3NXJA

Crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D99N from Pseudomonas Testosteroni (tKSI)
rcsb
source organism Comamonas testosteroni
total genus 21
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nxjA00
1E3VA 3DXOA 1WQLB 4HM0B 3FKAA 4HM1B 4HM3B 3NV0B 3KKGA 4HKVB 2Z7AA 1W6YA 4XDWA 3EN1B 1OPYA 1JKGB 1JN5A 5HGRA 3VGNA 5FW5A 3F7XA 3CNMA 5IERA 3MG3A 3LZAA 4I4KA 3FH1A 4XBTA 2BMRB 4PEJA 3GZRA 5IG5A 3F40A 1DMMA 1K41A 3MKIA 2XSOB 1OUNA 1JB2A 5D83A 4L8PA 3H51A 7STDA 3G0KA 3B8LA 1ASKA 3NM2A 3FGYA 2I9WA 3JUPA 5AIIA 5BXQA 5KP1A 5CLKA 3M8CA 5AEUB 1CQSA 1QMAA 4H3UA 2YFIB 3STDA 3RGAA 3H3HA 1W02A 1SJWA 3SOAA 5AIFA 2GEYA 5EVHA 3KE7A 2STDA 1O7NB 1Q40B 3FF2A 4LGQA 1A2KA 3K7CA 1ULIB 1O7MB 3K0ZA 2XSHB 1NWWA 3E99A 2RCDA 2B24B 3GZBA 3EJVA 1UUWB 3D9RA 4HM4B 3KSPA 5BVBA 2OWPA 4WWUC 3LYGA 1JB5A 1OH0A 2A15A 5D82A 4LEHA 1QJGA 3I0YA 2R4IA 3A76A 5STDA 5AIGA 1TP6A 4HM5B 5IG3A 5CXOA 4FCMA 5AI1A 4L7KA 3FF0A 2GBWB 3GRDA 4HJLB 2HMNB 3MG1A 3HZPA 3DUKA 4WYKB 2W2CA 3EBYA 3HX8A 1OGXA 3Q90A 3EQQB 3OWUA 5DRVA 5CF1A 5IG0A 1JN5B 1OHPA 2HMOB 4HM6B 1OHSA 3NV0A 2CHCA 3EHCA 3DM8A 2B1XB 1C7HA 2GXFA 2QGUA 4HZ9B 1EG9B 3MYTA 1OCVA 4R9LA 4IIAA 3MSOA 3ROBA 3EC9A 5AIHA 3EX9A 3OXAA 3G8ZA 2XR8B 2CKFB 3RGRA 4STDA 3B7CA 2F99A 5JPPA 3HK4A 5G2GA 2INXA 3EBTA 4GB5A 3EN8A 3NBRA 4R9KA 3FSDA 3KZTA 3SEDA 1GY5A 3CU3A 3GWRA 2PZVA 3F8HA 5IG4A 5CK6A 2Z77A 4U13A 4ORLA 1OF5B 1O7PB 4K1UA 1DMQA 1NDOB 5AEWB 4RZMA 4XDVA 6STDA 5IF6A 5DREA 2YFJB 1AR0A 1S5AA 1E3RA 3MG2A 3F7SA 5CF2A 3S5CA 3F14A 1ULJB 2HMJB 1STDA 3NHXA 3OV4A 2JQ5A 1Q42A 4L8OA 2HMLB 3FLJA 1HKXA 5JPUA 3BB9A 4N3VA 4Q53A 2GBXB 5TGNA 3NXJA 1O7WB 2BNGA 1ZX2A 1E97A 3JUOA 4OUQA 3G16A 2HMKB 2UX0A 4XBYA 5D81A 3GZXB 8CHOA 3NUVA 4J9AA 4MJDA 3F9SA 4XM4A 4WYKA 4WP5A 3OX9A 5IENA 2HMMB 3B4OA 1GS3A 1JKGA 3OWSA 3MHEA 4HM2B 4LMIA 4J8TA 3BLZA 5IEPA 3ER7A 3JUNA 3OWYA 4K1VA 3JUQA 4FCJA 4OVMA 1VZZA 4R1KA 4X2HA 1O7GB 1U5OA 3FZWA 4HM7B 3T8NA 1JB4A 3DMCA 1UUVB 3CNXA 2IMJA 2BMOB 3B4PA 1OHOA 1Z1SA 4HM8B 4KVHA 4HZBB 1TUHA 2Z76A 1DMNA 1ZO2A 2RGQA 3ECFA 5KP3A 5IEOA 4HVNA 2BMQB 3F8XA 4XB5A 1O7HB 3JUMA 3IPTA 1NU3A 3EF8A 1W01A 3SOYA 3UNLA 4XBXA 2QIYA 2F98A 1Q40A 3UJMA 2F86B 3GZYB 2XRXB 2RFRA 2YFLB 1IDPA 3VSYA 1GY6A 5KP4A 3T8UA 1OF5A 4X2OA 1GYBA 1W00A 3WMDA 1ISKA 1BUQA 2K54A 1GY7A 2GEXA 1EA2A 1OGZA 4CDLA 3DZLA 3CPOA
chains in the Genus database with same CATH superfamily
1BRNL 2OTJ3 1KQS2 3LTDA 1E3VA 1VQ73 2CFLA 2P09A 3DXOA 1WQLB 1TJDA 2R41A 4FMBA 4HM0B 1X1UA 1YGEA 1B2MA 1IT8A 1RCLA 3FKAA 1N5HA 2E2VA 3U97A 2OQEC 4HM3B 4HM1B 1B21A 1UI7A 1LOXA 3NV0B 1M1K4 3KKGA 4HKVB 3DGMA 3ZFZA 3CCM3 1Q9EA 5JBSA 3I563 2K0MA 1CH0A 4BTXA 3V98A 1BNFA 2Z7AA 1QVF2 1W6YA 1I0VA 1HU9A 4XDWA 1WMOA 3EN1B 4FR9A 1OPYA 1UGHI 1M1XB 1JKGB 1WTHA 3D79A 4H61A 3N8BA 1JN5A 2UUGC 5HGRA 3VGNA 5FW5A 5G1KA 3HIIA 3DH2A 3F7XA 4QWTA 1SQWA 2BO9B 1IQYA 3NQZA 3CNMA 4EBGA 5IERA 5I97A 3MG3A 1RCKA 3LOYA 3DY5A 3U1WA 3LZAA 4I4KA 3FH1A 4EXRA 4XBTA 1G96A 2BMRB 3LT8A 3PXMA 3GZRA 4PEJA 5IG5A 1AV4A 1NO3A 3D3LA 1GMPA 3F40A 3EE1A 1TFKA 2AAEA 1DMMA 2OQEA 1YI23 1K41A 1BSEA 2P05A 3MKIA 2XSOB 1OUNA 1JB2A 2XFSA 5D83A 3G4S3 1KC84 3CC43 1ZS7A 4L8PA 2CC3A 1T2HA 1IV9A 1IV7A 3BU4A 3H51A 1RGKA 3CME3 1G0TA 4BL2A 3RNTA 7STDA 4RBNA 8RNTA 3G0KA 3K63A 1FGOA 3B8LA 1ASKA 2ZL8A 2GU1A 1QAFA 3JVCA 3QK9A 2C4BA 3AGOA 3NM2A 2F5WA 2FGTA 3VF1A 1Q814 1NJI4 1LRAA 2I9WA 3FGYA 3CCU3 1B2XA 1RGFA 2V1LA 3JUPA 3NBJA 5AIIA 2CG0A 3S67A 5BXQA 2W9QA 2RNTA 4LYLB 5KP1A 3CMA3 3AHWA 1UGIA 3K5TA 5CLKA 5G1LA 4K61A 1RN4A 3M8CA 4BTYA 1GOUA 5AEUB 1BNJA 1CQSA 2O9UX 1QMAA 1RNTA 4H3UA 2WO0A 3X40A 2YFIB 1W2ZA 1IVWA 1M9GA 3BNCA 3STDA 2XGNA 1BSBA 3RGAA 1WMPA 3H3HA 1W02A 5LC6A 1SJWA 1VQ53 3G713 3NX0A 3SOAA 5AIFA 5RNTA 2GEYA 3CCR3 2CFKA 2KF3A 5EVHA 1SARA 3KE7A 2CFWA 2STDA 4JRFA 2OTL3 1O7NB 5FGOA 1Q40B 3ALAA 3FF2A 4LGQA 3SYUA 1PY3A 1A2KA 1F8NA 3K7CA 4FMCA 3N54B 3WOFB 3CCE3 3WOEB 2W03A 1ULIB 2IUJA 1DVDA 1O7MB 1PYLA 3AMOB 3K0ZA 2XSHB 2WOFA 1NWWA 1RNBA 3KCHA 2RCDA 3E99A 3S27A 1YJN3 1WNHA 4HAAA 2E2TA 2B24B 1UCJA 3GZBA 4AKYA 3EJVA 1UUWB 3PCSA 3WA2X 5M19A 3D9RA 2J8XB 4ZM8A 4HM4B 1ZGXA 1AQZA 3KSPA 5BVBA 1RSNA 2OWPA 5GSPA 4WWUC 1V57A 7RNTA 3LYGA 2K3DA 1JB5A 2KCDA 2W9PA 4GHOA 1OH0A 4JF8A 1L5GB 3ZG5A 2A15A 4GL6A 5D82A 4KFFA 4BU4A 4LEHA 1X1XA 1QJGA 3I0YA 4WHAA 1AY7A 2R4IA 3A76A 2PNCA 4RNTA 5STDA 1MWRA 5ELUA 6GSPA 1UW1A 1EKMA 3UL5A 2CWVA 1QAKA 1N9EA 2P0XA 5AIGA 1TP6A 2P38A 1BNSA 3QRDA 1QVG2 3PYJA 1YVBI 1FYSA 4HM5B 1IVVA 5CXOA 5IG3A 1BNIA 4FCMA 1C54A 1MGRA 5AI1A 1B27A 2IUKA 1RGEA 3LMLA 1JZDA 4CCVA 2IYJA 4EV2A 1MWTA 4L7KA 4O2HA 3SLUA 3FF0A 4WFOA 1BNRA 1IVXA 3X3XA 1RLSA 2CK3H 2GBWB 3GRDA 1BRGA 2L1SA 1A2VA 3FG4A 3DGOA 7GSPA 1PFPA 4HJLB 4IT7A 2CIUA 2HMNB 3MG1A 3HZPA 1W7CA 3DUKA 1RKYA 4WYKB 1B3SA 1YJ93 2W2CA 2H0IA 3EBYA 3HX8A 1GD4A 4HBRA 3WHOA 1OGXA 3Q90A 1IU7A 3CCL3 3EQQB 3OWUA 5DRVA 5CF1A 2W56B 1I3FA 3KSED 5IG0A 3S28A 1K9M4 3N9HA 1JN5B 2C10A 1T5YA 4R4KA 1IQ8A 2XEPA 5EQLA 3ZG0A 1V58A 1OHPA 3LTCA 2HMOB 1KSIA 1VQN3 4HM6B 1OHSA 3NV0A 2CHCA 2IA7A 2CG1A 9RNTA 3EHCA 2GSPA 3DM8A 2O3OA 3V92A 2B1XB 1A67A 1C7HA 1LNHA 1SIIA 3TDGA 2GXFA 4KT3B 2KXGA 1IT7A 1SIHA 1Y4KA 3X42A 5AYRB 3OW22 2KRTA 1VQL3 1FGMA 1R4YA 2QGUA 2WGOA 3LT9A 1BOXA 4HZ9B 1EG9B 1RRLA 1YVSA 3MYTA 5ELJA 1OCVA 4EC6A 1M904 4R9LA 4NPBA 4MMXB 1UDII 3SXXA 4IIAA 1J2BA 3MSOA 3ROBA 3EC9A 1N8R4 1X1YA 3WDGB 5AIHA 2KF6A 3EX9A 3OXAA 2BU4A 1GOVA 1KD14 3UL6A 1CYUA 3G8ZA 1LOWA 3CXC2 2E2UA 1FUWA 1BGSA 1UUGB 3G6E3 2CFGA 2XR8B 5IW9A 1RHLA 2IY2A 3PS8A 2OOVA 1G02A 2CKFB 6RNTA 1BUJA 3RGRA 4STDA 1RJOA 3B7CA 1Q7Y4 2Z6BA 3A5EA 1YIT3 3CCS3 4O8SA 1W5ZA 3CC23 1DETA 3FG1A 2ZDJA 1BSCA 4FMAA 1I2FA 1S723 2F99A 1W6GA 3PCRA 5JPPA 1FUSA 3HK4A 3X41A 2F56A 4CJNA 1GMQA 5G2GA 2INXA 1A2PA 1TRPA 3FCSB 1I3IA 3EBTA 4LZIA 4O3VA 1CEWI 1BIRA 3EN8A 3NBRA 4GB5A 1JJ22 1LQMB 4R9KA 1VQQA 1DYUA 3FSDA 3KZTA 1EEJA 3LH4A 3SEDA 1UCLA 4KFDA 1GY5A 3CU3A 3GWRA 4EW5A 2PZVA 2Y74A 1HYFA 3F8HA 1DVCA 5IG4A 1MOLA 2XGLA 3IJEB 3HIGA 5CK6A 2Z77A 4U13A 1I0XA 4ORLA 1V74A 3X3YA 1LOYA 1YIJ3 1Q824 1BSAA 1LOVA 2UGIA 2MF7A 1OF5B 1O7PB 4AKZA 4K1UA 1DMQA 1I8VA 1W4NA 2LYXA 1FW7A 2HOHA 3DGLA 1NDOB 2SARA 3EB8A 3L0RA 3NQYA 2WOHA 3AHSA 2H0HA 4AEQA 2KAAA 5AEWB 4RZMA 4XDVA 3SX1A 1KWIA 6STDA 4EV5A 2CX0A 5AYSC 5IF6A 5DREA 2YFJB 3DGNA 1D6UA 2P0MA 3AMOA 1AR0A 1S5AA 1E3RA 2XF3A 4MEIA 2GU3A 1BRIA 1JRQA 3LTAA 3MG2A 1UCKA 2C11A 3F7SA 5CF2A 3HI7A 3S5CA 3DGYA 3F14A 2FXTA 1ULJB 2HMJB 2ML5A 1STDA 1YGWA 2FNQA 1QALA 3NHXA 2LQVA 3OV4A 1BRSA 2F4YA 1W6CA 5HOHA 4K90B 2JQ5A 1Q42A 4L8OA 2HMLB 3FLJA 1I2GA 1JV2B 1B2UA 1HKXA 1NNVA 1STFI 2AADA 4BIRA 4BTWA 1Q864 3CD63 1ROVA 5JPUA 4CPKA 4N6TA 3BB9A 4N3VA 1FGTA 2CH9A 1TIJA 4FMDA 1AVKA 4Q53A 2GBXB 5TGNA 2BIRA 1PU4A 1LXEA 1VQ83 3AGNA 2JDIH 1YHQ3 1TRQA 3PZWA 3NXJA 4MMYB 1O7WB 2BNGA 2KF4A 2L4VA 1T2IA 1ZX2A 2ZHXB 1K8A4 1E97A 4N6UA 1K28A 3SVAA 3JUOA 1BNEA 1BANA 1B20A 3D5GA 4OUQA 2CW9A 3G16A 4N6LA 1MWUA 2HMKB 3K9MC 4G1MB 2UX0A 2OOVC 3BNEA 1MWSA 2M7OA 4XBYA 5D81A 3GZXB 4N6OB 8CHOA 3NUVA 1VQ93 1LQGC 4J9AA 3Q2PA 4N6NB 1IYYA 1VQM3 4MJDA 1ROAA 1Q7HA 4NREA 3F9SA 3I553 1JBSA 3CPW2 1AVLA 4NHFA 4XM4A 1VQ63 2W0QA 4WYKA 1FZUA 4WP5A 3OX9A 2MC8A 3UB1A 5IENA 4O02B 3V99A 2HMMB 3B4OA 1W2B2 5A0OB 2CWUA 2BHMA 3KN4A 1TU5A 4GSPA 3J7Yd 1D6YA 1BRJA 1RGLA 1MNLA 1JKGA 1GS3A 2W56A 2OCTA 3IMAB 3OWSA 4I5QA 1GSPA 3MHEA 4HM2B 4LMIA 5M1AA 2H0GA 1B2ZA 4J8TA 3D5IA 1UI8A 1I2EA 3BLZA 2CX1A 5IEPA 1GD3A 3ER7A 1GMRA 3T0UA 3JUNA 3OWYA 2CWTA 4K1VA 1BNGA 1OACA 2D42A 1IK3A 1A90A 3JUQA 1EUIC 4FCJA 1MGWA 2ZA4A 1FUTA 4OVMA 1R4CA 2SBLA 1VZZA 4ILFA 3X3ZA 1JBRA 1RGGA 4J5KA 1RN7A 3BIRA 4R1KA 4X2HA 1O7GB 1U5OA 3FZWA 1IVUA 1K734 3BNDA 3PGBA 4HM7B 1N8QA 1RDSA 2D1WA 3T8NA 1VQP3 1FA3A 1JB4A 1RN1A 2F5MA 3DMCA 3Q3FA 3CCQ3 3WA3A 1UUVB 3CNXA 2IMJA 2BMOB 3CCJ3 4OK0A 1RRHA 1OHOA 3B4PA 1SPUA 3RDEA 1Z1SA 3NBBA 1FGQA 2KF5A 1N9JA 3MPHA 4HM8B 4J5GA 3GSPA 3LTBA 4KVHA 4HZBB 1BAOA 2BT3A 1I70A 1TUHA 1N5PA 3BNBA 1RGCA 2Z76A 3Q1CA 4N6MA 1DMNA 1ZO2A 4HOHA 2RSXA 2RBIA 2RGQA 1GOYA 3ECFA 1WMNA 2W04A 5IEOA 5KP3A 3WR2A 3NM7A 3F8XA 2BMQB 4HVNA 1LVNA 1RMSA 3CC73 1JNQA 2Q07A 4XB5A 1JZOA 3CCV3 1O7HB 1HZ1A 3JUMA 1VQO3 3IPTA 4R80A 1NU3A 4EYCA 3EF8A 1W01A 1B2SA 1NB3I 3SOYA 3UNLA 1EQKA 1FGRA 4XBXA 4LSOA 2QIYA 1BSDA 5BU4A 2XH9A 1VQK3 2F98A 1Q40A 2XFTA 1UCIA 1D6ZA 3UJMA 2F86B 3HOHA 1RGAA 4N6V0 3GZYB 4TX4A 2XRXB 2RFRA 4MMZB 1IQXA 4RNZA 1BU4A 2YFLB 1TFOA 1IDPA 4RNYA 1GY6A 3VSYA 1X1WA 1BRKA 3T8UA 5KP4A 3WODG 1JBTA 2QEX3 2YX9A 1OF5A 3FG3A 4KZ1A 4X2OA 1GYBA 1LNIA 1T3BA 1YNVX 1BVIA 2WGQA 4FCZA 3LXUX 4BL3A 1CYVA 3KFQC 4HYZA 1W00A 1NB5I 2ML6A 3URPA 1RTUA 1BRHA 3GAXA 2CFDA 3S29A 1YJW3 5M18A 3KIIA 3WMDA 1ISKA 1BUQA 2K54A 1GY7A 4IPBA 1RGHA 2QA43 3D4AA 4KFEA 1US1A 4DKIA 1DE3A 5LC7A 2GEXA 1EA2A 1U8CB 5EEOA 2Y73A 3O8YA 5BIRA 1OGZA 2W6JH 4CDLA 1TTOA 3DZLA 3MWZA 1VQ43 3CPOA
chains in the Genus database with same CATH topology
2OTJ3 1KQS2 3LTDA 1E3VA 1VQ73 2CFLA 2P09A 3DXOA 1WQLB 4FMBA 4HM0B 1YGEA 1IT8A 3FKAA 1N5HA 2E2VA 3U97A 2OQEC 4HM3B 4HM1B 1UI7A 1LOXA 3NV0B 1M1K4 3KKGA 4HKVB 3DGMA 3CCM3 5JBSA 3I563 2K0MA 4BTXA 3V98A 2Z7AA 1QVF2 1W6YA 1HU9A 4XDWA 1WMOA 3EN1B 4FR9A 1OPYA 1M1XB 1JKGB 1WTHA 4H61A 3N8BA 1JN5A 5HGRA 3VGNA 5FW5A 3HIIA 3F7XA 4QWTA 1SQWA 2BO9B 1IQYA 3NQZA 3CNMA 4EBGA 5IERA 5I97A 3MG3A 3U1WA 3LOYA 3DY5A 3LZAA 4I4KA 3FH1A 4EXRA 4XBTA 1G96A 2BMRB 3LT8A 3PXMA 3GZRA 4PEJA 5IG5A 1AV4A 1NO3A 3D3LA 3F40A 3EE1A 1TFKA 1DMMA 2OQEA 1YI23 1K41A 2P05A 3MKIA 2XSOB 1OUNA 1JB2A 2XFSA 5D83A 3G4S3 1KC84 3CC43 4L8PA 2CC3A 1IV9A 1IV7A 3H51A 3CME3 7STDA 4RBNA 3G0KA 3K63A 1FGOA 3B8LA 1ASKA 2ZL8A 2GU1A 1QAFA 3JVCA 3QK9A 3NM2A 2FGTA 3VF1A 1Q814 1NJI4 3FGYA 2I9WA 3CCU3 2V1LA 3JUPA 5AIIA 3NBJA 2CG0A 3S67A 5BXQA 2W9QA 5KP1A 3CMA3 3K5TA 5CLKA 4K61A 3M8CA 4BTYA 5AEUB 1CQSA 2O9UX 1QMAA 3X40A 4H3UA 2WO0A 2YFIB 1W2ZA 1IVWA 1M9GA 3BNCA 3STDA 2XGNA 3RGAA 1WMPA 3H3HA 1W02A 5LC6A 1SJWA 1VQ53 3G713 3NX0A 3SOAA 5AIFA 3CCR3 2GEYA 2CFKA 5EVHA 3KE7A 2CFWA 2STDA 4JRFA 2OTL3 1O7NB 5FGOA 1Q40B 3ALAA 3FF2A 4LGQA 1A2KA 1F8NA 3K7CA 4FMCA 3N54B 3WOFB 3CCE3 3WOEB 2W03A 1ULIB 2IUJA 1DVDA 1O7MB 3AMOB 3K0ZA 2XSHB 2WOFA 1NWWA 2RCDA 3E99A 3S27A 1YJN3 1WNHA 2E2TA 2B24B 3GZBA 4AKYA 3EJVA 1UUWB 3PCSA 3WA2X 3D9RA 4ZM8A 4HM4B 3KSPA 5BVBA 2OWPA 4WWUC 3LYGA 1JB5A 2KCDA 2W9PA 1OH0A 4JF8A 1L5GB 2A15A 4GL6A 5D82A 4KFFA 4LEHA 1QJGA 3I0YA 4WHAA 2R4IA 3A76A 2PNCA 5STDA 5ELUA 1UW1A 1EKMA 3UL5A 2CWVA 1QAKA 1N9EA 2P0XA 5AIGA 1TP6A 2P38A 3QRDA 1QVG2 3PYJA 1YVBI 4HM5B 5IG3A 1IVVA 5CXOA 4FCMA 5AI1A 2IUKA 3LMLA 4CCVA 4EV2A 4L7KA 4O2HA 3SLUA 3FF0A 4WFOA 1IVXA 3X3XA 2CK3H 2GBWB 3GRDA 1A2VA 3FG4A 3DGOA 1PFPA 4HJLB 4IT7A 2CIUA 2HMNB 3MG1A 3HZPA 1W7CA 3DUKA 1RKYA 4WYKB 1YJ93 2W2CA 3EBYA 3HX8A 1GD4A 4HBRA 1OGXA 3Q90A 1IU7A 3CCL3 3EQQB 3OWUA 5DRVA 5CF1A 2W56B 3KSED 5IG0A 3S28A 1K9M4 3N9HA 1JN5B 2C10A 1T5YA 4R4KA 1IQ8A 2XEPA 5EQLA 1OHPA 3LTCA 2HMOB 1KSIA 1VQN3 4HM6B 1OHSA 3NV0A 2CHCA 2IA7A 2CG1A 3EHCA 3DM8A 2O3OA 3V92A 2B1XB 1A67A 1C7HA 1LNHA 1SIIA 3TDGA 2GXFA 2KXGA 1IT7A 1SIHA 1Y4KA 3X42A 5AYRB 3OW22 2KRTA 1VQL3 1FGMA 2QGUA 2WGOA 3LT9A 4HZ9B 1EG9B 1RRLA 3MYTA 4EC6A 5ELJA 1OCVA 1M904 4R9LA 4MMXB 3SXXA 4IIAA 1J2BA 3MSOA 3ROBA 3EC9A 1N8R4 3WDGB 5AIHA 3EX9A 3OXAA 1KD14 3UL6A 1CYUA 3G8ZA 3CXC2 2E2UA 1FUWA 3G6E3 2CFGA 2XR8B 5IW9A 3PS8A 2OOVA 2CKFB 3RGRA 4STDA 1RJOA 3B7CA 1Q7Y4 2Z6BA 1YIT3 3CCS3 4O8SA 1W5ZA 3CC23 3FG1A 2ZDJA 4FMAA 1S723 2F99A 1W6GA 3PCRA 5JPPA 3HK4A 3X41A 5G2GA 2INXA 3FCSB 4LZIA 3EBTA 4O3VA 1CEWI 4GB5A 3EN8A 3NBRA 1JJ22 4R9KA 1DYUA 3FSDA 3KZTA 3LH4A 3SEDA 4KFDA 1GY5A 3CU3A 3GWRA 2PZVA 2Y74A 3F8HA 1DVCA 5IG4A 1MOLA 2XGLA 3IJEB 3HIGA 5CK6A 2Z77A 4U13A 4ORLA 1V74A 3X3YA 1YIJ3 1Q824 2MF7A 1OF5B 1O7PB 4AKZA 4K1UA 1DMQA 1W4NA 2LYXA 3DGLA 1NDOB 3EB8A 3L0RA 3NQYA 2WOHA 4AEQA 5AEWB 4RZMA 4XDVA 3SX1A 1KWIA 6STDA 4EV5A 5AYSC 5IF6A 5DREA 2YFJB 3DGNA 1D6UA 2P0MA 3AMOA 1AR0A 1S5AA 1E3RA 2XF3A 4MEIA 2GU3A 1JRQA 3LTAA 3MG2A 3F7SA 2C11A 5CF2A 3HI7A 3S5CA 3F14A 2FXTA 1ULJB 2HMJB 2ML5A 1STDA 2FNQA 1QALA 3NHXA 2LQVA 3OV4A 1W6CA 4K90B 2JQ5A 1Q42A 4L8OA 2HMLB 3FLJA 1JV2B 4BTWA 1HKXA 1STFI 1Q864 3CD63 1ROVA 5JPUA 4N6TA 3BB9A 4N3VA 1FGTA 2CH9A 1TIJA 4FMDA 1AVKA 4Q53A 2GBXB 5TGNA 1PU4A 1LXEA 1VQ83 2JDIH 1YHQ3 3PZWA 3NXJA 4MMYB 1O7WB 2BNGA 2L4VA 1ZX2A 1K8A4 1E97A 4N6UA 1K28A 3SVAA 3JUOA 4OUQA 2CW9A 3G16A 4N6LA 2HMKB 3K9MC 4G1MB 2UX0A 2OOVC 3BNEA 2M7OA 4XBYA 5D81A 3GZXB 4N6OB 8CHOA 3NUVA 1VQ93 4J9AA 3Q2PA 4N6NB 1VQM3 4MJDA 1ROAA 4NREA 3F9SA 3I553 3CPW2 1AVLA 4NHFA 4XM4A 1VQ63 2W0QA 4WYKA 3UB1A 4WP5A 3OX9A 2MC8A 5IENA 4O02B 3V99A 2HMMB 3B4OA 1W2B2 5A0OB 2CWUA 2BHMA 3KN4A 1TU5A 3J7Yd 1D6YA 1GS3A 1MNLA 1JKGA 2W56A 3IMAB 2OCTA 3OWSA 3MHEA 4HM2B 4LMIA 4J8TA 1UI8A 3BLZA 5IEPA 1GD3A 3ER7A 3T0UA 3JUNA 3OWYA 2CWTA 4K1VA 1OACA 2D42A 1IK3A 1A90A 3JUQA 4FCJA 4OVMA 1R4CA 2SBLA 1VZZA 3X3ZA 1RN7A 4R1KA 4X2HA 1O7GB 1U5OA 3FZWA 1IVUA 1K734 3BNDA 3PGBA 4HM7B 1N8QA 3T8NA 2D1WA 1VQP3 1FA3A 1JB4A 3DMCA 3CCQ3 3WA3A 1UUVB 3CNXA 2IMJA 2BMOB 3CCJ3 4OK0A 1RRHA 1OHOA 3B4PA 1SPUA 3RDEA 1Z1SA 3NBBA 1FGQA 1N9JA 3MPHA 4HM8B 3LTBA 4KVHA 4HZBB 2BT3A 1TUHA 1N5PA 3BNBA 2Z76A 3Q1CA 4N6MA 1DMNA 1ZO2A 2RSXA 2RGQA 3ECFA 5KP3A 1WMNA 2W04A 5IEOA 3NM7A 3F8XA 2BMQB 4HVNA 1LVNA 3CC73 1JNQA 2Q07A 4XB5A 3CCV3 1O7HB 3JUMA 1VQO3 3IPTA 4R80A 1NU3A 4EYCA 3EF8A 1W01A 1NB3I 3SOYA 3UNLA 1EQKA 1FGRA 4XBXA 4LSOA 2QIYA 2XH9A 1VQK3 2F98A 1Q40A 2XFTA 1D6ZA 3UJMA 2F86B 4N6V0 3GZYB 4TX4A 2XRXB 2RFRA 4MMZB 1IQXA 4RNZA 2YFLB 1TFOA 1IDPA 4RNYA 1GY6A 3VSYA 5KP4A 3T8UA 3WODG 2QEX3 2YX9A 1OF5A 3FG3A 4KZ1A 4X2OA 1GYBA 2WGQA 4FCZA 3LXUX 1CYVA 3KFQC 4HYZA 1W00A 1NB5I 2ML6A 3GAXA 2CFDA 3S29A 1YJW3 3KIIA 3WMDA 1ISKA 1BUQA 2K54A 1GY7A 4IPBA 2QA43 4KFEA 1US1A 5LC7A 2GEXA 1EA2A 1U8CB 5EEOA 2Y73A 3O8YA 1OGZA 2W6JH 4CDLA 3DZLA 3MWZA 1VQ43 3CPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3V A;  3DXO A;  1WQL B;  4HM0 B;  3FKA A;  4HM1 B;  4HM3 B;  3NV0 B;  3KKG A;  4HKV B;  2Z7A A;  1W6Y A;  4XDW A;  3EN1 B;  1OPY A;  1JKG B;  1JN5 A;  5HGR A;  3VGN A;  5FW5 A;  3F7X A;  3CNM A;  5IER A;  3MG3 A;  3LZA A;  4I4K A;  3FH1 A;  4XBT A;  2BMR B;  4PEJ A;  3GZR A;  5IG5 A;  3F40 A;  1DMM A;  1K41 A;  3MKI A;  2XSO B;  1OUN A;  1JB2 A;  5D83 A;  4L8P A;  3H51 A;  7STD A;  3G0K A;  3B8L A;  1ASK A;  3NM2 A;  3FGY A;  2I9W A;  3JUP A;  5AII A;  5BXQ A;  5KP1 A;  5CLK A;  3M8C A;  5AEU B;  1CQS A;  1QMA A;  4H3U A;  2YFI B;  3STD A;  3RGA A;  3H3H A;  1W02 A;  1SJW A;  3SOA A;  5AIF A;  2GEY A;  5EVH A;  3KE7 A;  2STD A;  1O7N B;  1Q40 B;  3FF2 A;  4LGQ A;  1A2K A;  3K7C A;  1ULI B;  1O7M B;  3K0Z A;  2XSH B;  1NWW A;  3E99 A;  2RCD A;  2B24 B;  3GZB A;  3EJV A;  1UUW B;  3D9R A;  4HM4 B;  3KSP A;  5BVB A;  2OWP A;  4WWU C;  3LYG A;  1JB5 A;  1OH0 A;  2A15 A;  5D82 A;  4LEH A;  1QJG A;  3I0Y A;  2R4I A;  3A76 A;  5STD A;  5AIG A;  1TP6 A;  4HM5 B;  5IG3 A;  5CXO A;  4FCM A;  5AI1 A;  4L7K A;  3FF0 A;  2GBW B;  3GRD A;  4HJL B;  2HMN B;  3MG1 A;  3HZP A;  3DUK A;  4WYK B;  2W2C A;  3EBY A;  3HX8 A;  1OGX A;  3Q90 A;  3EQQ B;  3OWU A;  5DRV A;  5CF1 A;  5IG0 A;  1JN5 B;  1OHP A;  2HMO B;  4HM6 B;  1OHS A;  3NV0 A;  2CHC A;  3EHC A;  3DM8 A;  2B1X B;  1C7H A;  2GXF A;  2QGU A;  4HZ9 B;  1EG9 B;  3MYT A;  1OCV A;  4R9L A;  4IIA A;  3MSO A;  3ROB A;  3EC9 A;  5AIH A;  3EX9 A;  3OXA A;  3G8Z A;  2XR8 B;  2CKF B;  3RGR A;  4STD A;  3B7C A;  2F99 A;  5JPP A;  3HK4 A;  5G2G A;  2INX A;  3EBT A;  4GB5 A;  3EN8 A;  3NBR A;  4R9K A;  3FSD A;  3KZT A;  3SED A;  1GY5 A;  3CU3 A;  3GWR A;  2PZV A;  3F8H A;  5IG4 A;  5CK6 A;  2Z77 A;  4U13 A;  4ORL A;  1OF5 B;  1O7P B;  4K1U A;  1DMQ A;  1NDO B;  5AEW B;  4RZM A;  4XDV A;  6STD A;  5IF6 A;  5DRE A;  2YFJ B;  1AR0 A;  1S5A A;  1E3R A;  3MG2 A;  3F7S A;  5CF2 A;  3S5C A;  3F14 A;  1ULJ B;  2HMJ B;  1STD A;  3NHX A;  3OV4 A;  2JQ5 A;  1Q42 A;  4L8O A;  2HML B;  3FLJ A;  1HKX A;  5JPU A;  3BB9 A;  4N3V A;  4Q53 A;  2GBX B;  5TGN A;  3NXJ A;  1O7W B;  2BNG A;  1ZX2 A;  1E97 A;  3JUO A;  4OUQ A;  3G16 A;  2HMK B;  2UX0 A;  4XBY A;  5D81 A;  3GZX B;  8CHO A;  3NUV A;  4J9A A;  4MJD A;  3F9S A;  4XM4 A;  4WYK A;  4WP5 A;  3OX9 A;  5IEN A;  2HMM B;  3B4O A;  1GS3 A;  1JKG A;  3OWS A;  3MHE A;  4HM2 B;  4LMI A;  4J8T A;  3BLZ A;  5IEP A;  3ER7 A;  3JUN A;  3OWY A;  4K1V A;  3JUQ A;  4FCJ A;  4OVM A;  1VZZ A;  4R1K A;  4X2H A;  1O7G B;  1U5O A;  3FZW A;  4HM7 B;  3T8N A;  1JB4 A;  3DMC A;  1UUV B;  3CNX A;  2IMJ A;  2BMO B;  3B4P A;  1OHO A;  1Z1S A;  4HM8 B;  4KVH A;  4HZB B;  1TUH A;  2Z76 A;  1DMN A;  1ZO2 A;  2RGQ A;  3ECF A;  5KP3 A;  5IEO A;  4HVN A;  2BMQ B;  3F8X A;  4XB5 A;  1O7H B;  3JUM A;  3IPT A;  1NU3 A;  3EF8 A;  1W01 A;  3SOY A;  3UNL A;  4XBX A;  2QIY A;  2F98 A;  1Q40 A;  3UJM A;  2F86 B;  3GZY B;  2XRX B;  2RFR A;  2YFL B;  1IDP A;  3VSY A;  1GY6 A;  5KP4 A;  3T8U A;  1OF5 A;  4X2O A;  1GYB A;  1W00 A;  3WMD A;  1ISK A;  1BUQ A;  2K54 A;  1GY7 A;  2GEX A;  1EA2 A;  1OGZ A;  4CDL A;  3DZL A;  3CPO A; 
#chains in the Genus database with same CATH topology
 1BRN L;  2OTJ 3;  1KQS 2;  3LTD A;  1E3V A;  1VQ7 3;  2CFL A;  2P09 A;  3DXO A;  1WQL B;  1TJD A;  2R41 A;  4FMB A;  4HM0 B;  1X1U A;  1YGE A;  1B2M A;  1IT8 A;  1RCL A;  3FKA A;  1N5H A;  2E2V A;  3U97 A;  2OQE C;  4HM3 B;  4HM1 B;  1B21 A;  1UI7 A;  1LOX A;  3NV0 B;  1M1K 4;  3KKG A;  4HKV B;  3DGM A;  3ZFZ A;  3CCM 3;  1Q9E A;  5JBS A;  3I56 3;  2K0M A;  1CH0 A;  4BTX A;  3V98 A;  1BNF A;  2Z7A A;  1QVF 2;  1W6Y A;  1I0V A;  1HU9 A;  4XDW A;  1WMO A;  3EN1 B;  4FR9 A;  1OPY A;  1UGH I;  1M1X B;  1JKG B;  1WTH A;  3D79 A;  4H61 A;  3N8B A;  1JN5 A;  2UUG C;  5HGR A;  3VGN A;  5FW5 A;  5G1K A;  3HII A;  3DH2 A;  3F7X A;  4QWT A;  1SQW A;  2BO9 B;  1IQY A;  3NQZ A;  3CNM A;  4EBG A;  5IER A;  5I97 A;  3MG3 A;  1RCK A;  3LOY A;  3DY5 A;  3U1W A;  3LZA A;  4I4K A;  3FH1 A;  4EXR A;  4XBT A;  1G96 A;  2BMR B;  3LT8 A;  3PXM A;  3GZR A;  4PEJ A;  5IG5 A;  1AV4 A;  1NO3 A;  3D3L A;  1GMP A;  3F40 A;  3EE1 A;  1TFK A;  2AAE A;  1DMM A;  2OQE A;  1YI2 3;  1K41 A;  1BSE A;  2P05 A;  3MKI A;  2XSO B;  1OUN A;  1JB2 A;  2XFS A;  5D83 A;  3G4S 3;  1KC8 4;  3CC4 3;  1ZS7 A;  4L8P A;  2CC3 A;  1T2H A;  1IV9 A;  1IV7 A;  3BU4 A;  3H51 A;  1RGK A;  3CME 3;  1G0T A;  4BL2 A;  3RNT A;  7STD A;  4RBN A;  8RNT A;  3G0K A;  3K63 A;  1FGO A;  3B8L A;  1ASK A;  2ZL8 A;  2GU1 A;  1QAF A;  3JVC A;  3QK9 A;  2C4B A;  3AGO A;  3NM2 A;  2F5W A;  2FGT A;  3VF1 A;  1Q81 4;  1NJI 4;  1LRA A;  2I9W A;  3FGY A;  3CCU 3;  1B2X A;  1RGF A;  2V1L A;  3JUP A;  3NBJ A;  5AII A;  2CG0 A;  3S67 A;  5BXQ A;  2W9Q A;  2RNT A;  4LYL B;  5KP1 A;  3CMA 3;  3AHW A;  1UGI A;  3K5T A;  5CLK A;  5G1L A;  4K61 A;  1RN4 A;  3M8C A;  4BTY A;  1GOU A;  5AEU B;  1BNJ A;  1CQS A;  2O9U X;  1QMA A;  1RNT A;  4H3U A;  2WO0 A;  3X40 A;  2YFI B;  1W2Z A;  1IVW A;  1M9G A;  3BNC A;  3STD A;  2XGN A;  1BSB A;  3RGA A;  1WMP A;  3H3H A;  1W02 A;  5LC6 A;  1SJW A;  1VQ5 3;  3G71 3;  3NX0 A;  3SOA A;  5AIF A;  5RNT A;  2GEY A;  3CCR 3;  2CFK A;  2KF3 A;  5EVH A;  1SAR A;  3KE7 A;  2CFW A;  2STD A;  4JRF A;  2OTL 3;  1O7N B;  5FGO A;  1Q40 B;  3ALA A;  3FF2 A;  4LGQ A;  3SYU A;  1PY3 A;  1A2K A;  1F8N A;  3K7C A;  4FMC A;  3N54 B;  3WOF B;  3CCE 3;  3WOE B;  2W03 A;  1ULI B;  2IUJ A;  1DVD A;  1O7M B;  1PYL A;  3AMO B;  3K0Z A;  2XSH B;  2WOF A;  1NWW A;  1RNB A;  3KCH A;  2RCD A;  3E99 A;  3S27 A;  1YJN 3;  1WNH A;  4HAA A;  2E2T A;  2B24 B;  1UCJ A;  3GZB A;  4AKY A;  3EJV A;  1UUW B;  3PCS A;  3WA2 X;  5M19 A;  3D9R A;  2J8X B;  4ZM8 A;  4HM4 B;  1ZGX A;  1AQZ A;  3KSP A;  5BVB A;  1RSN A;  2OWP A;  5GSP A;  4WWU C;  1V57 A;  7RNT A;  3LYG A;  2K3D A;  1JB5 A;  2KCD A;  2W9P A;  4GHO A;  1OH0 A;  4JF8 A;  1L5G B;  3ZG5 A;  2A15 A;  4GL6 A;  5D82 A;  4KFF A;  4BU4 A;  4LEH A;  1X1X A;  1QJG A;  3I0Y A;  4WHA A;  1AY7 A;  2R4I A;  3A76 A;  2PNC A;  4RNT A;  5STD A;  1MWR A;  5ELU A;  6GSP A;  1UW1 A;  1EKM A;  3UL5 A;  2CWV A;  1QAK A;  1N9E A;  2P0X A;  5AIG A;  1TP6 A;  2P38 A;  1BNS A;  3QRD A;  1QVG 2;  3PYJ A;  1YVB I;  1FYS A;  4HM5 B;  1IVV A;  5CXO A;  5IG3 A;  1BNI A;  4FCM A;  1C54 A;  1MGR A;  5AI1 A;  1B27 A;  2IUK A;  1RGE A;  3LML A;  1JZD A;  4CCV A;  2IYJ A;  4EV2 A;  1MWT A;  4L7K A;  4O2H A;  3SLU A;  3FF0 A;  4WFO A;  1BNR A;  1IVX A;  3X3X A;  1RLS A;  2CK3 H;  2GBW B;  3GRD A;  1BRG A;  2L1S A;  1A2V A;  3FG4 A;  3DGO A;  7GSP A;  1PFP A;  4HJL B;  4IT7 A;  2CIU A;  2HMN B;  3MG1 A;  3HZP A;  1W7C A;  3DUK A;  1RKY A;  4WYK B;  1B3S A;  1YJ9 3;  2W2C A;  2H0I A;  3EBY A;  3HX8 A;  1GD4 A;  4HBR A;  3WHO A;  1OGX A;  3Q90 A;  1IU7 A;  3CCL 3;  3EQQ B;  3OWU A;  5DRV A;  5CF1 A;  2W56 B;  1I3F A;  3KSE D;  5IG0 A;  3S28 A;  1K9M 4;  3N9H A;  1JN5 B;  2C10 A;  1T5Y A;  4R4K A;  1IQ8 A;  2XEP A;  5EQL A;  3ZG0 A;  1V58 A;  1OHP A;  3LTC A;  2HMO B;  1KSI A;  1VQN 3;  4HM6 B;  1OHS A;  3NV0 A;  2CHC A;  2IA7 A;  2CG1 A;  9RNT A;  3EHC A;  2GSP A;  3DM8 A;  2O3O A;  3V92 A;  2B1X B;  1A67 A;  1C7H A;  1LNH A;  1SII A;  3TDG A;  2GXF A;  4KT3 B;  2KXG A;  1IT7 A;  1SIH A;  1Y4K A;  3X42 A;  5AYR B;  3OW2 2;  2KRT A;  1VQL 3;  1FGM A;  1R4Y A;  2QGU A;  2WGO A;  3LT9 A;  1BOX A;  4HZ9 B;  1EG9 B;  1RRL A;  1YVS A;  3MYT A;  5ELJ A;  1OCV A;  4EC6 A;  1M90 4;  4R9L A;  4NPB A;  4MMX B;  1UDI I;  3SXX A;  4IIA A;  1J2B A;  3MSO A;  3ROB A;  3EC9 A;  1N8R 4;  1X1Y A;  3WDG B;  5AIH A;  2KF6 A;  3EX9 A;  3OXA A;  2BU4 A;  1GOV A;  1KD1 4;  3UL6 A;  1CYU A;  3G8Z A;  1LOW A;  3CXC 2;  2E2U A;  1FUW A;  1BGS A;  1UUG B;  3G6E 3;  2CFG A;  2XR8 B;  5IW9 A;  1RHL A;  2IY2 A;  3PS8 A;  2OOV A;  1G02 A;  2CKF B;  6RNT A;  1BUJ A;  3RGR A;  4STD A;  1RJO A;  3B7C A;  1Q7Y 4;  2Z6B A;  3A5E A;  1YIT 3;  3CCS 3;  4O8S A;  1W5Z A;  3CC2 3;  1DET A;  3FG1 A;  2ZDJ A;  1BSC A;  4FMA A;  1I2F A;  1S72 3;  2F99 A;  1W6G A;  3PCR A;  5JPP A;  1FUS A;  3HK4 A;  3X41 A;  2F56 A;  4CJN A;  1GMQ A;  5G2G A;  2INX A;  1A2P A;  1TRP A;  3FCS B;  1I3I A;  3EBT A;  4LZI A;  4O3V A;  1CEW I;  1BIR A;  3EN8 A;  3NBR A;  4GB5 A;  1JJ2 2;  1LQM B;  4R9K A;  1VQQ A;  1DYU A;  3FSD A;  3KZT A;  1EEJ A;  3LH4 A;  3SED A;  1UCL A;  4KFD A;  1GY5 A;  3CU3 A;  3GWR A;  4EW5 A;  2PZV A;  2Y74 A;  1HYF A;  3F8H A;  1DVC A;  5IG4 A;  1MOL A;  2XGL A;  3IJE B;  3HIG A;  5CK6 A;  2Z77 A;  4U13 A;  1I0X A;  4ORL A;  1V74 A;  3X3Y A;  1LOY A;  1YIJ 3;  1Q82 4;  1BSA A;  1LOV A;  2UGI A;  2MF7 A;  1OF5 B;  1O7P B;  4AKZ A;  4K1U A;  1DMQ A;  1I8V A;  1W4N A;  2LYX A;  1FW7 A;  2HOH A;  3DGL A;  1NDO B;  2SAR A;  3EB8 A;  3L0R A;  3NQY A;  2WOH A;  3AHS A;  2H0H A;  4AEQ A;  2KAA A;  5AEW B;  4RZM A;  4XDV A;  3SX1 A;  1KWI A;  6STD A;  4EV5 A;  2CX0 A;  5AYS C;  5IF6 A;  5DRE A;  2YFJ B;  3DGN A;  1D6U A;  2P0M A;  3AMO A;  1AR0 A;  1S5A A;  1E3R A;  2XF3 A;  4MEI A;  2GU3 A;  1BRI A;  1JRQ A;  3LTA A;  3MG2 A;  1UCK A;  2C11 A;  3F7S A;  5CF2 A;  3HI7 A;  3S5C A;  3DGY A;  3F14 A;  2FXT A;  1ULJ B;  2HMJ B;  2ML5 A;  1STD A;  1YGW A;  2FNQ A;  1QAL A;  3NHX A;  2LQV A;  3OV4 A;  1BRS A;  2F4Y A;  1W6C A;  5HOH A;  4K90 B;  2JQ5 A;  1Q42 A;  4L8O A;  2HML B;  3FLJ A;  1I2G A;  1JV2 B;  1B2U A;  1HKX A;  1NNV A;  1STF I;  2AAD A;  4BIR A;  4BTW A;  1Q86 4;  3CD6 3;  1ROV A;  5JPU A;  4CPK A;  4N6T A;  3BB9 A;  4N3V A;  1FGT A;  2CH9 A;  1TIJ A;  4FMD A;  1AVK A;  4Q53 A;  2GBX B;  5TGN A;  2BIR A;  1PU4 A;  1LXE A;  1VQ8 3;  3AGN A;  2JDI H;  1YHQ 3;  1TRQ A;  3PZW A;  3NXJ A;  4MMY B;  1O7W B;  2BNG A;  2KF4 A;  2L4V A;  1T2I A;  1ZX2 A;  2ZHX B;  1K8A 4;  1E97 A;  4N6U A;  1K28 A;  3SVA A;  3JUO A;  1BNE A;  1BAN A;  1B20 A;  3D5G A;  4OUQ A;  2CW9 A;  3G16 A;  4N6L A;  1MWU A;  2HMK B;  3K9M C;  4G1M B;  2UX0 A;  2OOV C;  3BNE A;  1MWS A;  2M7O A;  4XBY A;  5D81 A;  3GZX B;  4N6O B;  8CHO A;  3NUV A;  1VQ9 3;  1LQG C;  4J9A A;  3Q2P A;  4N6N B;  1IYY A;  1VQM 3;  4MJD A;  1ROA A;  1Q7H A;  4NRE A;  3F9S A;  3I55 3;  1JBS A;  3CPW 2;  1AVL A;  4NHF A;  4XM4 A;  1VQ6 3;  2W0Q A;  4WYK A;  1FZU A;  4WP5 A;  3OX9 A;  2MC8 A;  3UB1 A;  5IEN A;  4O02 B;  3V99 A;  2HMM B;  3B4O A;  1W2B 2;  5A0O B;  2CWU A;  2BHM A;  3KN4 A;  1TU5 A;  4GSP A;  3J7Y d;  1D6Y A;  1BRJ A;  1RGL A;  1MNL A;  1JKG A;  1GS3 A;  2W56 A;  2OCT A;  3IMA B;  3OWS A;  4I5Q A;  1GSP A;  3MHE A;  4HM2 B;  4LMI A;  5M1A A;  2H0G A;  1B2Z A;  4J8T A;  3D5I A;  1UI8 A;  1I2E A;  3BLZ A;  2CX1 A;  5IEP A;  1GD3 A;  3ER7 A;  1GMR A;  3T0U A;  3JUN A;  3OWY A;  2CWT A;  4K1V A;  1BNG A;  1OAC A;  2D42 A;  1IK3 A;  1A90 A;  3JUQ A;  1EUI C;  4FCJ A;  1MGW A;  2ZA4 A;  1FUT A;  4OVM A;  1R4C A;  2SBL A;  1VZZ A;  4ILF A;  3X3Z A;  1JBR A;  1RGG A;  4J5K A;  1RN7 A;  3BIR A;  4R1K A;  4X2H A;  1O7G B;  1U5O A;  3FZW A;  1IVU A;  1K73 4;  3BND A;  3PGB A;  4HM7 B;  1N8Q A;  1RDS A;  2D1W A;  3T8N A;  1VQP 3;  1FA3 A;  1JB4 A;  1RN1 A;  2F5M A;  3DMC A;  3Q3F A;  3CCQ 3;  3WA3 A;  1UUV B;  3CNX A;  2IMJ A;  2BMO B;  3CCJ 3;  4OK0 A;  1RRH A;  1OHO A;  3B4P A;  1SPU A;  3RDE A;  1Z1S A;  3NBB A;  1FGQ A;  2KF5 A;  1N9J A;  3MPH A;  4HM8 B;  4J5G A;  3GSP A;  3LTB A;  4KVH A;  4HZB B;  1BAO A;  2BT3 A;  1I70 A;  1TUH A;  1N5P A;  3BNB A;  1RGC A;  2Z76 A;  3Q1C A;  4N6M A;  1DMN A;  1ZO2 A;  4HOH A;  2RSX A;  2RBI A;  2RGQ A;  1GOY A;  3ECF A;  1WMN A;  2W04 A;  5IEO A;  5KP3 A;  3WR2 A;  3NM7 A;  3F8X A;  2BMQ B;  4HVN A;  1LVN A;  1RMS A;  3CC7 3;  1JNQ A;  2Q07 A;  4XB5 A;  1JZO A;  3CCV 3;  1O7H B;  1HZ1 A;  3JUM A;  1VQO 3;  3IPT A;  4R80 A;  1NU3 A;  4EYC A;  3EF8 A;  1W01 A;  1B2S A;  1NB3 I;  3SOY A;  3UNL A;  1EQK A;  1FGR A;  4XBX A;  4LSO A;  2QIY A;  1BSD A;  5BU4 A;  2XH9 A;  1VQK 3;  2F98 A;  1Q40 A;  2XFT A;  1UCI A;  1D6Z A;  3UJM A;  2F86 B;  3HOH A;  1RGA A;  4N6V 0;  3GZY B;  4TX4 A;  2XRX B;  2RFR A;  4MMZ B;  1IQX A;  4RNZ A;  1BU4 A;  2YFL B;  1TFO A;  1IDP A;  4RNY A;  1GY6 A;  3VSY A;  1X1W A;  1BRK A;  3T8U A;  5KP4 A;  3WOD G;  1JBT A;  2QEX 3;  2YX9 A;  1OF5 A;  3FG3 A;  4KZ1 A;  4X2O A;  1GYB A;  1LNI A;  1T3B A;  1YNV X;  1BVI A;  2WGQ A;  4FCZ A;  3LXU X;  4BL3 A;  1CYV A;  3KFQ C;  4HYZ A;  1W00 A;  1NB5 I;  2ML6 A;  3URP A;  1RTU A;  1BRH A;  3GAX A;  2CFD A;  3S29 A;  1YJW 3;  5M18 A;  3KII A;  3WMD A;  1ISK A;  1BUQ A;  2K54 A;  1GY7 A;  4IPB A;  1RGH A;  2QA4 3;  3D4A A;  4KFE A;  1US1 A;  4DKI A;  1DE3 A;  5LC7 A;  2GEX A;  1EA2 A;  1U8C B;  5EEO A;  2Y73 A;  3O8Y A;  5BIR A;  1OGZ A;  2W6J H;  4CDL A;  1TTO A;  3DZL A;  3MWZ A;  1VQ4 3;  3CPO A; 
#chains in the Genus database with same CATH homology
 2OTJ 3;  1KQS 2;  3LTD A;  1E3V A;  1VQ7 3;  2CFL A;  2P09 A;  3DXO A;  1WQL B;  4FMB A;  4HM0 B;  1YGE A;  1IT8 A;  3FKA A;  1N5H A;  2E2V A;  3U97 A;  2OQE C;  4HM3 B;  4HM1 B;  1UI7 A;  1LOX A;  3NV0 B;  1M1K 4;  3KKG A;  4HKV B;  3DGM A;  3CCM 3;  5JBS A;  3I56 3;  2K0M A;  4BTX A;  3V98 A;  2Z7A A;  1QVF 2;  1W6Y A;  1HU9 A;  4XDW A;  1WMO A;  3EN1 B;  4FR9 A;  1OPY A;  1M1X B;  1JKG B;  1WTH A;  4H61 A;  3N8B A;  1JN5 A;  5HGR A;  3VGN A;  5FW5 A;  3HII A;  3F7X A;  4QWT A;  1SQW A;  2BO9 B;  1IQY A;  3NQZ A;  3CNM A;  4EBG A;  5IER A;  5I97 A;  3MG3 A;  3U1W A;  3LOY A;  3DY5 A;  3LZA A;  4I4K A;  3FH1 A;  4EXR A;  4XBT A;  1G96 A;  2BMR B;  3LT8 A;  3PXM A;  3GZR A;  4PEJ A;  5IG5 A;  1AV4 A;  1NO3 A;  3D3L A;  3F40 A;  3EE1 A;  1TFK A;  1DMM A;  2OQE A;  1YI2 3;  1K41 A;  2P05 A;  3MKI A;  2XSO B;  1OUN A;  1JB2 A;  2XFS A;  5D83 A;  3G4S 3;  1KC8 4;  3CC4 3;  4L8P A;  2CC3 A;  1IV9 A;  1IV7 A;  3H51 A;  3CME 3;  7STD A;  4RBN A;  3G0K A;  3K63 A;  1FGO A;  3B8L A;  1ASK A;  2ZL8 A;  2GU1 A;  1QAF A;  3JVC A;  3QK9 A;  3NM2 A;  2FGT A;  3VF1 A;  1Q81 4;  1NJI 4;  3FGY A;  2I9W A;  3CCU 3;  2V1L A;  3JUP A;  5AII A;  3NBJ A;  2CG0 A;  3S67 A;  5BXQ A;  2W9Q A;  5KP1 A;  3CMA 3;  3K5T A;  5CLK A;  4K61 A;  3M8C A;  4BTY A;  5AEU B;  1CQS A;  2O9U X;  1QMA A;  3X40 A;  4H3U A;  2WO0 A;  2YFI B;  1W2Z A;  1IVW A;  1M9G A;  3BNC A;  3STD A;  2XGN A;  3RGA A;  1WMP A;  3H3H A;  1W02 A;  5LC6 A;  1SJW A;  1VQ5 3;  3G71 3;  3NX0 A;  3SOA A;  5AIF A;  3CCR 3;  2GEY A;  2CFK A;  5EVH A;  3KE7 A;  2CFW A;  2STD A;  4JRF A;  2OTL 3;  1O7N B;  5FGO A;  1Q40 B;  3ALA A;  3FF2 A;  4LGQ A;  1A2K A;  1F8N A;  3K7C A;  4FMC A;  3N54 B;  3WOF B;  3CCE 3;  3WOE B;  2W03 A;  1ULI B;  2IUJ A;  1DVD A;  1O7M B;  3AMO B;  3K0Z A;  2XSH B;  2WOF A;  1NWW A;  2RCD A;  3E99 A;  3S27 A;  1YJN 3;  1WNH A;  2E2T A;  2B24 B;  3GZB A;  4AKY A;  3EJV A;  1UUW B;  3PCS A;  3WA2 X;  3D9R A;  4ZM8 A;  4HM4 B;  3KSP A;  5BVB A;  2OWP A;  4WWU C;  3LYG A;  1JB5 A;  2KCD A;  2W9P A;  1OH0 A;  4JF8 A;  1L5G B;  2A15 A;  4GL6 A;  5D82 A;  4KFF A;  4LEH A;  1QJG A;  3I0Y A;  4WHA A;  2R4I A;  3A76 A;  2PNC A;  5STD A;  5ELU A;  1UW1 A;  1EKM A;  3UL5 A;  2CWV A;  1QAK A;  1N9E A;  2P0X A;  5AIG A;  1TP6 A;  2P38 A;  3QRD A;  1QVG 2;  3PYJ A;  1YVB I;  4HM5 B;  5IG3 A;  1IVV A;  5CXO A;  4FCM A;  5AI1 A;  2IUK A;  3LML A;  4CCV A;  4EV2 A;  4L7K A;  4O2H A;  3SLU A;  3FF0 A;  4WFO A;  1IVX A;  3X3X A;  2CK3 H;  2GBW B;  3GRD A;  1A2V A;  3FG4 A;  3DGO A;  1PFP A;  4HJL B;  4IT7 A;  2CIU A;  2HMN B;  3MG1 A;  3HZP A;  1W7C A;  3DUK A;  1RKY A;  4WYK B;  1YJ9 3;  2W2C A;  3EBY A;  3HX8 A;  1GD4 A;  4HBR A;  1OGX A;  3Q90 A;  1IU7 A;  3CCL 3;  3EQQ B;  3OWU A;  5DRV A;  5CF1 A;  2W56 B;  3KSE D;  5IG0 A;  3S28 A;  1K9M 4;  3N9H A;  1JN5 B;  2C10 A;  1T5Y A;  4R4K A;  1IQ8 A;  2XEP A;  5EQL A;  1OHP A;  3LTC A;  2HMO B;  1KSI A;  1VQN 3;  4HM6 B;  1OHS A;  3NV0 A;  2CHC A;  2IA7 A;  2CG1 A;  3EHC A;  3DM8 A;  2O3O A;  3V92 A;  2B1X B;  1A67 A;  1C7H A;  1LNH A;  1SII A;  3TDG A;  2GXF A;  2KXG A;  1IT7 A;  1SIH A;  1Y4K A;  3X42 A;  5AYR B;  3OW2 2;  2KRT A;  1VQL 3;  1FGM A;  2QGU A;  2WGO A;  3LT9 A;  4HZ9 B;  1EG9 B;  1RRL A;  3MYT A;  4EC6 A;  5ELJ A;  1OCV A;  1M90 4;  4R9L A;  4MMX B;  3SXX A;  4IIA A;  1J2B A;  3MSO A;  3ROB A;  3EC9 A;  1N8R 4;  3WDG B;  5AIH A;  3EX9 A;  3OXA A;  1KD1 4;  3UL6 A;  1CYU A;  3G8Z A;  3CXC 2;  2E2U A;  1FUW A;  3G6E 3;  2CFG A;  2XR8 B;  5IW9 A;  3PS8 A;  2OOV A;  2CKF B;  3RGR A;  4STD A;  1RJO A;  3B7C A;  1Q7Y 4;  2Z6B A;  1YIT 3;  3CCS 3;  4O8S A;  1W5Z A;  3CC2 3;  3FG1 A;  2ZDJ A;  4FMA A;  1S72 3;  2F99 A;  1W6G A;  3PCR A;  5JPP A;  3HK4 A;  3X41 A;  5G2G A;  2INX A;  3FCS B;  4LZI A;  3EBT A;  4O3V A;  1CEW I;  4GB5 A;  3EN8 A;  3NBR A;  1JJ2 2;  4R9K A;  1DYU A;  3FSD A;  3KZT A;  3LH4 A;  3SED A;  4KFD A;  1GY5 A;  3CU3 A;  3GWR A;  2PZV A;  2Y74 A;  3F8H A;  1DVC A;  5IG4 A;  1MOL A;  2XGL A;  3IJE B;  3HIG A;  5CK6 A;  2Z77 A;  4U13 A;  4ORL A;  1V74 A;  3X3Y A;  1YIJ 3;  1Q82 4;  2MF7 A;  1OF5 B;  1O7P B;  4AKZ A;  4K1U A;  1DMQ A;  1W4N A;  2LYX A;  3DGL A;  1NDO B;  3EB8 A;  3L0R A;  3NQY A;  2WOH A;  4AEQ A;  5AEW B;  4RZM A;  4XDV A;  3SX1 A;  1KWI A;  6STD A;  4EV5 A;  5AYS C;  5IF6 A;  5DRE A;  2YFJ B;  3DGN A;  1D6U A;  2P0M A;  3AMO A;  1AR0 A;  1S5A A;  1E3R A;  2XF3 A;  4MEI A;  2GU3 A;  1JRQ A;  3LTA A;  3MG2 A;  3F7S A;  2C11 A;  5CF2 A;  3HI7 A;  3S5C A;  3F14 A;  2FXT A;  1ULJ B;  2HMJ B;  2ML5 A;  1STD A;  2FNQ A;  1QAL A;  3NHX A;  2LQV A;  3OV4 A;  1W6C A;  4K90 B;  2JQ5 A;  1Q42 A;  4L8O A;  2HML B;  3FLJ A;  1JV2 B;  4BTW A;  1HKX A;  1STF I;  1Q86 4;  3CD6 3;  1ROV A;  5JPU A;  4N6T A;  3BB9 A;  4N3V A;  1FGT A;  2CH9 A;  1TIJ A;  4FMD A;  1AVK A;  4Q53 A;  2GBX B;  5TGN A;  1PU4 A;  1LXE A;  1VQ8 3;  2JDI H;  1YHQ 3;  3PZW A;  3NXJ A;  4MMY B;  1O7W B;  2BNG A;  2L4V A;  1ZX2 A;  1K8A 4;  1E97 A;  4N6U A;  1K28 A;  3SVA A;  3JUO A;  4OUQ A;  2CW9 A;  3G16 A;  4N6L A;  2HMK B;  3K9M C;  4G1M B;  2UX0 A;  2OOV C;  3BNE A;  2M7O A;  4XBY A;  5D81 A;  3GZX B;  4N6O B;  8CHO A;  3NUV A;  1VQ9 3;  4J9A A;  3Q2P A;  4N6N B;  1VQM 3;  4MJD A;  1ROA A;  4NRE A;  3F9S A;  3I55 3;  3CPW 2;  1AVL A;  4NHF A;  4XM4 A;  1VQ6 3;  2W0Q A;  4WYK A;  3UB1 A;  4WP5 A;  3OX9 A;  2MC8 A;  5IEN A;  4O02 B;  3V99 A;  2HMM B;  3B4O A;  1W2B 2;  5A0O B;  2CWU A;  2BHM A;  3KN4 A;  1TU5 A;  3J7Y d;  1D6Y A;  1GS3 A;  1MNL A;  1JKG A;  2W56 A;  3IMA B;  2OCT A;  3OWS A;  3MHE A;  4HM2 B;  4LMI A;  4J8T A;  1UI8 A;  3BLZ A;  5IEP A;  1GD3 A;  3ER7 A;  3T0U A;  3JUN A;  3OWY A;  2CWT A;  4K1V A;  1OAC A;  2D42 A;  1IK3 A;  1A90 A;  3JUQ A;  4FCJ A;  4OVM A;  1R4C A;  2SBL A;  1VZZ A;  3X3Z A;  1RN7 A;  4R1K A;  4X2H A;  1O7G B;  1U5O A;  3FZW A;  1IVU A;  1K73 4;  3BND A;  3PGB A;  4HM7 B;  1N8Q A;  3T8N A;  2D1W A;  1VQP 3;  1FA3 A;  1JB4 A;  3DMC A;  3CCQ 3;  3WA3 A;  1UUV B;  3CNX A;  2IMJ A;  2BMO B;  3CCJ 3;  4OK0 A;  1RRH A;  1OHO A;  3B4P A;  1SPU A;  3RDE A;  1Z1S A;  3NBB A;  1FGQ A;  1N9J A;  3MPH A;  4HM8 B;  3LTB A;  4KVH A;  4HZB B;  2BT3 A;  1TUH A;  1N5P A;  3BNB A;  2Z76 A;  3Q1C A;  4N6M A;  1DMN A;  1ZO2 A;  2RSX A;  2RGQ A;  3ECF A;  5KP3 A;  1WMN A;  2W04 A;  5IEO A;  3NM7 A;  3F8X A;  2BMQ B;  4HVN A;  1LVN A;  3CC7 3;  1JNQ A;  2Q07 A;  4XB5 A;  3CCV 3;  1O7H B;  3JUM A;  1VQO 3;  3IPT A;  4R80 A;  1NU3 A;  4EYC A;  3EF8 A;  1W01 A;  1NB3 I;  3SOY A;  3UNL A;  1EQK A;  1FGR A;  4XBX A;  4LSO A;  2QIY A;  2XH9 A;  1VQK 3;  2F98 A;  1Q40 A;  2XFT A;  1D6Z A;  3UJM A;  2F86 B;  4N6V 0;  3GZY B;  4TX4 A;  2XRX B;  2RFR A;  4MMZ B;  1IQX A;  4RNZ A;  2YFL B;  1TFO A;  1IDP A;  4RNY A;  1GY6 A;  3VSY A;  5KP4 A;  3T8U A;  3WOD G;  2QEX 3;  2YX9 A;  1OF5 A;  3FG3 A;  4KZ1 A;  4X2O A;  1GYB A;  2WGQ A;  4FCZ A;  3LXU X;  1CYV A;  3KFQ C;  4HYZ A;  1W00 A;  1NB5 I;  2ML6 A;  3GAX A;  2CFD A;  3S29 A;  1YJW 3;  3KII A;  3WMD A;  1ISK A;  1BUQ A;  2K54 A;  1GY7 A;  4IPB A;  2QA4 3;  4KFE A;  1US1 A;  5LC7 A;  2GEX A;  1EA2 A;  1U8C B;  5EEO A;  2Y73 A;  3O8Y A;  1OGZ A;  2W6J H;  4CDL A;  3DZL A;  3MWZ A;  1VQ4 3;  3CPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...