFDA 4RBNA 1Q40B 3X42A 1ROAA 2Y74A 3JUNA 4STDA 1UUWB 4K61A 1JB2A 5CF2A 2XSOB 2Z77A 1YI23 3F8XA 5G2GA 3JUMA 4HBRA 3GRDA 5JPUA 1IQYA 1DMMA 1N5HA 1GY7A 3S28A 4XB5A 1VQ73 2GEYA 3FCSB 2V1LA 4LMIA 1QJGA 1ZX2A 4HM1B 5CLKA 1M904 3N9HA 2W9QA 1K41A 3MYTA 5CK6A 3X41A 1OHOA 2WGOA 5D83A 1W6CA 3H3HA 3PGBA 3Q2PA 3AMOA 2F99A 1N9JA 1TU5A 5I97A 4FCZA 3DGNA 1IV7A 1DMQA 1L5GB 3D9RA 2OQEA 3CCQ3 3X3XA 2E2TA 3CNXA 2XEPA 3GZBA 2RGQA 1YHQ3 1RN7A 4IIAA 3FF2A 1TFKA 3BNBA 1SPUA 3SX1A 1GY5A 1YJN3 3EX9A 5JBSA 3LZAA 3A76A 1LOXA 3V99A 3I553 4HM2B 1NDOB 3DGMA 2E2UA 1VQ93 3T8UA 1JN5A 4PEJA 5IG3A 4QWTA 3EQQB 4IPBA 1CEWI 5AYRB 3IPTA 4HKVB 4GL6A 4J8TA 3SLUA 4K1VA 3EN1B 5STDA 1BUQA 1HU9A 1OUNA 4CCVA 2JDIH 4ZM8A 4NREA 3CCL3 3CU3A 3X40A 2CK3H 1TUHA 1IVXA 1OH0A 2GBXB 1NO3A 4XBTA 3B4OA 4HM8B 4N6UA 3V92A 4OK0A 3WODG 3OWYA 4O02B 4X2OA 5DREA 5IG5A 1GD3A 1Q40A 4EC6A 2W6JH 1PFPA 1SIIA 3VSYA 1DYUA 3F8HA 1A2KA 3M8CA 4R9LA 3IMAB 3OX9A 3KKGA 2K54A 1O7WB 3LT8A 4RNYA 2WO0A 1US1A 1ASKA 2P05A 2GXFA 3BNCA 5KP3A 3K5TA 2XH9A 1J2BA 1LVNA 3H51A 3GAXA 4L8PA 3GZRA 1Q824 4I4KA 1NWWA 3O8YA 1RRLA 4JRFA 4FCMA 1KSIA 1C7HA 4K1UA 3MG2A 2BNGA 1OF5A 2CC3A 3NV0B 2Q07A 1GY6A 1JB5A 3DM8A 5IERA 1IDPA 5CXOA 2CIUA 1W00A 2YFJB 1R4CA 3KSPA 1O7NB 3LXUX 3RDEA 3EBYA 1AR0A 1IQXA 3BLZA 3DY5A 1WMOA 3SVAA 3PXMA 2CFLA 3L0RA 2W03A 1O7GB 2OOVA 4RZMA 1O7MB 3WMDA 1IV9A 2P0XA 3V98A 1QALA 3GWRA 1VQ53 2W04A 1QVG2 1W6GA 4EBGA 3S67A 2F86B 4XDWA 3F14A 1NU3A 3MPHA 2BMOB 2IUJA 1O7HB 3IJEB 4R4KA 2XRXB 1STFI 2OOVC 3GZYB 1N9EA 4XM4A 3CCJ3 2C10A 1TP6A 1KD14 2LQVA 1A2VA 3F40A 1WQLB 3WA2X 3LMLA 3D3LA 1E3RA 4BTXA 5AEUB 1YIJ3 3JUOA 1VQL3 1LXEA 2YFIB 1W6YA 2LYXA 2O9UX 2HMOB 3MSOA 3Q1CA 4AKZA 2A15A 4KFEA 1E3VA 3NM2A 1VQO3 2CW9A 4U13A 3LH4A 2FGTA 2B1XB 1ROVA 2W9PA 1OF5B 2HMMB 3NHXA 1D6UA 1JRQA 3QK9A 4L8OA 1FGMA 7STDA 1PU4A 1OHPA 3KIIA 2QA43 2Z6BA 5TGNA 1MNLA 3UL6A 3NQYA 1EG9B 4XDVA 5CF1A 1JV2B 2YFLB 5HGRA 2IA7A 1T5YA 1VQM3 2CG0A 3EF8A 3PZWA 4EXRA 1RJOA 2HMJB 3DUKA 1UI8A 3QRDA 4Q53A 3OW22 3LT9A 8CHOA 2OQEC 4R9KA 3RGAA 2BHMA 1E97A 4JF8A 4AKYA 1FUWA 4R80A 1VZZA 4EV5A 2GU1A 1WNHA 2XGLA 1NJI4 3NV0A 3WDGB 4X2HA 1NB3I 1VQ83 2D42A 4KVHA 5A0OB 1D6ZA 1DMNA 2OCTA 5IEPA 1AVKA 3HIGA 1N8QA 1FGTA 3N8BA 3FZWA 3LOYA 3EBTA 2RFRA 1F8NA 4NHFA 1QMAA 4MMYB 4K90B 3LTBA 1IK3A 4FCJA 2BMQB 2QGUA 2IMJA 1QAFA 3LTDA 3G16A 1Q864 1N8R4 4O2HA 1VQ43 4GB5A 1OCVA 2CHCA 3G8ZA 3FH1A 1CYVA 1WMPA 2C11A 2W0QA 4AEQA 2B24B 3CNMA 3CC73 1V74A 3MKIA 5EEOA 2RCDA 2CWVA 2I9WA 4HM0B 3EJVA 3S27A 5D82A 2W2CA 4BTYA 4HM5B 1K8A4 2BMRB 3E99A 4KZ1A 3G713 5AIGA 1Q42A 6STDA 4H61A 5FGOA 5DRVA 1G96A 3VGNA 5IW9A 2QIYA 1D6YA 3CCM3 4FMCA 2XFSA 2CFWA 4L7KA 2ZDJA 3MWZA 3CCU3 1M1XB 2OTJ3 4H3UA 1ZO2A 5IG0A 4XBXA 2K0MA 3EN8A 3I0YA 1STDA 2GU3A 1ULJB 3CD63 1EKMA 4WHAA 4J9AA 2P0MA 4G1MB 2F98A 3FLJA 1SJWA 2JQ5A 5IF6A 1YIT3 3FF0A 3CC43 2BT3A 3CC23 2XF3A 5FW5A 5AIFA 3CCV3 4N6LA 3EB8A 2OTL3 1HKXA 1JNQA 1MOLA 3CPW2 2FXTA 4HM6B 3NBRA 3DGOA 1U8CB 4HYZA 4LEHA 4O8SA 5LC6A 3SXXA 3X3YA 3G4S3 1DVDA 1OPYA 1UW1A 2PZVA 2XFTA 3NXJA 4OUQA 2WGQA 1IVVA 3UL5A 3SOYA 5IEOA 4HVNA 5IENA 2MF7A 5AYSC 1RKYA 3MHEA 3KZTA 4XBYA 1SIHA 3CCR3 1W02A 3LYGA 1IVWA 1M1K4 2XSHB 2W56B 2ML6A 2PNCA 3LTAA 3WOEB 5AEWB 3KN4A 2HMKB 1YVBI 4BTWA 3MG3A 2CFGA 5KP4A 1VQK3 1W5ZA 1SQWA 4MEIA 3MG1A 2GEXA 3KE7A 5KP1A 3OWSA 3CMA3 3EE1A 3HX8A 4TX4A 1YJ93 5ELJA 2P09A 1JJ22 3CPOA 1A67A 1OGZA 4HZBB 1K28A 1EQKA 1VQN3 3B8LA 4HJLB 4FMDA 3NUVA 2YX9A 3HK4A 3UJMA 2IUKA 3F7XA 2WOHA 2Y73A 4RNZA 3FG1A 3KSED 3NBBA 2STDA 1RRHA 3NQZA 4LZIA 1FGRA 4WP5A 1Q814 2CG1A 2WOFA 1AV4A 2CWTA 2CFKA 2D1WA 3N54B 4MMXB 4N6V0 2KRTA 4N6TA 1IT8A 2R4IA 1K9M4 5LC7A 4IT7A 1W4NA 3J7Yd 3ROBA 3PCSA 3KFQC 5IG4A 4WYKB 3JUQA 2Z76A 4MJDA 1EA2A 4WFOA 3FG4A 3DZLA 3DXOA 3K9MC 3X3ZA 1U5OA 3F9SA 2BO9B 1A90A 1VQ63 1IVUA 1LNHA 3JUPA 1FGQA 1NB5I 3HIIA 3EC9A 1W01A 3U97A 3EHCA 4N6MA 4FR9A 3NM7A 5ELUA 4EYCA 1S723 4HM3B 1GD4A 4FMBA 3B7CA 3CCE3 2CKFB 2ML5A 1W2ZA 5BVBA 1KC84 5JPPA 1JKGA 1OHSA 3SOAA 2W56A 2XR8B 1JB4A 1IQ8A 1N5PA 1QAKA 2SBLA 1YJW3 1ULIB 1FGOA 2KXGA 3T8NA 3U1WA 1CYUA 1ISKA 2Z7AA 2E2VA 2KCDA 4HM7B 3G6E3 1GS3A 2L4VA 5EQLA 1UUVB 1GYBA 3I563 2M7OA 2FNQA 2CWUA 2GBWB 2RSXA 2ZL8A 3S5CA 2UX0A 2CFDA 3ECFA 3RGRA 3UNLA 1Q7Y4 3AMOB 1UI7A 3FG3A 4R1KA 3CME3 1M9GA 1FA3A 3CXC2 1OGXA 3BNDA 3DGLA 3G0KA 3B4PA 2O3OA 1IT7A 1W7CA 3DMCA 2HMLB 1KQS2 4N6OB 3BNEA 3Q90A 1IU7A 2OWPA 3F7SA 1O7PB 3BB9A 4N6NB 3UB1A 4OVMA 2CH9A 1KWIA 3ALAA 4MMZB 3ER7A 3JVCA 3K0ZA 3LTCA 4O3VA 3FGYA 4EV2A 3SEDA 1QVF2 1CQSA 4LGQA 3FSDA 1K734 1Y4KA 3K7CA 3CCS3 3TDGA 1YGEA 1JN5B 4WYKA 4ORLA 1WTHA 1JKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INX A;  3OV4 A;  3HZP A;  1Z1S A;  5BXQ A;  3FKA A;  4HZ9 B;  4CDL A;  4N3V A;  5EVH A;  3STD A;  4WWU C;  5D81 A;  2HMN B;  1S5A A;  3OXA A;  5AII A;  5AIH A;  4HM4 B;  3OWU A;  3GZX B;  5AI1 A;  1Q40 B;  4STD A;  3JUN A;  1UUW B;  1JB2 A;  5CF2 A;  2XSO B;  2Z77 A;  3F8X A;  5G2G A;  3JUM A;  3GRD A;  5JPU A;  1DMM A;  1GY7 A;  4XB5 A;  2GEY A;  4LMI A;  1QJG A;  1ZX2 A;  4HM1 B;  5CLK A;  1K41 A;  3MYT A;  5CK6 A;  1OHO A;  5D83 A;  3H3H A;  2F99 A;  1DMQ A;  3D9R A;  3CNX A;  3GZB A;  2RGQ A;  4IIA A;  3FF2 A;  1GY5 A;  3EX9 A;  3LZA A;  3A76 A;  4HM2 B;  1NDO B;  3T8U A;  1JN5 A;  4PEJ A;  5IG3 A;  3EQQ B;  3IPT A;  4HKV B;  4J8T A;  4K1V A;  3EN1 B;  5STD A;  1BUQ A;  1OUN A;  3CU3 A;  1TUH A;  1OH0 A;  2GBX B;  4XBT A;  3B4O A;  4HM8 B;  3OWY A;  4X2O A;  5DRE A;  5IG5 A;  1Q40 A;  3VSY A;  3F8H A;  1A2K A;  3M8C A;  4R9L A;  3OX9 A;  3KKG A;  2K54 A;  1O7W B;  1ASK A;  2GXF A;  5KP3 A;  3H51 A;  4L8P A;  3GZR A;  4I4K A;  1NWW A;  4FCM A;  4K1U A;  1C7H A;  3MG2 A;  2BNG A;  1OF5 A;  3NV0 B;  1GY6 A;  1JB5 A;  3DM8 A;  5IER A;  1IDP A;  5CXO A;  1W00 A;  2YFJ B;  3KSP A;  1O7N B;  3EBY A;  1AR0 A;  3BLZ A;  1O7G B;  4RZM A;  1O7M B;  3WMD A;  3GWR A;  2F86 B;  4XDW A;  3F14 A;  1NU3 A;  2BMO B;  1O7H B;  2XRX B;  3GZY B;  4XM4 A;  1TP6 A;  3F40 A;  1WQL B;  5AEU B;  1E3R A;  3JUO A;  2YFI B;  1W6Y A;  3MSO A;  2HMO B;  2A15 A;  1E3V A;  3NM2 A;  4U13 A;  2B1X B;  1OF5 B;  2HMM B;  3NHX A;  4L8O A;  7STD A;  1OHP A;  5TGN A;  4XDV A;  1EG9 B;  5CF1 A;  2YFL B;  5HGR A;  3EF8 A;  2HMJ B;  3DUK A;  4Q53 A;  8CHO A;  4R9K A;  3RGA A;  1E97 A;  1VZZ A;  3NV0 A;  4X2H A;  4KVH A;  1DMN A;  5IEP A;  3FZW A;  3EBT A;  2RFR A;  1QMA A;  4FCJ A;  2BMQ B;  2QGU A;  2IMJ A;  3G16 A;  4GB5 A;  1OCV A;  2CHC A;  3G8Z A;  3FH1 A;  2B24 B;  3CNM A;  3MKI A;  2RCD A;  2I9W A;  4HM0 B;  3EJV A;  5D82 A;  2W2C A;  4HM5 B;  2BMR B;  3E99 A;  5AIG A;  1Q42 A;  6STD A;  5DRV A;  3VGN A;  2QIY A;  4L7K A;  4H3U A;  1ZO2 A;  5IG0 A;  4XBX A;  3EN8 A;  3I0Y A;  1STD A;  1ULJ B;  4J9A A;  2F98 A;  3FLJ A;  1SJW A;  2JQ5 A;  5IF6 A;  3FF0 A;  5FW5 A;  5AIF A;  1HKX A;  4HM6 B;  3NBR A;  4LEH A;  1OPY A;  2PZV A;  3NXJ A;  4OUQ A;  3SOY A;  5IEO A;  4HVN A;  5IEN A;  3MHE A;  3KZT A;  4XBY A;  1W02 A;  3LYG A;  2XSH B;  5AEW B;  2HMK B;  3MG3 A;  5KP4 A;  3MG1 A;  2GEX A;  3KE7 A;  5KP1 A;  3OWS A;  3HX8 A;  3CPO A;  1OGZ A;  4HZB B;  3B8L A;  4HJL B;  3NUV A;  3HK4 A;  3UJM A;  3F7X A;  2STD A;  4WP5 A;  2R4I A;  3ROB A;  5IG4 A;  4WYK B;  3JUQ A;  2Z76 A;  4MJD A;  1EA2 A;  3DZL A;  3DXO A;  1U5O A;  3F9S A;  3JUP A;  3EC9 A;  1W01 A;  3EHC A;  4HM3 B;  3B7C A;  2CKF B;  5BVB A;  5JPP A;  1JKG A;  1OHS A;  3SOA A;  2XR8 B;  1JB4 A;  1ULI B;  3T8N A;  1ISK A;  2Z7A A;  4HM7 B;  1GS3 A;  1UUV B;  1GYB A;  2GBW B;  3S5C A;  2UX0 A;  3ECF A;  3RGR A;  3UNL A;  4R1K A;  1OGX A;  3G0K A;  3B4P A;  3DMC A;  2HML B;  3Q90 A;  2OWP A;  3F7S A;  1O7P B;  3BB9 A;  4OVM A;  3ER7 A;  3K0Z A;  3FGY A;  3SED A;  1CQS A;  4LGQ A;  3FSD A;  3K7C A;  1JN5 B;  4WYK A;  4ORL A;  1JKG B; 
#chains in the Genus database with same CATH topology
 1DET A;  1T2H A;  4CJN A;  7GSP A;  2INX A;  5G1L A;  2UGI A;  3OV4 A;  3WA3 A;  1DVC A;  3HZP A;  1Z1S A;  3NBJ A;  3WOF B;  5BXQ A;  3FKA A;  3HI7 A;  4HZ9 B;  1W2B 2;  4CDL A;  4N3V A;  5EVH A;  3PS8 A;  7RNT A;  1VQP 3;  1OAC A;  3WR2 A;  1TIJ A;  4LSO A;  3K63 A;  3STD A;  1B2U A;  3VF1 A;  1TFO A;  4WWU C;  5D81 A;  1TJD A;  1S5A A;  2HMN B;  3OXA A;  1AVL A;  5AII A;  5AIH A;  2MC8 A;  3PYJ A;  4KFF A;  3NX0 A;  3PCR A;  3T0U A;  2QEX 3;  1WMN A;  4FMA A;  3S29 A;  4HM4 B;  3OWU A;  2P38 A;  2XGN A;  3GZX B;  5AI1 A;  4HOH A;  4KFD A;  1I8V A;  1Q40 B;  1VQQ A;  4RBN A;  1ROA A;  2Y74 A;  1MWR A;  3JUN A;  4STD A;  1UUW B;  4K61 A;  1JB2 A;  5CF2 A;  2XSO B;  2Z77 A;  1YI2 3;  3F8X A;  5G2G A;  3DGY A;  3JUM A;  4HBR A;  3GRD A;  5JPU A;  1CH0 A;  1IQY A;  1DMM A;  1N5H A;  1GY7 A;  3ZG5 A;  3S28 A;  4XB5 A;  1VQ7 3;  2GEY A;  1BNG A;  2V1L A;  3FCS B;  4LMI A;  1HZ1 A;  1QJG A;  1ZX2 A;  4HM1 B;  5CLK A;  1M90 4;  1RGC A;  2W9Q A;  1K41 A;  1UUG B;  3MYT A;  3N9H A;  5CK6 A;  3X41 A;  1RLS A;  1OHO A;  2WGO A;  5D83 A;  1W6C A;  1BNS A;  1UCK A;  3H3H A;  1UCJ A;  1BSE A;  3PGB A;  3AMO A;  1PY3 A;  2F99 A;  3Q2P A;  1N9J A;  3X42 A;  1TU5 A;  5I97 A;  1UCI A;  1JZO A;  3DGN A;  4FCZ A;  1IV7 A;  1DMQ A;  1X1W A;  1L5G B;  3D9R A;  1RN4 A;  2OQE A;  1LQG C;  3CCQ 3;  3X3X A;  2E2T A;  3CNX A;  2XEP A;  3GZB A;  2RGQ A;  1YHQ 3;  1RN7 A;  4IIA A;  3FF2 A;  1TFK A;  3BNB A;  1SPU A;  5HOH A;  3SX1 A;  1GY5 A;  1YJN 3;  3EX9 A;  5JBS A;  3LZA A;  2R41 A;  1UDI I;  1LOX A;  3A76 A;  3V99 A;  1BU4 A;  4HM2 B;  3I55 3;  3AHS A;  1NDO B;  3DGM A;  2E2U A;  4J5G A;  1VQ9 3;  3T8U A;  1JN5 A;  4PEJ A;  5IG3 A;  4BL3 A;  4QWT A;  3EQQ B;  4IPB A;  1CEW I;  1BUJ A;  5AYR B;  3IPT A;  4HKV B;  4GL6 A;  2BU4 A;  4J8T A;  1I70 A;  1X1X A;  3SLU A;  4K1V A;  3EN1 B;  1B3S A;  3Q3F A;  5STD A;  1RGE A;  1BUQ A;  1HU9 A;  1OUN A;  4CCV A;  2JDI H;  1AQZ A;  2RNT A;  4NRE A;  4ZM8 A;  1JBT A;  3CCL 3;  3BIR A;  3CU3 A;  3ZG0 A;  5M19 A;  3X40 A;  2CK3 H;  1TUH A;  1IVX A;  1OH0 A;  2GBX B;  1NO3 A;  4XBT A;  3B4O A;  2F56 A;  4HM8 B;  4N6U A;  3V92 A;  1I0X A;  4OK0 A;  3WOD G;  1IYY A;  1BRS A;  3OWY A;  4O02 B;  4X2O A;  5DRE A;  5IG5 A;  1G0T A;  1GD3 A;  1Q40 A;  4EC6 A;  2W6J H;  1PFP A;  1SII A;  3VSY A;  3RNT A;  1DYU A;  3F8H A;  3WHO A;  1BGS A;  1A2K A;  3M8C A;  4R9L A;  2IY2 A;  4BU4 A;  3IMA B;  1FW7 A;  3OX9 A;  3KKG A;  2KF6 A;  2K54 A;  1O7W B;  3LT8 A;  2H0H A;  4RNY A;  2WO0 A;  1US1 A;  1ASK A;  2P05 A;  2GXF A;  3BNC A;  5KP3 A;  3K5T A;  2XH9 A;  1FYS A;  1BNR A;  1J2B A;  1LVN A;  3H51 A;  3GAX A;  4L8P A;  3GZR A;  1RCL A;  1BRJ A;  1LOV A;  1Q82 4;  1Q9E A;  1NWW A;  4I4K A;  2GSP A;  3O8Y A;  1RRL A;  4JRF A;  4FCM A;  1KSI A;  1C7H A;  4K1U A;  2KF4 A;  3MG2 A;  2BNG A;  1OF5 A;  5BIR A;  2CC3 A;  3KCH A;  3AGN A;  2ZHX B;  3NV0 B;  3HOH A;  2L1S A;  2Q07 A;  1GY6 A;  1JB5 A;  3DM8 A;  5IER A;  1RGH A;  1IDP A;  5CXO A;  2CIU A;  1W00 A;  2YFJ B;  1R4C A;  3KSP A;  1O7N B;  3LXU X;  3RDE A;  1FUS A;  3EBY A;  1YNV X;  1AR0 A;  1IQX A;  3BLZ A;  3DY5 A;  1WMO A;  4GSP A;  3PXM A;  3SVA A;  1GOV A;  2CFL A;  3L0R A;  2W03 A;  1O7G B;  2OOV A;  4RZM A;  1GMR A;  1O7M B;  3WMD A;  1IV9 A;  2P0X A;  3V98 A;  1BRK A;  1RNB A;  1QAL A;  3GWR A;  1VQ5 3;  2W04 A;  1YGW A;  1QVG 2;  4CPK A;  1W6G A;  4EBG A;  3S67 A;  2F86 B;  2ZA4 A;  4XDW A;  3F14 A;  1HYF A;  1NU3 A;  3MPH A;  2BMO B;  2IUJ A;  1O7H B;  3IJE B;  4R4K A;  1LRA A;  1STF I;  2H0G A;  2KF3 A;  2OOV C;  2XRX B;  1I3I A;  1TTO A;  3GZY B;  1N9E A;  1BSA A;  4XM4 A;  3CCJ 3;  2C10 A;  1TP6 A;  1KD1 4;  2LQV A;  3D4A A;  1A2V A;  3F40 A;  1WQL B;  3WA2 X;  1BAO A;  3D3L A;  1E3R A;  3LML A;  4BTX A;  5AEU B;  1YIJ 3;  1PYL A;  1BSD A;  3URP A;  1MWT A;  3JUO A;  1VQL 3;  1LXE A;  2YFI B;  2C4B A;  1I2G A;  1W6Y A;  2LYX A;  4HAA A;  4KT3 B;  2O9U X;  2HMO B;  3MSO A;  3Q1C A;  4AKZ A;  1R4Y A;  2A15 A;  1E3V A;  4KFE A;  3NM2 A;  1VQO 3;  2CW9 A;  4LYL B;  1BRG A;  4U13 A;  3LH4 A;  2FGT A;  2B1X B;  1ROV A;  1V57 A;  2W9P A;  1OF5 B;  2HMM B;  3NHX A;  1D6U A;  1JRQ A;  3QK9 A;  4L8O A;  1FGM A;  7STD A;  1PU4 A;  1OHP A;  3KII A;  2QA4 3;  2Z6B A;  5TGN A;  2RBI A;  1MNL A;  3UL6 A;  3NQY A;  1EG9 B;  4XDV A;  5CF1 A;  1JV2 B;  2YFL B;  5HGR A;  2IA7 A;  6RNT A;  1NNV A;  1T5Y A;  1VQM 3;  2CG0 A;  3EF8 A;  3PZW A;  4EXR A;  1RJO A;  2HMJ B;  3DUK A;  1UI8 A;  3QRD A;  1RCK A;  4Q53 A;  3OW2 2;  3LT9 A;  8CHO A;  1RGL A;  2OQE C;  4R9K A;  3RGA A;  8RNT A;  2BHM A;  1E97 A;  4JF8 A;  4AKY A;  1BNE A;  1FUW A;  4R80 A;  1VZZ A;  4RNT A;  4EV5 A;  2GU1 A;  1WNH A;  2XGL A;  1NJI 4;  3NV0 A;  3WDG B;  1I0V A;  1NB3 I;  4X2H A;  5G1K A;  1VQ8 3;  4NPB A;  2D42 A;  4KVH A;  2CX1 A;  1B27 A;  5A0O B;  1D6Z A;  1DMN A;  2OCT A;  5IEP A;  2F5M A;  1AVK A;  3HIG A;  1N8Q A;  1FGT A;  1I2E A;  3FZW A;  1RGF A;  3LOY A;  3EBT A;  2RFR A;  1EUI C;  1F8N A;  1QMA A;  3N8B A;  4MMY B;  4NHF A;  9RNT A;  4K90 B;  3LTB A;  1A2P A;  1IK3 A;  4FCJ A;  2BMQ B;  2QGU A;  2IMJ A;  1QAF A;  3LTD A;  3G16 A;  1RTU A;  1Q86 4;  1N8R 4;  4O2H A;  1VQ4 3;  1RDS A;  2AAE A;  4GB5 A;  1OCV A;  2CHC A;  3G8Z A;  1JBS A;  3FH1 A;  1JBR A;  1CYV A;  1B2Z A;  1WMP A;  2C11 A;  2W0Q A;  2IYJ A;  4AEQ A;  2B24 B;  3CNM A;  4J5K A;  3CC7 3;  1V74 A;  3MKI A;  1SAR A;  2RCD A;  5EEO A;  2CWV A;  2I9W A;  4HM0 B;  3EJV A;  3S27 A;  5D82 A;  1GMQ A;  2W2C A;  4HM5 B;  4BTY A;  2BMR B;  4GHO A;  1K8A 4;  3E99 A;  4KZ1 A;  3G71 3;  5AIG A;  1Q42 A;  6STD A;  4H61 A;  5FGO A;  5DRV A;  1JZD A;  1G96 A;  3VGN A;  5IW9 A;  2QIY A;  1D6Y A;  2F4Y A;  4FMC A;  4BL2 A;  2XFS A;  3CCM 3;  1TRQ A;  2CFW A;  1BRH A;  4L7K A;  2ZDJ A;  3MWZ A;  3CCU 3;  1M1X B;  2OTJ 3;  4H3U A;  1ZO2 A;  5IG0 A;  3A5E A;  4XBX A;  2K0M A;  3EN8 A;  3I0Y A;  1GOU A;  1X1Y A;  1BAN A;  1STD A;  4BIR A;  4DKI A;  2GU3 A;  1ULJ B;  3CD6 3;  1EKM A;  4WHA A;  4J9A A;  2P0M A;  3SYU A;  4G1M B;  2H0I A;  2F98 A;  3FLJ A;  1SJW A;  1Q7H A;  2JQ5 A;  5IF6 A;  4EW5 A;  1YIT 3;  3FF0 A;  3CC4 3;  2BT3 A;  1RNT A;  3CC2 3;  2XF3 A;  5FW5 A;  5AIF A;  3CCV 3;  1GOY A;  4N6L A;  3EB8 A;  2OTL 3;  1HKX A;  1JNQ A;  1MOL A;  1V58 A;  3CPW 2;  1BNF A;  2FXT A;  4HM6 B;  3NBR A;  3DGO A;  1U8C B;  4HYZ A;  4LEH A;  4O8S A;  5LC6 A;  3SXX A;  3X3Y A;  3G4S 3;  1DVD A;  1OPY A;  1UW1 A;  2PZV A;  2XFT A;  3NXJ A;  4OUQ A;  1B21 A;  2WGQ A;  1IVV A;  2F5W A;  3UL5 A;  3SOY A;  1RSN A;  5IEO A;  4HVN A;  5IEN A;  2MF7 A;  5AYS C;  1RKY A;  3MHE A;  3KZT A;  4XBY A;  1SIH A;  3CCR 3;  1W02 A;  3LYG A;  1IVW A;  1M1K 4;  2XSH B;  2W56 B;  2ML6 A;  1RN1 A;  2PNC A;  3LTA A;  3WOE B;  1ZGX A;  1BSB A;  3KN4 A;  2HMK B;  1YVB I;  5AEW B;  2AAD A;  4BTW A;  3MG3 A;  2CFG A;  5KP4 A;  1VQK 3;  1UCL A;  1W5Z A;  1SQW A;  4MEI A;  3MG1 A;  2GEX A;  3KE7 A;  2BIR A;  3AGO A;  5KP1 A;  3OWS A;  3CMA 3;  1LNI A;  3EE1 A;  3HX8 A;  4TX4 A;  5M18 A;  1YJ9 3;  5ELJ A;  2P09 A;  3DH2 A;  1JJ2 2;  3CPO A;  1A67 A;  1OGZ A;  3GSP A;  4HZB B;  1FZU A;  1K28 A;  1EQK A;  1VQN 3;  3B8L A;  4HJL B;  5GSP A;  1RHL A;  1ZS7 A;  4FMD A;  3NUV A;  2YX9 A;  3HK4 A;  1TRP A;  2IUK A;  3F7X A;  2WOH A;  3UJM A;  2Y73 A;  3D79 A;  4RNZ A;  3FG1 A;  3KSE D;  3NBB A;  1X1U A;  2STD A;  3AHW A;  1RRH A;  3NQZ A;  1BVI A;  4LZI A;  1FGR A;  4WP5 A;  1MGR A;  1Q81 4;  2CG1 A;  3ZFZ A;  2WOF A;  1AV4 A;  2CWT A;  2CFK A;  2D1W A;  3N54 B;  4MMX B;  3D5G A;  4N6V 0;  2KRT A;  4N6T A;  1IT8 A;  2R4I A;  1K9M 4;  5LC7 A;  4IT7 A;  1W4N A;  3J7Y d;  3ROB A;  1LOW A;  3PCS A;  3KFQ C;  1MGW A;  4WYK B;  5IG4 A;  1RMS A;  3JUQ A;  2Z76 A;  4MJD A;  1UGI A;  1EA2 A;  3D5I A;  4WFO A;  3FG4 A;  3DZL A;  3DXO A;  1RGG A;  3K9M C;  3X3Z A;  1U5O A;  3F9S A;  2BO9 B;  1A90 A;  1VQ6 3;  1IVU A;  1LNH A;  3JUP A;  1FGQ A;  4I5Q A;  1NB5 I;  3HII A;  3EC9 A;  2KAA A;  1W01 A;  4ILF A;  3U97 A;  1AY7 A;  3EHC A;  1BRN L;  4N6M A;  4FR9 A;  3NM7 A;  5ELU A;  4EYC A;  1S72 3;  4HM3 B;  5BU4 A;  1GD4 A;  1T2I A;  4FMB A;  3B7C A;  3CCE 3;  1GSP A;  2CKF B;  2ML5 A;  6GSP A;  1BRI A;  1W2Z A;  5BVB A;  1BIR A;  1C54 A;  1KC8 4;  5JPP A;  1JKG A;  1OHS A;  1B20 A;  2W56 A;  2XR8 B;  3SOA A;  1JB4 A;  1BSC A;  1IQ8 A;  1N5P A;  1QAK A;  2SBL A;  1YJW 3;  1ULI B;  1LOY A;  1GMP A;  1B2S A;  1FGO A;  2KXG A;  2KF5 A;  3T8N A;  3U1W A;  1T3B A;  1CYU A;  1ISK A;  2Z7A A;  2E2V A;  2KCD A;  2UUG C;  4HM7 B;  3G6E 3;  1GS3 A;  2L4V A;  5EQL A;  1UUV B;  1GYB A;  1RGA A;  3I56 3;  2M7O A;  5RNT A;  2FNQ A;  2CWU A;  2GBW B;  2RSX A;  2ZL8 A;  2HOH A;  1I3F A;  1BOX A;  3S5C A;  2UX0 A;  2CFD A;  2K3D A;  3ECF A;  3RGR A;  3UNL A;  1BNJ A;  1Q7Y 4;  3AMO B;  1UI7 A;  3FG3 A;  4R1K A;  3CME 3;  1M9G A;  1FA3 A;  1UGH I;  3CXC 2;  1OGX A;  3BND A;  3DGL A;  3G0K A;  3B4P A;  2O3O A;  1IT7 A;  1W7C A;  3DMC A;  2HML B;  1KQS 2;  4N6O B;  3BNE A;  3Q90 A;  1B2M A;  1IU7 A;  1I2F A;  2OWP A;  1EEJ A;  2CX0 A;  3F7S A;  1O7P B;  3BB9 A;  4N6N B;  3UB1 A;  4OVM A;  2CH9 A;  1KWI A;  3ALA A;  4MMZ B;  3ER7 A;  1MWS A;  3JVC A;  3K0Z A;  3LTC A;  3FGY A;  4O3V A;  4EV2 A;  3SED A;  1QVF 2;  1G02 A;  1CQS A;  1RGK A;  1FUT A;  2J8X B;  3BU4 A;  4LGQ A;  1DE3 A;  2SAR A;  3FSD A;  1K73 4;  1BNI A;  1Y4K A;  3K7C A;  3CCS 3;  1MWU A;  1B2X A;  1YVS A;  3TDG A;  1YGE A;  1LQM B;  1JN5 B;  5M1A A;  4WYK A;  4ORL A;  1WTH A;  1JKG B; 
#chains in the Genus database with same CATH homology
 2INX A;  3OV4 A;  3WA3 A;  1DVC A;  3HZP A;  1Z1S A;  3NBJ A;  3WOF B;  5BXQ A;  3FKA A;  3HI7 A;  4HZ9 B;  1W2B 2;  4CDL A;  4N3V A;  5EVH A;  3PS8 A;  1VQP 3;  1OAC A;  1TIJ A;  4LSO A;  3K63 A;  3STD A;  1TFO A;  4WWU C;  5D81 A;  2HMN B;  1S5A A;  3OXA A;  5AII A;  1AVL A;  5AIH A;  3T0U A;  2MC8 A;  3PYJ A;  4KFF A;  3NX0 A;  3PCR A;  3VF1 A;  2QEX 3;  1WMN A;  4FMA A;  3S29 A;  4HM4 B;  3OWU A;  2P38 A;  2XGN A;  3GZX B;  5AI1 A;  4KFD A;  4RBN A;  1Q40 B;  3X42 A;  1ROA A;  2Y74 A;  3JUN A;  4STD A;  1UUW B;  4K61 A;  1JB2 A;  5CF2 A;  2XSO B;  2Z77 A;  1YI2 3;  3F8X A;  5G2G A;  3JUM A;  4HBR A;  3GRD A;  5JPU A;  1IQY A;  1DMM A;  1N5H A;  1GY7 A;  3S28 A;  4XB5 A;  1VQ7 3;  2GEY A;  3FCS B;  2V1L A;  4LMI A;  1QJG A;  1ZX2 A;  4HM1 B;  5CLK A;  1M90 4;  3N9H A;  2W9Q A;  1K41 A;  3MYT A;  5CK6 A;  3X41 A;  1OHO A;  2WGO A;  5D83 A;  1W6C A;  3H3H A;  3PGB A;  3Q2P A;  3AMO A;  2F99 A;  1N9J A;  1TU5 A;  5I97 A;  4FCZ A;  3DGN A;  1IV7 A;  1DMQ A;  1L5G B;  3D9R A;  2OQE A;  3CCQ 3;  3X3X A;  2E2T A;  3CNX A;  2XEP A;  3GZB A;  2RGQ A;  1YHQ 3;  1RN7 A;  4IIA A;  3FF2 A;  1TFK A;  3BNB A;  1SPU A;  3SX1 A;  1GY5 A;  1YJN 3;  3EX9 A;  5JBS A;  3LZA A;  3A76 A;  1LOX A;  3V99 A;  3I55 3;  4HM2 B;  1NDO B;  3DGM A;  2E2U A;  1VQ9 3;  3T8U A;  1JN5 A;  4PEJ A;  5IG3 A;  4QWT A;  3EQQ B;  4IPB A;  1CEW I;  5AYR B;  3IPT A;  4HKV B;  4GL6 A;  4J8T A;  3SLU A;  4K1V A;  3EN1 B;  5STD A;  1BUQ A;  1HU9 A;  1OUN A;  4CCV A;  2JDI H;  4ZM8 A;  4NRE A;  3CCL 3;  3CU3 A;  3X40 A;  2CK3 H;  1TUH A;  1IVX A;  1OH0 A;  2GBX B;  1NO3 A;  4XBT A;  3B4O A;  4HM8 B;  4N6U A;  3V92 A;  4OK0 A;  3WOD G;  3OWY A;  4O02 B;  4X2O A;  5DRE A;  5IG5 A;  1GD3 A;  1Q40 A;  4EC6 A;  2W6J H;  1PFP A;  1SII A;  3VSY A;  1DYU A;  3F8H A;  1A2K A;  3M8C A;  4R9L A;  3IMA B;  3OX9 A;  3KKG A;  2K54 A;  1O7W B;  3LT8 A;  4RNY A;  2WO0 A;  1US1 A;  1ASK A;  2P05 A;  2GXF A;  3BNC A;  5KP3 A;  3K5T A;  2XH9 A;  1J2B A;  1LVN A;  3H51 A;  3GAX A;  4L8P A;  3GZR A;  1Q82 4;  4I4K A;  1NWW A;  3O8Y A;  1RRL A;  4JRF A;  4FCM A;  1KSI A;  1C7H A;  4K1U A;  3MG2 A;  2BNG A;  1OF5 A;  2CC3 A;  3NV0 B;  2Q07 A;  1GY6 A;  1JB5 A;  3DM8 A;  5IER A;  1IDP A;  5CXO A;  2CIU A;  1W00 A;  2YFJ B;  1R4C A;  3KSP A;  1O7N B;  3LXU X;  3RDE A;  3EBY A;  1AR0 A;  1IQX A;  3BLZ A;  3DY5 A;  1WMO A;  3SVA A;  3PXM A;  2CFL A;  3L0R A;  2W03 A;  1O7G B;  2OOV A;  4RZM A;  1O7M B;  3WMD A;  1IV9 A;  2P0X A;  3V98 A;  1QAL A;  3GWR A;  1VQ5 3;  2W04 A;  1QVG 2;  1W6G A;  4EBG A;  3S67 A;  2F86 B;  4XDW A;  3F14 A;  1NU3 A;  3MPH A;  2BMO B;  2IUJ A;  1O7H B;  3IJE B;  4R4K A;  2XRX B;  1STF I;  2OOV C;  3GZY B;  1N9E A;  4XM4 A;  3CCJ 3;  2C10 A;  1TP6 A;  1KD1 4;  2LQV A;  1A2V A;  3F40 A;  1WQL B;  3WA2 X;  3LML A;  3D3L A;  1E3R A;  4BTX A;  5AEU B;  1YIJ 3;  3JUO A;  1VQL 3;  1LXE A;  2YFI B;  1W6Y A;  2LYX A;  2O9U X;  2HMO B;  3MSO A;  3Q1C A;  4AKZ A;  2A15 A;  4KFE A;  1E3V A;  3NM2 A;  1VQO 3;  2CW9 A;  4U13 A;  3LH4 A;  2FGT A;  2B1X B;  1ROV A;  2W9P A;  1OF5 B;  2HMM B;  3NHX A;  1D6U A;  1JRQ A;  3QK9 A;  4L8O A;  1FGM A;  7STD A;  1PU4 A;  1OHP A;  3KII A;  2QA4 3;  2Z6B A;  5TGN A;  1MNL A;  3UL6 A;  3NQY A;  1EG9 B;  4XDV A;  5CF1 A;  1JV2 B;  2YFL B;  5HGR A;  2IA7 A;  1T5Y A;  1VQM 3;  2CG0 A;  3EF8 A;  3PZW A;  4EXR A;  1RJO A;  2HMJ B;  3DUK A;  1UI8 A;  3QRD A;  4Q53 A;  3OW2 2;  3LT9 A;  8CHO A;  2OQE C;  4R9K A;  3RGA A;  2BHM A;  1E97 A;  4JF8 A;  4AKY A;  1FUW A;  4R80 A;  1VZZ A;  4EV5 A;  2GU1 A;  1WNH A;  2XGL A;  1NJI 4;  3NV0 A;  3WDG B;  4X2H A;  1NB3 I;  1VQ8 3;  2D42 A;  4KVH A;  5A0O B;  1D6Z A;  1DMN A;  2OCT A;  5IEP A;  1AVK A;  3HIG A;  1N8Q A;  1FGT A;  3N8B A;  3FZW A;  3LOY A;  3EBT A;  2RFR A;  1F8N A;  4NHF A;  1QMA A;  4MMY B;  4K90 B;  3LTB A;  1IK3 A;  4FCJ A;  2BMQ B;  2QGU A;  2IMJ A;  1QAF A;  3LTD A;  3G16 A;  1Q86 4;  1N8R 4;  4O2H A;  1VQ4 3;  4GB5 A;  1OCV A;  2CHC A;  3G8Z A;  3FH1 A;  1CYV A;  1WMP A;  2C11 A;  2W0Q A;  4AEQ A;  2B24 B;  3CNM A;  3CC7 3;  1V74 A;  3MKI A;  5EEO A;  2RCD A;  2CWV A;  2I9W A;  4HM0 B;  3EJV A;  3S27 A;  5D82 A;  2W2C A;  4BTY A;  4HM5 B;  1K8A 4;  2BMR B;  3E99 A;  4KZ1 A;  3G71 3;  5AIG A;  1Q42 A;  6STD A;  4H61 A;  5FGO A;  5DRV A;  1G96 A;  3VGN A;  5IW9 A;  2QIY A;  1D6Y A;  3CCM 3;  4FMC A;  2XFS A;  2CFW A;  4L7K A;  2ZDJ A;  3MWZ A;  3CCU 3;  1M1X B;  2OTJ 3;  4H3U A;  1ZO2 A;  5IG0 A;  4XBX A;  2K0M A;  3EN8 A;  3I0Y A;  1STD A;  2GU3 A;  1ULJ B;  3CD6 3;  1EKM A;  4WHA A;  4J9A A;  2P0M A;  4G1M B;  2F98 A;  3FLJ A;  1SJW A;  2JQ5 A;  5IF6 A;  1YIT 3;  3FF0 A;  3CC4 3;  2BT3 A;  3CC2 3;  2XF3 A;  5FW5 A;  5AIF A;  3CCV 3;  4N6L A;  3EB8 A;  2OTL 3;  1HKX A;  1JNQ A;  1MOL A;  3CPW 2;  2FXT A;  4HM6 B;  3NBR A;  3DGO A;  1U8C B;  4HYZ A;  4LEH A;  4O8S A;  5LC6 A;  3SXX A;  3X3Y A;  3G4S 3;  1DVD A;  1OPY A;  1UW1 A;  2PZV A;  2XFT A;  3NXJ A;  4OUQ A;  2WGQ A;  1IVV A;  3UL5 A;  3SOY A;  5IEO A;  4HVN A;  5IEN A;  2MF7 A;  5AYS C;  1RKY A;  3MHE A;  3KZT A;  4XBY A;  1SIH A;  3CCR 3;  1W02 A;  3LYG A;  1IVW A;  1M1K 4;  2XSH B;  2W56 B;  2ML6 A;  2PNC A;  3LTA A;  3WOE B;  5AEW B;  3KN4 A;  2HMK B;  1YVB I;  4BTW A;  3MG3 A;  2CFG A;  5KP4 A;  1VQK 3;  1W5Z A;  1SQW A;  4MEI A;  3MG1 A;  2GEX A;  3KE7 A;  5KP1 A;  3OWS A;  3CMA 3;  3EE1 A;  3HX8 A;  4TX4 A;  1YJ9 3;  5ELJ A;  2P09 A;  1JJ2 2;  3CPO A;  1A67 A;  1OGZ A;  4HZB B;  1K28 A;  1EQK A;  1VQN 3;  3B8L A;  4HJL B;  4FMD A;  3NUV A;  2YX9 A;  3HK4 A;  3UJM A;  2IUK A;  3F7X A;  2WOH A;  2Y73 A;  4RNZ A;  3FG1 A;  3KSE D;  3NBB A;  2STD A;  1RRH A;  3NQZ A;  4LZI A;  1FGR A;  4WP5 A;  1Q81 4;  2CG1 A;  2WOF A;  1AV4 A;  2CWT A;  2CFK A;  2D1W A;  3N54 B;  4MMX B;  4N6V 0;  2KRT A;  4N6T A;  1IT8 A;  2R4I A;  1K9M 4;  5LC7 A;  4IT7 A;  1W4N A;  3J7Y d;  3ROB A;  3PCS A;  3KFQ C;  5IG4 A;  4WYK B;  3JUQ A;  2Z76 A;  4MJD A;  1EA2 A;  4WFO A;  3FG4 A;  3DZL A;  3DXO A;  3K9M C;  3X3Z A;  1U5O A;  3F9S A;  2BO9 B;  1A90 A;  1VQ6 3;  1IVU A;  1LNH A;  3JUP A;  1FGQ A;  1NB5 I;  3HII A;  3EC9 A;  1W01 A;  3U97 A;  3EHC A;  4N6M A;  4FR9 A;  3NM7 A;  5ELU A;  4EYC A;  1S72 3;  4HM3 B;  1GD4 A;  4FMB A;  3B7C A;  3CCE 3;  2CKF B;  2ML5 A;  1W2Z A;  5BVB A;  1KC8 4;  5JPP A;  1JKG A;  1OHS A;  3SOA A;  2W56 A;  2XR8 B;  1JB4 A;  1IQ8 A;  1N5P A;  1QAK A;  2SBL A;  1YJW 3;  1ULI B;  1FGO A;  2KXG A;  3T8N A;  3U1W A;  1CYU A;  1ISK A;  2Z7A A;  2E2V A;  2KCD A;  4HM7 B;  3G6E 3;  1GS3 A;  2L4V A;  5EQL A;  1UUV B;  1GYB A;  3I56 3;  2M7O A;  2FNQ A;  2CWU A;  2GBW B;  2RSX A;  2ZL8 A;  3S5C A;  2UX0 A;  2CFD A;  3ECF A;  3RGR A;  3UNL A;  1Q7Y 4;  3AMO B;  1UI7 A;  3FG3 A;  4R1K A;  3CME 3;  1M9G A;  1FA3 A;  3CXC 2;  1OGX A;  3BND A;  3DGL A;  3G0K A;  3B4P A;  2O3O A;  1IT7 A;  1W7C A;  3DMC A;  2HML B;  1KQS 2;  4N6O B;  3BNE A;  3Q90 A;  1IU7 A;  2OWP A;  3F7S A;  1O7P B;  3BB9 A;  4N6N B;  3UB1 A;  4OVM A;  2CH9 A;  1KWI A;  3ALA A;  4MMZ B;  3ER7 A;  3JVC A;  3K0Z A;  3LTC A;  4O3V A;  3FGY A;  4EV2 A;  3SED A;  1QVF 2;  1CQS A;  4LGQ A;  3FSD A;  1K73 4;  1Y4K A;  3K7C A;  3CCS 3;  3TDG A;  1YGE A;  1JN5 B;  4WYK A;  4ORL A;  1WTH A;  1JKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...