1JZDA

Dsbc-dsbdalpha complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
b'GAMADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiol:disulfide interchange protein dsbc
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzdA02
20GSA 4XHMA 4MMMA 4PUFC 2FHEA 2FCHA 3GA4A 1E2YA 4RI7A 1X9MB 4N11A 2YCDA 1SJIA 2OE0A 2CQ9A 5ECQB 1I9DA 3M8NA 2PU9C 5CRDA 1HYUA 4Z7XA 4WBRD 3CTFA 1SL0B 4PQHA 4WXTA 2L6DA 3F4RA 3GH6A 2VLVA 3N9JA 2YPMA 4D73B 3QFBC 4AF2A 4GXZA 4N0VA 1LJRA 1GRXA 4YQUA 1K0BA 2WGRA 3TOTA 4IP6A 1V58A 4JR4A 4ZIJA 4MLYA 3UARA 1ZMAA 5J9BA 4ISDA 3ZVJD 1EEMA 1SK0A 1GTUA 5HR2A 1GUHA 2IYJA 3E3EA 2XBIA 2I81A 4KA0A 2CX3A 3G7IA 2E2MA 2VD1A 5A4UA 3C1SA 4JEDA 2HXKA 3FY7A 4KB3A 1F2EA 2YWMA 2VIMA 1LBKA 2IMEA 3F3QA 3F3RA 5EY6A 1V40A 3GURA 2DSAA 1XW9A 1XBSA 3L0HA 2RIIA 1FB0A 2ALBA 2AAWA 5F8BA 4Q5RA 2N5FA 2GSTA 2O7KA 1TP9A 1PD21 4IBPA 1OE7A 4BWSA 4PX1A 2YZHA 3KMNA 5DJLA 1FAAA 5KEJA 1XVWA 5G1LA 6GSSA 3UMAA 3QCPA 4I6XA 2B7KA 4EF0A 1F9MA 3RBTA 4V1Ag 2RM5A 3IDVA 4ECCA 1XW6A 1SL2B 3J7Yk 3F6FA 4V2LA 2C4JA 3DXBA 4CDOA 4F2IA 2HT9A 3UVTA 3MSZA 1G0TA 2GLRA 3WD6A 1O81A 2P5RA 1O8WA 2B5XA 4KUNA 5DCGA 1U3IA 1XWGA 5AIVA 1Z7RA 3ERWA 2L5OA 3KH9A 5AISA 1XOAA 2L59A 3WGEA 2H1DA 4I2TA 5IMVA 4XS6A 6GSTA 2PVOC 2EIRA 1N8JA 3ZFLA 2HFDA 3DWVA 3LXZA 1PX6A 1Z9HA 4MZCA 1MTCA 4RUVA 5KN3A 3D0ZA 3FHKA 5IMFA 4BL7A 2YANA 4HUAA 4KDUA 4ZB9A 1X9SB 2H6XA 2VL3A 3PINA 5G2ZA 1PKWA 3ME8A 2GSSA 4GCIA 5D93A 5JCUA 1EGOA 2R6KA 3AY8A 4J2FA 2A2SA 2F3MA 2X8CA 1F37A 1V98A 3P90A 4V2NA 5G1KA 5GAPD 2FWHA 4EDZA 3KP9A 3HKRA 14GSA 4ID0A 1JZOA 3F4SA 4K7IA 3FKFA 4TR4A 3ZL5A 2C0DA 5H5RA 3KCMA 3BD2A 4Q5QA 2H6ZA 2F8FA 3HXSA 2EIOA 2XPDA 3US3A 1PRXA 5CRGA 4IS0A 3ZTLA 1X9WB 1SK1A 3GL3A 3ZIVA 4HQZA 4YAPA 2C0EA 1K3LA 2WULA 4EXJA 4POLA 1VF1A 3HZ8A 1T00A 2CAIA 1AC1A 4K6XA 5DQSA 3KEBA 3HZ4A 2WFCA 1ABAA 5JCWA 2LQOA 1TI3A 3GKKA 1E6BA 2FWEA 3Q19A 1FVJA 4PNFA 4BPYA 3EC3A 6GSXA 3A2XA 3CXGA 1PN9A 1CQHA 2JZSA 4RI6A 1SKSB 1HQOA 1Q4JA 3A2VA 3ZMLA 2FA4A 4GSNA 2GZYA 2BJXA 4MDCA 3BOAA 2K18A 3E0UA 4ZB8A 2QKEA 5IO2A 4KSOA 3FYGA 3IC4A 3WT1A 3KTBA 3DD3A 3S9FA 5A4VA 3M9JA 1AW9A 2PMTA 2YOIA 5GSTA 3WGDA 5ECOB 3IHQA 4KX4A 2P5QA 4WF5A 3EU4A 1HNBA 4IQ1A 2CZ2A 1THXA 2PVQA 5F06A 1UC7A 4FH8A 1DE1A 4ZL9A 3QAGA 5AIXA 1Z3EA 1NSWA 2H30A 5IM9A 5INYA 1VF3A 4AGSA 1TU7A 4ZILA 1Z5YE 2B1LA 4J57E 1GTBA 2PUKC 2IIYA 3RHCA 2HI7A 1B48A 3UL3A 2X99A 4XRDA 3E9JB 3Q74A 2IMKA 4HJMA 3GTUB 4AJ7A 2B3SA 3TRPA 2L6CA 1K0CA 3H8QA 3OR5A 4KCEA 2OBKA 3DRNA 3PH9A 5GSSA 2C1YA 2I9HA 1I5GA 1XZOA 5D9WA 3ZVJA 3GIXA 2A4VA 3L4NA 3HDCA 3GKMA 3HVXA 1NHYA 1YF1A 3TKSC 4HZ4A 16GSA 2XHFA 3TJJA 4PGTA 5ECLB 2X8GA 1XIYA 2DC5A 4MJAA 1B4PA 1B9YC 4I97A 2V2GA 2GGTA 3JCML 1N2AA 2F9SA 5COHA 1KNGA 1EGRA 2E7PA 1Z6NA 1VF4A 3M0FA 4L5LA 2V41A 3V1WA 3FEUA 3WT2A 3L78A 3O3TA 5HFKA 1PQNA 2PBJA 1Y6EA 2VL2A 3KP8A 2C0GA 4IJ3A 5F0GA 4TR0A 2QSIA 1OYJA 2LRTA 4HI7A 13GSA 2R5GA 5LCZA 2GT5A 4K9ZA 1HD2A 3VWXA 3GH9A 2BMXA 2PERA 3NZNA 3M3MA 2OKAA 4MPGA 3FR9A 4LL4B 1YKAA 2NVLA 1THOA 2H0HA 2P0GA 4ECJA 1SKWB 1R5PA 4GRFA 2IL3A 2VL9A 4K0GA 4OCFA 2DJ0A 1EP8A 5IMAA 1A8LA 4KE3A 1GH2A 3IPZA 4ZL8A 4O7HA 2M72A 2AUVA 3D21A 2GQKA 4K7OA 5ELAA 4BWQA 1ERVA 4POMA 2CX4A 3BCIA 2HSYA 3O6TA 3CRUA 1DUGA 3MNGA 1TU8A 2L57A 3G9BA 1VRSD 2KOKA 1TRUA 2DIZA 2FWGA 2GSRA 1EOHA 1FHEA 4OFMA 3C8EA 3PR8A 3GKNA 2YN1A 4BA7A 1FVKA 1VGLA 2HSHA 3HVVA 3TKSE 4GF0A 3D4MA 3TJBA 4LMVA 4XTSA 1M9BA 2PN8A 3TUEA 19GSA 3DVXA 3LORA 2YP6A 4EDYA 1YEPA 1OC3A 3FZ4A 5IMCA 2FNOA 1GWCA 2MMNA 1QUWA 3GV1A 5AGYA 5CYYA 2JACA 1A2JA 2AV4A 4AJ8A 5D9VA 4I2UA 3TRQA 3GSTA 3VI5A 2G2QA 1ST9A 2LSTA 2AJQB 3LQ7A 2WCIA 4RQRA 2GQLA 4O32A 3UEMA 2KP2A 5HR3A 3PGTA 2VCQA 3KMOA 3H79A 4ILFA 2DLXA 3GTUA 1ZGNA 3F63A 4LLRA 3A5WA 2C0FA 6GSUA 5FHIA 1BAYA 2FGXA 4HU7A 5E4WA 3IXRA 3KGKA 3R2QA 4L8EA 1WMJA 5H5QA 5LNKe 1K0DA 5ECKB 3UJ1A 1PMTA 2R4VA 2H0GA 5ID2A 4K1FA 2KHPA 2TRCP 4LL1B 4GLTA 5D8IA 2WB9A 2MBTA 1GLPA 2AYTA 2DJ3A 1M9AA 3U5RE 3J7Yb 3C7MA 2TRXA 1A0FA 1WWJA 4V1Ap 1Y25A 1TK8B 2YV9A 4DSQA 4ZBDA 4OO4A 2OBIA 3W6GA 5IOXA 4NPBA 1ZOFA 1X5DA 1PA3A 1ERTA 3FR3A 1TKDB 3P2AA 1KEBA 6GSYA 3APOA 4JU5A 3NOFA 3EMXA 4TR3A 4E8HA 5ECRB 5IIZA 3L9VA 3VLNA 2PGTA 3VFIA 2YWOA 3D22A 5DALA 6GSWA 1DBYA 4MF7A 1GTIA 2V32A 1HNCA 4I8BA 3HCZA 5HFIA 5D73A 5JWOB 4GQCA 3ZMKA 3KTLA 3QR6A 1K0NA 4ECBA 1TI1A 4TXOA 4IHUA 1K3OA 4HQSA 5GAND 1SYXA 4HOJA 2AHEA 1PGTA 3KD0A 4WKWA 4F03A 1GNWA 2O85A 1OC8A 1OKTA 1OKDA 2H73A 2HZEB 3DVWA 3O76A 1B4QA 4IVFA 2H66A 2OACA 4JR6A 3LFLA 1Z7PA 1SKRB 3UAPA 17GSA 4QL9A 3KXOA 2H1AA 1TW9A 1T8EB 3ZIJA 4TXVA 4D73A 3TJKA 3I43A 3QAVA 2REMA 3ERGA 1H75A 1SD8A 4HU9A 3UBKA 4IN0A 5HQPA 2C3TA 4HZ2A 2IFQB 4GWRA 5EPFA 3A3TA 2I3YA 1ILOA 3VPQA 3GMFA 2GQMA 2K8VA 5CRHA 4K2DA 1TRWA 4ML1A 3CTGA 1GP1A 1XOBA 3DIEA 1GLQA 4PUAA 1B9XC 1ERUA 3EURA 4KNDA 3CYNA 1T7PB 1NW2A 5IQYA 5G30A 2DMLA 3EWLA 4JE1A 3CMIA 2EIQA 2VLTA 3DKSA 4YQVA 2JSZA 2H8LA 4XS1A 3M9KA 4X43A 4MF6A 1TK0B 2JSYA 3P7XA 4IJIA 1S3AA 1A2MA 1ZYQB 3IA1A 5A4WA 1WE0A 2I1UA 4MA9A 3DGQA 4NV5A 4NHWA 2PPTA 4V2MA 2N5BA 3KJYA 4K7NA 2KLXA 2R37A 2FA8A 2PWJA 1R5AA 1M2AA 4OFNA 2H74A 5KN0A 3EINA 3MWHA 4XRAA 1GSFA 4HDEA 1GUMA 1U87A 1H4OA 1WPIA 2VCTA 4TOPA 1YQ1A 3A2WA 2YWIA 3CSIA 2O87A 1AQXA 1YDKA 2ON7A 4FYCA 4N0ZA 5CAXA 2TIRA 3TKPA 3EU3A 4WF4A 2DJ2A 1RK4A 2B6MA 4QQ7A 4ZBBA 1C72A 1A24A 2L5LA 3DYRA 4AJ6A 1MEKA 4MH3A 1FB6A 2A2RA 2V1MA 4N30A 3IRAA 5CO3A 1U3AA 5D9XA 1KTEA 5ECMB 2IMFA 5CNWA 5FWGA 1FO5A 4NXIA 2YJHA 1WOUA 4NAXA 1GSUA 1EWXA 4YQMA 2B5EA 3BJ5A 4MF5A 1GSSA 2R3XA 2FY6A 1AQWA 4KH7A 3L9SA 2IJYA 6GSVA 4EO3A 4KSMA 2RLIA 2VAFA 3LYPA 3FZ5A 4N10A 1J9BA 1FOVA 2FUG2 2M80A 11GSA 4EL1A 3APQA 3TRXA 4HS1A 3D4TA 5IMZA 1DE2A 3RDWA 3RAZA 3QDNA 2HE3A 1K0MA 1YF0A 1O8XA 2VCVA 5B6NA 4EVMA 1OE8A 2O8VB 4XIHA 3TJFA 2O89A 4K8MA 5JCGA 2OA7A 5DDLA 4MZWA 4KDXA 3DMLA 3TCOA 1EZKA 1ML6A 1UN2A 2VM1A 2MZCA 5DQYA 4JRRA 4QL7A 3SWLA 1QGVA 4OCEA 12GSA 3HYPA 5H5SA 4GSSA 1SL1B 3HJOA 3DEXA 1BJXA 1R26A 2AB6A 5A5KA 1SK2A 1W89A 2LKUA 1LU4A 5ECNB 4G10A 1YKCA 1GTAA 1S3DA 2DIYA 2F51A 4ECIA 5F07A 3I9V2 2RUEA 1QQ2A 2VD0A 1G6YA 2LJRA 3CBUA 1GL8A 1OAZA 1SU9A 4O92A 2HRNA 4PNGA 4OO5A 2IY2A 3MDKA 3TKSA 3APSA 3CSHA 1O73A 1M7TA 3TJGA 3QAWA 1T4ZA 5FT3A 1MD4A 2GTUA 4TR1B 2YJ7A 1MD3A 1JZRA 4EE0A 2KUCA 3ZFBA 3W8JA 4P3YB 3GN3A 4EKZA 4DVCA 2JZRA 1M0UA 3GSSA 3F8UA 5ECSA 4F0BA 4JBBA 4MJEA 3IAS2 1ZZYA 3VK9A 1XCCA 2F8AA 1IYIA 2VCZA 1M2BA 5EL8A 3QPMA 1QMVA 4MJBA 1OC9B 3QMXA 2FD3A 3MAKA 1JLVA 3VWUA 3GX0A 4NHZA 4PURA 3ZREA 4WETA 4WBJA 2FLSA 5B7CA 22GSA 2LS5A 2VM2A 5IPHA 5G31A 1NM3A 5C04A 4L0UA 5ECPB 4YAVA 4MABA 3UIWA 3UOMA 5J3RA 2DBCA 2IN3A 2I4AA 3LXTA 3QFAC 5DBQA 4OD7A 3NIVA 1XWAA 1T1VA 1MDKA 9GSSA 4IGJA 5J5NA 3HHVA 2WS2A 4FO5A 1F3BA 3I6AA 4EUYA 2H1BA 2H70A 4TVEA 1AUCA 5J41A 3H1NA 7GSSA 3TB2A 5D96A 4FYUA 2IMIA 2FWFA 2ZUPA 4ULXA 3IBHA 3F6DA 1T4YA 1K0OA 2JL4A 2WZ9A 4G9HA 3C71A 3VURA 1ZYEA 3IE3A 2CT6A 2DJJA 1JFUA 2D2ZA 1A2LA 1ERWA 4RQXA 1TOFA 2GVPA 2IWTA 1TDIA 2H71A 1X0RA 5IPGA 1G7OA 1K3YA 2C3NA 3ERFA 3HA9A 3ME7A 1R4WA 1YJ6A 2GZZA 4H86A 4WR5A 2VUPA 2H1GA 2NDOA 4X1UA 4POKA 1DSBA 1XVQA 3KM6A 4BVXA 2VCXA 1URMA 2QC7A 4EC0A 4G19A 2B1KA 5ABRA 5IOWA 1USBA 2VCWA 1TRSA 5B6MA 1GNEA 3HD5A 4TRXA 2NPBA 4KCAA 1BEDA 3GHAA 5JWQB 4X0XA 5LD0A 2LJKA 4L0WA 1A0RP 3LG6A 3TDGA 2H19A 2KP1A 2OE3A 5CP1A 5D9TA 1GULA 4KDYA 5GZZB 1YY7A 1SD9A 2M46A 3GYKA 2B5YA 4J56E 1O85A 4PQIA 3ED3A 4HJ2A 4K0NA 3GKXA 1JZDA 3GX8A 3L9UA 3H93A 2XC2A 2LEGA 2OADA 4MPFA 2CVBA 1TJDA 1TXXA 3IR4A 4ACSA 3ZYWA 5G5EA 2OE1A 1GSEA 3I69A 4Q5FA 2HYXA 4TR1A 2GT6A 2HLSA 4ZBAA 3VPTA 4TKYA 5IMDA 1EV9A 2N5AA 3HY2A 5DAKB 1UVZA 1QFNA 2LV3A 3FZ9A 4XS4B 3G7YA 4OFTA 1XWKA 1X5EA 4IQAA 3GUSA 1OC9A 1BQ7A 1QK8A 1GUKA 3IAM2 4PXOA 1ACVA 2NTOA 2MBSA 4OWYA 1G6WA 1PL2A 1Q98A 2P31A 2X64A 2J9HA 4F82A 4IKHA 2LUSA 3CRTA 4F9ZA 5C00A 1JLWA 4KW6A 4TN8A 3IK9A 5E59A 5JWRB 3D5JA 4I5QA 3TKRA 1PSQA 3LJRA 2HRFA 5ECIB 2CA8A 2GDRA 1V57A 3EE2A 1F6MC 1AXDA 2MMZA 2YV7A 2CVKA 2VLUA 2L4CA 1FW1A 2E2GA 1V9WA 4MZBA 4OMVA 4IW9A 3UVHA 2CV4A 1BX9A 1WP0A 1SENA 3Q6OA 1PL1A 4TW5A 2DMMA 3QOUA 3BCKA 1F3AA 2NBSA 3LGCA 2VOCA 1O7UA 4ZXGA 2C8UA 2XPEA 3QD9A 3H4KA 1TTZA 2H0IA 2ZNMA 4O5RA 1EOGA 2QGVA 4ZL7A 1GSQA 3LYKA 4BVYA 4DSRA 2GSQA 10GSA 3M1GA 2JU5A 3IV4A 4MCUA 3RPNA 4NV2A 1MDJA 1G7EA 3P8WA 1KBNA 3TOUA 3HJPA 2C80A 3IOSA 1V2AA 5KN2A 2V6OA 4IP1A 2ES7A 2R2JA 4DEJA 3WYWA 5L71A 3LEFA 5AN1A 1FG4A 3EYTA 3VI7A 2WRTA 5B8AA 1WRYA 2LTKA 2MMAA 1J08A 1GSYA 8GSSA 1R7HA 2YZUA 4GQFA 3KZQA 3LSZA 1BG5A 4DSSB 1SYRA 4CHSA 2H6YA 2XBQA 3FR6A 4LMWA 5DVBA 3EVIA 3U6VA 3D6IA 5F05A 18GSA 1ZCPA 1XWBA 1XWCA 4FIWA 3K8NA 1B8XA 3ZRDA 2C3QA 1TK5B 2DJKA 1Z6MA 2LNSA 2K9FA 4NWYA 1XFLA 1QXHA 1XPVA 1IYHA 2HNLA 3ZLPA 3EMPA 4PQ1A 2CVDA 1W4VA 3F0IA 2CAQA 1NHOA 3SBCA 2V6KA 3RHBA 2YWNA 3IK7A 2YNXA 5ECHB 1O6JA 2JZTA 1EV4A 4MH2A 4G2EA 2OJLA 5ELGA 4ZB6A 4L5OA 5HR1A 5CRWA 2GS3A 1PKZA 4WEYA 1WIKA 2IPAA 3ISOA 5ENUA 1U88A 1YZXA 1J0FA 5DAKA 2H76A 3F4TA 4XS4A 2LNTA 3FRCA 2RUFA 3FZAA 4KAEA 2H72A 1XXUA 2LJAA 2WDUA 1A8YA 2G0FA 2MYGA 1JZWA 1K0AA 3VWVA 2LRCA 5G5FA 3UBLA 3VWWA 3HVSA 3TGZA 3W8SA 1OVNA 2K6VA 2L4QA 3GNJA 5J4UA 2IMDA 3CSJA 4KGIA 2HZEA 3KIJA 4MP4A 5J9CA 5CREA 4YH2A 3F9UA 2H75A 4ML6A 1MDIA 1S3CA 4JZQA 3ZITA 3WGXA 4IELA 1AIUA 1BYEA 1ON4A 3ZZXA 1YEXA 2VO4A 1M2DA 2GZPA 4HEA2 3C1RA 3GRXA 2IFQA 5DJMA 4NMUA 1T3BA 5HFGA 1UA5A 1RQMA 3FW2A 4FYBA 3G7JA 3LWAA 2K8SA 2VL2C 2RM6A 4Q5NA 5ID2B 4MJCA 5DCHA 3FK8A 4E8EA 3BBYA 5IO0A 1ZL9A 1M99A 5KN1A 4POBA 1EEJA 1EP7A 1U6TA 1A23A 4MK3A 2H01A 1WJKA 1JHBA 1AQVA 5EVOA 4XCSA 2JADA 1RW1A 4F0CA 2J23A 2LRNA 4CW9A 1GSDA 3TKQA 1VF2A 2ON5A 1SJ6A 1X5CA 1HNAA 2HZFA 4GSTA 3HJMA 2B7JA 1TRVA 1XW5A 2DJ1A 4WR4A 2BTOT 2X8HA 5B8BA 3C73A 1PX7A 5DALB 3Q18A 3RPPA 1CQGA 4DSSA 3GFKA 5HR0A 4GTUA 2E0QA 4LA1A 1AAZA 2WJUA 2LQQA 3GL5A 2CZ3A 4TXOB 2ZCTA 2MMOA 3KH7A 2EC4A 1SJZA 3N5OA 2Z9SA
chains in the Genus database with same CATH superfamily
2HSMA 20GSA 4XHMA 4NHFA 4MMMA 4PUFC 2FHEA 2FCHA 3GA4A 1E2YA 4RI7A 1X9MB 4N11A 2YCDA 3HX8A 1SJIA 2OE0A 2CQ9A 5ECQB 1I9DA 4N6MA 3M8NA 1UCKA 2PU9C 1HYUA 5CRDA 3K0ZA 4Z7XA 1Z1SA 4WBRD 5AI1A 3CTFA 1R4CA 3J7Yd 1AV4A 2WOHA 1QMAA 3NX0A 4PQHA 1SL0B 4WXTA 2L6DA 4J5KA 3F4RA 1MWUA 3GH6A 4BL7B 2VLVA 2HMJB 3N9JA 2F86B 2BHMA 2YPMA 1JKGA 5AYRB 1RHLA 3QFBC 4D73B 4HVNA 4AF2A 4GXZA 4N0VA 1LJRA 1GRXA 4YQUA 1CEWI 4BU4A 3MWZA 1K0BA 1IDPA 2WGRA 3TOTA 4IP6A 1V58A 5KOWA 4JR4A 4ZIJA 3CME3 5BXQA 4MLYA 3UARA 1ZMAA 5J9BA 4ISDA 3ZVJD 1EEMA 1SK0A 2AADA 1D6YA 3NBBA 2CW9A 1GTUA 1E3RA 5HR2A 1DE3A 2K3DA 1FGRA 1GUHA 2IYJA 3E3EA 4EV2A 2XBIA 2I81A 2XH9A 1PFOA 4HM3B 4N6TA 4KA0A 2CX3A 1I3FA 3G7IA 1GD4A 1D6UA 3ZFZA 2E2MA 4RBNA 2VD1A 1SPUA 1I0VA 2I9WA 5A4UA 3C1SA 4JEDA 2HXKA 3FY7A 1WMNA 2QA1A 4KB3A 1F2EA 2YWMA 2VIMA 2KF4A 1LBKA 2IMEA 3F3QA 2UX0A 3PZWA 3F3RA 5EY6A 1V40A 3GURA 2DSAA 1BNRA 3N54B 1XW9A 1XBSA 3RGRA 4WWUC 3L0HA 2RIIA 1FB0A 2ALBA 5FW5A 2AAWA 5F8BA 4Q5RA 2XSHB 5EVHA 3D79A 2N5FA 2GSTA 2W2CA 2O7KA 3OX9A 2V1LA 5KP1A 1LXEA 2CWUA 4MNNA 4OK0A 1TP9A 2UGIA 3ECFA 1PD21 3VF1A 4IBPA 2KF5A 1OE7A 4BWSA 4PX1A 2YZHA 3KMNA 2W6JH 5DJLA 2CX0A 2CFKA 1FAAA 1BRHA 3GAXA 5KEJA 1XVWA 3HVNA 5G1LA 1W7CA 2SARA 6GSSA 1FGTA 3SXXA 3UMAA 3QCPA 4I6XA 4KFFA 1Q7HA 2CHCA 2B7KA 1GY6A 4EF0A 1F9MA 3RBTA 1BRKA 3CU3A 4V1Ag 4R1KA 2RM5A 2W56A 3IDVA 4ECCA 1XW6A 1SL2B 4FCJA 3J7Yk 3F6FA 1E97A 1LOYA 1BSBA 2XGLA 2CH9A 3JUPA 3IJEB 5M18A 2C4JA 3DXBA 4V2LA 4CDOA 4F2IA 2HT9A 3UVTA 3MSZA 4J5GA 1G0TA 2GLRA 5IW9A 3WD6A 3K5TA 2KCDA 1O81A 2P5RA 1O8WA 2HMNB 8RNTA 2B5XA 4KUNA 3G16A 5DCGA 1JBTA 1U3IA 1XWGA 4N6UA 5AIVA 1Z7RA 2W04A 3ERWA 2L5OA 3KH9A 1IQYA 5AISA 1FUTA 1XOAA 3LXUX 2L59A 3WGEA 2H1DA 2GXFA 1YJN3 4I2TA 1JB5A 4XM4A 5IMVA 4XS6A 6GSTA 2PVOC 2EIRA 2ZA4A 4IPBA 4J9AA 1N8JA 3ZFLA 2X4AA 2CWVA 4Q53A 2HFDA 3DWVA 3CC73 1RN1A 3LXZA 1O7MB 1PX6A 3BU4A 1SJWA 1C54A 1Z9HA 4MZCA 5IG3A 3LTCA 1MTCA 4R9KA 4RUVA 5KN3A 3ROBA 3CPOA 3D0ZA 3F40A 3FHKA 2P38A 1W6YA 5IMFA 3JUMA 4BL7A 2YANA 4HUAA 4KDUA 4ZB9A 4KFDA 1X9SB 2H6XA 2VL3A 3PINA 5G2ZA 3F7SA 1PKWA 3ME8A 2GSSA 4GCIA 4WYKB 5D93A 3QRDA 5JCUA 1EGOA 2RCDA 2R6KA 2F5WA 3AY8A 3CCE3 3AMOB 3RDEA 4N6NB 4J2FA 2A2SA 2F3MA 2X8CA 2F56A 1F37A 3A5IA 1V98A 3P90A 4V2NA 5G1KA 5GAPD 2C10A 2FWHA 3FSDA 3KP9A 4EDZA 9RNTA 3HKRA 2JDIH 14GSA 1AVLA 1JB4A 4ID0A 1JZOA 3F4SA 4K7IA 3FKFA 1NU3A 4TR4A 3ZL5A 4G1MB 1WNHA 1BRGA 2C0DA 5H5RA 3KCMA 2YFLB 3JUQA 3BD2A 4Q5QA 2H6ZA 3MPHA 4OVMA 2F8FA 2CK3H 4XDVA 1YIT3 3HXSA 2EIOA 2XPDA 3US3A 3SEDA 1PRXA 3LZAA 5CRGA 1A2KA 4IS0A 3ZTLA 1X9WB 1SK1A 1HZ1A 4MEIA 3GL3A 4HQZA 5IG4A 3BLZA 4YAPA 3ZIVA 2C0EA 2HOHA 5EEOA 1K3LA 2WULA 4EXJA 1YJW3 1B2ZA 4POLA 1VF1A 1X1WA 3HZ8A 1Q824 3NXJA 1T00A 1UI7A 3JUNA 2BNGA 4O02B 3NBJA 2CAIA 1AC1A 4K6XA 3N9HA 5ELJA 1JBSA 5DQSA 3KEBA 3HZ4A 2WFCA 2E2VA 1ABAA 5JCWA 3KE7A 3I563 2LQOA 2O9UX 3DUKA 1TI3A 3GKKA 1E6BA 4AEQA 3EJVA 2YFJB 2FGTA 3FG1A 3OW22 2CFLA 2FWEA 3CCL3 3Q19A 1FVJA 1UDII 1OUNA 3F8HA 5CK6A 4PNFA 2D1WA 4BPYA 3EC3A 3LTBA 6GSXA 3A2XA 3LT8A 3CXGA 3FCSB 1PN9A 4K90B 1CQHA 2JZSA 4RI6A 1SKSB 2K54A 1HQOA 1Q4JA 3A2VA 3ZMLA 2FA4A 4GSNA 1R4YA 3WODG 4N6V0 2WGOA 2GZYA 2ML5A 2BJXA 4MDCA 1VQM3 3BOAA 1UUVB 3DGNA 1LNHA 3SYUA 2K18A 1O7WB 4PEJA 3FF2A 3UL6A 3E0UA 4ZB8A 1W6GA 3B8LA 3DGMA 2QKEA 5IO2A 4KSOA 3FYGA 3IC4A 2ML6A 3WT1A 3KTBA 3DM8A 3DD3A 1YVSA 3S9FA 4FCMA 5A4VA 4N6LA 3M9JA 3MYDA 1TRQA 1AW9A 3PCRA 2PMTA 2YOIA 5GSTA 3WGDA 5ECOB 4HM6B 3IHQA 4KX4A 2P5QA 4WF5A 2C4BA 3EU4A 1HNBA 4WP5A 4IQ1A 2CZ2A 1THXA 2PVQA 5KP3A 5F06A 1UC7A 4FH8A 1U5OA 3KIIA 1DE1A 3EF8A 4ZL9A 2DKIA 3QAGA 1ZYNA 5AIXA 1Z3EA 2RSXA 1NSWA 2H30A 5IM9A 3UB1A 1VF3A 4AGSA 5INYA 1TU7A 1BNEA 4ZILA 1Z5YE 3CMA3 2B1LA 1S5AA 4J57E 3DY5A 1GTBA 2PUKC 2IIYA 3RHCA 2HI7A 1B48A 2OTJ3 5BVBA 3K7CA 3UL3A 2ZDJA 2X99A 7STDA 4XRDA 3E9JB 3Q74A 2IMKA 2ZHXB 1ZO2A 4HJMA 3GTUB 1BSAA 4AJ7A 3V92A 3Q3FA 2B3SA 3CD63 3TRPA 4NREA 2L6CA 1K0CA 3H8QA 3OR5A 4KCEA 2OBKA 1TFOA 3PYJA 4FMBA 3DRNA 3PH9A 5GSSA 2C1YA 4CY8A 2I9HA 1IVVA 1FYSA 3HK4A 1I5GA 5CLKA 1XZOA 1M9GA 5D9WA 1LOXA 4BVXB 3FMWA 1W01A 1D6ZA 2KF3A 3ZVJA 3GIXA 2A4VA 2QA43 1GOYA 3L4NA 3HDCA 3GKMA 3HVXA 1SQWA 1NHYA 1YF1A 3TKSC 5HOHA 16GSA 4HZ4A 2XHFA 1RTUA 1Q40B 3AMOA 3TJJA 2P0MA 2F98A 4PGTA 5ECLB 2X8GA 1RGCA 1XIYA 2DC5A 3DH2A 4MJAA 1O7PB 4HM1B 4Z2UA 4FQUA 1B4PA 1B9YC 4HSCX 4I97A 2V2GA 3SOYA 2GGTA 3JCML 1N2AA 2F9SA 5COHA 1KNGA 1BNFA 1EGRA 2E7PA 1Z6NA 3IHGA 1VF4A 3KSPA 4G0IA 3M0FA 4L5LA 2V41A 3V1WA 3FEUA 4JRFA 3WT2A 3STDA 3L78A 3O3TA 5HFKA 1W02A 1PQNA 2PBJA 1Y6EA 2VL2A 3KP8A 1BANA 1FGQA 2C0GA 4IJ3A 4N3VA 1QAFA 5F0GA 4TR0A 2QSIA 2Z6BA 5LC6A 1OYJA 2LRTA 4HI7A 13GSA 3KSED 2R5GA 2CWTA 5LCZA 2GT5A 4K9ZA 1IT7A 1Y4KA 1HD2A 1MGWA 3VWXA 1M904 5BRTA 3GH9A 2BMXA 2PERA 1V74A 3NQZA 3NZNA 3M3MA 1IU7A 2OKAA 4MPGA 2CIUA 3FR9A 1X1XA 4LL4B 3MIXA 1YKAA 1I2GA 2NVLA 1THOA 2H0HA 2P0GA 2L1SA 4ECJA 1SKWB 1R5PA 4GRFA 1YVBI 3DGLA 1OGXA 2IL3A 2VL9A 4K0GA 4N6OB 1RGKA 4OCFA 2DJ0A 1EP8A 3EN8A 5IMAA 1A8LA 3MYTA 4KE3A 1RJOA 1GH2A 3IPZA 4ZL8A 4PTSA 2RNTA 4O7HA 2M72A 2AUVA 3D21A 4K1UA 2GQKA 4K7OA 5ELAA 4BWQA 1ERVA 4POMA 4HM8B 1OF5A 2A15A 2CX4A 1U8CB 2OQEA 1JB2A 1HYFA 3KFQC 3D5GA 3BCIA 4MJDA 2HSYA 3O6TA 3CRUA 1DUGA 3KN4A 3MNGA 1TU8A 2L57A 1LQGC 1UW1A 3G9BA 2KRTA 1VRSD 2KOKA 1TRUA 3DXOA 3V98A 2DIZA 2GU3A 2HRAA 1SARA 1FUWA 2FWGA 2GSRA 4GSPA 3BB9A 1EOHA 3LTAA 1FHEA 4OFMA 3C8EA 3PR8A 3GKNA 2YN1A 1VQ43 4BA7A 1FVKA 1VGLA 2HSHA 3HVVA 1B3SA 1VQ63 4GF0A 3D4MA 3TJBA 5D82A 3TKSE 4LMVA 4XTSA 1VQ93 1NB3I 4LGQA 1M9BA 2PN8A 3TUEA 19GSA 3OWYA 3DVXA 1T5YA 4O2HA 3CCQ3 3LORA 3B4OA 2YP6A 1DYUA 1FGOA 1GOVA 4EDYA 4HYZA 1YEPA 1OC3A 3FZ4A 5IMCA 3CCU3 2FNQA 4IT7A 3NV0B 2FNOA 1GWCA 5HGRA 4FMDA 2MMNA 1QUWA 3GV1A 5AGYA 5CYYA 2JACA 1A2JA 2AV4A 1UUWB 4AJ8A 1M3JA 2Z7AA 5BIRA 5D9VA 4I2UA 3FF0A 3TRQA 3GSTA 1QVF2 3VI5A 1BNIA 2OWPA 2G2QA 1ST9A 2LSTA 3EBTA 2AJQB 3EE1A 7GSPA 2SBLA 3LQ7A 1RMSA 3ER7A 2WCIA 1QJGA 4RQRA 2GQLA 4O32A 3UEMA 2KP2A 5HR3A 3PGTA 2VCQA 3KMOA 3H79A 4ILFA 2DLXA 3GTUA 4KZ1A 1ZGNA 3F63A 1DMQA 3MG3A 4LLRA 3A5WA 2F99A 2C0FA 6GSUA 5FHIA 3G8ZA 4H3UA 1VQ53 1BAYA 3F14A 2FGXA 4HU7A 5E4WA 3IXRA 3KGKA 1K41A 3Q90A 3R2QA 2RFRA 4L8EA 1WMJA 5H5QA 1BVIA 5LNKe 1W5ZA 1K0DA 5ECKB 3UJ1A 1PMTA 2R4VA 2H0GA 5ID2A 1JJ22 4K1FA 2QA2A 1JN5B 2XSOB 2W03A 1UUGB 2KHPA 1PU4A 3GZRA 2TRCP 1KQS2 1K28A 4LL1B 1AVKA 4GLTA 4K5SA 5D8IA 2WB9A 4MH3A 2MBTA 2ZL8A 1GLPA 2AYTA 1WTHA 1K734 2DJ3A 1M9AA 2B24B 3U5RE 3J7Yb 3C7MA 2TRXA 1A0FA 1WWJA 1Q864 4V1Ap 1DETA 1Y25A 1TK8B 2YV9A 4MMYB 1ROAA 4DSQA 4ZBDA 1JNQA 4OO4A 1BRSA 2OBIA 3W6GA 5IOXA 4NPBA 1ZOFA 3A5EA 1RLSA 1X5DA 1PA3A 1ERTA 3FR3A 1BUQA 4X2OA 1TKDB 3P2AA 1KEBA 6GSYA 3APOA 4JU5A 3NOFA 5JBSA 3D4AA 3EMXA 4TR3A 2AAEA 4E8HA 4GHOA 5ECRB 3Q2PA 5IIZA 1OGZA 3L9VA 3FKAA 3VLNA 2PGTA 3NM7A 3VFIA 4HM5B 2YWOA 3CCR3 3D22A 5DALA 6GSWA 1RGEA 1DBYA 4MF7A 1GTIA 2V32A 1HNCA 3NBRA 2GBWB 3FH1A 4I8BA 3HCZA 5HFIA 5D73A 5JWOB 4GQCA 3ZMKA 3KTLA 3QR6A 1K0NA 1W6CA 5ELUA 1TUHA 1OACA 4ECBA 4HM7B 1AY7A 1TI1A 4TXOA 1N5HA 4IHUA 1K3OA 1QALA 2GEYA 3MHEA 4HQSA 3DGYA 3LW9A 5GAND 1TTOA 3ZG0A 1SYXA 1MWRA 4HOJA 2AHEA 1RDSA 1ULIB 1PGTA 3KD0A 3S29A 4WKWA 4F03A 1TFKA 3WR2A 4Z2TA 2IA7A 1GNWA 2O85A 2X49A 1OC8A 1OKTA 4EIPA 1OKDA 2H73A 3B4PA 2HZEB 3SOAA 1TRPA 3DVWA 3O76A 4IVFA 1B4QA 2H66A 2OACA 4JR6A 3LFLA 3MG2A 3E99A 3HIIA 1UCIA 3EC9A 4HKVB 1Z7PA 1SKRB 1GD3A 1GMPA 2A4HA 3CXC2 1N9JA 3UAPA 17GSA 4QL9A 3KXOA 2H1AA 1YIJ3 1TW9A 1IYYA 1T8EB 3ZIJA 1B2XA 4TXVA 2F5MA 4D73A 3TJKA 1VZZA 4HJLB 1LVNA 3I43A 1L5GB 5GSPA 3QAVA 2REMA 3ERGA 1H75A 2YX9A 1SD8A 4HU9A 3UBKA 4IN0A 5HQPA 2C3TA 4HZ2A 2IFQB 4GWRA 5EPFA 3A3TA 2I3YA 1BRIA 3IC8A 1ILOA 3VPQA 3GMFA 2GQMA 3FG3A 2K8VA 5CRHA 4K2DA 2E2TA 1TRWA 3Q1CA 4ML1A 1S723 4FMAA 3CTGA 4LEHA 2GEXA 1ASKA 1GP1A 1XOBA 3DIEA 1GLQA 4PUAA 1B9XC 1EQKA 1ERUA 3FLJA 3EURA 5KOXA 5AEWB 4KNDA 3LMLA 2IUKA 3CYNA 1VQO3 1T7PB 5M1AA 3S5CA 1NW2A 4YKFA 5IQYA 5G30A 3BNDA 5LC7A 2DMLA 1LNIA 3EWLA 4JE1A 1UGIA 2EIQA 1YHQ3 3CMIA 2VLTA 3DKSA 4YQVA 2JSZA 2H8LA 1OHSA 4XS1A 3M9KA 1DMMA 4X43A 5I97A 1Q42A 4BIRA 4MF6A 1TK0B 1M1K4 2JSYA 2HMKB 3P7XA 1GS3A 4IJIA 1S3AA 1A2MA 4BTWA 2RBIA 1ZYQB 3IA1A 5A4WA 1WE0A 2I1UA 4MA9A 3DGQA 1PFPA 4NV5A 4NHWA 4L7KA 3IMAB 2PPTA 1BIRA 4V2MA 2N5BA 1IVUA 3KJYA 4K7NA 4YKGA 2KLXA 2R37A 2FA8A 3OWUA 4BIKA 3SVAA 2PWJA 1HU9A 1GSPA 1E3VA 1R5AA 2YFIB 1M2AA 5FGOA 5BMUA 4RZMA 4GB5A 4OFNA 2QGUA 2XFTA 2H74A 1IVWA 1I2EA 3EBYA 3B7CA 1JN5A 5KN0A 3EINA 3MWHA 2A2PA 4XRAA 1GSFA 4HDEA 2CFDA 1ZX2A 5AIIA 1GUMA 1U87A 4AKZA 1H4OA 4O5QA 1WPIA 1RGLA 2HMOB 2VCTA 3EPTA 4TOPA 1YQ1A 1DMNA 1EG9B 3A2WA 1BUJA 2YWIA 1ROVA 3HI7A 3CSIA 1UCLA 3EB8A 2O87A 1AQXA 2BU4A 4XBYA 1YDKA 2ON7A 4FYCA 4N0ZA 5CAXA 2TIRA 3LYGA 3TKPA 3EU3A 4WF4A 2OOVC 2DJ2A 1RK4A 2B6MA 4QQ7A 4ZBBA 1C72A 4OUQA 1A24A 1FA3A 2WOFA 2L5LA 1ULJB 3OV4A 3DYRA 4RNZA 1BNSA 4AJ6A 5KP4A 2KF6A 1ZYPA 2C11A 4HZ9B 1B20A 3UJMA 1VQN3 1MEKA 1FB6A 2A2RA 1RKYA 4ZM8A 2V1MA 3IRAA 1MGRA 4R80A 4N30A 5CO3A 4BTYA 1U3AA 1T2HA 5D9XA 5STDA 1KTEA 5ECMB 2IMFA 5CNWA 5FWGA 1FUSA 3GZXB 1FO5A 4NXIA 3NM2A 2YJHA 1WOUA 2WO0A 3EHCA 1SIHA 3K9MC 4L8OA 4NAXA 1GSUA 3IPTA 1EWXA 4YQMA 2B5EA 3BJ5A 2GU1A 1GSSA 2R3XA 4MF5A 1HKXA 2FY6A 5IG5A 1AQWA 4KH7A 3L9SA 3X41A 1STDA 2IJYA 6GSVA 1KSIA 4EO3A 3PS8A 4KSMA 2RLIA 2VAFA 3LYPA 3FZ5A 4EXRA 1FW7A 4N10A 1J9BA 3F7XA 1FOVA 2FUG2 2M80A 4EC6A 11GSA 4EL1A 3APQA 3TRXA 2CG0A 3D4TA 4HS1A 4LMIA 1GY7A 5IMZA 1DE2A 3RDWA 3RAZA 3QDNA 3CNXA 1W2ZA 2HE3A 2LYXA 1LOVA 1K0MA 1YF0A 1O8XA 2VCVA 5B6NA 4EVMA 1OE8A 2O8VB 4XIHA 3TJFA 2O89A 4K8MA 5JCGA 3S67A 2OA7A 1JRQA 5DDLA 5DREA 5IERA 2DKHA 1LQMB 2GBXB 3CNMA 4MZWA 4KDXA 2JQ5A 3DMLA 4HBRA 2KAAA 3TCOA 1EZKA 3X3YA 1ML6A 1UN2A 2MZCA 2VM1A 4JRRA 5DQYA 4QL7A 3SWLA 1QGVA 4OCEA 4WYKA 4DKIA 12GSA 3G0KA 3HYPA 5H5SA 4GSSA 6GSPA 3WHOA 2Z77A 1SL1B 3HJOA 3DEXA 3CCS3 1BJXA 1R26A 2AB6A 5A5KA 1RN4A 1SK2A 1W89A 2LKUA 2Y74A 2D42A 1LU4A 1RNBA 5ECNB 3OWSA 2XF3A 4G10A 1YKCA 1EA2A 1O7NB 1A2VA 1GTAA 1S3DA 1RCLA 2DIYA 2F51A 4ECIA 5F07A 1EUIC 3I9V2 2OTL3 2RUEA 1QQ2A 2VD0A 1G6YA 1RGGA 2LJRA 3CBUA 4CPKA 1GL8A 1CQSA 5D83A 1OAZA 1SU9A 4O92A 1I8VA 2B1XB 2HRNA 4XBXA 4OO5A 4FCZA 4PNGA 2IY2A 3MDKA 3TKSA 3SX1A 1OHPA 3APSA 3CSHA 1O73A 1F8NA 1NDOB 3EN1B 3KZTA 1M7TA 3TJGA 3QAWA 1T4ZA 5FT3A 1MD4A 3WOEB 2GTUA 1IV9A 4TR1B 2WGQA 1MD3A 2YJ7A 4JF8A 1JZRA 4EE0A 2KUCA 2L4VA 3X40A 1AR0A 3ZFBA 4XB5A 2Q07A 3W8JA 4P3YB 3GN3A 4EKZA 1BSDA 3I0YA 4DVCA 4CJNA 2JZRA 1M0UA 2W56B 2HMMB 5CXOA 3GSSA 3F8UA 5ECSA 1OPYA 4F0BA 1KD14 4JBBA 4K5RA 4MJEA 2Z9SA 4WHAA 3LTDA 3IAS2 1ZZYA 3VK9A 2HMLB 1XCCA 2F8AA 1IYIA 2VCZA 1M2BA 5EL8A 4WFOA 5IF6A 3QPMA 1QMVA 4MJBA 2HRKA 4QWTA 1OC9B 3ALAA 3QMXA 3S28A 2FD3A 3MAKA 4HOHA 1JLVA 4K2XA 3VWUA 2Z76A 3GX0A 4NHZA 3O8YA 4PURA 4WETA 4WBJA 3ZREA 3MKIA 1T2IA 2FLSA 2M7OA 5AIHA 5B7CA 6STDA 2P0XA 22GSA 5DRVA 2LS5A 2VM2A 5IPHA 3JVCA 5G31A 4CCVA 1NM3A 5C04A 4L0UA 4U13A 5ECPB 4YAVA 4MABA 3UIWA 3UOMA 5J3RA 2DBCA 1RRLA 1M1XB 2IN3A 2I4AA 3LXTA 3FG4A 1I3IA 1BGSA 4BL2A 3I553 3X42A 1J2BA 3QFAC 5DBQA 1YGEA 2BMQB 3NIVA 4OD7A 4XDWA 2R0GA 4ORLA 1XWAA 1T1VA 2PZVA 1MDKA 9GSSA 2BO9B 4IGJA 3LOYA 2W0QA 5J5NA 1SIIA 1WMPA 2WS2A 3HHVA 4FO5A 1F3BA 3I6AA 4EUYA 3BIRA 2K0MA 2H1BA 2H70A 3AGOA 4TVEA 3M8CA 1BOXA 1AUCA 5J41A 1OHOA 3H1NA 7GSSA 1NO3A 3TB2A 5D81A 4LYLB 3WA3A 1RGHA 5D96A 4FYUA 2IMIA 1NB5I 2FWFA 2ZUPA 5JPUA 4ULXA 1W4NA 3IBHA 3F6DA 1NJI4 1T4YA 3RNTA 1K0OA 4HZBB 3AHSA 2JL4A 4STDA 1N8R4 2WZ9A 4G9HA 4KVHA 3VGNA 3C71A 3VURA 1ZGXA 4BVYB 1ZYEA 3IE3A 2CT6A 3R3EA 1US1A 2DJJA 1JFUA 3D3LA 2D2ZA 1A2LA 1ERWA 5CF2A 4RQXA 1TOFA 2GVPA 2IWTA 1G02A 1TDIA 2H71A 1X0RA 1YGWA 5IPGA 1G7OA 1K3YA 2FXTA 1JV2B 5TGNA 3G6E3 1VQL3 1N8QA 2C3NA 3ERFA 3HA9A 3ME7A 1A2PA 1R4WA 1YJ6A 3PGBA 2GZZA 2BMRB 4H86A 1LOWA 4WR5A 2VUPA 2H1GA 2NDOA 6RNTA 3D9RA 4X1UA 4J8TA 1STFI 2R41A 4POKA 2J8XB 3GWRA 4G0KA 1DSBA 1RN7A 1XVQA 3KM6A 4BVXA 2VCXA 1URMA 4HM0B 2QC7A 4EC0A 4G19A 2B1KA 5M19A 5ABRA 5IOWA 3LH4A 1USBA 1A67A 2VCWA 1TRSA 5B6MA 1CYUA 3LT9A 1GNEA 3HD5A 2STDA 3BNEA 4TRXA 1QVG2 1Q40A 2NPBA 4KCAA 2R0PA 1BEDA 3GHAA 5JWQB 4X0XA 2XEPA 5LD0A 2LJKA 2XGNA 4L0WA 1A0RP 3LG6A 3TDGA 1PYLA 2H19A 2KP1A 4G0LA 2UUGC 1TU5A 2OE3A 5CP1A 5AIGA 1I70A 5D9TA 1GULA 4KDYA 5GZZB 1YY7A 3G4S3 1SD9A 2M46A 3GYKA 2QEX3 4K61A 2B5YA 4J56E 1O85A 3PXMA 4PQIA 3CQFA 3ED3A 4HJ2A 2P05A 4K0NA 3GKXA 1JZDA 3GX8A 1YNVX 5IG0A 3L9UA 3H93A 2XC2A 2LEGA 2OADA 4MPFA 2CVBA 1B2SA 1TJDA 5AIFA 1TXXA 3IR4A 4EBGA 4ACSA 3ZYWA 5G5EA 2OE1A 1GSEA 3WOFB 3T8NA 1IV7A 3HOHA 3I69A 4TX4A 4Q5FA 2HYXA 4TR1A 2OCTA 1VQP3 3DGOA 2GT6A 2HLSA 2RGQA 4ZBAA 1GMQA 3VPTA 4TKYA 5IMDA 1EV9A 3NUVA 1K9M4 2N5AA 3HY2A 4RNTA 3U97A 1DVDA 5DAKB 1UVZA 1QFNA 2LV3A 1A90A 3FZ9A 1RNTA 4XS4B 4O8SA 3G7YA 4OFTA 3WDGB 1BAOA 1XWKA 3OXAA 1RRHA 1X5EA 4IQAA 3GUSA 1OC9A 1BQ7A 1QK8A 1KC84 5AEUB 1GUKA 1BU4A 5BU4A 3IAM2 4PXOA 1M3IA 1ACVA 4HM2B 3AHWA 2NTOA 2MBSA 4OWYA 2PNCA 1MOLA 4R9LA 1PL2A 1G6WA 1PY3A 4XBTA 1Q98A 2P31A 2X64A 2J9HA 4F82A 4IKHA 2LUSA 3CRTA 3NHXA 4F9ZA 5C00A 4O5UA 1JLWA 4KW6A 4KF9A 4TN8A 4A5PA 3EQQB 1MNLA 2XFSA 3IK9A 5E59A 5JWRB 1W00A 3X3ZA 3D5JA 4I5QA 3TKRA 1PSQA 3LJRA 2HRFA 5ECIB 1GY5A 2CA8A 2GDRA 1V57A 3EE2A 1F6MC 3AGNA 1VQ83 4H61A 1AXDA 2MMZA 2YV7A 1WQLB 2CVKA 2VLUA 2L4CA 1FW1A 2E2GA 1V9WA 4MZBA 4OMVA 4IW9A 1I0XA 3UVHA 1OH0A 1BNGA 2CV4A 1BX9A 1WP0A 1SENA 2BIRA 3Q6OA 2BMOB 3T8UA 1PL1A 4TW5A 2CG1A 3VSYA 3L0RA 2DMMA 3QOUA 3BCKA 1C7HA 1F3AA 2NBSA 1QAKA 3NV0A 3LGCA 3BNBA 2VOCA 1O7UA 2F4YA 4ZXGA 3MSOA 2C8UA 3CCM3 3X3XA 2XPEA 3QD9A 3H4KA 1TTZA 1N5PA 4KT3B 2H0IA 2ZNMA 1G96A 5EQLA 4O5RA 1EOGA 2IMJA 2QGVA 4ZL7A 1GSQA 3LYKA 3KCHA 4BVYA 3MG1A 2R0CA 4DSRA 2GSQA 10GSA 3M1GA 3S27A 2JU5A 3IV4A 4MCUA 2CFGA 3RPNA 4NV2A 5CF1A 1MDJA 1G7EA 3P8WA 1KBNA 1IVXA 3TOUA 3HJPA 2GSPA 2C80A 1XG8A 3IOSA 3UL5A 1V2AA 5KN2A 2E2UA 2V6OA 4IP1A 2ES7A 1FZUA 2R4IA 3K63A 2R2JA 4DEJA 3WYWA 1IQXA 5L71A 3LEFA 7RNTA 5AN1A 1FG4A 3EYTA 3GSPA 2IUJA 3VI7A 4RNYA 1DVCA 2WRTA 2UZ8A 4EIQA 5B8AA 1WRYA 3PPUA 3HIGA 2LTKA 1J08A 2MMAA 2BT3A 1GSYA 8GSSA 1R7HA 2YZUA 4GQFA 3KZQA 3LSZA 1MWTA 1BG5A 3N8BA 4CY6A 4DSSB 1SYRA 1BSCA 1EKMA 4CHSA 2H6YA 3CC43 2XBQA 3FR6A 3WA2X 4LMWA 2W9PA 5DVBA 2CC3A 1RCKA 3A76A 3FGYA 5RNTA 3EVIA 3F9SA 3U6VA 3D6IA 4X4JA 3U1WA 1Q7Y4 5F05A 18GSA 1ZCPA 1XWBA 1XWCA 1KWIA 4FIWA 3K8NA 1B8XA 3CCJ3 4K1VA 1OF5B 1VQ73 3ZRDA 2C3QA 1TK5B 2DJKA 1Z6MA 2XR8B 2K9FA 2LNSA 4NWYA 1XFLA 1OCVA 1QXHA 1XPVA 1IYHA 3GRDA 2HNLA 3ZLPA 3EMPA 4PQ1A 2CVDA 1GYBA 1W4VA 3F0IA 1BRNL 2CAQA 1NHOA 3SBCA 2V6KA 3RHBA 3QK9A 4L8PA 2YWNA 3IK7A 2YNXA 5ECHB 4HM4B 1O6JA 1O7HB 1K8A4 1EV4A 2JZTA 4MH2A 2CX1A 4G2EA 2OJLA 1JKGB 5ELGA 4ZB6A 4L5OA 5HR1A 5CRWA 2GS3A 1PKZA 4WEYA 3H51A 3V99A 1WIKA 4HAAA 2IPAA 3ISOA 5ENUA 1U88A 1CH0A 4EYCA 1YZXA 1B2MA 1J0FA 1UCJA 3DZLA 5DAKA 1FGMA 2CKFB 2H76A 3F4TA 1WMOA 1LRAA 4XS4A 2OOVA 3F8XA 2LNTA 1Q814 3FRCA 1YJ93 2RUFA 3FZAA 4KAEA 2H72A 1RGAA 1XXUA 2LJAA 2Y73A 3JUOA 1A8YA 2G0FA 2KXGA 2WDUA 2MYGA 4ICYA 5G2GA 1JZWA 1K0AA 3VWVA 4KFEA 4LSOA 4FMCA 2LRCA 5G5FA 2XRXB 1RSNA 3WMDA 3UBLA 3VWWA 3HVSA 3TGZA 3W8SA 5AYSC 2MC8A 1OVNA 2K6VA 2L4QA 3GNJA 5J4UA 3EX9A 2IMDA 4FR9A 3CSJA 1B2UA 4KGIA 2HZEA 1I2FA 3T0UA 3KIJA 4MP4A 5J9CA 4AKYA 5CREA 5IEOA 4YH2A 3F9UA 2H75A 4ML6A 1MDIA 1S3CA 2CFWA 4JZQA 8CHOA 3ZITA 3CCV3 3BNCA 3WGXA 3UNLA 1X1UA 4IELA 1ISKA 1AIUA 3NQYA 1BYEA 1ON4A 3ZZXA 1YEXA 1VQK3 2VO4A 1M2DA 3GZBA 2GZPA 4HEA2 3C1RA 1FOHA 4MMZB 4BTXA 1NNVA 3GRXA 2IFQA 5DJMA 4NMUA 1T3BA 1AQZA 5HFGA 1UA5A 4Z2RA 1O7GB 1IQ8A 1RQMA 5IEPA 3FW2A 4FYBA 3HZPA 3G7JA 3LWAA 3KKGA 2K8SA 2VL2C 2RM6A 4Q5NA 5ID2B 4MMXB 1NWWA 4O3VA 1Q9EA 4MJCA 4CDLA 3CC23 5DCHA 3FK8A 4EW5A 4E8EA 3BBYA 4EV5A 1S3RA 5IO0A 1ZL9A 1GOUA 2LQVA 1M99A 3G713 4POBA 5KN1A 1EEJA 1EP7A 3D5IA 1TP6A 1U6TA 5JPPA 1B21A 2P09A 2W9QA 4IIAA 1W2B2 1A23A 1CYVA 4MK3A 5A0OB 2H01A 3CPW2 1WJKA 1X1YA 1JHBA 1IK3A 1AQVA 5EVOA 4GL6A 4XCSA 2QIYA 2JADA 1RW1A 4LZIA 4F0CA 2J23A 3FZWA 2LRNA 4CW9A 1GSDA 3TKQA 2O3OA 3GZYB 1VF2A 1ZS7A 2ON5A 1SJ6A 2INXA 1N9EA 1X5CA 5IENA 1VQQA 1HNAA 1JBRA 2HZFA 1PN0A 4GSTA 3HJMA 1BNJA 1RGFA 2B7JA 1B27A 2MF7A 1TRVA 1XW5A 2DJ1A 3RGAA 1UI8A 1MWSA 1UGHI 4WR4A 2OQEC 2BTOT 2X8HA 3DMCA 3PCSA 4X2HA 5B8BA 3C73A 4USSA 1PX7A 3URPA 5DALB 3Q18A 3RPPA 1CQGA 4DSSA 3GFKA 5HR0A 4GTUA 1BRJA 2E0QA 4R4KA 4LA1A 1AAZA 4I4KA 1IT8A 3ZG5A 1BSEA 1GMRA 2WJUA 3H3HA 2LQQA 3SLUA 3GL5A 4BL3A 2CZ3A 4TXOB 1TIJA 2ZCTA 2MMOA 3KH7A 2EC4A 1SJZA 3N5OA 1YI23
chains in the Genus database with same CATH topology
2HSMA 20GSA 4XHMA 4MMMA 4PUFC 2FHEA 2FCHA 3GA4A 1E2YA 4RI7A 1X9MB 4N11A 2YCDA 1SJIA 2OE0A 2CQ9A 5ECQB 1I9DA 3M8NA 2PU9C 5CRDA 1HYUA 4Z7XA 4WBRD 3CTFA 1SL0B 4PQHA 4WXTA 2L6DA 3F4RA 3GH6A 4BL7B 2VLVA 3N9JA 2YPMA 4D73B 3QFBC 4AF2A 4GXZA 4N0VA 1LJRA 1GRXA 4YQUA 1K0BA 2WGRA 3TOTA 4IP6A 1V58A 5KOWA 4JR4A 4ZIJA 4MLYA 3UARA 1ZMAA 5J9BA 4ISDA 3ZVJD 1EEMA 1SK0A 1GTUA 5HR2A 1GUHA 2IYJA 3E3EA 2XBIA 2I81A 4KA0A 2CX3A 3G7IA 2E2MA 2VD1A 5A4UA 3C1SA 4JEDA 2HXKA 3FY7A 2QA1A 4KB3A 1F2EA 2YWMA 2VIMA 1LBKA 2IMEA 3F3QA 3F3RA 5EY6A 1V40A 3GURA 2DSAA 1XW9A 1XBSA 3L0HA 2RIIA 1FB0A 2ALBA 2AAWA 5F8BA 4Q5RA 2N5FA 2GSTA 2O7KA 4MNNA 1TP9A 1PD21 4IBPA 1OE7A 4BWSA 4PX1A 2YZHA 3KMNA 5DJLA 1FAAA 5KEJA 1XVWA 5G1LA 6GSSA 3UMAA 3QCPA 4I6XA 2B7KA 4EF0A 1F9MA 3RBTA 4V1Ag 2RM5A 3IDVA 4ECCA 1XW6A 1SL2B 3J7Yk 3F6FA 4V2LA 2C4JA 3DXBA 4CDOA 4F2IA 2HT9A 3UVTA 3MSZA 1G0TA 2GLRA 3WD6A 1O81A 2P5RA 1O8WA 2B5XA 4KUNA 5DCGA 1U3IA 1XWGA 5AIVA 1Z7RA 3ERWA 2L5OA 3KH9A 5AISA 1XOAA 2L59A 3WGEA 2H1DA 4I2TA 5IMVA 4XS6A 6GSTA 2PVOC 2EIRA 1N8JA 3ZFLA 2X4AA 2HFDA 3DWVA 3LXZA 1PX6A 1Z9HA 4MZCA 1MTCA 4RUVA 5KN3A 3D0ZA 3FHKA 5IMFA 4BL7A 2YANA 4HUAA 4KDUA 4ZB9A 1X9SB 2H6XA 2VL3A 3PINA 5G2ZA 1PKWA 3ME8A 2GSSA 4GCIA 5D93A 5JCUA 1EGOA 2R6KA 3AY8A 4J2FA 2A2SA 2F3MA 2X8CA 1F37A 3A5IA 1V98A 3P90A 4V2NA 5G1KA 5GAPD 2FWHA 4EDZA 3KP9A 3HKRA 14GSA 4ID0A 1JZOA 3F4SA 4K7IA 3FKFA 4TR4A 3ZL5A 2C0DA 5H5RA 3KCMA 3BD2A 4Q5QA 2H6ZA 2F8FA 3HXSA 2EIOA 2XPDA 3US3A 1PRXA 5CRGA 4IS0A 3ZTLA 1X9WB 1SK1A 3GL3A 3ZIVA 4HQZA 4YAPA 2C0EA 1K3LA 2WULA 4EXJA 4POLA 1VF1A 3HZ8A 1T00A 2CAIA 1AC1A 4K6XA 5DQSA 3KEBA 3HZ4A 2WFCA 1ABAA 5JCWA 2LQOA 1TI3A 3GKKA 1E6BA 2FWEA 3Q19A 1FVJA 4PNFA 4BPYA 3EC3A 6GSXA 3A2XA 3CXGA 1PN9A 1CQHA 2JZSA 4RI6A 1SKSB 1HQOA 1Q4JA 3A2VA 3ZMLA 2FA4A 4GSNA 2GZYA 2BJXA 4MDCA 3BOAA 2K18A 3E0UA 4ZB8A 2QKEA 5IO2A 4KSOA 3FYGA 3IC4A 3WT1A 3KTBA 3DD3A 3S9FA 5A4VA 3M9JA 3MYDA 1AW9A 2PMTA 2YOIA 5GSTA 3WGDA 5ECOB 3IHQA 4KX4A 2P5QA 4WF5A 3EU4A 1HNBA 4IQ1A 2CZ2A 1THXA 2PVQA 5F06A 1UC7A 4FH8A 1DE1A 4ZL9A 2DKIA 3QAGA 1ZYNA 5AIXA 1Z3EA 1NSWA 2H30A 5IM9A 5INYA 1VF3A 4AGSA 1TU7A 4ZILA 1Z5YE 2B1LA 4J57E 1GTBA 2PUKC 2IIYA 3RHCA 2HI7A 1B48A 3UL3A 2X99A 4XRDA 3E9JB 3Q74A 2IMKA 4HJMA 3GTUB 4AJ7A 2B3SA 3TRPA 2L6CA 1K0CA 3H8QA 3OR5A 4KCEA 2OBKA 3DRNA 3PH9A 5GSSA 2C1YA 4CY8A 2I9HA 1I5GA 1XZOA 5D9WA 4BVXB 3FMWA 3ZVJA 3GIXA 2A4VA 3L4NA 3HDCA 3GKMA 3HVXA 1NHYA 1YF1A 3TKSC 4HZ4A 16GSA 2XHFA 3TJJA 4PGTA 5ECLB 2X8GA 1XIYA 2DC5A 4MJAA 4Z2UA 4FQUA 1B4PA 1B9YC 4I97A 2V2GA 2GGTA 3JCML 1N2AA 2F9SA 5COHA 1KNGA 1EGRA 2E7PA 1Z6NA 3IHGA 1VF4A 4G0IA 3M0FA 4L5LA 2V41A 3V1WA 3FEUA 3WT2A 3L78A 3O3TA 5HFKA 1PQNA 2PBJA 1Y6EA 2VL2A 3KP8A 2C0GA 4IJ3A 5F0GA 4TR0A 2QSIA 1OYJA 2LRTA 4HI7A 13GSA 2R5GA 5LCZA 2GT5A 4K9ZA 1HD2A 3VWXA 5BRTA 3GH9A 2BMXA 2PERA 3NZNA 3M3MA 2OKAA 4MPGA 3FR9A 4LL4B 3MIXA 1YKAA 2NVLA 1THOA 2H0HA 2P0GA 4ECJA 1SKWB 1R5PA 4GRFA 2IL3A 2VL9A 4K0GA 4OCFA 2DJ0A 1EP8A 5IMAA 1A8LA 4KE3A 1GH2A 3IPZA 4ZL8A 4PTSA 4O7HA 2M72A 2AUVA 3D21A 2GQKA 4K7OA 5ELAA 4BWQA 1ERVA 4POMA 2CX4A 3BCIA 2HSYA 3O6TA 3CRUA 1DUGA 3MNGA 1TU8A 2L57A 3G9BA 1VRSD 2KOKA 1TRUA 2DIZA 2HRAA 2FWGA 2GSRA 1EOHA 1FHEA 4OFMA 3C8EA 3PR8A 3GKNA 2YN1A 4BA7A 1FVKA 1VGLA 2HSHA 3HVVA 3TKSE 4GF0A 3D4MA 3TJBA 4LMVA 4XTSA 1M9BA 2PN8A 3TUEA 19GSA 3DVXA 3LORA 2YP6A 4EDYA 1YEPA 1OC3A 3FZ4A 5IMCA 2FNOA 1GWCA 2MMNA 1QUWA 3GV1A 5AGYA 5CYYA 2JACA 1A2JA 2AV4A 4AJ8A 5D9VA 4I2UA 3TRQA 3GSTA 3VI5A 2G2QA 1ST9A 2LSTA 2AJQB 3LQ7A 2WCIA 4RQRA 2GQLA 4O32A 3UEMA 2KP2A 5HR3A 3PGTA 2VCQA 3KMOA 3H79A 4ILFA 2DLXA 3GTUA 1ZGNA 3F63A 4LLRA 3A5WA 2C0FA 6GSUA 5FHIA 1BAYA 2FGXA 4HU7A 5E4WA 3IXRA 3KGKA 3R2QA 4L8EA 1WMJA 5H5QA 5LNKe 1K0DA 5ECKB 3UJ1A 1PMTA 2R4VA 2H0GA 5ID2A 4K1FA 2QA2A 2KHPA 2TRCP 4LL1B 4K5SA 4GLTA 5D8IA 2WB9A 2MBTA 1GLPA 2AYTA 2DJ3A 1M9AA 3U5RE 3J7Yb 3C7MA 2TRXA 1A0FA 1WWJA 4V1Ap 1Y25A 1TK8B 2YV9A 4DSQA 4ZBDA 4OO4A 2OBIA 3W6GA 5IOXA 4NPBA 1ZOFA 1X5DA 1PA3A 1ERTA 3FR3A 1TKDB 3P2AA 1KEBA 6GSYA 3APOA 4JU5A 3NOFA 3EMXA 4TR3A 4E8HA 5ECRB 5IIZA 3L9VA 3VLNA 2PGTA 3VFIA 2YWOA 3D22A 5DALA 6GSWA 1DBYA 4MF7A 1GTIA 2V32A 1HNCA 4I8BA 3HCZA 5HFIA 5D73A 5JWOB 4GQCA 3ZMKA 3KTLA 3QR6A 1K0NA 4ECBA 1TI1A 4TXOA 4IHUA 1K3OA 4HQSA 3LW9A 5GAND 1SYXA 4HOJA 2AHEA 1PGTA 3KD0A 4WKWA 4F03A 4Z2TA 1GNWA 2O85A 2X49A 1OC8A 1OKTA 4EIPA 1OKDA 2H73A 2HZEB 3DVWA 3O76A 1B4QA 4IVFA 2H66A 2OACA 4JR6A 3LFLA 1Z7PA 1SKRB 2A4HA 3UAPA 17GSA 4QL9A 3KXOA 2H1AA 1TW9A 1T8EB 3ZIJA 4TXVA 4D73A 3TJKA 3I43A 3QAVA 2REMA 3ERGA 1H75A 1SD8A 4HU9A 3UBKA 4IN0A 5HQPA 2C3TA 4HZ2A 2IFQB 4GWRA 5EPFA 3A3TA 2I3YA 3IC8A 1ILOA 3VPQA 3GMFA 2GQMA 2K8VA 5CRHA 4K2DA 1TRWA 4ML1A 3CTGA 1GP1A 1XOBA 3DIEA 1GLQA 4PUAA 1B9XC 1ERUA 3EURA 5KOXA 4KNDA 3CYNA 1T7PB 1NW2A 4YKFA 5IQYA 5G30A 2DMLA 3EWLA 4JE1A 3CMIA 2EIQA 2VLTA 3DKSA 4YQVA 2JSZA 2H8LA 4XS1A 3M9KA 4X43A 4MF6A 1TK0B 2JSYA 3P7XA 4IJIA 1S3AA 1A2MA 1ZYQB 3IA1A 5A4WA 1WE0A 2I1UA 4MA9A 3DGQA 4NV5A 4NHWA 2PPTA 4V2MA 2N5BA 3KJYA 4K7NA 4YKGA 2KLXA 2R37A 2FA8A 2PWJA 1R5AA 1M2AA 5BMUA 4OFNA 2H74A 5KN0A 3EINA 3MWHA 2A2PA 4XRAA 1GSFA 4HDEA 1GUMA 1U87A 1H4OA 4O5QA 1WPIA 2VCTA 3EPTA 4TOPA 1YQ1A 3A2WA 2YWIA 3CSIA 2O87A 1AQXA 1YDKA 2ON7A 4FYCA 4N0ZA 5CAXA 2TIRA 3TKPA 3EU3A 4WF4A 2DJ2A 1RK4A 2B6MA 4QQ7A 4ZBBA 1C72A 1A24A 2L5LA 3DYRA 4AJ6A 1ZYPA 1MEKA 4MH3A 1FB6A 2A2RA 2V1MA 4N30A 3IRAA 5CO3A 1U3AA 5D9XA 1KTEA 5ECMB 2IMFA 5CNWA 5FWGA 1FO5A 4NXIA 2YJHA 1WOUA 4NAXA 1GSUA 1EWXA 4YQMA 2B5EA 3BJ5A 4MF5A 1GSSA 2R3XA 2FY6A 1AQWA 4KH7A 3L9SA 2IJYA 6GSVA 4EO3A 4KSMA 2RLIA 2VAFA 3LYPA 3FZ5A 4N10A 1J9BA 1FOVA 2FUG2 2M80A 11GSA 4EL1A 3APQA 3TRXA 4HS1A 3D4TA 5IMZA 1DE2A 3RDWA 3RAZA 3QDNA 2HE3A 1K0MA 1YF0A 1O8XA 2VCVA 5B6NA 4EVMA 1OE8A 2O8VB 4XIHA 3TJFA 2O89A 4K8MA 5JCGA 2OA7A 5DDLA 2DKHA 4MZWA 4KDXA 3DMLA 3TCOA 1EZKA 1ML6A 1UN2A 2VM1A 2MZCA 5DQYA 4JRRA 4QL7A 3SWLA 1QGVA 4OCEA 12GSA 3HYPA 5H5SA 4GSSA 1SL1B 3HJOA 3DEXA 1BJXA 1R26A 2AB6A 5A5KA 1SK2A 1W89A 2LKUA 1LU4A 5ECNB 4G10A 1YKCA 1GTAA 1S3DA 2DIYA 2F51A 4ECIA 5F07A 3I9V2 2RUEA 1QQ2A 2VD0A 1G6YA 2LJRA 3CBUA 1GL8A 1OAZA 1SU9A 4O92A 2HRNA 4PNGA 4OO5A 2IY2A 3MDKA 3TKSA 3APSA 3CSHA 1O73A 1M7TA 3TJGA 3QAWA 1T4ZA 5FT3A 1MD4A 2GTUA 4TR1B 2YJ7A 1MD3A 1JZRA 4EE0A 2KUCA 3ZFBA 3W8JA 4P3YB 3GN3A 4EKZA 4DVCA 2JZRA 1M0UA 3GSSA 3F8UA 5ECSA 4F0BA 4JBBA 4K5RA 4MJEA 3IAS2 1ZZYA 3VK9A 1XCCA 2F8AA 1IYIA 2VCZA 1M2BA 5EL8A 3QPMA 1QMVA 4MJBA 2HRKA 1OC9B 3QMXA 2FD3A 3MAKA 1JLVA 4K2XA 3VWUA 3GX0A 4NHZA 4PURA 3ZREA 4WETA 4WBJA 2FLSA 5B7CA 22GSA 2LS5A 2VM2A 5IPHA 5G31A 1NM3A 5C04A 4L0UA 5ECPB 4YAVA 4MABA 3UIWA 3UOMA 5J3RA 2DBCA 2IN3A 2I4AA 3LXTA 3QFAC 5DBQA 4OD7A 3NIVA 2R0GA 1XWAA 1T1VA 1MDKA 9GSSA 4IGJA 5J5NA 3HHVA 2WS2A 4FO5A 1F3BA 3I6AA 4EUYA 2H1BA 2H70A 4TVEA 1AUCA 5J41A 3H1NA 7GSSA 3TB2A 5D96A 4FYUA 2IMIA 2FWFA 2ZUPA 4ULXA 3IBHA 3F6DA 1T4YA 1K0OA 2JL4A 2WZ9A 4G9HA 3C71A 3VURA 4BVYB 1ZYEA 3IE3A 2CT6A 3R3EA 2DJJA 1JFUA 2D2ZA 1A2LA 1ERWA 4RQXA 1TOFA 2GVPA 2IWTA 1TDIA 2H71A 1X0RA 5IPGA 1G7OA 1K3YA 2C3NA 3ERFA 3HA9A 3ME7A 1R4WA 1YJ6A 2GZZA 4H86A 4WR5A 2VUPA 2H1GA 2NDOA 4X1UA 4POKA 4G0KA 1DSBA 1XVQA 3KM6A 4BVXA 2VCXA 1URMA 2QC7A 4EC0A 4G19A 2B1KA 5ABRA 5IOWA 1USBA 2VCWA 1TRSA 5B6MA 1GNEA 3HD5A 4TRXA 2NPBA 4KCAA 2R0PA 1BEDA 3GHAA 5JWQB 4X0XA 5LD0A 2LJKA 4L0WA 1A0RP 3LG6A 3TDGA 2H19A 4G0LA 2KP1A 2OE3A 5CP1A 5D9TA 1GULA 4KDYA 5GZZB 1YY7A 1SD9A 2M46A 3GYKA 2B5YA 4J56E 1O85A 4PQIA 3ED3A 4HJ2A 4K0NA 3GKXA 1JZDA 3GX8A 3L9UA 3H93A 2XC2A 2LEGA 2OADA 4MPFA 2CVBA 1TJDA 1TXXA 3IR4A 4ACSA 3ZYWA 5G5EA 2OE1A 1GSEA 3I69A 4Q5FA 2HYXA 4TR1A 2GT6A 2HLSA 4ZBAA 3VPTA 4TKYA 5IMDA 1EV9A 2N5AA 3HY2A 5DAKB 1UVZA 1QFNA 2LV3A 3FZ9A 4XS4B 3G7YA 4OFTA 1XWKA 1X5EA 4IQAA 3GUSA 1OC9A 1BQ7A 1QK8A 1GUKA 3IAM2 4PXOA 1ACVA 2NTOA 2MBSA 4OWYA 1G6WA 1PL2A 1Q98A 2P31A 2X64A 2J9HA 4F82A 4IKHA 2LUSA 3CRTA 4F9ZA 5C00A 4O5UA 1JLWA 4KW6A 4KF9A 4TN8A 4A5PA 3IK9A 5E59A 5JWRB 3D5JA 4I5QA 3TKRA 1PSQA 3LJRA 2HRFA 5ECIB 2CA8A 2GDRA 1V57A 3EE2A 1F6MC 1AXDA 2MMZA 2YV7A 2CVKA 2VLUA 2L4CA 1FW1A 2E2GA 1V9WA 4MZBA 4OMVA 4IW9A 3UVHA 2CV4A 1BX9A 1WP0A 1SENA 3Q6OA 1PL1A 4TW5A 2DMMA 3QOUA 3BCKA 1F3AA 2NBSA 3LGCA 2VOCA 1O7UA 4ZXGA 2C8UA 2XPEA 3QD9A 3H4KA 1TTZA 2H0IA 2ZNMA 4O5RA 1EOGA 2QGVA 4ZL7A 1GSQA 3LYKA 4BVYA 2R0CA 4DSRA 2GSQA 10GSA 3M1GA 2JU5A 3IV4A 4MCUA 3RPNA 4NV2A 1MDJA 1G7EA 3P8WA 1KBNA 3TOUA 3HJPA 2C80A 3IOSA 1V2AA 5KN2A 2V6OA 4IP1A 2ES7A 2R2JA 4DEJA 3WYWA 5L71A 3LEFA 5AN1A 1FG4A 3EYTA 3VI7A 2WRTA 2UZ8A 4EIQA 5B8AA 1WRYA 3PPUA 2LTKA 2MMAA 1J08A 1GSYA 8GSSA 1R7HA 2YZUA 4GQFA 3KZQA 3LSZA 1BG5A 4CY6A 4DSSB 1SYRA 4CHSA 2H6YA 2XBQA 3FR6A 4LMWA 5DVBA 3EVIA 3U6VA 3D6IA 4X4JA 5F05A 18GSA 1ZCPA 1XWBA 1XWCA 4FIWA 3K8NA 1B8XA 3ZRDA 2C3QA 1TK5B 2DJKA 1Z6MA 2LNSA 2K9FA 4NWYA 1XFLA 1QXHA 1XPVA 1IYHA 2HNLA 3ZLPA 3EMPA 4PQ1A 2CVDA 1W4VA 3F0IA 2CAQA 1NHOA 3SBCA 2V6KA 3RHBA 2YWNA 3IK7A 2YNXA 5ECHB 1O6JA 2JZTA 1EV4A 4MH2A 4G2EA 2OJLA 5ELGA 4ZB6A 4L5OA 5HR1A 5CRWA 2GS3A 1PKZA 4WEYA 1WIKA 2IPAA 3ISOA 5ENUA 1U88A 1YZXA 1J0FA 5DAKA 2H76A 3F4TA 4XS4A 2LNTA 3FRCA 2RUFA 3FZAA 4KAEA 2H72A 1XXUA 2LJAA 2WDUA 1A8YA 2G0FA 2MYGA 4ICYA 1JZWA 1K0AA 3VWVA 2LRCA 5G5FA 3UBLA 3VWWA 3HVSA 3TGZA 3W8SA 1OVNA 2K6VA 2L4QA 3GNJA 5J4UA 2IMDA 3CSJA 4KGIA 2HZEA 3KIJA 4MP4A 5J9CA 5CREA 4YH2A 3F9UA 2H75A 4ML6A 1MDIA 1S3CA 4JZQA 3ZITA 3WGXA 4IELA 1AIUA 1BYEA 1ON4A 3ZZXA 1YEXA 2VO4A 1M2DA 2GZPA 4HEA2 3C1RA 1FOHA 3GRXA 2IFQA 5DJMA 4NMUA 1T3BA 5HFGA 1UA5A 4Z2RA 1RQMA 3FW2A 4FYBA 3G7JA 3LWAA 2K8SA 2VL2C 2RM6A 4Q5NA 5ID2B 4MJCA 5DCHA 3FK8A 4E8EA 3BBYA 5IO0A 1ZL9A 1M99A 5KN1A 4POBA 1EEJA 1EP7A 1U6TA 1A23A 4MK3A 2H01A 1WJKA 1JHBA 1AQVA 5EVOA 4XCSA 2JADA 1RW1A 4F0CA 2J23A 2LRNA 4CW9A 1GSDA 3TKQA 1VF2A 2ON5A 1SJ6A 1X5CA 1HNAA 2HZFA 1PN0A 4GSTA 3HJMA 2B7JA 1TRVA 1XW5A 2DJ1A 4WR4A 2BTOT 2X8HA 5B8BA 3C73A 4USSA 1PX7A 5DALB 3Q18A 3RPPA 1CQGA 4DSSA 3GFKA 5HR0A 4GTUA 2E0QA 4LA1A 1AAZA 2WJUA 2LQQA 3GL5A 2CZ3A 4TXOB 2ZCTA 2MMOA 3KH7A 2EC4A 1SJZA 3N5OA 2Z9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 20GS A;  4XHM A;  4MMM A;  4PUF C;  2FHE A;  2FCH A;  3GA4 A;  1E2Y A;  4RI7 A;  1X9M B;  4N11 A;  2YCD A;  1SJI A;  2OE0 A;  2CQ9 A;  5ECQ B;  1I9D A;  3M8N A;  2PU9 C;  5CRD A;  1HYU A;  4Z7X A;  4WBR D;  3CTF A;  1SL0 B;  4PQH A;  4WXT A;  2L6D A;  3F4R A;  3GH6 A;  2VLV A;  3N9J A;  2YPM A;  4D73 B;  3QFB C;  4AF2 A;  4GXZ A;  4N0V A;  1LJR A;  1GRX A;  4YQU A;  1K0B A;  2WGR A;  3TOT A;  4IP6 A;  1V58 A;  4JR4 A;  4ZIJ A;  4MLY A;  3UAR A;  1ZMA A;  5J9B A;  4ISD A;  3ZVJ D;  1EEM A;  1SK0 A;  1GTU A;  5HR2 A;  1GUH A;  2IYJ A;  3E3E A;  2XBI A;  2I81 A;  4KA0 A;  2CX3 A;  3G7I A;  2E2M A;  2VD1 A;  5A4U A;  3C1S A;  4JED A;  2HXK A;  3FY7 A;  4KB3 A;  1F2E A;  2YWM A;  2VIM A;  1LBK A;  2IME A;  3F3Q A;  3F3R A;  5EY6 A;  1V40 A;  3GUR A;  2DSA A;  1XW9 A;  1XBS A;  3L0H A;  2RII A;  1FB0 A;  2ALB A;  2AAW A;  5F8B A;  4Q5R A;  2N5F A;  2GST A;  2O7K A;  1TP9 A;  1PD2 1;  4IBP A;  1OE7 A;  4BWS A;  4PX1 A;  2YZH A;  3KMN A;  5DJL A;  1FAA A;  5KEJ A;  1XVW A;  5G1L A;  6GSS A;  3UMA A;  3QCP A;  4I6X A;  2B7K A;  4EF0 A;  1F9M A;  3RBT A;  4V1A g;  2RM5 A;  3IDV A;  4ECC A;  1XW6 A;  1SL2 B;  3J7Y k;  3F6F A;  4V2L A;  2C4J A;  3DXB A;  4CDO A;  4F2I A;  2HT9 A;  3UVT A;  3MSZ A;  1G0T A;  2GLR A;  3WD6 A;  1O81 A;  2P5R A;  1O8W A;  2B5X A;  4KUN A;  5DCG A;  1U3I A;  1XWG A;  5AIV A;  1Z7R A;  3ERW A;  2L5O A;  3KH9 A;  5AIS A;  1XOA A;  2L59 A;  3WGE A;  2H1D A;  4I2T A;  5IMV A;  4XS6 A;  6GST A;  2PVO C;  2EIR A;  1N8J A;  3ZFL A;  2HFD A;  3DWV A;  3LXZ A;  1PX6 A;  1Z9H A;  4MZC A;  1MTC A;  4RUV A;  5KN3 A;  3D0Z A;  3FHK A;  5IMF A;  4BL7 A;  2YAN A;  4HUA A;  4KDU A;  4ZB9 A;  1X9S B;  2H6X A;  2VL3 A;  3PIN A;  5G2Z A;  1PKW A;  3ME8 A;  2GSS A;  4GCI A;  5D93 A;  5JCU A;  1EGO A;  2R6K A;  3AY8 A;  4J2F A;  2A2S A;  2F3M A;  2X8C A;  1F37 A;  1V98 A;  3P90 A;  4V2N A;  5G1K A;  5GAP D;  2FWH A;  4EDZ A;  3KP9 A;  3HKR A;  14GS A;  4ID0 A;  1JZO A;  3F4S A;  4K7I A;  3FKF A;  4TR4 A;  3ZL5 A;  2C0D A;  5H5R A;  3KCM A;  3BD2 A;  4Q5Q A;  2H6Z A;  2F8F A;  3HXS A;  2EIO A;  2XPD A;  3US3 A;  1PRX A;  5CRG A;  4IS0 A;  3ZTL A;  1X9W B;  1SK1 A;  3GL3 A;  3ZIV A;  4HQZ A;  4YAP A;  2C0E A;  1K3L A;  2WUL A;  4EXJ A;  4POL A;  1VF1 A;  3HZ8 A;  1T00 A;  2CAI A;  1AC1 A;  4K6X A;  5DQS A;  3KEB A;  3HZ4 A;  2WFC A;  1ABA A;  5JCW A;  2LQO A;  1TI3 A;  3GKK A;  1E6B A;  2FWE A;  3Q19 A;  1FVJ A;  4PNF A;  4BPY A;  3EC3 A;  6GSX A;  3A2X A;  3CXG A;  1PN9 A;  1CQH A;  2JZS A;  4RI6 A;  1SKS B;  1HQO A;  1Q4J A;  3A2V A;  3ZML A;  2FA4 A;  4GSN A;  2GZY A;  2BJX A;  4MDC A;  3BOA A;  2K18 A;  3E0U A;  4ZB8 A;  2QKE A;  5IO2 A;  4KSO A;  3FYG A;  3IC4 A;  3WT1 A;  3KTB A;  3DD3 A;  3S9F A;  5A4V A;  3M9J A;  1AW9 A;  2PMT A;  2YOI A;  5GST A;  3WGD A;  5ECO B;  3IHQ A;  4KX4 A;  2P5Q A;  4WF5 A;  3EU4 A;  1HNB A;  4IQ1 A;  2CZ2 A;  1THX A;  2PVQ A;  5F06 A;  1UC7 A;  4FH8 A;  1DE1 A;  4ZL9 A;  3QAG A;  5AIX A;  1Z3E A;  1NSW A;  2H30 A;  5IM9 A;  5INY A;  1VF3 A;  4AGS A;  1TU7 A;  4ZIL A;  1Z5Y E;  2B1L A;  4J57 E;  1GTB A;  2PUK C;  2IIY A;  3RHC A;  2HI7 A;  1B48 A;  3UL3 A;  2X99 A;  4XRD A;  3E9J B;  3Q74 A;  2IMK A;  4HJM A;  3GTU B;  4AJ7 A;  2B3S A;  3TRP A;  2L6C A;  1K0C A;  3H8Q A;  3OR5 A;  4KCE A;  2OBK A;  3DRN A;  3PH9 A;  5GSS A;  2C1Y A;  2I9H A;  1I5G A;  1XZO A;  5D9W A;  3ZVJ A;  3GIX A;  2A4V A;  3L4N A;  3HDC A;  3GKM A;  3HVX A;  1NHY A;  1YF1 A;  3TKS C;  4HZ4 A;  16GS A;  2XHF A;  3TJJ A;  4PGT A;  5ECL B;  2X8G A;  1XIY A;  2DC5 A;  4MJA A;  1B4P A;  1B9Y C;  4I97 A;  2V2G A;  2GGT A;  3JCM L;  1N2A A;  2F9S A;  5COH A;  1KNG A;  1EGR A;  2E7P A;  1Z6N A;  1VF4 A;  3M0F A;  4L5L A;  2V41 A;  3V1W A;  3FEU A;  3WT2 A;  3L78 A;  3O3T A;  5HFK A;  1PQN A;  2PBJ A;  1Y6E A;  2VL2 A;  3KP8 A;  2C0G A;  4IJ3 A;  5F0G A;  4TR0 A;  2QSI A;  1OYJ A;  2LRT A;  4HI7 A;  13GS A;  2R5G A;  5LCZ A;  2GT5 A;  4K9Z A;  1HD2 A;  3VWX A;  3GH9 A;  2BMX A;  2PER A;  3NZN A;  3M3M A;  2OKA A;  4MPG A;  3FR9 A;  4LL4 B;  1YKA A;  2NVL A;  1THO A;  2H0H A;  2P0G A;  4ECJ A;  1SKW B;  1R5P A;  4GRF A;  2IL3 A;  2VL9 A;  4K0G A;  4OCF A;  2DJ0 A;  1EP8 A;  5IMA A;  1A8L A;  4KE3 A;  1GH2 A;  3IPZ A;  4ZL8 A;  4O7H A;  2M72 A;  2AUV A;  3D21 A;  2GQK A;  4K7O A;  5ELA A;  4BWQ A;  1ERV A;  4POM A;  2CX4 A;  3BCI A;  2HSY A;  3O6T A;  3CRU A;  1DUG A;  3MNG A;  1TU8 A;  2L57 A;  3G9B A;  1VRS D;  2KOK A;  1TRU A;  2DIZ A;  2FWG A;  2GSR A;  1EOH A;  1FHE A;  4OFM A;  3C8E A;  3PR8 A;  3GKN A;  2YN1 A;  4BA7 A;  1FVK A;  1VGL A;  2HSH A;  3HVV A;  3TKS E;  4GF0 A;  3D4M A;  3TJB A;  4LMV A;  4XTS A;  1M9B A;  2PN8 A;  3TUE A;  19GS A;  3DVX A;  3LOR A;  2YP6 A;  4EDY A;  1YEP A;  1OC3 A;  3FZ4 A;  5IMC A;  2FNO A;  1GWC A;  2MMN A;  1QUW A;  3GV1 A;  5AGY A;  5CYY A;  2JAC A;  1A2J A;  2AV4 A;  4AJ8 A;  5D9V A;  4I2U A;  3TRQ A;  3GST A;  3VI5 A;  2G2Q A;  1ST9 A;  2LST A;  2AJQ B;  3LQ7 A;  2WCI A;  4RQR A;  2GQL A;  4O32 A;  3UEM A;  2KP2 A;  5HR3 A;  3PGT A;  2VCQ A;  3KMO A;  3H79 A;  4ILF A;  2DLX A;  3GTU A;  1ZGN A;  3F63 A;  4LLR A;  3A5W A;  2C0F A;  6GSU A;  5FHI A;  1BAY A;  2FGX A;  4HU7 A;  5E4W A;  3IXR A;  3KGK A;  3R2Q A;  4L8E A;  1WMJ A;  5H5Q A;  5LNK e;  1K0D A;  5ECK B;  3UJ1 A;  1PMT A;  2R4V A;  2H0G A;  5ID2 A;  4K1F A;  2KHP A;  2TRC P;  4LL1 B;  4GLT A;  5D8I A;  2WB9 A;  2MBT A;  1GLP A;  2AYT A;  2DJ3 A;  1M9A A;  3U5R E;  3J7Y b;  3C7M A;  2TRX A;  1A0F A;  1WWJ A;  4V1A p;  1Y25 A;  1TK8 B;  2YV9 A;  4DSQ A;  4ZBD A;  4OO4 A;  2OBI A;  3W6G A;  5IOX A;  4NPB A;  1ZOF A;  1X5D A;  1PA3 A;  1ERT A;  3FR3 A;  1TKD B;  3P2A A;  1KEB A;  6GSY A;  3APO A;  4JU5 A;  3NOF A;  3EMX A;  4TR3 A;  4E8H A;  5ECR B;  5IIZ A;  3L9V A;  3VLN A;  2PGT A;  3VFI A;  2YWO A;  3D22 A;  5DAL A;  6GSW A;  1DBY A;  4MF7 A;  1GTI A;  2V32 A;  1HNC A;  4I8B A;  3HCZ A;  5HFI A;  5D73 A;  5JWO B;  4GQC A;  3ZMK A;  3KTL A;  3QR6 A;  1K0N A;  4ECB A;  1TI1 A;  4TXO A;  4IHU A;  1K3O A;  4HQS A;  5GAN D;  1SYX A;  4HOJ A;  2AHE A;  1PGT A;  3KD0 A;  4WKW A;  4F03 A;  1GNW A;  2O85 A;  1OC8 A;  1OKT A;  1OKD A;  2H73 A;  2HZE B;  3DVW A;  3O76 A;  1B4Q A;  4IVF A;  2H66 A;  2OAC A;  4JR6 A;  3LFL A;  1Z7P A;  1SKR B;  3UAP A;  17GS A;  4QL9 A;  3KXO A;  2H1A A;  1TW9 A;  1T8E B;  3ZIJ A;  4TXV A;  4D73 A;  3TJK A;  3I43 A;  3QAV A;  2REM A;  3ERG A;  1H75 A;  1SD8 A;  4HU9 A;  3UBK A;  4IN0 A;  5HQP A;  2C3T A;  4HZ2 A;  2IFQ B;  4GWR A;  5EPF A;  3A3T A;  2I3Y A;  1ILO A;  3VPQ A;  3GMF A;  2GQM A;  2K8V A;  5CRH A;  4K2D A;  1TRW A;  4ML1 A;  3CTG A;  1GP1 A;  1XOB A;  3DIE A;  1GLQ A;  4PUA A;  1B9X C;  1ERU A;  3EUR A;  4KND A;  3CYN A;  1T7P B;  1NW2 A;  5IQY A;  5G30 A;  2DML A;  3EWL A;  4JE1 A;  3CMI A;  2EIQ A;  2VLT A;  3DKS A;  4YQV A;  2JSZ A;  2H8L A;  4XS1 A;  3M9K A;  4X43 A;  4MF6 A;  1TK0 B;  2JSY A;  3P7X A;  4IJI A;  1S3A A;  1A2M A;  1ZYQ B;  3IA1 A;  5A4W A;  1WE0 A;  2I1U A;  4MA9 A;  3DGQ A;  4NV5 A;  4NHW A;  2PPT A;  4V2M A;  2N5B A;  3KJY A;  4K7N A;  2KLX A;  2R37 A;  2FA8 A;  2PWJ A;  1R5A A;  1M2A A;  4OFN A;  2H74 A;  5KN0 A;  3EIN A;  3MWH A;  4XRA A;  1GSF A;  4HDE A;  1GUM A;  1U87 A;  1H4O A;  1WPI A;  2VCT A;  4TOP A;  1YQ1 A;  3A2W A;  2YWI A;  3CSI A;  2O87 A;  1AQX A;  1YDK A;  2ON7 A;  4FYC A;  4N0Z A;  5CAX A;  2TIR A;  3TKP A;  3EU3 A;  4WF4 A;  2DJ2 A;  1RK4 A;  2B6M A;  4QQ7 A;  4ZBB A;  1C72 A;  1A24 A;  2L5L A;  3DYR A;  4AJ6 A;  1MEK A;  4MH3 A;  1FB6 A;  2A2R A;  2V1M A;  4N30 A;  3IRA A;  5CO3 A;  1U3A A;  5D9X A;  1KTE A;  5ECM B;  2IMF A;  5CNW A;  5FWG A;  1FO5 A;  4NXI A;  2YJH A;  1WOU A;  4NAX A;  1GSU A;  1EWX A;  4YQM A;  2B5E A;  3BJ5 A;  4MF5 A;  1GSS A;  2R3X A;  2FY6 A;  1AQW A;  4KH7 A;  3L9S A;  2IJY A;  6GSV A;  4EO3 A;  4KSM A;  2RLI A;  2VAF A;  3LYP A;  3FZ5 A;  4N10 A;  1J9B A;  1FOV A;  2FUG 2;  2M80 A;  11GS A;  4EL1 A;  3APQ A;  3TRX A;  4HS1 A;  3D4T A;  5IMZ A;  1DE2 A;  3RDW A;  3RAZ A;  3QDN A;  2HE3 A;  1K0M A;  1YF0 A;  1O8X A;  2VCV A;  5B6N A;  4EVM A;  1OE8 A;  2O8V B;  4XIH A;  3TJF A;  2O89 A;  4K8M A;  5JCG A;  2OA7 A;  5DDL A;  4MZW A;  4KDX A;  3DML A;  3TCO A;  1EZK A;  1ML6 A;  1UN2 A;  2VM1 A;  2MZC A;  5DQY A;  4JRR A;  4QL7 A;  3SWL A;  1QGV A;  4OCE A;  12GS A;  3HYP A;  5H5S A;  4GSS A;  1SL1 B;  3HJO A;  3DEX A;  1BJX A;  1R26 A;  2AB6 A;  5A5K A;  1SK2 A;  1W89 A;  2LKU A;  1LU4 A;  5ECN B;  4G10 A;  1YKC A;  1GTA A;  1S3D A;  2DIY A;  2F51 A;  4ECI A;  5F07 A;  3I9V 2;  2RUE A;  1QQ2 A;  2VD0 A;  1G6Y A;  2LJR A;  3CBU A;  1GL8 A;  1OAZ A;  1SU9 A;  4O92 A;  2HRN A;  4PNG A;  4OO5 A;  2IY2 A;  3MDK A;  3TKS A;  3APS A;  3CSH A;  1O73 A;  1M7T A;  3TJG A;  3QAW A;  1T4Z A;  5FT3 A;  1MD4 A;  2GTU A;  4TR1 B;  2YJ7 A;  1MD3 A;  1JZR A;  4EE0 A;  2KUC A;  3ZFB A;  3W8J A;  4P3Y B;  3GN3 A;  4EKZ A;  4DVC A;  2JZR A;  1M0U A;  3GSS A;  3F8U A;  5ECS A;  4F0B A;  4JBB A;  4MJE A;  3IAS 2;  1ZZY A;  3VK9 A;  1XCC A;  2F8A A;  1IYI A;  2VCZ A;  1M2B A;  5EL8 A;  3QPM A;  1QMV A;  4MJB A;  1OC9 B;  3QMX A;  2FD3 A;  3MAK A;  1JLV A;  3VWU A;  3GX0 A;  4NHZ A;  4PUR A;  3ZRE A;  4WET A;  4WBJ A;  2FLS A;  5B7C A;  22GS A;  2LS5 A;  2VM2 A;  5IPH A;  5G31 A;  1NM3 A;  5C04 A;  4L0U A;  5ECP B;  4YAV A;  4MAB A;  3UIW A;  3UOM A;  5J3R A;  2DBC A;  2IN3 A;  2I4A A;  3LXT A;  3QFA C;  5DBQ A;  4OD7 A;  3NIV A;  1XWA A;  1T1V A;  1MDK A;  9GSS A;  4IGJ A;  5J5N A;  3HHV A;  2WS2 A;  4FO5 A;  1F3B A;  3I6A A;  4EUY A;  2H1B A;  2H70 A;  4TVE A;  1AUC A;  5J41 A;  3H1N A;  7GSS A;  3TB2 A;  5D96 A;  4FYU A;  2IMI A;  2FWF A;  2ZUP A;  4ULX A;  3IBH A;  3F6D A;  1T4Y A;  1K0O A;  2JL4 A;  2WZ9 A;  4G9H A;  3C71 A;  3VUR A;  1ZYE A;  3IE3 A;  2CT6 A;  2DJJ A;  1JFU A;  2D2Z A;  1A2L A;  1ERW A;  4RQX A;  1TOF A;  2GVP A;  2IWT A;  1TDI A;  2H71 A;  1X0R A;  5IPG A;  1G7O A;  1K3Y A;  2C3N A;  3ERF A;  3HA9 A;  3ME7 A;  1R4W A;  1YJ6 A;  2GZZ A;  4H86 A;  4WR5 A;  2VUP A;  2H1G A;  2NDO A;  4X1U A;  4POK A;  1DSB A;  1XVQ A;  3KM6 A;  4BVX A;  2VCX A;  1URM A;  2QC7 A;  4EC0 A;  4G19 A;  2B1K A;  5ABR A;  5IOW A;  1USB A;  2VCW A;  1TRS A;  5B6M A;  1GNE A;  3HD5 A;  4TRX A;  2NPB A;  4KCA A;  1BED A;  3GHA A;  5JWQ B;  4X0X A;  5LD0 A;  2LJK A;  4L0W A;  1A0R P;  3LG6 A;  3TDG A;  2H19 A;  2KP1 A;  2OE3 A;  5CP1 A;  5D9T A;  1GUL A;  4KDY A;  5GZZ B;  1YY7 A;  1SD9 A;  2M46 A;  3GYK A;  2B5Y A;  4J56 E;  1O85 A;  4PQI A;  3ED3 A;  4HJ2 A;  4K0N A;  3GKX A;  1JZD A;  3GX8 A;  3L9U A;  3H93 A;  2XC2 A;  2LEG A;  2OAD A;  4MPF A;  2CVB A;  1TJD A;  1TXX A;  3IR4 A;  4ACS A;  3ZYW A;  5G5E A;  2OE1 A;  1GSE A;  3I69 A;  4Q5F A;  2HYX A;  4TR1 A;  2GT6 A;  2HLS A;  4ZBA A;  3VPT A;  4TKY A;  5IMD A;  1EV9 A;  2N5A A;  3HY2 A;  5DAK B;  1UVZ A;  1QFN A;  2LV3 A;  3FZ9 A;  4XS4 B;  3G7Y A;  4OFT A;  1XWK A;  1X5E A;  4IQA A;  3GUS A;  1OC9 A;  1BQ7 A;  1QK8 A;  1GUK A;  3IAM 2;  4PXO A;  1ACV A;  2NTO A;  2MBS A;  4OWY A;  1G6W A;  1PL2 A;  1Q98 A;  2P31 A;  2X64 A;  2J9H A;  4F82 A;  4IKH A;  2LUS A;  3CRT A;  4F9Z A;  5C00 A;  1JLW A;  4KW6 A;  4TN8 A;  3IK9 A;  5E59 A;  5JWR B;  3D5J A;  4I5Q A;  3TKR A;  1PSQ A;  3LJR A;  2HRF A;  5ECI B;  2CA8 A;  2GDR A;  1V57 A;  3EE2 A;  1F6M C;  1AXD A;  2MMZ A;  2YV7 A;  2CVK A;  2VLU A;  2L4C A;  1FW1 A;  2E2G A;  1V9W A;  4MZB A;  4OMV A;  4IW9 A;  3UVH A;  2CV4 A;  1BX9 A;  1WP0 A;  1SEN A;  3Q6O A;  1PL1 A;  4TW5 A;  2DMM A;  3QOU A;  3BCK A;  1F3A A;  2NBS A;  3LGC A;  2VOC A;  1O7U A;  4ZXG A;  2C8U A;  2XPE A;  3QD9 A;  3H4K A;  1TTZ A;  2H0I A;  2ZNM A;  4O5R A;  1EOG A;  2QGV A;  4ZL7 A;  1GSQ A;  3LYK A;  4BVY A;  4DSR A;  2GSQ A;  10GS A;  3M1G A;  2JU5 A;  3IV4 A;  4MCU A;  3RPN A;  4NV2 A;  1MDJ A;  1G7E A;  3P8W A;  1KBN A;  3TOU A;  3HJP A;  2C80 A;  3IOS A;  1V2A A;  5KN2 A;  2V6O A;  4IP1 A;  2ES7 A;  2R2J A;  4DEJ A;  3WYW A;  5L71 A;  3LEF A;  5AN1 A;  1FG4 A;  3EYT A;  3VI7 A;  2WRT A;  5B8A A;  1WRY A;  2LTK A;  2MMA A;  1J08 A;  1GSY A;  8GSS A;  1R7H A;  2YZU A;  4GQF A;  3KZQ A;  3LSZ A;  1BG5 A;  4DSS B;  1SYR A;  4CHS A;  2H6Y A;  2XBQ A;  3FR6 A;  4LMW A;  5DVB A;  3EVI A;  3U6V A;  3D6I A;  5F05 A;  18GS A;  1ZCP A;  1XWB A;  1XWC A;  4FIW A;  3K8N A;  1B8X A;  3ZRD A;  2C3Q A;  1TK5 B;  2DJK A;  1Z6M A;  2LNS A;  2K9F A;  4NWY A;  1XFL A;  1QXH A;  1XPV A;  1IYH A;  2HNL A;  3ZLP A;  3EMP A;  4PQ1 A;  2CVD A;  1W4V A;  3F0I A;  2CAQ A;  1NHO A;  3SBC A;  2V6K A;  3RHB A;  2YWN A;  3IK7 A;  2YNX A;  5ECH B;  1O6J A;  2JZT A;  1EV4 A;  4MH2 A;  4G2E A;  2OJL A;  5ELG A;  4ZB6 A;  4L5O A;  5HR1 A;  5CRW A;  2GS3 A;  1PKZ A;  4WEY A;  1WIK A;  2IPA A;  3ISO A;  5ENU A;  1U88 A;  1YZX A;  1J0F A;  5DAK A;  2H76 A;  3F4T A;  4XS4 A;  2LNT A;  3FRC A;  2RUF A;  3FZA A;  4KAE A;  2H72 A;  1XXU A;  2LJA A;  2WDU A;  1A8Y A;  2G0F A;  2MYG A;  1JZW A;  1K0A A;  3VWV A;  2LRC A;  5G5F A;  3UBL A;  3VWW A;  3HVS A;  3TGZ A;  3W8S A;  1OVN A;  2K6V A;  2L4Q A;  3GNJ A;  5J4U A;  2IMD A;  3CSJ A;  4KGI A;  2HZE A;  3KIJ A;  4MP4 A;  5J9C A;  5CRE A;  4YH2 A;  3F9U A;  2H75 A;  4ML6 A;  1MDI A;  1S3C A;  4JZQ A;  3ZIT A;  3WGX A;  4IEL A;  1AIU A;  1BYE A;  1ON4 A;  3ZZX A;  1YEX A;  2VO4 A;  1M2D A;  2GZP A;  4HEA 2;  3C1R A;  3GRX A;  2IFQ A;  5DJM A;  4NMU A;  1T3B A;  5HFG A;  1UA5 A;  1RQM A;  3FW2 A;  4FYB A;  3G7J A;  3LWA A;  2K8S A;  2VL2 C;  2RM6 A;  4Q5N A;  5ID2 B;  4MJC A;  5DCH A;  3FK8 A;  4E8E A;  3BBY A;  5IO0 A;  1ZL9 A;  1M99 A;  5KN1 A;  4POB A;  1EEJ A;  1EP7 A;  1U6T A;  1A23 A;  4MK3 A;  2H01 A;  1WJK A;  1JHB A;  1AQV A;  5EVO A;  4XCS A;  2JAD A;  1RW1 A;  4F0C A;  2J23 A;  2LRN A;  4CW9 A;  1GSD A;  3TKQ A;  1VF2 A;  2ON5 A;  1SJ6 A;  1X5C A;  1HNA A;  2HZF A;  4GST A;  3HJM A;  2B7J A;  1TRV A;  1XW5 A;  2DJ1 A;  4WR4 A;  2BTO T;  2X8H A;  5B8B A;  3C73 A;  1PX7 A;  5DAL B;  3Q18 A;  3RPP A;  1CQG A;  4DSS A;  3GFK A;  5HR0 A;  4GTU A;  2E0Q A;  4LA1 A;  1AAZ A;  2WJU A;  2LQQ A;  3GL5 A;  2CZ3 A;  4TXO B;  2ZCT A;  2MMO A;  3KH7 A;  2EC4 A;  1SJZ A;  3N5O A;  2Z9S A; 
#chains in the Genus database with same CATH topology
 2HSM A;  20GS A;  4XHM A;  4NHF A;  4MMM A;  4PUF C;  2FHE A;  2FCH A;  3GA4 A;  1E2Y A;  4RI7 A;  1X9M B;  4N11 A;  2YCD A;  3HX8 A;  1SJI A;  2OE0 A;  2CQ9 A;  5ECQ B;  1I9D A;  4N6M A;  3M8N A;  1UCK A;  2PU9 C;  1HYU A;  5CRD A;  3K0Z A;  4Z7X A;  1Z1S A;  4WBR D;  5AI1 A;  3CTF A;  1R4C A;  3J7Y d;  1AV4 A;  2WOH A;  1QMA A;  3NX0 A;  4PQH A;  1SL0 B;  4WXT A;  2L6D A;  4J5K A;  3F4R A;  1MWU A;  3GH6 A;  4BL7 B;  2VLV A;  2HMJ B;  3N9J A;  2F86 B;  2BHM A;  2YPM A;  1JKG A;  5AYR B;  1RHL A;  3QFB C;  4D73 B;  4HVN A;  4AF2 A;  4GXZ A;  4N0V A;  1LJR A;  1GRX A;  4YQU A;  1CEW I;  4BU4 A;  3MWZ A;  1K0B A;  1IDP A;  2WGR A;  3TOT A;  4IP6 A;  1V58 A;  5KOW A;  4JR4 A;  4ZIJ A;  3CME 3;  5BXQ A;  4MLY A;  3UAR A;  1ZMA A;  5J9B A;  4ISD A;  3ZVJ D;  1EEM A;  1SK0 A;  2AAD A;  1D6Y A;  3NBB A;  2CW9 A;  1GTU A;  1E3R A;  5HR2 A;  1DE3 A;  2K3D A;  1FGR A;  1GUH A;  2IYJ A;  3E3E A;  4EV2 A;  2XBI A;  2I81 A;  2XH9 A;  1PFO A;  4HM3 B;  4N6T A;  4KA0 A;  2CX3 A;  1I3F A;  3G7I A;  1GD4 A;  1D6U A;  3ZFZ A;  2E2M A;  4RBN A;  2VD1 A;  1SPU A;  1I0V A;  2I9W A;  5A4U A;  3C1S A;  4JED A;  2HXK A;  3FY7 A;  1WMN A;  2QA1 A;  4KB3 A;  1F2E A;  2YWM A;  2VIM A;  2KF4 A;  1LBK A;  2IME A;  3F3Q A;  2UX0 A;  3PZW A;  3F3R A;  5EY6 A;  1V40 A;  3GUR A;  2DSA A;  1BNR A;  3N54 B;  1XW9 A;  1XBS A;  3RGR A;  4WWU C;  3L0H A;  2RII A;  1FB0 A;  2ALB A;  5FW5 A;  2AAW A;  5F8B A;  4Q5R A;  2XSH B;  5EVH A;  3D79 A;  2N5F A;  2GST A;  2W2C A;  2O7K A;  3OX9 A;  2V1L A;  5KP1 A;  1LXE A;  2CWU A;  4MNN A;  4OK0 A;  1TP9 A;  2UGI A;  3ECF A;  1PD2 1;  3VF1 A;  4IBP A;  2KF5 A;  1OE7 A;  4BWS A;  4PX1 A;  2YZH A;  3KMN A;  2W6J H;  5DJL A;  2CX0 A;  2CFK A;  1FAA A;  1BRH A;  3GAX A;  5KEJ A;  1XVW A;  3HVN A;  5G1L A;  1W7C A;  2SAR A;  6GSS A;  1FGT A;  3SXX A;  3UMA A;  3QCP A;  4I6X A;  4KFF A;  1Q7H A;  2CHC A;  2B7K A;  1GY6 A;  4EF0 A;  1F9M A;  3RBT A;  1BRK A;  3CU3 A;  4V1A g;  4R1K A;  2RM5 A;  2W56 A;  3IDV A;  4ECC A;  1XW6 A;  1SL2 B;  4FCJ A;  3J7Y k;  3F6F A;  1E97 A;  1LOY A;  1BSB A;  2XGL A;  2CH9 A;  3JUP A;  3IJE B;  5M18 A;  2C4J A;  3DXB A;  4V2L A;  4CDO A;  4F2I A;  2HT9 A;  3UVT A;  3MSZ A;  4J5G A;  1G0T A;  2GLR A;  5IW9 A;  3WD6 A;  3K5T A;  2KCD A;  1O81 A;  2P5R A;  1O8W A;  2HMN B;  8RNT A;  2B5X A;  4KUN A;  3G16 A;  5DCG A;  1JBT A;  1U3I A;  1XWG A;  4N6U A;  5AIV A;  1Z7R A;  2W04 A;  3ERW A;  2L5O A;  3KH9 A;  1IQY A;  5AIS A;  1FUT A;  1XOA A;  3LXU X;  2L59 A;  3WGE A;  2H1D A;  2GXF A;  1YJN 3;  4I2T A;  1JB5 A;  4XM4 A;  5IMV A;  4XS6 A;  6GST A;  2PVO C;  2EIR A;  2ZA4 A;  4IPB A;  4J9A A;  1N8J A;  3ZFL A;  2X4A A;  2CWV A;  4Q53 A;  2HFD A;  3DWV A;  3CC7 3;  1RN1 A;  3LXZ A;  1O7M B;  1PX6 A;  3BU4 A;  1SJW A;  1C54 A;  1Z9H A;  4MZC A;  5IG3 A;  3LTC A;  1MTC A;  4R9K A;  4RUV A;  5KN3 A;  3ROB A;  3CPO A;  3D0Z A;  3F40 A;  3FHK A;  2P38 A;  1W6Y A;  5IMF A;  3JUM A;  4BL7 A;  2YAN A;  4HUA A;  4KDU A;  4ZB9 A;  4KFD A;  1X9S B;  2H6X A;  2VL3 A;  3PIN A;  5G2Z A;  3F7S A;  1PKW A;  3ME8 A;  2GSS A;  4GCI A;  4WYK B;  5D93 A;  3QRD A;  5JCU A;  1EGO A;  2RCD A;  2R6K A;  2F5W A;  3AY8 A;  3CCE 3;  3AMO B;  3RDE A;  4N6N B;  4J2F A;  2A2S A;  2F3M A;  2X8C A;  2F56 A;  1F37 A;  3A5I A;  1V98 A;  3P90 A;  4V2N A;  5G1K A;  5GAP D;  2C10 A;  2FWH A;  3FSD A;  3KP9 A;  4EDZ A;  9RNT A;  3HKR A;  2JDI H;  14GS A;  1AVL A;  1JB4 A;  4ID0 A;  1JZO A;  3F4S A;  4K7I A;  3FKF A;  1NU3 A;  4TR4 A;  3ZL5 A;  4G1M B;  1WNH A;  1BRG A;  2C0D A;  5H5R A;  3KCM A;  2YFL B;  3JUQ A;  3BD2 A;  4Q5Q A;  2H6Z A;  3MPH A;  4OVM A;  2F8F A;  2CK3 H;  4XDV A;  1YIT 3;  3HXS A;  2EIO A;  2XPD A;  3US3 A;  3SED A;  1PRX A;  3LZA A;  5CRG A;  1A2K A;  4IS0 A;  3ZTL A;  1X9W B;  1SK1 A;  1HZ1 A;  4MEI A;  3GL3 A;  4HQZ A;  5IG4 A;  3BLZ A;  4YAP A;  3ZIV A;  2C0E A;  2HOH A;  5EEO A;  1K3L A;  2WUL A;  4EXJ A;  1YJW 3;  1B2Z A;  4POL A;  1VF1 A;  1X1W A;  3HZ8 A;  1Q82 4;  3NXJ A;  1T00 A;  1UI7 A;  3JUN A;  2BNG A;  4O02 B;  3NBJ A;  2CAI A;  1AC1 A;  4K6X A;  3N9H A;  5ELJ A;  1JBS A;  5DQS A;  3KEB A;  3HZ4 A;  2WFC A;  2E2V A;  1ABA A;  5JCW A;  3KE7 A;  3I56 3;  2LQO A;  2O9U X;  3DUK A;  1TI3 A;  3GKK A;  1E6B A;  4AEQ A;  3EJV A;  2YFJ B;  2FGT A;  3FG1 A;  3OW2 2;  2CFL A;  2FWE A;  3CCL 3;  3Q19 A;  1FVJ A;  1UDI I;  1OUN A;  3F8H A;  5CK6 A;  4PNF A;  2D1W A;  4BPY A;  3EC3 A;  3LTB A;  6GSX A;  3A2X A;  3LT8 A;  3CXG A;  3FCS B;  1PN9 A;  4K90 B;  1CQH A;  2JZS A;  4RI6 A;  1SKS B;  2K54 A;  1HQO A;  1Q4J A;  3A2V A;  3ZML A;  2FA4 A;  4GSN A;  1R4Y A;  3WOD G;  4N6V 0;  2WGO A;  2GZY A;  2ML5 A;  2BJX A;  4MDC A;  1VQM 3;  3BOA A;  1UUV B;  3DGN A;  1LNH A;  3SYU A;  2K18 A;  1O7W B;  4PEJ A;  3FF2 A;  3UL6 A;  3E0U A;  4ZB8 A;  1W6G A;  3B8L A;  3DGM A;  2QKE A;  5IO2 A;  4KSO A;  3FYG A;  3IC4 A;  2ML6 A;  3WT1 A;  3KTB A;  3DM8 A;  3DD3 A;  1YVS A;  3S9F A;  4FCM A;  5A4V A;  4N6L A;  3M9J A;  3MYD A;  1TRQ A;  1AW9 A;  3PCR A;  2PMT A;  2YOI A;  5GST A;  3WGD A;  5ECO B;  4HM6 B;  3IHQ A;  4KX4 A;  2P5Q A;  4WF5 A;  2C4B A;  3EU4 A;  1HNB A;  4WP5 A;  4IQ1 A;  2CZ2 A;  1THX A;  2PVQ A;  5KP3 A;  5F06 A;  1UC7 A;  4FH8 A;  1U5O A;  3KII A;  1DE1 A;  3EF8 A;  4ZL9 A;  2DKI A;  3QAG A;  1ZYN A;  5AIX A;  1Z3E A;  2RSX A;  1NSW A;  2H30 A;  5IM9 A;  3UB1 A;  1VF3 A;  4AGS A;  5INY A;  1TU7 A;  1BNE A;  4ZIL A;  1Z5Y E;  3CMA 3;  2B1L A;  1S5A A;  4J57 E;  3DY5 A;  1GTB A;  2PUK C;  2IIY A;  3RHC A;  2HI7 A;  1B48 A;  2OTJ 3;  5BVB A;  3K7C A;  3UL3 A;  2ZDJ A;  2X99 A;  7STD A;  4XRD A;  3E9J B;  3Q74 A;  2IMK A;  2ZHX B;  1ZO2 A;  4HJM A;  3GTU B;  1BSA A;  4AJ7 A;  3V92 A;  3Q3F A;  2B3S A;  3CD6 3;  3TRP A;  4NRE A;  2L6C A;  1K0C A;  3H8Q A;  3OR5 A;  4KCE A;  2OBK A;  1TFO A;  3PYJ A;  4FMB A;  3DRN A;  3PH9 A;  5GSS A;  2C1Y A;  4CY8 A;  2I9H A;  1IVV A;  1FYS A;  3HK4 A;  1I5G A;  5CLK A;  1XZO A;  1M9G A;  5D9W A;  1LOX A;  4BVX B;  3FMW A;  1W01 A;  1D6Z A;  2KF3 A;  3ZVJ A;  3GIX A;  2A4V A;  2QA4 3;  1GOY A;  3L4N A;  3HDC A;  3GKM A;  3HVX A;  1SQW A;  1NHY A;  1YF1 A;  3TKS C;  5HOH A;  16GS A;  4HZ4 A;  2XHF A;  1RTU A;  1Q40 B;  3AMO A;  3TJJ A;  2P0M A;  2F98 A;  4PGT A;  5ECL B;  2X8G A;  1RGC A;  1XIY A;  2DC5 A;  3DH2 A;  4MJA A;  1O7P B;  4HM1 B;  4Z2U A;  4FQU A;  1B4P A;  1B9Y C;  4HSC X;  4I97 A;  2V2G A;  3SOY A;  2GGT A;  3JCM L;  1N2A A;  2F9S A;  5COH A;  1KNG A;  1BNF A;  1EGR A;  2E7P A;  1Z6N A;  3IHG A;  1VF4 A;  3KSP A;  4G0I A;  3M0F A;  4L5L A;  2V41 A;  3V1W A;  3FEU A;  4JRF A;  3WT2 A;  3STD A;  3L78 A;  3O3T A;  5HFK A;  1W02 A;  1PQN A;  2PBJ A;  1Y6E A;  2VL2 A;  3KP8 A;  1BAN A;  1FGQ A;  2C0G A;  4IJ3 A;  4N3V A;  1QAF A;  5F0G A;  4TR0 A;  2QSI A;  2Z6B A;  5LC6 A;  1OYJ A;  2LRT A;  4HI7 A;  13GS A;  3KSE D;  2R5G A;  2CWT A;  5LCZ A;  2GT5 A;  4K9Z A;  1IT7 A;  1Y4K A;  1HD2 A;  1MGW A;  3VWX A;  1M90 4;  5BRT A;  3GH9 A;  2BMX A;  2PER A;  1V74 A;  3NQZ A;  3NZN A;  3M3M A;  1IU7 A;  2OKA A;  4MPG A;  2CIU A;  3FR9 A;  1X1X A;  4LL4 B;  3MIX A;  1YKA A;  1I2G A;  2NVL A;  1THO A;  2H0H A;  2P0G A;  2L1S A;  4ECJ A;  1SKW B;  1R5P A;  4GRF A;  1YVB I;  3DGL A;  1OGX A;  2IL3 A;  2VL9 A;  4K0G A;  4N6O B;  1RGK A;  4OCF A;  2DJ0 A;  1EP8 A;  3EN8 A;  5IMA A;  1A8L A;  3MYT A;  4KE3 A;  1RJO A;  1GH2 A;  3IPZ A;  4ZL8 A;  4PTS A;  2RNT A;  4O7H A;  2M72 A;  2AUV A;  3D21 A;  4K1U A;  2GQK A;  4K7O A;  5ELA A;  4BWQ A;  1ERV A;  4POM A;  4HM8 B;  1OF5 A;  2A15 A;  2CX4 A;  1U8C B;  2OQE A;  1JB2 A;  1HYF A;  3KFQ C;  3D5G A;  3BCI A;  4MJD A;  2HSY A;  3O6T A;  3CRU A;  1DUG A;  3KN4 A;  3MNG A;  1TU8 A;  2L57 A;  1LQG C;  1UW1 A;  3G9B A;  2KRT A;  1VRS D;  2KOK A;  1TRU A;  3DXO A;  3V98 A;  2DIZ A;  2GU3 A;  2HRA A;  1SAR A;  1FUW A;  2FWG A;  2GSR A;  4GSP A;  3BB9 A;  1EOH A;  3LTA A;  1FHE A;  4OFM A;  3C8E A;  3PR8 A;  3GKN A;  2YN1 A;  1VQ4 3;  4BA7 A;  1FVK A;  1VGL A;  2HSH A;  3HVV A;  1B3S A;  1VQ6 3;  4GF0 A;  3D4M A;  3TJB A;  5D82 A;  3TKS E;  4LMV A;  4XTS A;  1VQ9 3;  1NB3 I;  4LGQ A;  1M9B A;  2PN8 A;  3TUE A;  19GS A;  3OWY A;  3DVX A;  1T5Y A;  4O2H A;  3CCQ 3;  3LOR A;  3B4O A;  2YP6 A;  1DYU A;  1FGO A;  1GOV A;  4EDY A;  4HYZ A;  1YEP A;  1OC3 A;  3FZ4 A;  5IMC A;  3CCU 3;  2FNQ A;  4IT7 A;  3NV0 B;  2FNO A;  1GWC A;  5HGR A;  4FMD A;  2MMN A;  1QUW A;  3GV1 A;  5AGY A;  5CYY A;  2JAC A;  1A2J A;  2AV4 A;  1UUW B;  4AJ8 A;  1M3J A;  2Z7A A;  5BIR A;  5D9V A;  4I2U A;  3FF0 A;  3TRQ A;  3GST A;  1QVF 2;  3VI5 A;  1BNI A;  2OWP A;  2G2Q A;  1ST9 A;  2LST A;  3EBT A;  2AJQ B;  3EE1 A;  7GSP A;  2SBL A;  3LQ7 A;  1RMS A;  3ER7 A;  2WCI A;  1QJG A;  4RQR A;  2GQL A;  4O32 A;  3UEM A;  2KP2 A;  5HR3 A;  3PGT A;  2VCQ A;  3KMO A;  3H79 A;  4ILF A;  2DLX A;  3GTU A;  4KZ1 A;  1ZGN A;  3F63 A;  1DMQ A;  3MG3 A;  4LLR A;  3A5W A;  2F99 A;  2C0F A;  6GSU A;  5FHI A;  3G8Z A;  4H3U A;  1VQ5 3;  1BAY A;  3F14 A;  2FGX A;  4HU7 A;  5E4W A;  3IXR A;  3KGK A;  1K41 A;  3Q90 A;  3R2Q A;  2RFR A;  4L8E A;  1WMJ A;  5H5Q A;  1BVI A;  5LNK e;  1W5Z A;  1K0D A;  5ECK B;  3UJ1 A;  1PMT A;  2R4V A;  2H0G A;  5ID2 A;  1JJ2 2;  4K1F A;  2QA2 A;  1JN5 B;  2XSO B;  2W03 A;  1UUG B;  2KHP A;  1PU4 A;  3GZR A;  2TRC P;  1KQS 2;  1K28 A;  4LL1 B;  1AVK A;  4GLT A;  4K5S A;  5D8I A;  2WB9 A;  4MH3 A;  2MBT A;  2ZL8 A;  1GLP A;  2AYT A;  1WTH A;  1K73 4;  2DJ3 A;  1M9A A;  2B24 B;  3U5R E;  3J7Y b;  3C7M A;  2TRX A;  1A0F A;  1WWJ A;  1Q86 4;  4V1A p;  1DET A;  1Y25 A;  1TK8 B;  2YV9 A;  4MMY B;  1ROA A;  4DSQ A;  4ZBD A;  1JNQ A;  4OO4 A;  1BRS A;  2OBI A;  3W6G A;  5IOX A;  4NPB A;  1ZOF A;  3A5E A;  1RLS A;  1X5D A;  1PA3 A;  1ERT A;  3FR3 A;  1BUQ A;  4X2O A;  1TKD B;  3P2A A;  1KEB A;  6GSY A;  3APO A;  4JU5 A;  3NOF A;  5JBS A;  3D4A A;  3EMX A;  4TR3 A;  2AAE A;  4E8H A;  4GHO A;  5ECR B;  3Q2P A;  5IIZ A;  1OGZ A;  3L9V A;  3FKA A;  3VLN A;  2PGT A;  3NM7 A;  3VFI A;  4HM5 B;  2YWO A;  3CCR 3;  3D22 A;  5DAL A;  6GSW A;  1RGE A;  1DBY A;  4MF7 A;  1GTI A;  2V32 A;  1HNC A;  3NBR A;  2GBW B;  3FH1 A;  4I8B A;  3HCZ A;  5HFI A;  5D73 A;  5JWO B;  4GQC A;  3ZMK A;  3KTL A;  3QR6 A;  1K0N A;  1W6C A;  5ELU A;  1TUH A;  1OAC A;  4ECB A;  4HM7 B;  1AY7 A;  1TI1 A;  4TXO A;  1N5H A;  4IHU A;  1K3O A;  1QAL A;  2GEY A;  3MHE A;  4HQS A;  3DGY A;  3LW9 A;  5GAN D;  1TTO A;  3ZG0 A;  1SYX A;  1MWR A;  4HOJ A;  2AHE A;  1RDS A;  1ULI B;  1PGT A;  3KD0 A;  3S29 A;  4WKW A;  4F03 A;  1TFK A;  3WR2 A;  4Z2T A;  2IA7 A;  1GNW A;  2O85 A;  2X49 A;  1OC8 A;  1OKT A;  4EIP A;  1OKD A;  2H73 A;  3B4P A;  2HZE B;  3SOA A;  1TRP A;  3DVW A;  3O76 A;  4IVF A;  1B4Q A;  2H66 A;  2OAC A;  4JR6 A;  3LFL A;  3MG2 A;  3E99 A;  3HII A;  1UCI A;  3EC9 A;  4HKV B;  1Z7P A;  1SKR B;  1GD3 A;  1GMP A;  2A4H A;  3CXC 2;  1N9J A;  3UAP A;  17GS A;  4QL9 A;  3KXO A;  2H1A A;  1YIJ 3;  1TW9 A;  1IYY A;  1T8E B;  3ZIJ A;  1B2X A;  4TXV A;  2F5M A;  4D73 A;  3TJK A;  1VZZ A;  4HJL B;  1LVN A;  3I43 A;  1L5G B;  5GSP A;  3QAV A;  2REM A;  3ERG A;  1H75 A;  2YX9 A;  1SD8 A;  4HU9 A;  3UBK A;  4IN0 A;  5HQP A;  2C3T A;  4HZ2 A;  2IFQ B;  4GWR A;  5EPF A;  3A3T A;  2I3Y A;  1BRI A;  3IC8 A;  1ILO A;  3VPQ A;  3GMF A;  2GQM A;  3FG3 A;  2K8V A;  5CRH A;  4K2D A;  2E2T A;  1TRW A;  3Q1C A;  4ML1 A;  1S72 3;  4FMA A;  3CTG A;  4LEH A;  2GEX A;  1ASK A;  1GP1 A;  1XOB A;  3DIE A;  1GLQ A;  4PUA A;  1B9X C;  1EQK A;  1ERU A;  3FLJ A;  3EUR A;  5KOX A;  5AEW B;  4KND A;  3LML A;  2IUK A;  3CYN A;  1VQO 3;  1T7P B;  5M1A A;  3S5C A;  1NW2 A;  4YKF A;  5IQY A;  5G30 A;  3BND A;  5LC7 A;  2DML A;  1LNI A;  3EWL A;  4JE1 A;  1UGI A;  2EIQ A;  1YHQ 3;  3CMI A;  2VLT A;  3DKS A;  4YQV A;  2JSZ A;  2H8L A;  1OHS A;  4XS1 A;  3M9K A;  1DMM A;  4X43 A;  5I97 A;  1Q42 A;  4BIR A;  4MF6 A;  1TK0 B;  1M1K 4;  2JSY A;  2HMK B;  3P7X A;  1GS3 A;  4IJI A;  1S3A A;  1A2M A;  4BTW A;  2RBI A;  1ZYQ B;  3IA1 A;  5A4W A;  1WE0 A;  2I1U A;  4MA9 A;  3DGQ A;  1PFP A;  4NV5 A;  4NHW A;  4L7K A;  3IMA B;  2PPT A;  1BIR A;  4V2M A;  2N5B A;  1IVU A;  3KJY A;  4K7N A;  4YKG A;  2KLX A;  2R37 A;  2FA8 A;  3OWU A;  4BIK A;  3SVA A;  2PWJ A;  1HU9 A;  1GSP A;  1E3V A;  1R5A A;  2YFI B;  1M2A A;  5FGO A;  5BMU A;  4RZM A;  4GB5 A;  4OFN A;  2QGU A;  2XFT A;  2H74 A;  1IVW A;  1I2E A;  3EBY A;  3B7C A;  1JN5 A;  5KN0 A;  3EIN A;  3MWH A;  2A2P A;  4XRA A;  1GSF A;  4HDE A;  2CFD A;  1ZX2 A;  5AII A;  1GUM A;  1U87 A;  4AKZ A;  1H4O A;  4O5Q A;  1WPI A;  1RGL A;  2HMO B;  2VCT A;  3EPT A;  4TOP A;  1YQ1 A;  1DMN A;  1EG9 B;  3A2W A;  1BUJ A;  2YWI A;  1ROV A;  3HI7 A;  3CSI A;  1UCL A;  3EB8 A;  2O87 A;  1AQX A;  2BU4 A;  4XBY A;  1YDK A;  2ON7 A;  4FYC A;  4N0Z A;  5CAX A;  2TIR A;  3LYG A;  3TKP A;  3EU3 A;  4WF4 A;  2OOV C;  2DJ2 A;  1RK4 A;  2B6M A;  4QQ7 A;  4ZBB A;  1C72 A;  4OUQ A;  1A24 A;  1FA3 A;  2WOF A;  2L5L A;  1ULJ B;  3OV4 A;  3DYR A;  4RNZ A;  1BNS A;  4AJ6 A;  5KP4 A;  2KF6 A;  1ZYP A;  2C11 A;  4HZ9 B;  1B20 A;  3UJM A;  1VQN 3;  1MEK A;  1FB6 A;  2A2R A;  1RKY A;  4ZM8 A;  2V1M A;  3IRA A;  1MGR A;  4R80 A;  4N30 A;  5CO3 A;  4BTY A;  1U3A A;  1T2H A;  5D9X A;  5STD A;  1KTE A;  5ECM B;  2IMF A;  5CNW A;  5FWG A;  1FUS A;  3GZX B;  1FO5 A;  4NXI A;  3NM2 A;  2YJH A;  1WOU A;  2WO0 A;  3EHC A;  1SIH A;  3K9M C;  4L8O A;  4NAX A;  1GSU A;  3IPT A;  1EWX A;  4YQM A;  2B5E A;  3BJ5 A;  2GU1 A;  1GSS A;  2R3X A;  4MF5 A;  1HKX A;  2FY6 A;  5IG5 A;  1AQW A;  4KH7 A;  3L9S A;  3X41 A;  1STD A;  2IJY A;  6GSV A;  1KSI A;  4EO3 A;  3PS8 A;  4KSM A;  2RLI A;  2VAF A;  3LYP A;  3FZ5 A;  4EXR A;  1FW7 A;  4N10 A;  1J9B A;  3F7X A;  1FOV A;  2FUG 2;  2M80 A;  4EC6 A;  11GS A;  4EL1 A;  3APQ A;  3TRX A;  2CG0 A;  3D4T A;  4HS1 A;  4LMI A;  1GY7 A;  5IMZ A;  1DE2 A;  3RDW A;  3RAZ A;  3QDN A;  3CNX A;  1W2Z A;  2HE3 A;  2LYX A;  1LOV A;  1K0M A;  1YF0 A;  1O8X A;  2VCV A;  5B6N A;  4EVM A;  1OE8 A;  2O8V B;  4XIH A;  3TJF A;  2O89 A;  4K8M A;  5JCG A;  3S67 A;  2OA7 A;  1JRQ A;  5DDL A;  5DRE A;  5IER A;  2DKH A;  1LQM B;  2GBX B;  3CNM A;  4MZW A;  4KDX A;  2JQ5 A;  3DML A;  4HBR A;  2KAA A;  3TCO A;  1EZK A;  3X3Y A;  1ML6 A;  1UN2 A;  2MZC A;  2VM1 A;  4JRR A;  5DQY A;  4QL7 A;  3SWL A;  1QGV A;  4OCE A;  4WYK A;  4DKI A;  12GS A;  3G0K A;  3HYP A;  5H5S A;  4GSS A;  6GSP A;  3WHO A;  2Z77 A;  1SL1 B;  3HJO A;  3DEX A;  3CCS 3;  1BJX A;  1R26 A;  2AB6 A;  5A5K A;  1RN4 A;  1SK2 A;  1W89 A;  2LKU A;  2Y74 A;  2D42 A;  1LU4 A;  1RNB A;  5ECN B;  3OWS A;  2XF3 A;  4G10 A;  1YKC A;  1EA2 A;  1O7N B;  1A2V A;  1GTA A;  1S3D A;  1RCL A;  2DIY A;  2F51 A;  4ECI A;  5F07 A;  1EUI C;  3I9V 2;  2OTL 3;  2RUE A;  1QQ2 A;  2VD0 A;  1G6Y A;  1RGG A;  2LJR A;  3CBU A;  4CPK A;  1GL8 A;  1CQS A;  5D83 A;  1OAZ A;  1SU9 A;  4O92 A;  1I8V A;  2B1X B;  2HRN A;  4XBX A;  4OO5 A;  4FCZ A;  4PNG A;  2IY2 A;  3MDK A;  3TKS A;  3SX1 A;  1OHP A;  3APS A;  3CSH A;  1O73 A;  1F8N A;  1NDO B;  3EN1 B;  3KZT A;  1M7T A;  3TJG A;  3QAW A;  1T4Z A;  5FT3 A;  1MD4 A;  3WOE B;  2GTU A;  1IV9 A;  4TR1 B;  2WGQ A;  1MD3 A;  2YJ7 A;  4JF8 A;  1JZR A;  4EE0 A;  2KUC A;  2L4V A;  3X40 A;  1AR0 A;  3ZFB A;  4XB5 A;  2Q07 A;  3W8J A;  4P3Y B;  3GN3 A;  4EKZ A;  1BSD A;  3I0Y A;  4DVC A;  4CJN A;  2JZR A;  1M0U A;  2W56 B;  2HMM B;  5CXO A;  3GSS A;  3F8U A;  5ECS A;  1OPY A;  4F0B A;  1KD1 4;  4JBB A;  4K5R A;  4MJE A;  2Z9S A;  4WHA A;  3LTD A;  3IAS 2;  1ZZY A;  3VK9 A;  2HML B;  1XCC A;  2F8A A;  1IYI A;  2VCZ A;  1M2B A;  5EL8 A;  4WFO A;  5IF6 A;  3QPM A;  1QMV A;  4MJB A;  2HRK A;  4QWT A;  1OC9 B;  3ALA A;  3QMX A;  3S28 A;  2FD3 A;  3MAK A;  4HOH A;  1JLV A;  4K2X A;  3VWU A;  2Z76 A;  3GX0 A;  4NHZ A;  3O8Y A;  4PUR A;  4WET A;  4WBJ A;  3ZRE A;  3MKI A;  1T2I A;  2FLS A;  2M7O A;  5AIH A;  5B7C A;  6STD A;  2P0X A;  22GS A;  5DRV A;  2LS5 A;  2VM2 A;  5IPH A;  3JVC A;  5G31 A;  4CCV A;  1NM3 A;  5C04 A;  4L0U A;  4U13 A;  5ECP B;  4YAV A;  4MAB A;  3UIW A;  3UOM A;  5J3R A;  2DBC A;  1RRL A;  1M1X B;  2IN3 A;  2I4A A;  3LXT A;  3FG4 A;  1I3I A;  1BGS A;  4BL2 A;  3I55 3;  3X42 A;  1J2B A;  3QFA C;  5DBQ A;  1YGE A;  2BMQ B;  3NIV A;  4OD7 A;  4XDW A;  2R0G A;  4ORL A;  1XWA A;  1T1V A;  2PZV A;  1MDK A;  9GSS A;  2BO9 B;  4IGJ A;  3LOY A;  2W0Q A;  5J5N A;  1SII A;  1WMP A;  2WS2 A;  3HHV A;  4FO5 A;  1F3B A;  3I6A A;  4EUY A;  3BIR A;  2K0M A;  2H1B A;  2H70 A;  3AGO A;  4TVE A;  3M8C A;  1BOX A;  1AUC A;  5J41 A;  1OHO A;  3H1N A;  7GSS A;  1NO3 A;  3TB2 A;  5D81 A;  4LYL B;  3WA3 A;  1RGH A;  5D96 A;  4FYU A;  2IMI A;  1NB5 I;  2FWF A;  2ZUP A;  5JPU A;  4ULX A;  1W4N A;  3IBH A;  3F6D A;  1NJI 4;  1T4Y A;  3RNT A;  1K0O A;  4HZB B;  3AHS A;  2JL4 A;  4STD A;  1N8R 4;  2WZ9 A;  4G9H A;  4KVH A;  3VGN A;  3C71 A;  3VUR A;  1ZGX A;  4BVY B;  1ZYE A;  3IE3 A;  2CT6 A;  3R3E A;  1US1 A;  2DJJ A;  1JFU A;  3D3L A;  2D2Z A;  1A2L A;  1ERW A;  5CF2 A;  4RQX A;  1TOF A;  2GVP A;  2IWT A;  1G02 A;  1TDI A;  2H71 A;  1X0R A;  1YGW A;  5IPG A;  1G7O A;  1K3Y A;  2FXT A;  1JV2 B;  5TGN A;  3G6E 3;  1VQL 3;  1N8Q A;  2C3N A;  3ERF A;  3HA9 A;  3ME7 A;  1A2P A;  1R4W A;  1YJ6 A;  3PGB A;  2GZZ A;  2BMR B;  4H86 A;  1LOW A;  4WR5 A;  2VUP A;  2H1G A;  2NDO A;  6RNT A;  3D9R A;  4X1U A;  4J8T A;  1STF I;  2R41 A;  4POK A;  2J8X B;  3GWR A;  4G0K A;  1DSB A;  1RN7 A;  1XVQ A;  3KM6 A;  4BVX A;  2VCX A;  1URM A;  4HM0 B;  2QC7 A;  4EC0 A;  4G19 A;  2B1K A;  5M19 A;  5ABR A;  5IOW A;  3LH4 A;  1USB A;  1A67 A;  2VCW A;  1TRS A;  5B6M A;  1CYU A;  3LT9 A;  1GNE A;  3HD5 A;  2STD A;  3BNE A;  4TRX A;  1QVG 2;  1Q40 A;  2NPB A;  4KCA A;  2R0P A;  1BED A;  3GHA A;  5JWQ B;  4X0X A;  2XEP A;  5LD0 A;  2LJK A;  2XGN A;  4L0W A;  1A0R P;  3LG6 A;  3TDG A;  1PYL A;  2H19 A;  2KP1 A;  4G0L A;  2UUG C;  1TU5 A;  2OE3 A;  5CP1 A;  5AIG A;  1I70 A;  5D9T A;  1GUL A;  4KDY A;  5GZZ B;  1YY7 A;  3G4S 3;  1SD9 A;  2M46 A;  3GYK A;  2QEX 3;  4K61 A;  2B5Y A;  4J56 E;  1O85 A;  3PXM A;  4PQI A;  3CQF A;  3ED3 A;  4HJ2 A;  2P05 A;  4K0N A;  3GKX A;  1JZD A;  3GX8 A;  1YNV X;  5IG0 A;  3L9U A;  3H93 A;  2XC2 A;  2LEG A;  2OAD A;  4MPF A;  2CVB A;  1B2S A;  1TJD A;  5AIF A;  1TXX A;  3IR4 A;  4EBG A;  4ACS A;  3ZYW A;  5G5E A;  2OE1 A;  1GSE A;  3WOF B;  3T8N A;  1IV7 A;  3HOH A;  3I69 A;  4TX4 A;  4Q5F A;  2HYX A;  4TR1 A;  2OCT A;  1VQP 3;  3DGO A;  2GT6 A;  2HLS A;  2RGQ A;  4ZBA A;  1GMQ A;  3VPT A;  4TKY A;  5IMD A;  1EV9 A;  3NUV A;  1K9M 4;  2N5A A;  3HY2 A;  4RNT A;  3U97 A;  1DVD A;  5DAK B;  1UVZ A;  1QFN A;  2LV3 A;  1A90 A;  3FZ9 A;  1RNT A;  4XS4 B;  4O8S A;  3G7Y A;  4OFT A;  3WDG B;  1BAO A;  1XWK A;  3OXA A;  1RRH A;  1X5E A;  4IQA A;  3GUS A;  1OC9 A;  1BQ7 A;  1QK8 A;  1KC8 4;  5AEU B;  1GUK A;  1BU4 A;  5BU4 A;  3IAM 2;  4PXO A;  1M3I A;  1ACV A;  4HM2 B;  3AHW A;  2NTO A;  2MBS A;  4OWY A;  2PNC A;  1MOL A;  4R9L A;  1PL2 A;  1G6W A;  1PY3 A;  4XBT A;  1Q98 A;  2P31 A;  2X64 A;  2J9H A;  4F82 A;  4IKH A;  2LUS A;  3CRT A;  3NHX A;  4F9Z A;  5C00 A;  4O5U A;  1JLW A;  4KW6 A;  4KF9 A;  4TN8 A;  4A5P A;  3EQQ B;  1MNL A;  2XFS A;  3IK9 A;  5E59 A;  5JWR B;  1W00 A;  3X3Z A;  3D5J A;  4I5Q A;  3TKR A;  1PSQ A;  3LJR A;  2HRF A;  5ECI B;  1GY5 A;  2CA8 A;  2GDR A;  1V57 A;  3EE2 A;  1F6M C;  3AGN A;  1VQ8 3;  4H61 A;  1AXD A;  2MMZ A;  2YV7 A;  1WQL B;  2CVK A;  2VLU A;  2L4C A;  1FW1 A;  2E2G A;  1V9W A;  4MZB A;  4OMV A;  4IW9 A;  1I0X A;  3UVH A;  1OH0 A;  1BNG A;  2CV4 A;  1BX9 A;  1WP0 A;  1SEN A;  2BIR A;  3Q6O A;  2BMO B;  3T8U A;  1PL1 A;  4TW5 A;  2CG1 A;  3VSY A;  3L0R A;  2DMM A;  3QOU A;  3BCK A;  1C7H A;  1F3A A;  2NBS A;  1QAK A;  3NV0 A;  3LGC A;  3BNB A;  2VOC A;  1O7U A;  2F4Y A;  4ZXG A;  3MSO A;  2C8U A;  3CCM 3;  3X3X A;  2XPE A;  3QD9 A;  3H4K A;  1TTZ A;  1N5P A;  4KT3 B;  2H0I A;  2ZNM A;  1G96 A;  5EQL A;  4O5R A;  1EOG A;  2IMJ A;  2QGV A;  4ZL7 A;  1GSQ A;  3LYK A;  3KCH A;  4BVY A;  3MG1 A;  2R0C A;  4DSR A;  2GSQ A;  10GS A;  3M1G A;  3S27 A;  2JU5 A;  3IV4 A;  4MCU A;  2CFG A;  3RPN A;  4NV2 A;  5CF1 A;  1MDJ A;  1G7E A;  3P8W A;  1KBN A;  1IVX A;  3TOU A;  3HJP A;  2GSP A;  2C80 A;  1XG8 A;  3IOS A;  3UL5 A;  1V2A A;  5KN2 A;  2E2U A;  2V6O A;  4IP1 A;  2ES7 A;  1FZU A;  2R4I A;  3K63 A;  2R2J A;  4DEJ A;  3WYW A;  1IQX A;  5L71 A;  3LEF A;  7RNT A;  5AN1 A;  1FG4 A;  3EYT A;  3GSP A;  2IUJ A;  3VI7 A;  4RNY A;  1DVC A;  2WRT A;  2UZ8 A;  4EIQ A;  5B8A A;  1WRY A;  3PPU A;  3HIG A;  2LTK A;  1J08 A;  2MMA A;  2BT3 A;  1GSY A;  8GSS A;  1R7H A;  2YZU A;  4GQF A;  3KZQ A;  3LSZ A;  1MWT A;  1BG5 A;  3N8B A;  4CY6 A;  4DSS B;  1SYR A;  1BSC A;  1EKM A;  4CHS A;  2H6Y A;  3CC4 3;  2XBQ A;  3FR6 A;  3WA2 X;  4LMW A;  2W9P A;  5DVB A;  2CC3 A;  1RCK A;  3A76 A;  3FGY A;  5RNT A;  3EVI A;  3F9S A;  3U6V A;  3D6I A;  4X4J A;  3U1W A;  1Q7Y 4;  5F05 A;  18GS A;  1ZCP A;  1XWB A;  1XWC A;  1KWI A;  4FIW A;  3K8N A;  1B8X A;  3CCJ 3;  4K1V A;  1OF5 B;  1VQ7 3;  3ZRD A;  2C3Q A;  1TK5 B;  2DJK A;  1Z6M A;  2XR8 B;  2K9F A;  2LNS A;  4NWY A;  1XFL A;  1OCV A;  1QXH A;  1XPV A;  1IYH A;  3GRD A;  2HNL A;  3ZLP A;  3EMP A;  4PQ1 A;  2CVD A;  1GYB A;  1W4V A;  3F0I A;  1BRN L;  2CAQ A;  1NHO A;  3SBC A;  2V6K A;  3RHB A;  3QK9 A;  4L8P A;  2YWN A;  3IK7 A;  2YNX A;  5ECH B;  4HM4 B;  1O6J A;  1O7H B;  1K8A 4;  1EV4 A;  2JZT A;  4MH2 A;  2CX1 A;  4G2E A;  2OJL A;  1JKG B;  5ELG A;  4ZB6 A;  4L5O A;  5HR1 A;  5CRW A;  2GS3 A;  1PKZ A;  4WEY A;  3H51 A;  3V99 A;  1WIK A;  4HAA A;  2IPA A;  3ISO A;  5ENU A;  1U88 A;  1CH0 A;  4EYC A;  1YZX A;  1B2M A;  1J0F A;  1UCJ A;  3DZL A;  5DAK A;  1FGM A;  2CKF B;  2H76 A;  3F4T A;  1WMO A;  1LRA A;  4XS4 A;  2OOV A;  3F8X A;  2LNT A;  1Q81 4;  3FRC A;  1YJ9 3;  2RUF A;  3FZA A;  4KAE A;  2H72 A;  1RGA A;  1XXU A;  2LJA A;  2Y73 A;  3JUO A;  1A8Y A;  2G0F A;  2KXG A;  2WDU A;  2MYG A;  4ICY A;  5G2G A;  1JZW A;  1K0A A;  3VWV A;  4KFE A;  4LSO A;  4FMC A;  2LRC A;  5G5F A;  2XRX B;  1RSN A;  3WMD A;  3UBL A;  3VWW A;  3HVS A;  3TGZ A;  3W8S A;  5AYS C;  2MC8 A;  1OVN A;  2K6V A;  2L4Q A;  3GNJ A;  5J4U A;  3EX9 A;  2IMD A;  4FR9 A;  3CSJ A;  1B2U A;  4KGI A;  2HZE A;  1I2F A;  3T0U A;  3KIJ A;  4MP4 A;  5J9C A;  4AKY A;  5CRE A;  5IEO A;  4YH2 A;  3F9U A;  2H75 A;  4ML6 A;  1MDI A;  1S3C A;  2CFW A;  4JZQ A;  8CHO A;  3ZIT A;  3CCV 3;  3BNC A;  3WGX A;  3UNL A;  1X1U A;  4IEL A;  1ISK A;  1AIU A;  3NQY A;  1BYE A;  1ON4 A;  3ZZX A;  1YEX A;  1VQK 3;  2VO4 A;  1M2D A;  3GZB A;  2GZP A;  4HEA 2;  3C1R A;  1FOH A;  4MMZ B;  4BTX A;  1NNV A;  3GRX A;  2IFQ A;  5DJM A;  4NMU A;  1T3B A;  1AQZ A;  5HFG A;  1UA5 A;  4Z2R A;  1O7G B;  1IQ8 A;  1RQM A;  5IEP A;  3FW2 A;  4FYB A;  3HZP A;  3G7J A;  3LWA A;  3KKG A;  2K8S A;  2VL2 C;  2RM6 A;  4Q5N A;  5ID2 B;  4MMX B;  1NWW A;  4O3V A;  1Q9E A;  4MJC A;  4CDL A;  3CC2 3;  5DCH A;  3FK8 A;  4EW5 A;  4E8E A;  3BBY A;  4EV5 A;  1S3R A;  5IO0 A;  1ZL9 A;  1GOU A;  2LQV A;  1M99 A;  3G71 3;  4POB A;  5KN1 A;  1EEJ A;  1EP7 A;  3D5I A;  1TP6 A;  1U6T A;  5JPP A;  1B21 A;  2P09 A;  2W9Q A;  4IIA A;  1W2B 2;  1A23 A;  1CYV A;  4MK3 A;  5A0O B;  2H01 A;  3CPW 2;  1WJK A;  1X1Y A;  1JHB A;  1IK3 A;  1AQV A;  5EVO A;  4GL6 A;  4XCS A;  2QIY A;  2JAD A;  1RW1 A;  4LZI A;  4F0C A;  2J23 A;  3FZW A;  2LRN A;  4CW9 A;  1GSD A;  3TKQ A;  2O3O A;  3GZY B;  1VF2 A;  1ZS7 A;  2ON5 A;  1SJ6 A;  2INX A;  1N9E A;  1X5C A;  5IEN A;  1VQQ A;  1HNA A;  1JBR A;  2HZF A;  1PN0 A;  4GST A;  3HJM A;  1BNJ A;  1RGF A;  2B7J A;  1B27 A;  2MF7 A;  1TRV A;  1XW5 A;  2DJ1 A;  3RGA A;  1UI8 A;  1MWS A;  1UGH I;  4WR4 A;  2OQE C;  2BTO T;  2X8H A;  3DMC A;  3PCS A;  4X2H A;  5B8B A;  3C73 A;  4USS A;  1PX7 A;  3URP A;  5DAL B;  3Q18 A;  3RPP A;  1CQG A;  4DSS A;  3GFK A;  5HR0 A;  4GTU A;  1BRJ A;  2E0Q A;  4R4K A;  4LA1 A;  1AAZ A;  4I4K A;  1IT8 A;  3ZG5 A;  1BSE A;  1GMR A;  2WJU A;  3H3H A;  2LQQ A;  3SLU A;  3GL5 A;  4BL3 A;  2CZ3 A;  4TXO B;  1TIJ A;  2ZCT A;  2MMO A;  3KH7 A;  2EC4 A;  1SJZ A;  3N5O A;  1YI2 3; 
#chains in the Genus database with same CATH homology
 2HSM A;  20GS A;  4XHM A;  4MMM A;  4PUF C;  2FHE A;  2FCH A;  3GA4 A;  1E2Y A;  4RI7 A;  1X9M B;  4N11 A;  2YCD A;  1SJI A;  2OE0 A;  2CQ9 A;  5ECQ B;  1I9D A;  3M8N A;  2PU9 C;  5CRD A;  1HYU A;  4Z7X A;  4WBR D;  3CTF A;  1SL0 B;  4PQH A;  4WXT A;  2L6D A;  3F4R A;  3GH6 A;  4BL7 B;  2VLV A;  3N9J A;  2YPM A;  4D73 B;  3QFB C;  4AF2 A;  4GXZ A;  4N0V A;  1LJR A;  1GRX A;  4YQU A;  1K0B A;  2WGR A;  3TOT A;  4IP6 A;  1V58 A;  5KOW A;  4JR4 A;  4ZIJ A;  4MLY A;  3UAR A;  1ZMA A;  5J9B A;  4ISD A;  3ZVJ D;  1EEM A;  1SK0 A;  1GTU A;  5HR2 A;  1GUH A;  2IYJ A;  3E3E A;  2XBI A;  2I81 A;  4KA0 A;  2CX3 A;  3G7I A;  2E2M A;  2VD1 A;  5A4U A;  3C1S A;  4JED A;  2HXK A;  3FY7 A;  2QA1 A;  4KB3 A;  1F2E A;  2YWM A;  2VIM A;  1LBK A;  2IME A;  3F3Q A;  3F3R A;  5EY6 A;  1V40 A;  3GUR A;  2DSA A;  1XW9 A;  1XBS A;  3L0H A;  2RII A;  1FB0 A;  2ALB A;  2AAW A;  5F8B A;  4Q5R A;  2N5F A;  2GST A;  2O7K A;  4MNN A;  1TP9 A;  1PD2 1;  4IBP A;  1OE7 A;  4BWS A;  4PX1 A;  2YZH A;  3KMN A;  5DJL A;  1FAA A;  5KEJ A;  1XVW A;  5G1L A;  6GSS A;  3UMA A;  3QCP A;  4I6X A;  2B7K A;  4EF0 A;  1F9M A;  3RBT A;  4V1A g;  2RM5 A;  3IDV A;  4ECC A;  1XW6 A;  1SL2 B;  3J7Y k;  3F6F A;  4V2L A;  2C4J A;  3DXB A;  4CDO A;  4F2I A;  2HT9 A;  3UVT A;  3MSZ A;  1G0T A;  2GLR A;  3WD6 A;  1O81 A;  2P5R A;  1O8W A;  2B5X A;  4KUN A;  5DCG A;  1U3I A;  1XWG A;  5AIV A;  1Z7R A;  3ERW A;  2L5O A;  3KH9 A;  5AIS A;  1XOA A;  2L59 A;  3WGE A;  2H1D A;  4I2T A;  5IMV A;  4XS6 A;  6GST A;  2PVO C;  2EIR A;  1N8J A;  3ZFL A;  2X4A A;  2HFD A;  3DWV A;  3LXZ A;  1PX6 A;  1Z9H A;  4MZC A;  1MTC A;  4RUV A;  5KN3 A;  3D0Z A;  3FHK A;  5IMF A;  4BL7 A;  2YAN A;  4HUA A;  4KDU A;  4ZB9 A;  1X9S B;  2H6X A;  2VL3 A;  3PIN A;  5G2Z A;  1PKW A;  3ME8 A;  2GSS A;  4GCI A;  5D93 A;  5JCU A;  1EGO A;  2R6K A;  3AY8 A;  4J2F A;  2A2S A;  2F3M A;  2X8C A;  1F37 A;  3A5I A;  1V98 A;  3P90 A;  4V2N A;  5G1K A;  5GAP D;  2FWH A;  4EDZ A;  3KP9 A;  3HKR A;  14GS A;  4ID0 A;  1JZO A;  3F4S A;  4K7I A;  3FKF A;  4TR4 A;  3ZL5 A;  2C0D A;  5H5R A;  3KCM A;  3BD2 A;  4Q5Q A;  2H6Z A;  2F8F A;  3HXS A;  2EIO A;  2XPD A;  3US3 A;  1PRX A;  5CRG A;  4IS0 A;  3ZTL A;  1X9W B;  1SK1 A;  3GL3 A;  3ZIV A;  4HQZ A;  4YAP A;  2C0E A;  1K3L A;  2WUL A;  4EXJ A;  4POL A;  1VF1 A;  3HZ8 A;  1T00 A;  2CAI A;  1AC1 A;  4K6X A;  5DQS A;  3KEB A;  3HZ4 A;  2WFC A;  1ABA A;  5JCW A;  2LQO A;  1TI3 A;  3GKK A;  1E6B A;  2FWE A;  3Q19 A;  1FVJ A;  4PNF A;  4BPY A;  3EC3 A;  6GSX A;  3A2X A;  3CXG A;  1PN9 A;  1CQH A;  2JZS A;  4RI6 A;  1SKS B;  1HQO A;  1Q4J A;  3A2V A;  3ZML A;  2FA4 A;  4GSN A;  2GZY A;  2BJX A;  4MDC A;  3BOA A;  2K18 A;  3E0U A;  4ZB8 A;  2QKE A;  5IO2 A;  4KSO A;  3FYG A;  3IC4 A;  3WT1 A;  3KTB A;  3DD3 A;  3S9F A;  5A4V A;  3M9J A;  3MYD A;  1AW9 A;  2PMT A;  2YOI A;  5GST A;  3WGD A;  5ECO B;  3IHQ A;  4KX4 A;  2P5Q A;  4WF5 A;  3EU4 A;  1HNB A;  4IQ1 A;  2CZ2 A;  1THX A;  2PVQ A;  5F06 A;  1UC7 A;  4FH8 A;  1DE1 A;  4ZL9 A;  2DKI A;  3QAG A;  1ZYN A;  5AIX A;  1Z3E A;  1NSW A;  2H30 A;  5IM9 A;  5INY A;  1VF3 A;  4AGS A;  1TU7 A;  4ZIL A;  1Z5Y E;  2B1L A;  4J57 E;  1GTB A;  2PUK C;  2IIY A;  3RHC A;  2HI7 A;  1B48 A;  3UL3 A;  2X99 A;  4XRD A;  3E9J B;  3Q74 A;  2IMK A;  4HJM A;  3GTU B;  4AJ7 A;  2B3S A;  3TRP A;  2L6C A;  1K0C A;  3H8Q A;  3OR5 A;  4KCE A;  2OBK A;  3DRN A;  3PH9 A;  5GSS A;  2C1Y A;  4CY8 A;  2I9H A;  1I5G A;  1XZO A;  5D9W A;  4BVX B;  3FMW A;  3ZVJ A;  3GIX A;  2A4V A;  3L4N A;  3HDC A;  3GKM A;  3HVX A;  1NHY A;  1YF1 A;  3TKS C;  4HZ4 A;  16GS A;  2XHF A;  3TJJ A;  4PGT A;  5ECL B;  2X8G A;  1XIY A;  2DC5 A;  4MJA A;  4Z2U A;  4FQU A;  1B4P A;  1B9Y C;  4I97 A;  2V2G A;  2GGT A;  3JCM L;  1N2A A;  2F9S A;  5COH A;  1KNG A;  1EGR A;  2E7P A;  1Z6N A;  3IHG A;  1VF4 A;  4G0I A;  3M0F A;  4L5L A;  2V41 A;  3V1W A;  3FEU A;  3WT2 A;  3L78 A;  3O3T A;  5HFK A;  1PQN A;  2PBJ A;  1Y6E A;  2VL2 A;  3KP8 A;  2C0G A;  4IJ3 A;  5F0G A;  4TR0 A;  2QSI A;  1OYJ A;  2LRT A;  4HI7 A;  13GS A;  2R5G A;  5LCZ A;  2GT5 A;  4K9Z A;  1HD2 A;  3VWX A;  5BRT A;  3GH9 A;  2BMX A;  2PER A;  3NZN A;  3M3M A;  2OKA A;  4MPG A;  3FR9 A;  4LL4 B;  3MIX A;  1YKA A;  2NVL A;  1THO A;  2H0H A;  2P0G A;  4ECJ A;  1SKW B;  1R5P A;  4GRF A;  2IL3 A;  2VL9 A;  4K0G A;  4OCF A;  2DJ0 A;  1EP8 A;  5IMA A;  1A8L A;  4KE3 A;  1GH2 A;  3IPZ A;  4ZL8 A;  4PTS A;  4O7H A;  2M72 A;  2AUV A;  3D21 A;  2GQK A;  4K7O A;  5ELA A;  4BWQ A;  1ERV A;  4POM A;  2CX4 A;  3BCI A;  2HSY A;  3O6T A;  3CRU A;  1DUG A;  3MNG A;  1TU8 A;  2L57 A;  3G9B A;  1VRS D;  2KOK A;  1TRU A;  2DIZ A;  2HRA A;  2FWG A;  2GSR A;  1EOH A;  1FHE A;  4OFM A;  3C8E A;  3PR8 A;  3GKN A;  2YN1 A;  4BA7 A;  1FVK A;  1VGL A;  2HSH A;  3HVV A;  3TKS E;  4GF0 A;  3D4M A;  3TJB A;  4LMV A;  4XTS A;  1M9B A;  2PN8 A;  3TUE A;  19GS A;  3DVX A;  3LOR A;  2YP6 A;  4EDY A;  1YEP A;  1OC3 A;  3FZ4 A;  5IMC A;  2FNO A;  1GWC A;  2MMN A;  1QUW A;  3GV1 A;  5AGY A;  5CYY A;  2JAC A;  1A2J A;  2AV4 A;  4AJ8 A;  5D9V A;  4I2U A;  3TRQ A;  3GST A;  3VI5 A;  2G2Q A;  1ST9 A;  2LST A;  2AJQ B;  3LQ7 A;  2WCI A;  4RQR A;  2GQL A;  4O32 A;  3UEM A;  2KP2 A;  5HR3 A;  3PGT A;  2VCQ A;  3KMO A;  3H79 A;  4ILF A;  2DLX A;  3GTU A;  1ZGN A;  3F63 A;  4LLR A;  3A5W A;  2C0F A;  6GSU A;  5FHI A;  1BAY A;  2FGX A;  4HU7 A;  5E4W A;  3IXR A;  3KGK A;  3R2Q A;  4L8E A;  1WMJ A;  5H5Q A;  5LNK e;  1K0D A;  5ECK B;  3UJ1 A;  1PMT A;  2R4V A;  2H0G A;  5ID2 A;  4K1F A;  2QA2 A;  2KHP A;  2TRC P;  4LL1 B;  4K5S A;  4GLT A;  5D8I A;  2WB9 A;  2MBT A;  1GLP A;  2AYT A;  2DJ3 A;  1M9A A;  3U5R E;  3J7Y b;  3C7M A;  2TRX A;  1A0F A;  1WWJ A;  4V1A p;  1Y25 A;  1TK8 B;  2YV9 A;  4DSQ A;  4ZBD A;  4OO4 A;  2OBI A;  3W6G A;  5IOX A;  4NPB A;  1ZOF A;  1X5D A;  1PA3 A;  1ERT A;  3FR3 A;  1TKD B;  3P2A A;  1KEB A;  6GSY A;  3APO A;  4JU5 A;  3NOF A;  3EMX A;  4TR3 A;  4E8H A;  5ECR B;  5IIZ A;  3L9V A;  3VLN A;  2PGT A;  3VFI A;  2YWO A;  3D22 A;  5DAL A;  6GSW A;  1DBY A;  4MF7 A;  1GTI A;  2V32 A;  1HNC A;  4I8B A;  3HCZ A;  5HFI A;  5D73 A;  5JWO B;  4GQC A;  3ZMK A;  3KTL A;  3QR6 A;  1K0N A;  4ECB A;  1TI1 A;  4TXO A;  4IHU A;  1K3O A;  4HQS A;  3LW9 A;  5GAN D;  1SYX A;  4HOJ A;  2AHE A;  1PGT A;  3KD0 A;  4WKW A;  4F03 A;  4Z2T A;  1GNW A;  2O85 A;  2X49 A;  1OC8 A;  1OKT A;  4EIP A;  1OKD A;  2H73 A;  2HZE B;  3DVW A;  3O76 A;  1B4Q A;  4IVF A;  2H66 A;  2OAC A;  4JR6 A;  3LFL A;  1Z7P A;  1SKR B;  2A4H A;  3UAP A;  17GS A;  4QL9 A;  3KXO A;  2H1A A;  1TW9 A;  1T8E B;  3ZIJ A;  4TXV A;  4D73 A;  3TJK A;  3I43 A;  3QAV A;  2REM A;  3ERG A;  1H75 A;  1SD8 A;  4HU9 A;  3UBK A;  4IN0 A;  5HQP A;  2C3T A;  4HZ2 A;  2IFQ B;  4GWR A;  5EPF A;  3A3T A;  2I3Y A;  3IC8 A;  1ILO A;  3VPQ A;  3GMF A;  2GQM A;  2K8V A;  5CRH A;  4K2D A;  1TRW A;  4ML1 A;  3CTG A;  1GP1 A;  1XOB A;  3DIE A;  1GLQ A;  4PUA A;  1B9X C;  1ERU A;  3EUR A;  5KOX A;  4KND A;  3CYN A;  1T7P B;  1NW2 A;  4YKF A;  5IQY A;  5G30 A;  2DML A;  3EWL A;  4JE1 A;  3CMI A;  2EIQ A;  2VLT A;  3DKS A;  4YQV A;  2JSZ A;  2H8L A;  4XS1 A;  3M9K A;  4X43 A;  4MF6 A;  1TK0 B;  2JSY A;  3P7X A;  4IJI A;  1S3A A;  1A2M A;  1ZYQ B;  3IA1 A;  5A4W A;  1WE0 A;  2I1U A;  4MA9 A;  3DGQ A;  4NV5 A;  4NHW A;  2PPT A;  4V2M A;  2N5B A;  3KJY A;  4K7N A;  4YKG A;  2KLX A;  2R37 A;  2FA8 A;  2PWJ A;  1R5A A;  1M2A A;  5BMU A;  4OFN A;  2H74 A;  5KN0 A;  3EIN A;  3MWH A;  2A2P A;  4XRA A;  1GSF A;  4HDE A;  1GUM A;  1U87 A;  1H4O A;  4O5Q A;  1WPI A;  2VCT A;  3EPT A;  4TOP A;  1YQ1 A;  3A2W A;  2YWI A;  3CSI A;  2O87 A;  1AQX A;  1YDK A;  2ON7 A;  4FYC A;  4N0Z A;  5CAX A;  2TIR A;  3TKP A;  3EU3 A;  4WF4 A;  2DJ2 A;  1RK4 A;  2B6M A;  4QQ7 A;  4ZBB A;  1C72 A;  1A24 A;  2L5L A;  3DYR A;  4AJ6 A;  1ZYP A;  1MEK A;  4MH3 A;  1FB6 A;  2A2R A;  2V1M A;  4N30 A;  3IRA A;  5CO3 A;  1U3A A;  5D9X A;  1KTE A;  5ECM B;  2IMF A;  5CNW A;  5FWG A;  1FO5 A;  4NXI A;  2YJH A;  1WOU A;  4NAX A;  1GSU A;  1EWX A;  4YQM A;  2B5E A;  3BJ5 A;  4MF5 A;  1GSS A;  2R3X A;  2FY6 A;  1AQW A;  4KH7 A;  3L9S A;  2IJY A;  6GSV A;  4EO3 A;  4KSM A;  2RLI A;  2VAF A;  3LYP A;  3FZ5 A;  4N10 A;  1J9B A;  1FOV A;  2FUG 2;  2M80 A;  11GS A;  4EL1 A;  3APQ A;  3TRX A;  4HS1 A;  3D4T A;  5IMZ A;  1DE2 A;  3RDW A;  3RAZ A;  3QDN A;  2HE3 A;  1K0M A;  1YF0 A;  1O8X A;  2VCV A;  5B6N A;  4EVM A;  1OE8 A;  2O8V B;  4XIH A;  3TJF A;  2O89 A;  4K8M A;  5JCG A;  2OA7 A;  5DDL A;  2DKH A;  4MZW A;  4KDX A;  3DML A;  3TCO A;  1EZK A;  1ML6 A;  1UN2 A;  2VM1 A;  2MZC A;  5DQY A;  4JRR A;  4QL7 A;  3SWL A;  1QGV A;  4OCE A;  12GS A;  3HYP A;  5H5S A;  4GSS A;  1SL1 B;  3HJO A;  3DEX A;  1BJX A;  1R26 A;  2AB6 A;  5A5K A;  1SK2 A;  1W89 A;  2LKU A;  1LU4 A;  5ECN B;  4G10 A;  1YKC A;  1GTA A;  1S3D A;  2DIY A;  2F51 A;  4ECI A;  5F07 A;  3I9V 2;  2RUE A;  1QQ2 A;  2VD0 A;  1G6Y A;  2LJR A;  3CBU A;  1GL8 A;  1OAZ A;  1SU9 A;  4O92 A;  2HRN A;  4PNG A;  4OO5 A;  2IY2 A;  3MDK A;  3TKS A;  3APS A;  3CSH A;  1O73 A;  1M7T A;  3TJG A;  3QAW A;  1T4Z A;  5FT3 A;  1MD4 A;  2GTU A;  4TR1 B;  2YJ7 A;  1MD3 A;  1JZR A;  4EE0 A;  2KUC A;  3ZFB A;  3W8J A;  4P3Y B;  3GN3 A;  4EKZ A;  4DVC A;  2JZR A;  1M0U A;  3GSS A;  3F8U A;  5ECS A;  4F0B A;  4JBB A;  4K5R A;  4MJE A;  3IAS 2;  1ZZY A;  3VK9 A;  1XCC A;  2F8A A;  1IYI A;  2VCZ A;  1M2B A;  5EL8 A;  3QPM A;  1QMV A;  4MJB A;  2HRK A;  1OC9 B;  3QMX A;  2FD3 A;  3MAK A;  1JLV A;  4K2X A;  3VWU A;  3GX0 A;  4NHZ A;  4PUR A;  3ZRE A;  4WET A;  4WBJ A;  2FLS A;  5B7C A;  22GS A;  2LS5 A;  2VM2 A;  5IPH A;  5G31 A;  1NM3 A;  5C04 A;  4L0U A;  5ECP B;  4YAV A;  4MAB A;  3UIW A;  3UOM A;  5J3R A;  2DBC A;  2IN3 A;  2I4A A;  3LXT A;  3QFA C;  5DBQ A;  4OD7 A;  3NIV A;  2R0G A;  1XWA A;  1T1V A;  1MDK A;  9GSS A;  4IGJ A;  5J5N A;  3HHV A;  2WS2 A;  4FO5 A;  1F3B A;  3I6A A;  4EUY A;  2H1B A;  2H70 A;  4TVE A;  1AUC A;  5J41 A;  3H1N A;  7GSS A;  3TB2 A;  5D96 A;  4FYU A;  2IMI A;  2FWF A;  2ZUP A;  4ULX A;  3IBH A;  3F6D A;  1T4Y A;  1K0O A;  2JL4 A;  2WZ9 A;  4G9H A;  3C71 A;  3VUR A;  4BVY B;  1ZYE A;  3IE3 A;  2CT6 A;  3R3E A;  2DJJ A;  1JFU A;  2D2Z A;  1A2L A;  1ERW A;  4RQX A;  1TOF A;  2GVP A;  2IWT A;  1TDI A;  2H71 A;  1X0R A;  5IPG A;  1G7O A;  1K3Y A;  2C3N A;  3ERF A;  3HA9 A;  3ME7 A;  1R4W A;  1YJ6 A;  2GZZ A;  4H86 A;  4WR5 A;  2VUP A;  2H1G A;  2NDO A;  4X1U A;  4POK A;  4G0K A;  1DSB A;  1XVQ A;  3KM6 A;  4BVX A;  2VCX A;  1URM A;  2QC7 A;  4EC0 A;  4G19 A;  2B1K A;  5ABR A;  5IOW A;  1USB A;  2VCW A;  1TRS A;  5B6M A;  1GNE A;  3HD5 A;  4TRX A;  2NPB A;  4KCA A;  2R0P A;  1BED A;  3GHA A;  5JWQ B;  4X0X A;  5LD0 A;  2LJK A;  4L0W A;  1A0R P;  3LG6 A;  3TDG A;  2H19 A;  4G0L A;  2KP1 A;  2OE3 A;  5CP1 A;  5D9T A;  1GUL A;  4KDY A;  5GZZ B;  1YY7 A;  1SD9 A;  2M46 A;  3GYK A;  2B5Y A;  4J56 E;  1O85 A;  4PQI A;  3ED3 A;  4HJ2 A;  4K0N A;  3GKX A;  1JZD A;  3GX8 A;  3L9U A;  3H93 A;  2XC2 A;  2LEG A;  2OAD A;  4MPF A;  2CVB A;  1TJD A;  1TXX A;  3IR4 A;  4ACS A;  3ZYW A;  5G5E A;  2OE1 A;  1GSE A;  3I69 A;  4Q5F A;  2HYX A;  4TR1 A;  2GT6 A;  2HLS A;  4ZBA A;  3VPT A;  4TKY A;  5IMD A;  1EV9 A;  2N5A A;  3HY2 A;  5DAK B;  1UVZ A;  1QFN A;  2LV3 A;  3FZ9 A;  4XS4 B;  3G7Y A;  4OFT A;  1XWK A;  1X5E A;  4IQA A;  3GUS A;  1OC9 A;  1BQ7 A;  1QK8 A;  1GUK A;  3IAM 2;  4PXO A;  1ACV A;  2NTO A;  2MBS A;  4OWY A;  1G6W A;  1PL2 A;  1Q98 A;  2P31 A;  2X64 A;  2J9H A;  4F82 A;  4IKH A;  2LUS A;  3CRT A;  4F9Z A;  5C00 A;  4O5U A;  1JLW A;  4KW6 A;  4KF9 A;  4TN8 A;  4A5P A;  3IK9 A;  5E59 A;  5JWR B;  3D5J A;  4I5Q A;  3TKR A;  1PSQ A;  3LJR A;  2HRF A;  5ECI B;  2CA8 A;  2GDR A;  1V57 A;  3EE2 A;  1F6M C;  1AXD A;  2MMZ A;  2YV7 A;  2CVK A;  2VLU A;  2L4C A;  1FW1 A;  2E2G A;  1V9W A;  4MZB A;  4OMV A;  4IW9 A;  3UVH A;  2CV4 A;  1BX9 A;  1WP0 A;  1SEN A;  3Q6O A;  1PL1 A;  4TW5 A;  2DMM A;  3QOU A;  3BCK A;  1F3A A;  2NBS A;  3LGC A;  2VOC A;  1O7U A;  4ZXG A;  2C8U A;  2XPE A;  3QD9 A;  3H4K A;  1TTZ A;  2H0I A;  2ZNM A;  4O5R A;  1EOG A;  2QGV A;  4ZL7 A;  1GSQ A;  3LYK A;  4BVY A;  2R0C A;  4DSR A;  2GSQ A;  10GS A;  3M1G A;  2JU5 A;  3IV4 A;  4MCU A;  3RPN A;  4NV2 A;  1MDJ A;  1G7E A;  3P8W A;  1KBN A;  3TOU A;  3HJP A;  2C80 A;  3IOS A;  1V2A A;  5KN2 A;  2V6O A;  4IP1 A;  2ES7 A;  2R2J A;  4DEJ A;  3WYW A;  5L71 A;  3LEF A;  5AN1 A;  1FG4 A;  3EYT A;  3VI7 A;  2WRT A;  2UZ8 A;  4EIQ A;  5B8A A;  1WRY A;  3PPU A;  2LTK A;  2MMA A;  1J08 A;  1GSY A;  8GSS A;  1R7H A;  2YZU A;  4GQF A;  3KZQ A;  3LSZ A;  1BG5 A;  4CY6 A;  4DSS B;  1SYR A;  4CHS A;  2H6Y A;  2XBQ A;  3FR6 A;  4LMW A;  5DVB A;  3EVI A;  3U6V A;  3D6I A;  4X4J A;  5F05 A;  18GS A;  1ZCP A;  1XWB A;  1XWC A;  4FIW A;  3K8N A;  1B8X A;  3ZRD A;  2C3Q A;  1TK5 B;  2DJK A;  1Z6M A;  2LNS A;  2K9F A;  4NWY A;  1XFL A;  1QXH A;  1XPV A;  1IYH A;  2HNL A;  3ZLP A;  3EMP A;  4PQ1 A;  2CVD A;  1W4V A;  3F0I A;  2CAQ A;  1NHO A;  3SBC A;  2V6K A;  3RHB A;  2YWN A;  3IK7 A;  2YNX A;  5ECH B;  1O6J A;  2JZT A;  1EV4 A;  4MH2 A;  4G2E A;  2OJL A;  5ELG A;  4ZB6 A;  4L5O A;  5HR1 A;  5CRW A;  2GS3 A;  1PKZ A;  4WEY A;  1WIK A;  2IPA A;  3ISO A;  5ENU A;  1U88 A;  1YZX A;  1J0F A;  5DAK A;  2H76 A;  3F4T A;  4XS4 A;  2LNT A;  3FRC A;  2RUF A;  3FZA A;  4KAE A;  2H72 A;  1XXU A;  2LJA A;  2WDU A;  1A8Y A;  2G0F A;  2MYG A;  4ICY A;  1JZW A;  1K0A A;  3VWV A;  2LRC A;  5G5F A;  3UBL A;  3VWW A;  3HVS A;  3TGZ A;  3W8S A;  1OVN A;  2K6V A;  2L4Q A;  3GNJ A;  5J4U A;  2IMD A;  3CSJ A;  4KGI A;  2HZE A;  3KIJ A;  4MP4 A;  5J9C A;  5CRE A;  4YH2 A;  3F9U A;  2H75 A;  4ML6 A;  1MDI A;  1S3C A;  4JZQ A;  3ZIT A;  3WGX A;  4IEL A;  1AIU A;  1BYE A;  1ON4 A;  3ZZX A;  1YEX A;  2VO4 A;  1M2D A;  2GZP A;  4HEA 2;  3C1R A;  1FOH A;  3GRX A;  2IFQ A;  5DJM A;  4NMU A;  1T3B A;  5HFG A;  1UA5 A;  4Z2R A;  1RQM A;  3FW2 A;  4FYB A;  3G7J A;  3LWA A;  2K8S A;  2VL2 C;  2RM6 A;  4Q5N A;  5ID2 B;  4MJC A;  5DCH A;  3FK8 A;  4E8E A;  3BBY A;  5IO0 A;  1ZL9 A;  1M99 A;  5KN1 A;  4POB A;  1EEJ A;  1EP7 A;  1U6T A;  1A23 A;  4MK3 A;  2H01 A;  1WJK A;  1JHB A;  1AQV A;  5EVO A;  4XCS A;  2JAD A;  1RW1 A;  4F0C A;  2J23 A;  2LRN A;  4CW9 A;  1GSD A;  3TKQ A;  1VF2 A;  2ON5 A;  1SJ6 A;  1X5C A;  1HNA A;  2HZF A;  1PN0 A;  4GST A;  3HJM A;  2B7J A;  1TRV A;  1XW5 A;  2DJ1 A;  4WR4 A;  2BTO T;  2X8H A;  5B8B A;  3C73 A;  4USS A;  1PX7 A;  5DAL B;  3Q18 A;  3RPP A;  1CQG A;  4DSS A;  3GFK A;  5HR0 A;  4GTU A;  2E0Q A;  4LA1 A;  1AAZ A;  2WJU A;  2LQQ A;  3GL5 A;  2CZ3 A;  4TXO B;  2ZCT A;  2MMO A;  3KH7 A;  2EC4 A;  1SJZ A;  3N5O A;  2Z9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...