1JZDA

Dsbc-dsbdalpha complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
GAMADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiol:disulfide interchange protein dsbc
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzdA02
2RUFA 5G5FA 2QC7A 2K8SA 3APOA 3ERGA 4GXZA 3WGEA 5KN1A 4X43A 2TRXA 1T4YA 1S3CA 3FZ4A 1A8YA 5DQYA 1QMVA 1VF3A 3TRXA 3DEXA 3U6VA 1M7TA 4ZB6A 3D21A 4Q5FA 2N5FA 3MNGA 4AGSA 3Q19A 1XWGA 2DBCA 4NV2A 3HJPA 2JZSA 3IK7A 1GNWA 1M99A 3PR8A 5JCGA 3GNJA 1KTEA 1WE0A 1U6TA 1SU9A 4ISDA 2VCWA 1PMTA 5HR1A 4K7NA 4BA7A 3IRAA 3EU3A 2X8GA 2YWIA 4KH7A 3VURA 2F8FA 4IS0A 5IO0A 2X99A 3FZ9A 3N9JA 2B7KA 2LSTA 1BQ7A 1Z5YE 3DMLA 1X9SB 4XRDA 4TN8A 3ERWA 2AHEA 1XW9A 1HD2A 4TXOB 1O81A 3GFKA 3E9JB 4PQHA 6GSVA 2L4CA 2CT6A 3ME8A 1S3DA 5DQSA 4D73B 4EKZA 3F4SA 2B5XA 5IMCA 3E3EA 1JFUA 1TRUA 1FB0A 5G5EA 4JEDA 4CDOA 2I9HA 1FAAA 3HYPA 4F0BA 16GSA 3TDGA 2FWEA 2IMEA 2HSHA 2H1DA 2C0GA 1H75A 3FZ5A 4EUYA 2AUVA 1EV9A 4AJ8A 3ZFBA 3JCML 4PUFC 2HNLA 1SYRA 5DAKB 4L8EA 4KW6A 2AV4A 3UVTA 4XS4B 2P5RA 5INYA 4GLTA 5F06A 1GNEA 4I5QA 3GX0A 5C04A 4TR1B 3S9FA 2JZRA 5HFKA 2VD0A 4L0UA 1PGTA 3GHAA 5ECPB 4DVCA 2FCHA 1M2AA 2C0EA 3CTFA 5AIXA 3FR3A 4OMVA 4P3YB 3HD5A 4F03A 1QUWA 4CHSA 5B8AA 2VIMA 3LQ7A 2WDUA 3HCZA 2IMIA 3O76A 4TXVA 1RK4A 19GSA 3L9VA 2L5LA 3TJGA 1K3YA 4KSOA 3N5OA 1AW9A 2PMTA 2DLXA 3A2XA 2P5QA 3VPQA 2JSYA 1XOAA 4FYUA 5CRHA 2R5GA 2YV9A 1TK8B 2ALBA 3DVXA 3FK8A 3QMXA 1Z3EA 4NHWA 3TKSE 2MMNA 3ZL5A 3ZITA 2LJAA 2ZCTA 22GSA 3J7Yk 2H75A 1X9WB 2C4JA 2L4QA 3FYGA 4XCSA 1ILOA 2EIRA 2MMZA 1UC7A 3D5JA 6GSTA 3HVSA 2LEGA 6GSXA 1OVNA 5HQPA 3O3TA 1A2LA 1A24A 17GSA 1OC9B 1XBSA 5H5RA 1ZYQB 4K6XA 3M0FA 5IIZA 3LFLA 4ZXGA 4BWQA 1YJ6A 4I2UA 3WGXA 1A0RP 5CRDA 2AB6A 1TP9A 2A2RA 2WRTA 1S3AA 1OYJA 4I6XA 3GH9A 4DSSB 2GQKA 1E2YA 3F9UA 5DCHA 4EF0A 1OC3A 5KN3A 3HZ4A 4O32A 5E4WA 5CRWA 1ZZYA 1THOA 3HKRA 1PKZA 5J3RA 3UAPA 4OWYA 3KMOA 2DJ2A 2N5AA 3BBYA 4V2MA 2FNOA 6GSWA 2IFQB 2OACA 4N10A 5DALB 3FEUA 3WYWA 2LUSA 4IHUA 1DE1A 5B7CA 2LKUA 5IMFA 2PU9C 4ULXA 5GSTA 1TI3A 1GUHA 2K9FA 3TKPA 1HNCA 4IJIA 1GH2A 2LRNA 1SK1A 4J56E 1R26A 4YH2A 2FHEA 5IQYA 2LRTA 3TJJA 3GKNA 2VCTA 5DBQA 3A2VA 3R2QA 4H86A 3LGCA 4HOJA 3APQA 2F9SA 3KIJA 3ME7A 2KP1A 3H93A 2H70A 5AGYA 5DCGA 1M0UA 1OE8A 4MP4A 3GKKA 3GRXA 5EY6A 1XVQA 10GSA 1JZRA 5ID2A 1GSEA 2JL4A 1SL2B 2I81A 4TR1A 1BG5A 4QQ7A 1K0CA 2WGRA 1DBYA 2WULA 3ZREA 3DVWA 4WF5A 2IN3A 1OC8A 1R7HA 5IPGA 4TW5A 4KX4A 2H71A 5J9BA 3DIEA 5AISA 1NW2A 3BD2A 3HZ8A 4MJCA 2K18A 3ZIVA 2GZYA 1G7EA 2JZTA 2OBIA 1AAZA 1Z7RA 2PPTA 2O87A 2CAIA 4KA0A 3P8WA 4TRXA 5KEJA 1V2AA 5IMDA 2M80A 1T7PB 2TRCP 2LJRA 2V41A 3RPNA 3VWXA 5GSSA 3MWHA 5A4UA 1ZCPA 1RQMA 2YANA 2MYGA 1K0NA 2YJHA 4ZB9A 2FD3A 4MDCA 1PX6A 2HFDA 5CP1A 2CVKA 2R37A 3QPMA 4ZBDA 2LTKA 2HRNA 1O8XA 3MSZA 4F82A 1GSQA 2FLSA 3KJYA 1USBA 3W8JA 4ECCA 1FOVA 1ZOFA 5FWGA 3GTUA 1J08A 3LORA 3TOUA 4MH3A 2C8UA 2DJ3A 3D6IA 1XXUA 4DSSA 2L6CA 2CVDA 1GRXA 1NHYA 4KGIA 2LNSA 4DSQA 4XRAA 5EL8A 4N11A 2JU5A 4QL7A 3GYKA 3BJ5A 5CO3A 2I3YA 3UARA 1GTIA 1IYHA 13GSA 1O73A 1PL1A 3P7XA 4HI7A 2P31A 4ML6A 2XBIA 5B8BA 1EP8A 4FH8A 2IPAA 5ECOB 3QAGA 4GF0A 1PQNA 3L9SA 4WEYA 1TRWA 1G6WA 3EURA 3E0UA 5IMVA 4Q5RA 5LCZA 1XZOA 4Q5NA 5D9TA 5F8BA 3KP8A 5KN0A 4K0GA 3DGQA 4PGTA 1V40A 4K7IA 4WR5A 2HSYA 1UVZA 1MD3A 1ERWA 4KDYA 1TJDA 5ABRA 4MH2A 2KOKA 4MPGA 2VD1A 2L6DA 1WRYA 4OFTA 2GZZA 1SK0A 3MDKA 3US3A 4O92A 2CV4A 2VLTA 7GSSA 2HZFA 2FWGA 3D22A 4ZBAA 5G31A 1TDIA 2YP6A 2CX3A 2ZUPA 1K0AA 4JR6A 4V2LA 3DRNA 1MTCA 6GSYA 1MDKA 1VRSD 1RW1A 1X5EA 3EMPA 4XHMA 4EDYA 3FZAA 4OFNA 1QGVA 3FY7A 2V6OA 1EOGA 5GZZB 4RI6A 4WKWA 1R5AA 2CX4A 2HE3A 4IKHA 1JZWA 2J23A 5IMAA 1O6JA 4TR4A 1PD21 2OJLA 3GA4A 5F05A 1XOBA 3TKQA 2HYXA 2HXKA 1ACVA 3KH9A 3O6TA 2X8HA 3GN3A 2A2SA 3KD0A 1GTBA 1OKTA 1CQHA 1T3BA 3EE2A 5HR2A 3HVXA 3GSTA 1F2EA 4ILFA 1TU7A 5DJLA 5DVBA 5ELGA 3HDCA 5IPHA 1A23A 4GSNA 1TU8A 1XWAA 4O5RA 1O7UA 4XTSA 2M72A 1LJRA 3TGZA 1K0DA 1Y6EA 4MLYA 3G7IA 1XVWA 1T00A 5EVOA 2DJKA 3L78A 2K6VA 1E6BA 1IYIA 1XCCA 3HA9A 1UA5A 1YEXA 5ECSA 1H4OA 2OADA 2N5BA 2VL2C 2CAQA 4EO3A 1ABAA 1NSWA 1PA3A 1JZDA 2YOIA 2ON7A 4HJ2A 2R4VA 2IMKA 4PNGA 1Y25A 3PGTA 4I2TA 3VFIA 2DSAA 4MZCA 2MZCA 1XWBA 1YQ1A 2ON5A 5D96A 2C80A 4WR4A 1TW9A 2WS2A 2H1BA 3QCPA 4POLA 3EVIA 5JCUA 5ECQB 3GX8A 2TIRA 2OKAA 2PWJA 3IAS2 3P2AA 1MDIA 2Z9SA 1PKWA 3LXTA 4I97A 5ENUA 1SKSB 2IWTA 1ERUA 5LNKe 1JZOA 1AQWA 4K1FA 1GUMA 1SD8A 2YZUA 1TKDB 5ELAA 3NZNA 4IGJA 3C73A 3G9BA 2VL3A 5C00A 3IV4A 3TKSC 3TRPA 3QR6A 1WPIA 1SK2A 2VAFA 6GSUA 4E8EA 3CBUA 1SYXA 4K9ZA 2H19A 1ZL9A 1SKRB 11GSA 4FO5A 2WB9A 1V9WA 2V1MA 4LL4B 3RPPA 4K8MA 1B48A 2H0GA 3F8UA 4RI7A 2H6XA 5D9WA 2GT6A 5HFIA 1G6YA 3D4TA 3KZQA 1N8JA 3KTBA 3VLNA 3WGDA 4GQFA 1DUGA 4IBPA 4MMMA 4IQAA 4MABA 3GKMA 4PUAA 3GURA 4EE0A 1XW5A 2E7PA 3GKXA 4ECJA 2MBTA 1WP0A 8GSSA 1G0TA 2PVQA 3SBCA 5J9CA 3LYKA 3F3RA 1QQ2A 3OR5A 2PBJA 2XPEA 2B5EA 3C7MA 3CSHA 3TJKA 4Z7XA 2M46A 3QFBC 3D0ZA 3EINA 3HHVA 1YF0A 1R5PA 4PQ1A 2CA8A 4EDZA 3HVVA 3IOSA 3QDNA 4MZBA 3VWUA 4KSMA 2IY2A 1HNBA 4GRFA 3SWLA 4LLRA 3MAKA 3ZLPA 3RDWA 2NVLA 5HFGA 2KHPA 5H5SA 1PX7A 4IP6A 4TXOA 1YDKA 4WXTA 1GSFA 3BCKA 4OO5A 3IE3A 4E8HA 4MJAA 2VOCA 3CMIA 1Z6MA 4V2NA 2YWNA 4G19A 4HU9A 2D2ZA 2YWOA 4D73A 2O7KA 3M9JA 1K0OA 1EZKA 2OBKA 4OCEA 2E0QA 5KN2A 1M2BA 1JHBA 4JU5A 4KUNA 3GH6A 4MA9A 5D73A 4HUAA 3L4NA 4RQRA 3APSA 4EL1A 1BYEA 3NOFA 2FA8A 2DC5A 2VCQA 3P90A 1OKDA 2C3QA 4JBBA 3UMAA 1ST9A 5DAKA 2MBSA 1V57A 2PUKC 3VI7A 1W4VA 2REMA 4AJ6A 4XS4A 4MJEA 4YQUA 2IYJA 1SKWB 3KP9A 1FVJA 4PXOA 1A2MA 3IHQA 3CSIA 3PINA 3ZZXA 5D8IA 3KXOA 5CYYA 4PQIA 2H30A 1GLQA 1XWKA 2DIYA 4LMWA 5G2ZA 4MF6A 5AN1A 1EEMA 1TI1A 2VUPA 1TXXA 1TTZA 4TOPA 2B1KA 1ERTA 1GWCA 3A2WA 1DSBA 3UBKA 2FA4A 1U3IA 5EPFA 3UVHA 1GUKA 2X64A 1MEKA 2BJXA 4KDUA 1GSUA 3EMXA 3LJRA 2NDOA 2V32A 1ON4A 3LSZA 1ZMAA 3M1GA 3NIVA 4ECIA 5AIVA 3ISOA 2IL3A 3H79A 1GL8A 3WT1A 4N0ZA 2GSQA 2CVBA 4OD7A 4PX1A 4G10A 3ZIJA 2BTOT 3QAWA 4ACSA 4L0WA 9GSSA 5FT3A 3ZRDA 1HQOA 3HY2A 3LWAA 2ZNMA 4ZIJA 3IR4A 4KDXA 1J9BA 3UEMA 1SJZA 2AJQB 2H72A 3Q74A 4POKA 1EWXA 4TR0A 3KCMA 1UN2A 3DYRA 2B3SA 2PGTA 3ERFA 4KNDA 3TOTA 2YNXA 3VWVA 4EC0A 1AQXA 2F8AA 1F9MA 1OC9A 2C0FA 4TR3A 5ECRB 4Q5QA 2E2MA 4K0NA 2HZEB 4ZB8A 1U87A 2HRFA 3FR9A 1X5CA 1T1VA 1KNGA 4WBRD 1F3BA 3TJBA 2C3TA 2EIQA 1FG4A 1SENA 2VCVA 5IO2A 2R3XA 2NTOA 2VLUA 5FHIA 4YAPA 3CTGA 2DMLA 1A0FA 2H76A 2OA7A 1ZGNA 3A5WA 4X0XA 1FB6A 2LS5A 3G7JA 2EC4A 2WZ9A 4X1UA 3J7Yb 1YY7A 1EV4A 4TKYA 3IK9A 4JE1A 1J0FA 2GSSA 4GSSA 1PSQA 1THXA 2IFQA 5DALA 4V1Ag 4YQVA 3EWLA 1K3LA 2FUG2 1Q98A 5A5KA 2AAWA 2DJJA 2VCZA 4EVMA 2H66A 1YEPA 2XC2A 2H0HA 3L9UA 5DJMA 3F63A 3KMNA 2RLIA 2DJ0A 3ZVJA 2KLXA 4J2FA 4J57E 3TCOA 1X9MB 2LJKA 1EEJA 3FKFA 1A8LA 5A4VA 1GP1A 1GSDA 3H1NA 3HJMA 3ZTLA 4IJ3A 4NXIA 1M9BA 5DDLA 4NHZA 20GSA 3CRUA 3QFAC 3LG6A 1YF1A 3UIWA 3EU4A 1A2JA 2IJYA 4LMVA 5CREA 2CQ9A 4LA1A 5CRGA 2YCDA 3I69A 2H8LA 5HR0A 2A4VA 2PERA 2GQLA 3H4KA 5G30A 4AJ7A 5F07A 3CSJA 4K2DA 14GSA 1YKCA 3M3MA 5B6NA 4FYCA 4DSRA 3Q18A 1EGOA 2LNTA 3F0IA 1V98A 1KBNA 18GSA 1N2AA 4POBA 2B1LA 4IN0A 4G2EA 5D9XA 4ZL9A 5L71A 2JSZA 1XWCA 3CRTA 1AUCA 5J41A 1OAZA 3KH7A 5GAND 4NV5A 3WT2A 1QXHA 3IAM2 4RUVA 3KGKA 4KE3A 1HNAA 4KCAA 5ECIB 5COHA 2WJUA 2O89A 4ZBBA 3I9V2 1YZXA 4GSTA 3LEFA 4N0VA 4N30A 2X8CA 3UJ1A 4GCIA 2V6KA 4WETA 1FW1A 3VI5A 6GSSA 4OFMA 4YAVA 3IBHA 3KEBA 4QL9A 1X5DA 4JR4A 4DEJA 1AIUA 4BPYA 1YKAA 3RHCA 3FRCA 3TJFA 3HXSA 4K7OA 4WBJA 2PVOC 2AYTA 2GSTA 2HZEA 3C8EA 3AY8A 1TOFA 3WD6A 2GT5A 4RQXA 3GSSA 1VF2A 2FWFA 3DWVA 1CQGA 1FHEA 2GS3A 3I6AA 1GULA 4IVFA 3ZYWA 3GL5A 3Q6OA 3F4RA 1AQVA 1JLWA 4IQ1A 2DMMA 1SJIA 1URMA 3F3QA 4WF4A 4HJMA 3W6GA 2XPDA 4NAXA 3IA1A 3W8SA 1LU4A 5ID2B 3GMFA 2GVPA 2KUCA 2C1YA 4TVEA 4HDEA 2NPBA 1O85A 4IW9A 4GQCA 2OE1A 3A3TA 5HR3A 3LXZA 3DD3A 1ZYEA 4IP1A 1EP7A 4HZ2A 4PNFA 1WIKA 1M9AA 2VLVA 4MF7A 2O85A 1EOHA 2IMDA 1DE2A 2RM6A 1GSSA 1AXDA 1ERVA 4I8BA 4CW9A 3H8QA 2H6YA 1F6MC 5IOXA 2O8VB 2F3MA 2LV3A 3CYNA 3C71A 4F9ZA 5F0GA 1F37A 2XHFA 1MD4A 3KTLA 2YN1A 4F0CA 1LBKA 3G7YA 2KP2A 3EC3A 2YWMA 4OCFA 4IELA 2LQQA 3U5RE 2OE0A 1K3OA 4O7HA 4OO4A 3ZVJD 4HEA2 1X0RA 2I4AA 3ZMLA 1SL1B 2FWHA 4ECBA 2HLSA 2G2QA 2H74A 3F6DA 1GSYA 5LD0A 1WJKA 3PH9A 2JACA 3C1RA 4LL1B 4XIHA 5CAXA 1WMJA 2QSIA 3F6FA 1EGRA 1GLPA 3BOAA 2DJ1A 1FO5A 4FYBA 3GTUB 5ECLB 2CZ3A 4NPBA 1Z7PA 4BWSA 2I1UA 1U88A 3UOMA 1OE7A 4YQMA 1B9XC 1HYUA 4HS1A 5ECKB 1V58A 1R4WA 5JWRB 4HU7A 2LQOA 1I5GA 4MJBA 1TK0B 2VO4A 4BL7A 2E2GA 1XFLA 3RAZA 3LYPA 3IPZA 5A4WA 1T8EB 3DKSA 3D4MA 4V1Ap 5GAPD 4XS6A 3GL3A 1VGLA 2L59A 3L0HA 3TRQA 2C0DA 2YV7A 1B4PA 1B4QA 4L5LA 5IOWA 3IC4A 2EIOA 2FY6A 4KAEA 4EXJA 1G7OA 2B5YA 2G0FA 3C1SA 5JWQB 2HI7A 1TRVA 2H73A 2NBSA 5CNWA 2V2GA 4BVYA 1PL2A 1TRSA 2J9HA 3RHBA 2K8VA 5G1KA 1K0BA 3GIXA 1QK8A 2WCIA 2YJ7A 1GTAA 2QKEA 1PRXA 1PN9A 1JLVA 5J5NA 3M8NA 1FVKA 1BJXA 1Q4JA 1XIYA 2GTUA 2VM1A 3BCIA 1M2DA 2GLRA 2IMFA 1SJ6A 4HQZA 3VWWA 2H0IA 4KB3A 3IXRA 3ZFLA 5ECHB 1KEBA 3GUSA 1GTUA 1WWJA 2BMXA 2LRCA 3GV1A 4AF2A 1VF4A 5IM9A 3QD9A 3KM6A 2ES7A 3DXBA 2GGTA 5ECMB 3TUEA 3UL3A 4FIWA 1K0MA 2H01A 4L5OA 2FGXA 4MPFA 3ED3A 4GWRA 2B6MA 5D9VA 2RM5A 1SD9A 1BEDA 2H1GA 3K8NA 4BVXA 1SL0B 3UBLA 4ID0A 1NHOA 3VK9A 4F2IA 1MDJA 5B6MA 3I43A 2L5OA 3TKRA 2XBQA 3VPTA 5D93A 1O8WA 2GDRA 1T4ZA 2VL2A 1XW6A 2HT9A 4POMA 4JZQA 1B8XA 2R2JA 4NWYA 5H5QA 1QFNA 4MF5A 3TB2A 2GQMA 1BAYA 5ECNB 4HQSA 5G1LA 2H6ZA 2YPMA 4XS1A 1Z9HA 3M9KA 2R6KA 1Z6NA 3FHKA 2OE3A 4MCUA 5IMZA 1U3AA 5JWOB 2QGVA 3CXGA 4G9HA 4ZL7A 1NM3A 2VCXA 5E59A 2CZ2A 3F4TA 1C72A 4JRRA 1AC1A 1VF1A 4MK3A 1XPVA 4NMUA 2MMOA 4GTUA 5J4UA 2MMAA 12GSA 4KCEA 1WOUA 2GZPA 4ML1A 1ML6A 4PURA 2JADA 1BX9A 2GSRA 2WFCA 4ZILA 3HJOA 3QAVA 3EYTA 2DIZA 3V1WA 3QOUA 3FR6A 2H1AA 2VL9A 4MZWA 4HZ4A 2L57A 5JCWA 3FW2A 3IDVA 2PN8A 4ZL8A 1I9DA 2RIIA 1B9YC 2B7JA 2YZHA 3TKSA 2VM2A 2C3NA 3RBTA 1TK5B 2IIYA 2F51A 1F3AA 1W89A 2P0GA 3ZMKA 2RUEA
chains in the Genus database with same CATH superfamily
2RUFA 5G5FA 2KCDA 2QC7A 1Z1SA 1RTUA 2K8SA 3APOA 3ERGA 4GXZA 3WGEA 5KN1A 4X43A 2TRXA 4MEIA 1T4YA 1S3CA 3FZ4A 4KF9A 1A8YA 2B24B 3NBRA 2HSMA 5DQYA 1QMVA 1VF3A 3TRXA 3DEXA 3U6VA 2PNCA 1M7TA 1OH0A 2MF7A 4ZB6A 1UCIA 3D21A 3S29A 5AEWB 4Q5FA 2N5FA 2OOVC 4R9KA 3VSYA 5G2GA 3MNGA 1MNLA 4IPBA 4BTWA 4AGSA 3Q19A 1XWGA 2DBCA 4NV2A 3NX0A 3HJPA 2JZSA 3IK7A 3UB1A 2A4HA 1GNWA 1M99A 3PR8A 5JCGA 3GNJA 1KTEA 1JBSA 1WE0A 1LQGC 3CPOA 1U6TA 2CIUA 2BO9B 1SU9A 3Q1CA 4ISDA 4AEQA 5LC7A 1GY7A 1LXEA 2VCWA 3F7SA 1BSDA 1PMTA 5HR1A 4K7NA 4BA7A 3IRAA 1PU4A 2QEX3 3EU3A 2X8GA 2YWIA 2QA43 4KH7A 1RLSA 2RGQA 3VURA 2WOHA 1F8NA 2F8FA 5GSPA 4IS0A 1VQ63 5IO0A 2X99A 3FZ9A 3N9JA 1W4NA 3KN4A 2B7KA 1RGLA 2CX0A 2LSTA 4HVNA 1BQ7A 1Z5YE 1DMQA 1BANA 3DMLA 1X9SB 5M1AA 2D1WA 4XRDA 4TN8A 4KFDA 1BRNL 1I8VA 3FLJA 2F4YA 3ERWA 2AHEA 1N9EA 1XW9A 1X1XA 1HD2A 4J5GA 4TXOB 3KCHA 1O81A 3GFKA 3E9JB 1J2BA 2ZA4A 4PQHA 1MGRA 6GSVA 4N6MA 1DE3A 2L4CA 2STDA 2CT6A 3ME8A 3BB9A 1S3DA 5DQSA 4D73B 4CDLA 4EKZA 3FG3A 2XH9A 3F4SA 2B5XA 3T8NA 5IMCA 3E3EA 3MWZA 1JFUA 1ASKA 1TRUA 1FB0A 5G5EA 3MG1A 1VQL3 4JEDA 4CDOA 2I9HA 1FAAA 3HYPA 4F0BA 2OTL3 16GSA 4EC6A 3L0RA 4O02B 3BLZA 3TDGA 2FWEA 2ZL8A 3NM7A 1V74A 2IMEA 3F7XA 2HSHA 2H1DA 2C0GA 3LT8A 1H75A 3V99A 3FZ5A 3CNXA 1RGEA 3LTBA 4EUYA 2AUVA 2KXGA 1EV9A 4AJ8A 3ZFBA 3JCML 8CHOA 4PUFC 2HNLA 1SYRA 5DAKB 4L8EA 4KW6A 2AV4A 3UVTA 1OF5B 4XS4B 2P5RA 5INYA 4GLTA 5F06A 1GNEA 4I5QA 3GX0A 4QWTA 5C04A 4TR1B 3S9FA 3AGOA 3UL6A 3EC9A 2JZRA 4EBGA 5HFKA 2VD0A 3ER7A 4L0UA 1BAOA 2ZDJA 1PGTA 2GSPA 3GHAA 5ECPB 4DVCA 2HMMB 2FCHA 1M2AA 2C0EA 3CTFA 5AIXA 3FR3A 1NWWA 3T8UA 4OMVA 3NV0A 4P3YB 3HD5A 1W6CA 2HOHA 4F03A 1QUWA 4CHSA 5B8AA 2VIMA 3LQ7A 2WDUA 3D79A 2CWUA 3HCZA 2IMIA 3O76A 4TXVA 1O7WB 4X2HA 1RK4A 19GSA 3L9VA 2L5LA 3TJGA 1K3YA 4KSOA 3N5OA 3NBJA 1AW9A 2PMTA 5EEOA 3CQFA 2DLXA 3A2XA 2PZVA 2P5QA 3VPQA 5ELUA 2JSYA 1XOAA 4FYUA 5CRHA 2R5GA 1RCLA 2YV9A 1TK8B 2GEYA 2ALBA 3CD63 3DVXA 3FK8A 3QMXA 1Z3EA 4NHWA 3PCSA 2CFKA 3TKSE 4Z2TA 3D9RA 2MMNA 3ZL5A 3SOYA 3ZITA 2HMNB 1N5HA 2LJAA 2ZCTA 22GSA 5CLKA 1HYFA 3EF8A 2H75A 3J7Yk 3B7CA 1X9WB 4FR9A 2C4JA 2L4QA 3FYGA 4XCSA 3D3LA 1BVIA 1ILOA 4WHAA 1KQS2 2EIRA 2MMZA 3X42A 1LOVA 1UC7A 1FA3A 3D5JA 6GSTA 1SJWA 1Q864 3HVSA 2LEGA 6GSXA 4XDWA 1OVNA 1I2EA 5HQPA 3O3TA 1A2LA 1A24A 4J5KA 17GSA 1OC9B 1XBSA 5H5RA 2RBIA 5JPUA 1ZYQB 4K6XA 4IT7A 3M0FA 3ZYWA 5IIZA 5BRTA 3LFLA 4ZXGA 4BWQA 1YJ6A 1IV9A 4I2UA 3WGXA 1A0RP 1HKXA 5CRDA 1X1WA 2AB6A 1TP9A 2A2RA 2WRTA 5IERA 1MWSA 1S3AA 1OYJA 3MG2A 4I6XA 3GH9A 4DSSB 2V1LA 2GQKA 1E2YA 3F9UA 4K61A 5DCHA 1FGTA 4EF0A 1OC3A 5KN3A 5A0OB 4FCZA 3HZ4A 4O32A 5E4WA 5CRWA 3QK9A 3H51A 1ZZYA 1HZ1A 4N6V0 1THOA 3RGRA 4RNTA 1JN5B 1ULJB 1I3IA 3MYTA 1SIHA 3HKRA 4BIRA 1IT8A 1PKZA 5J3RA 4LYLB 5BU4A 3JUMA 3UAPA 4OWYA 3DUKA 3KMOA 2DJ2A 2N5AA 3BBYA 4V2MA 2R0CA 3I563 2FNOA 1BIRA 4BIKA 3CC43 6GSWA 5AIHA 5AIGA 2IFQB 2OACA 1RN7A 3CCU3 5HGRA 4N10A 3FEUA 5DALB 3Q3FA 2LUSA 3WYWA 1IVVA 4IHUA 1DE1A 5B7CA 2LKUA 4ICYA 5IMFA 2PU9C 4ULXA 1DETA 5GSTA 1TI3A 3GZYB 1GUHA 2K9FA 3TKPA 1MWUA 3CCQ3 1HNCA 4IJIA 2OWPA 1GH2A 2CC3A 1UGIA 2LRNA 1ZGXA 1SK1A 4J56E 1R26A 2FNQA 4YH2A 1N8QA 1VQQA 1XG8A 2FHEA 1YJ93 4WYKB 5IQYA 1GMPA 2LRTA 2QIYA 3TJJA 1VQ43 3GKNA 2VCTA 5DBQA 3A2VA 3R2QA 4H86A 3LGCA 4HOJA 1OACA 3APQA 2F9SA 3KIJA 3BIRA 3ME7A 4NHFA 2KP1A 3IHGA 3H93A 2BMOB 2H70A 1BNGA 5AGYA 5DCGA 1M0UA 1IK3A 3ALAA 1NO3A 1OE8A 4MP4A 1X1UA 3GKKA 3GRXA 2E2UA 2KF6A 1NU3A 5EY6A 1XVQA 10GSA 2QA1A 4K1VA 4A5PA 1JZRA 5ID2A 1GSEA 5BVBA 2JL4A 1SL2B 2I81A 4TR1A 1IQXA 3IPTA 1BG5A 4QQ7A 1K0CA 2WGRA 1DBYA 4FMAA 2WULA 1IQ8A 1T2HA 3ZREA 3URPA 3DVWA 1TRPA 4WF5A 2OQEA 4BL2A 5IEPA 1RN4A 2BNGA 1OC8A 1R7HA 2IN3A 4LZIA 5DREA 4RNYA 3U97A 1TTOA 5IPGA 4TW5A 4KX4A 1FYSA 2P0MA 5IG5A 3HI7A 2H71A 1GMRA 5J9BA 3DIEA 5JBSA 5AISA 3UJMA 3JVCA 3LXUX 1NW2A 3BD2A 3HZ8A 4MJCA 4N6LA 3RDEA 2K18A 3S67A 2QA2A 3ZIVA 5FW5A 2GZYA 2UUGC 1G7EA 1OGZA 2JZTA 4USSA 2OBIA 1AAZA 4JRFA 1SQWA 2XRXB 1Z7RA 2PPTA 2O87A 2CAIA 4KA0A 1O7MB 3P8WA 1IDPA 2R41A 6RNTA 1S3RA 2Z76A 4TRXA 5KEJA 3VGNA 1V2AA 3I0YA 2AAEA 2W2CA 3IJEB 5IMDA 2M80A 3PS8A 2M7OA 1U8CB 1T7PB 2TRCP 2LJRA 1RKYA 4BTXA 1TIJA 1BNJA 2V41A 3RPNA 3VWXA 5GSSA 3MWHA 5A4UA 1CEWI 4HM0B 4U13A 1IQYA 1ZCPA 1RQMA 2YANA 2MYGA 5BIRA 1K0NA 3S5CA 2YJHA 4ZB9A 2FD3A 4MDCA 1PX6A 2HFDA 5CP1A 2CVKA 2R37A 3QPMA 1B2ZA 4ZBDA 1UW1A 3DGOA 3A5IA 2LTKA 2HRNA 1O8XA 3MSZA 3N8BA 4OK0A 3EPTA 4F82A 1GSQA 3BNBA 1K8A4 1LOXA 2FLSA 3KJYA 1USBA 3W8JA 1W2ZA 2CH9A 4ECCA 1FOVA 4HM3B 1ZOFA 4HYZA 3JUQA 5FWGA 2BMRB 3GTUA 1J08A 4KFFA 3LORA 3TOUA 1I0VA 1GOYA 2B1XB 4MH3A 5IG3A 2C8UA 3CMA3 4MNNA 2DJ3A 3D6IA 1ZX2A 1K9M4 2Z6BA 1AVLA 1XXUA 7RNTA 3EBTA 1YIJ3 4K90B 1KWIA 4DSSA 4FMDA 2L6CA 4HAAA 2CVDA 1GRXA 2HMOB 4KZ1A 1VQ93 5ELJA 1DMNA 7GSPA 1JBTA 1NHYA 4KGIA 1OHOA 4KVHA 2LNSA 4DSQA 4XRAA 1HU9A 4N11A 5EL8A 1JN5A 2JU5A 4QL7A 3GYKA 3BJ5A 5CO3A 2I3YA 3UARA 1GTIA 1RMSA 1IYHA 6STDA 13GSA 1O73A 1PL1A 3P7XA 4HI7A 2P31A 4ML6A 2XBIA 5B8BA 1A2PA 1EP8A 4FH8A 2IPAA 5ECOB 2Q07A 3QAGA 4GF0A 1PQNA 3L9SA 4WEYA 3GRDA 3DH2A 4H3UA 1TRWA 1G6WA 3EURA 3G713 3E0UA 2HMLB 1UI7A 5IMVA 4Q5RA 5LCZA 1XZOA 4Q5NA 5D9TA 5F8BA 3KP8A 4BU4A 1Q42A 4MMYB 4K0GA 5KN0A 4EV5A 3DGQA 4PGTA 1V40A 4K7IA 4WR5A 5AYRB 3SXXA 2HSYA 1RGFA 1UVZA 1MD3A 1ERWA 3PCRA 1NB5I 4KDYA 3EJVA 1TJDA 2BHMA 5ABRA 4MH2A 2KOKA 4R9LA 4MPGA 2VD1A 2L6DA 3Q90A 1RHLA 3EX9A 1WRYA 3NQZA 5IF6A 4OFTA 2GZZA 1SK0A 3LW9A 5M18A 2L4VA 3MDKA 3US3A 4O92A 2CV4A 2VLTA 2W6JH 3G4S3 1D6UA 7GSSA 2HZFA 3BU4A 1MWTA 3GZBA 2FWGA 3D22A 4ZBAA 5G31A 1TDIA 2YP6A 2CX3A 1B3SA 2ZUPA 4HM8B 3D5IA 1K0AA 4JR6A 4V2LA 1UCLA 3DRNA 1MTCA 2W56B 6GSYA 3KKGA 1MDKA 1VRSD 1RW1A 1X5EA 3EMPA 4XHMA 2WOFA 4EDYA 3FZAA 4OFNA 1QGVA 5I97A 3FY7A 2V6OA 1EOGA 2BMQB 2XGNA 5GZZB 1B2SA 4RI6A 4WKWA 1R5AA 1YVSA 2CX4A 2HE3A 4IKHA 2CWVA 2IUKA 1JZWA 2J23A 5IMAA 1O6JA 1BRHA 4TR4A 1PD21 2OJLA 3GA4A 5F05A 1XOBA 3TKQA 1M9GA 2HXKA 1ACVA 1W01A 3X41A 2HYXA 2X8HA 3KH9A 3O6TA 3GN3A 3AMOA 2F5MA 4N6NB 2A2SA 3KD0A 1GTBA 1OKTA 1MWRA 3SYUA 1CQHA 1T3BA 3EE2A 5HR2A 9RNTA 3HVXA 3WA2X 3GSTA 1TP6A 1RSNA 1YGEA 1ZO2A 1F2EA 4ILFA 1TU7A 5DJLA 5DVBA 1MGWA 4O5QA 5ELGA 1NB3I 1M3JA 3HDCA 5IPHA 1A23A 5AIFA 4GSNA 2X4AA 1TU8A 1XWAA 4O5RA 1O7UA 4PEJA 4XTSA 2M72A 3JUPA 1LJRA 3TGZA 1K0DA 1Y6EA 1FW7A 4BL7B 1N8R4 4MLYA 3G7IA 5IEOA 3OXAA 1XVWA 3CU3A 3F8XA 1T00A 5EVOA 2DJKA 2XEPA 2QGUA 1GSPA 3FG1A 3L78A 2HMKB 2K6VA 2W9QA 5CK6A 1E6BA 1IYIA 1XCCA 2R0PA 3HA9A 1OHSA 1UA5A 1YEXA 5ECSA 1H4OA 2OADA 2N5BA 1UUVB 2VL2C 3EE1A 2CAQA 1EKMA 1ABAA 4EO3A 1NSWA 1PA3A 3CXC2 1PFPA 1JZDA 2YOIA 2ON7A 3NM2A 1A90A 4HJ2A 1G02A 2R4VA 2IMKA 4G1MB 3FSDA 4PNGA 1Y25A 3PGTA 1JKGA 1LOYA 4I2TA 3CME3 3VFIA 5EQLA 2DSAA 4MZCA 2KF3A 1VZZA 2MZCA 1XWBA 1O7HB 1GYBA 1YQ1A 1UCJA 2ON5A 5D96A 3RGAA 2C80A 3B8LA 3MIXA 3STDA 4WR4A 2UZ8A 1TW9A 2WS2A 2H1BA 3QCPA 4POLA 4NREA 3EVIA 1IV7A 5JCUA 1Q814 5ECQB 3DGNA 3GX8A 3LYGA 2TIRA 1LQMB 2OKAA 2PWJA 3IAS2 1KSIA 3P2AA 1MDIA 2Z9SA 1PKWA 3LT9A 3LXTA 4I97A 5ENUA 1BRGA 1SKSB 2IWTA 1ERUA 3N54B 5LNKe 1JZOA 3AGNA 1IVUA 2W9PA 3OWYA 1AQWA 4K1FA 1GUMA 4O5UA 2SARA 1SD8A 2YZUA 1TKDB 3DGMA 5ELAA 5IENA 4TX4A 1BRSA 3NZNA 4IGJA 3C73A 3G9BA 2VL3A 5C00A 2KF4A 3IV4A 4JF8A 3TKSC 1W7CA 3GZXB 1SPUA 3TRPA 3QR6A 4ORLA 1WPIA 2WGOA 1SK2A 2VAFA 3SVAA 6GSUA 4E8EA 2ZHXB 3CBUA 1SYXA 4K9ZA 2H19A 1ZL9A 2P38A 1SKRB 11GSA 4FO5A 3FH1A 4HZ9B 3WA3A 1V9WA 2WB9A 2X49A 2V1MA 1TFKA 4LL4B 1QJGA 3RPPA 4K8MA 1B48A 2H0GA 3F8UA 4RI7A 2H6XA 5D9WA 5AI1A 2GT6A 5HFIA 1G6YA 3D4TA 3KZQA 1N8JA 4EW5A 1BRIA 1CQSA 3KTBA 1B2MA 3VLNA 1JRQA 3WGDA 4GQFA 3V98A 3HVNA 1DUGA 4IIAA 4IBPA 4MMMA 3F8HA 4IQAA 1OUNA 4MABA 1FZUA 3CCS3 3GKMA 4PUAA 3GURA 4HBRA 4EE0A 1W6YA 3MYDA 1XW5A 1M1XB 2GBXB 4G0LA 3SEDA 2E7PA 2R0GA 3GKXA 4ECJA 2MBTA 1WP0A 1UUGB 4EIQA 8GSSA 1YNVX 1G0TA 2PVQA 3SBCA 2Y73A 5J9CA 3LYKA 5BMUA 3F3RA 3KFQC 1QQ2A 3WDGB 3OR5A 2PBJA 2XPEA 2B5EA 3C7MA 3CSHA 3TJKA 4Z7XA 2M46A 3QFBC 1R4YA 3D0ZA 3CC23 3EINA 1JB4A 3S27A 3HHVA 1YF0A 1R5PA 4PQ1A 2CA8A 1EUIC 7STDA 4EDZA 3HVVA 3IOSA 3QDNA 4MZBA 1I0XA 3VWUA 4KSMA 2IY2A 3KSPA 1HNBA 4GRFA 3SWLA 4LLRA 3MAKA 4R4KA 3ZLPA 3RDWA 2NVLA 5HFGA 2KHPA 4FQUA 5H5SA 1PX7A 4IP6A 4TXOA 1YDKA 4WXTA 1GSFA 2CW9A 3BCKA 4OO5A 3IE3A 4E8HA 4MJAA 2VOCA 3FZWA 3CMIA 4YKGA 1Z6MA 4V2NA 2MC8A 1VQ53 1IU7A 4J9AA 2YWNA 4G19A 4HU9A 2D2ZA 1Q40B 5CXOA 2YWOA 2RFRA 1RDSA 4D73A 1QVF2 1E3RA 2CG0A 2CX1A 2O7KA 2CWTA 1BRKA 5AIIA 3M9JA 1K0OA 3FGYA 1EZKA 2OBKA 2LQVA 4OCEA 1NNVA 3F40A 2W04A 2E0QA 5KN2A 1M2BA 2YFLB 4G0IA 3NQYA 1JHBA 3AHSA 4JU5A 4KUNA 1DVDA 3GH6A 4MA9A 5D73A 4HUAA 3L4NA 1KD14 5LC6A 1VQO3 4RQRA 2CFGA 1PFOA 3APSA 1B2XA 4GHOA 1JJ22 4EL1A 1BYEA 1G96A 3NOFA 2FA8A 2DC5A 2VCQA 3P90A 2OOVA 3BNEA 1OKDA 2C3QA 4JBBA 3UMAA 1ST9A 3CC73 5DAKA 1STFI 2MBSA 2K54A 1V57A 2PUKC 3VI7A 4FMCA 1QAFA 1W4VA 4FCJA 2REMA 1OF5A 4AJ6A 5KP4A 4XS4A 4MJEA 4YQUA 2IYJA 3DXOA 3KP9A 1SKWB 1FVJA 2OCTA 4PXOA 1A2MA 3IHQA 3CSIA 3PINA 3ZZXA 1B2UA 1KC84 1JBRA 3KXOA 5D8IA 3OW22 1W00A 1O7NB 5CYYA 4PQIA 2H30A 1GLQA 3PZWA 1LRAA 3ZG5A 1XWKA 2DIYA 4LMWA 5G2ZA 4MF6A 5AN1A 1D6YA 1EEMA 1TI1A 4CPKA 2VUPA 2GU3A 1TXXA 5JPPA 2K0MA 3PPUA 1BGSA 1GY5A 1TTZA 4TOPA 2B1KA 1YI23 2YFJB 1ERTA 1GWCA 3A2WA 1E3VA 1NJI4 1DSBA 4X2OA 3UBKA 2FA4A 1U3IA 5EPFA 1AR0A 2WGQA 3UVHA 2HMJB 3JUOA 1GUKA 2X64A 1MEKA 1BRJA 1OPYA 2BJXA 4KDUA 3FKAA 1GSUA 3EMXA 3WOEB 3LJRA 2NDOA 2V32A 1ON4A 3LSZA 2IMJA 3HK4A 3K5TA 1ZMAA 3M1GA 3NIVA 4ECIA 5AIVA 2BT3A 3ISOA 2IL3A 1LOWA 3H79A 4J8TA 1GL8A 3WT1A 4N0ZA 3EBYA 2SBLA 4ZM8A 2GSQA 2CVBA 4K1UA 4OD7A 4PX1A 4G10A 1W02A 1FOHA 3ZIJA 3AHWA 1BNEA 1OCVA 2BTOT 3DGLA 3QAWA 4N3VA 4ACSA 1IVWA 3CCM3 1QVG2 5KP3A 4L0WA 3D5GA 4YKFA 9GSSA 2Y74A 3IC8A 5FT3A 3ZRDA 2XFTA 1HQOA 3HY2A 3LWAA 2ZNMA 4ZIJA 3IR4A 1YIT3 1FUSA 1J9BA 4KDXA 3UEMA 1SJZA 3K63A 4CJNA 2AJQB 2H72A 3Q74A 1EA2A 4POKA 1EWXA 3WHOA 3KCMA 1UN2A 4TR0A 3DYRA 3WR2A 2B3SA 2PGTA 3ERFA 1BSEA 2KAAA 4KNDA 3TOTA 3OWSA 2YNXA 3VWVA 2CFLA 1JB5A 4EC0A 1AQXA 3J7Yd 2F8AA 1FUTA 4O2HA 1F9MA 1OC9A 1FGMA 3GZRA 2C0FA 1RGAA 4MMXB 4TR3A 5ECRB 4Q5QA 2E2MA 4AKZA 4K0NA 2HZEB 4ZB8A 1U87A 2HRFA 2F56A 3FR9A 5KOXA 3B4PA 4XDVA 1X5CA 1T1VA 3N9HA 3EN1B 2KF5A 1KNGA 1WMNA 5HOHA 4WBRD 1F3BA 5M19A 3TJBA 2C3TA 2EIQA 3LTDA 3O8YA 3KSED 3PGBA 1FG4A 1SENA 2VCVA 2R3XA 2NTOA 5IO2A 2O9UX 2VLUA 4HOHA 1RGHA 4YAPA 5FHIA 3NXJA 3CTGA 3T0UA 3WMDA 2DMLA 4STDA 1LVNA 4L7KA 2XSOB 1A0FA 2H76A 3LTCA 4O8SA 2OA7A 1ZYNA 1ZGNA 4XB5A 3A5WA 4X0XA 1FB6A 1W2B2 2LS5A 3G7JA 4RNZA 2EC4A 2WZ9A 3SLUA 4X1UA 1WQLB 3H3HA 3J7Yb 1ISKA 1YY7A 3X3ZA 1EV4A 4TKYA 2CHCA 3IK9A 4JE1A 5AEUB 1TFOA 2GSSA 1J0FA 4GSSA 3LTAA 1LNHA 1PSQA 1BUQA 1THXA 1O7PB 2IFQA 5DALA 4V1Ag 4YQVA 3EWLA 1UUWB 1K3LA 2FUG2 1Q98A 5A5KA 2AAWA 2DJJA 2VCZA 4EVMA 2H66A 3CCE3 4Z2RA 1YEPA 2XC2A 2H0HA 3L9UA 5DJMA 3F63A 3KMNA 2RLIA 1T5YA 1VQ83 4LSOA 2DJ0A 3ZVJA 2KLXA 4J2FA 4J57E 3TCOA 1X9MB 1Q7HA 2LJKA 1I3FA 4WYKA 1EEJA 1SARA 1FGQA 3FKFA 1TRQA 1A8LA 3MPHA 1GP1A 5A4VA 1GSDA 3H1NA 3HJMA 3ZTLA 4L8PA 4IJ3A 4NXIA 4HM4B 2GU1A 1L5GB 1M9BA 5DDLA 4NHZA 20GSA 3CRUA 3QFAC 3LG6A 2D42A 1YF1A 3UIWA 3EB8A 3EU4A 1PN0A 1K28A 1A2JA 2IJYA 4LMVA 5CREA 1JV2B 6GSPA 2CQ9A 4LA1A 5CRGA 2YCDA 4HM7B 3I69A 2H8LA 5CF1A 5HR0A 3KZTA 4HM6B 1AY7A 1YJW3 2A4VA 2PERA 2GQLA 3H4KA 2C10A 5IG4A 3EN8A 5G30A 4AJ7A 1TU5A 2P05A 4K5RA 5F07A 3CSJA 4K2DA 1YGWA 4N6TA 4AKYA 14GSA 1CYVA 1B27A 1YKCA 3HZPA 3M3MA 5B6NA 1RNTA 4Q53A 4FYCA 1C7HA 4DSRA 4MMZB 3Q18A 2XFSA 1EGOA 1K734 2LNTA 3F0IA 1Q9EA 1V98A 1BNSA 5D81A 1KBNA 18GSA 2OQEC 1N9JA 1N2AA 4POBA 4MJDA 2B1LA 1STDA 8RNTA 4IN0A 4G2EA 3BNDA 1EQKA 5D9XA 3LMLA 1RN1A 2A15A 4ZL9A 5L71A 4X4JA 4LEHA 1YHQ3 1D6ZA 2JSZA 1XWCA 4O3VA 1AUCA 3CRTA 5J41A 3JUNA 2JQ5A 1OAZA 4HM5B 1B20A 1GOVA 2XR8B 2GBWB 1BUJA 3DY5A 3KH7A 5GAND 4NV5A 3WT2A 3SX1A 1QXHA 5D82A 3IAM2 4OVMA 4RUVA 3KGKA 4KE3A 1T2IA 1HNAA 4KCAA 1WTHA 5ECIB 5COHA 2WJUA 2O89A 3NBBA 3CCJ3 4ZBBA 3I9V2 1YZXA 2F86B 4GSTA 3LEFA 4N0VA 3HIGA 2CFWA 4N30A 2X8CA 3UJ1A 3A76A 4GCIA 2V6KA 4WETA 3K9MC 4L8OA 1FW1A 3VF1A 3VI5A 2DKHA 1M1K4 6GSSA 2R4IA 1R4CA 4OFMA 4YAVA 4BVYB 3IBHA 4WFOA 3KEBA 2J8XB 4QL9A 1X5DA 3CCR3 4JR4A 4DEJA 1AIUA 4BPYA 5STDA 1YKAA 3UL5A 3RHCA 3FRCA 3TJFA 2BU4A 3GAXA 3HXSA 4K7OA 2FXTA 4WBJA 1FGOA 2PVOC 2AYTA 2GSTA 2HZEA 1MOLA 1RRHA 1WMOA 1QALA 3AY8A 3C8EA 3M8CA 1TOFA 2F5WA 3HIIA 2IA7A 4LGQA 3HOHA 3WD6A 2GT5A 4RQXA 3GSSA 1VF2A 1GS3A 4WWUC 2FWFA 3DWVA 1CQGA 1FHEA 2GS3A 1I70A 1GULA 3I6AA 4IVFA 2F98A 2RCDA 2DKIA 2UX0A 3GL5A 3F4RA 1UGHI 1AQVA 1JLWA 3Q6OA 3DMCA 3SOAA 3ZFZA 4IQ1A 2DMMA 3GSPA 1SJIA 1URMA 3F3QA 4WF4A 4HJMA 2YFIB 3W6GA 2XPDA 4NAXA 5KP1A 3IA1A 2E2VA 3FG4A 2L1SA 3W8SA 1FGRA 2UGIA 1VQ73 1LU4A 5ID2B 3GMFA 5DRVA 2GVPA 2KUCA 5TGNA 2C1YA 4XBTA 4TVEA 4HDEA 2NPBA 3ROBA 3A5EA 1O85A 4IW9A 3GWRA 3G16A 2OE1A 4GQCA 1X1YA 2GEXA 3A3TA 1QAKA 5BXQA 1CYUA 3X40A 4K5SA 5HR3A 3LXZA 3RNTA 3EHCA 3DD3A 4XBYA 1RJOA 1ZYEA 4IP1A 1FUWA 3Q2PA 4CY8A 1EP7A 4HZ2A 4I4KA 2C4BA 1B21A 4PNFA 1VQK3 1M9AA 1WIKA 2VLVA 4HJLB 4BVXB 4MF7A 4DKIA 2O85A 1UCKA 1EOHA 1QMAA 2IMDA 1DE2A 2RM6A 2W0QA 1GSSA 1AXDA 1ERVA 4I8BA 4CW9A 3H8QA 5EVHA 4CCVA 2H6YA 3K0ZA 4LMIA 1M904 1IVXA 1F6MC 5IOXA 1A67A 2O8VB 1RCKA 2F3MA 3I553 2LV3A 3CYNA 4BL3A 3LZAA 3C71A 4F9ZA 3CPW2 3IMAB 5F0GA 1F37A 2CK3H 1RGKA 2CFDA 2XHFA 1MD4A 3KTLA 3OWUA 2YN1A 4F0CA 1LBKA 3G7YA 2KP2A 1S5AA 3EC3A 2YWMA 3D4AA 4OCFA 4IELA 3U1WA 2LQQA 3U5RE 2OE0A 2W56A 2YX9A 4HM2B 1K3OA 4O7HA 4OO4A 2W03A 5AYSC 3ZVJD 4HEA2 1X0RA 3NUVA 1W6GA 2IUJA 2I4AA 3ZMLA 1SL1B 2FWHA 4ECBA 1NDOB 3FMWA 2CKFB 2HLSA 3G8ZA 2G2QA 2WO0A 2H74A 3F6DA 2Z7AA 3F14A 4RBNA 1GSYA 3FCSB 5LD0A 1WJKA 3PH9A 1Q824 2JACA 3C1RA 5IW9A 4LL1B 2K3DA 4XIHA 1WMJA 4H61A 2QSIA 3F6FA 5CAXA 1EGRA 1GLPA 3BOAA 2XGLA 2DJ1A 3CNMA 4FYBA 1FO5A 1OHPA 3UNLA 1RGCA 3GTUB 5ECLB 2CZ3A 4NPBA 1Z7PA 3ECFA 4BWSA 2I1UA 1U88A 3UOMA 1OE7A 4YQMA 4FCMA 3BNCA 1B9XC 1HYUA 4GB5A 4R80A 4HS1A 5ECKB 1V58A 3LOYA 4N6UA 1R4WA 3WODG 4PTSA 5JWRB 3MG3A 4HU7A 2LQOA 1I5GA 1IYYA 4MJBA 1TK0B 2VO4A 2XF3A 4BL7A 2E2GA 1XFLA 3RAZA 3DGYA 1A2VA 5IG0A 1US1A 3LYPA 3IPZA 5A4WA 1T8EB 3DKSA 3KE7A 4CY6A 4R1KA 3D4MA 4V1Ap 3WOFB 5GAPD 1PYLA 4XS6A 3NHXA 3GL3A 1VGLA 2L59A 1SIIA 3L0HA 3TRQA 1C54A 2C0DA 1ULIB 2YV7A 1B4PA 1ZYPA 4L5LA 1B4QA 5IOWA 1UI8A 3IC4A 1Q7Y4 2EIOA 2FY6A 4KAEA 4EXJA 4OUQA 1G7OA 2B5YA 2G0FA 3V92A 3C1SA 5JWQB 2HI7A 1TRVA 2H73A 2NBSA 5CNWA 2V2GA 4BVYA 1PL2A 1TRSA 2J9HA 1N5PA 3RHBA 3MHEA 2K8VA 4HSCX 1LNIA 5G1KA 4HM1B 3HX8A 1K0BA 3GIXA 3S28A 1QK8A 5KOWA 2WCIA 2JDIH 2YJ7A 1GTAA 3CCL3 2QKEA 1PRXA 1PN9A 1DVCA 4XBXA 1JLVA 2AADA 1ROAA 5J5NA 3M8NA 4KFEA 3X3YA 3K7CA 1FVKA 1BJXA 1Q4JA 1XIYA 2GTUA 2VM1A 2BIRA 1BU4A 3BCIA 1M2DA 2GLRA 2IMFA 1SJ6A 4HQZA 1BNRA 3VWWA 1BOXA 1ROVA 2H0IA 4KB3A 3IXRA 3QRDA 3ZFLA 5ECHB 1KEBA 5CF2A 1GMQA 1S723 2RNTA 2HRKA 3GUSA 5D83A 1GTUA 1WWJA 2BMXA 1GD3A 2LRCA 3GV1A 1GD4A 4AF2A 4EXRA 3E99A 4HKVB 3LH4A 1U5OA 1VF4A 1O7GB 4HZBB 5IM9A 3QD9A 3KM6A 2ES7A 2F99A 2ML6A 1DYUA 1YVBI 4KT3B 2GGTA 1EG9B 1RNBA 3DXBA 5ECMB 3TUEA 3UL3A 4FIWA 2P0XA 3AMOB 1K0MA 2A2PA 1VQP3 2H01A 3CCV3 3G6E3 3MSOA 4L5OA 3MKIA 2FGXA 1AVKA 4MPFA 3ED3A 4GWRA 2B6MA 5D9VA 2RM5A 1SD9A 1IT7A 1BEDA 2H1GA 3K8NA 4BVXA 4BTYA 1SL0B 3UBLA 4ID0A 1NHOA 3VK9A 2RSXA 1WMPA 4F2IA 1K41A 1MDJA 1UDII 5B6MA 3I43A 2L5OA 3TKRA 1VQM3 2XBQA 2INXA 3VPTA 5D93A 2Z77A 1O8WA 2GDRA 4Z2UA 1BSBA 1W5ZA 1WNHA 2I9WA 1T4ZA 2LYXA 2VL2A 3R3EA 4GL6A 3PYJA 1BSCA 1XW6A 2HT9A 3FF2A 4POMA 4JZQA 1B8XA 2R2JA 4NWYA 5H5QA 1QFNA 3G0KA 4MF5A 3TB2A 2GQMA 1BAYA 4FMBA 5ECNB 4HQSA 3PXMA 1A2KA 5G1LA 1AQZA 2H6ZA 3X3XA 2YPMA 2XSHB 2P09A 3FF0A 4XS1A 1Z9HA 4GSPA 3M9KA 1RRLA 2R6KA 1Z6NA 1ZS7A 3F9SA 3FHKA 1JB2A 2OE3A 4G0KA 4MCUA 1RGGA 1Y4KA 5IMZA 1U3AA 5JWOB 2QGVA 3CXGA 1BNIA 4G9HA 4ZL7A 1M3IA 1NM3A 2VCXA 3DZLA 5E59A 2CZ2A 3F4TA 1JKGB 1C72A 1OGXA 3KIIA 4JRRA 1AC1A 1VF1A 4MK3A 1BSAA 3B4OA 3OX9A 1XPVA 1AV4A 4NMUA 2MMOA 4GTUA 1E97A 3OV4A 5J4UA 1YJN3 2MMAA 12GSA 4KCEA 1WOUA 2GZPA 4ML1A 1ML6A 4PURA 2JADA 1BX9A 5FGOA 2GSRA 2WFCA 4ZILA 2FGTA 1CH0A 3HJOA 3QAVA 3EYTA 2DIZA 1I2GA 1I2FA 3V1WA 1TUHA 3QOUA 3FR6A 2HRAA 2H1AA 2VL9A 1PY3A 4MZWA 4HZ4A 2L57A 5JCWA 3FW2A 3ZG0A 4RZMA 3IDVA 4XM4A 2PN8A 4ZL8A 1GOUA 1VQN3 4WP5A 4EIPA 1I9DA 2CG1A 1JNQA 1Q40A 1BNFA 1GY6A 2RIIA 4EYCA 1B9YC 2B7JA 2YZHA 3TKSA 2VM2A 2C3NA 4EV2A 3EQQB 3NV0B 3DM8A 2OTJ3 3RBTA 2O3OA 5RNTA 1TK5B 1DMMA 2E2TA 2IIYA 2F51A 1F3AA 2KRTA 2ML5A 2C11A 1W89A 4K2XA 2P0GA 2GXFA 3ZMKA 2RUEA 4N6OB
chains in the Genus database with same CATH topology
2RUFA 5G5FA 2QC7A 2K8SA 3APOA 3ERGA 4GXZA 3WGEA 5KN1A 4X43A 2TRXA 1T4YA 1S3CA 3FZ4A 4KF9A 1A8YA 2HSMA 5DQYA 1QMVA 1VF3A 3TRXA 3DEXA 3U6VA 1M7TA 4ZB6A 3D21A 4Q5FA 2N5FA 3MNGA 4AGSA 3Q19A 1XWGA 2DBCA 4NV2A 3HJPA 2JZSA 3IK7A 2A4HA 1GNWA 1M99A 3PR8A 5JCGA 3GNJA 1KTEA 1WE0A 1U6TA 1SU9A 4ISDA 2VCWA 1PMTA 5HR1A 4K7NA 4BA7A 3IRAA 3EU3A 2X8GA 2YWIA 4KH7A 3VURA 2F8FA 4IS0A 5IO0A 2X99A 3FZ9A 3N9JA 2B7KA 2LSTA 1BQ7A 1Z5YE 3DMLA 1X9SB 4XRDA 4TN8A 3ERWA 2AHEA 1XW9A 1HD2A 4TXOB 1O81A 3GFKA 3E9JB 4PQHA 6GSVA 2L4CA 2CT6A 3ME8A 1S3DA 5DQSA 4D73B 4EKZA 3F4SA 2B5XA 5IMCA 3E3EA 1JFUA 1TRUA 1FB0A 5G5EA 4JEDA 4CDOA 2I9HA 1FAAA 3HYPA 4F0BA 16GSA 3TDGA 2FWEA 2IMEA 2HSHA 2H1DA 2C0GA 1H75A 3FZ5A 4EUYA 2AUVA 1EV9A 4AJ8A 3ZFBA 3JCML 4PUFC 2HNLA 1SYRA 5DAKB 4L8EA 4KW6A 2AV4A 3UVTA 4XS4B 2P5RA 5INYA 4GLTA 5F06A 1GNEA 4I5QA 3GX0A 5C04A 4TR1B 3S9FA 2JZRA 5HFKA 2VD0A 4L0UA 1PGTA 3GHAA 5ECPB 4DVCA 2FCHA 1M2AA 2C0EA 3CTFA 5AIXA 3FR3A 4OMVA 4P3YB 3HD5A 4F03A 1QUWA 4CHSA 5B8AA 2VIMA 3LQ7A 2WDUA 3HCZA 2IMIA 3O76A 4TXVA 1RK4A 19GSA 3L9VA 2L5LA 3TJGA 1K3YA 4KSOA 3N5OA 1AW9A 2PMTA 2DLXA 3A2XA 2P5QA 3VPQA 2JSYA 1XOAA 4FYUA 5CRHA 2R5GA 2YV9A 1TK8B 2ALBA 3DVXA 3FK8A 3QMXA 1Z3EA 4NHWA 3TKSE 4Z2TA 2MMNA 3ZL5A 3ZITA 2LJAA 2ZCTA 22GSA 3J7Yk 2H75A 1X9WB 2C4JA 2L4QA 3FYGA 4XCSA 1ILOA 2EIRA 2MMZA 1UC7A 3D5JA 6GSTA 3HVSA 2LEGA 6GSXA 1OVNA 5HQPA 3O3TA 1A2LA 1A24A 17GSA 1OC9B 1XBSA 5H5RA 1ZYQB 4K6XA 3M0FA 5IIZA 5BRTA 3LFLA 4ZXGA 4BWQA 1YJ6A 4I2UA 3WGXA 1A0RP 5CRDA 2AB6A 1TP9A 2A2RA 2WRTA 1S3AA 1OYJA 4I6XA 3GH9A 4DSSB 2GQKA 1E2YA 3F9UA 5DCHA 4EF0A 1OC3A 5KN3A 3HZ4A 4O32A 5E4WA 5CRWA 1ZZYA 1THOA 3HKRA 1PKZA 5J3RA 3UAPA 4OWYA 3KMOA 2DJ2A 2N5AA 3BBYA 4V2MA 2R0CA 2FNOA 6GSWA 2IFQB 2OACA 4N10A 5DALB 3FEUA 3WYWA 2LUSA 4IHUA 1DE1A 5B7CA 2LKUA 4ICYA 5IMFA 2PU9C 4ULXA 5GSTA 1TI3A 1GUHA 2K9FA 3TKPA 1HNCA 4IJIA 1GH2A 2LRNA 1SK1A 4J56E 1R26A 4YH2A 2FHEA 5IQYA 2LRTA 3TJJA 3GKNA 2VCTA 5DBQA 3A2VA 3R2QA 4H86A 3LGCA 4HOJA 3APQA 2F9SA 3KIJA 3ME7A 2KP1A 3IHGA 3H93A 2H70A 5AGYA 5DCGA 1M0UA 1OE8A 4MP4A 3GKKA 3GRXA 5EY6A 1XVQA 10GSA 2QA1A 4A5PA 1JZRA 5ID2A 1GSEA 2JL4A 1SL2B 2I81A 4TR1A 1BG5A 4QQ7A 1K0CA 2WGRA 1DBYA 2WULA 3ZREA 3DVWA 4WF5A 2IN3A 1OC8A 1R7HA 5IPGA 4TW5A 4KX4A 2H71A 5J9BA 3DIEA 5AISA 1NW2A 3BD2A 3HZ8A 4MJCA 2K18A 2QA2A 3ZIVA 2GZYA 1G7EA 2JZTA 4USSA 2OBIA 1AAZA 1Z7RA 2PPTA 2O87A 2CAIA 4KA0A 3P8WA 4TRXA 5KEJA 1V2AA 5IMDA 2M80A 1T7PB 2TRCP 2LJRA 2V41A 3RPNA 3VWXA 5GSSA 3MWHA 5A4UA 1ZCPA 1RQMA 2YANA 2MYGA 1K0NA 2YJHA 4ZB9A 2FD3A 4MDCA 1PX6A 2HFDA 5CP1A 2CVKA 2R37A 3QPMA 4ZBDA 3A5IA 2LTKA 2HRNA 1O8XA 3MSZA 3EPTA 4F82A 1GSQA 2FLSA 3KJYA 1USBA 3W8JA 4ECCA 1FOVA 1ZOFA 5FWGA 3GTUA 1J08A 3LORA 3TOUA 4MH3A 2C8UA 4MNNA 2DJ3A 3D6IA 1XXUA 4DSSA 2L6CA 2CVDA 1GRXA 1NHYA 4KGIA 2LNSA 4DSQA 4XRAA 5EL8A 4N11A 2JU5A 4QL7A 3GYKA 3BJ5A 5CO3A 2I3YA 3UARA 1GTIA 1IYHA 13GSA 1O73A 1PL1A 3P7XA 4HI7A 2P31A 4ML6A 2XBIA 5B8BA 1EP8A 4FH8A 2IPAA 5ECOB 3QAGA 4GF0A 1PQNA 3L9SA 4WEYA 1TRWA 1G6WA 3EURA 3E0UA 5IMVA 4Q5RA 5LCZA 1XZOA 4Q5NA 5D9TA 5F8BA 3KP8A 5KN0A 4K0GA 3DGQA 4PGTA 1V40A 4K7IA 4WR5A 2HSYA 1UVZA 1MD3A 1ERWA 4KDYA 1TJDA 5ABRA 4MH2A 2KOKA 4MPGA 2VD1A 2L6DA 1WRYA 4OFTA 2GZZA 1SK0A 3LW9A 3MDKA 3US3A 4O92A 2CV4A 2VLTA 7GSSA 2HZFA 2FWGA 3D22A 4ZBAA 5G31A 1TDIA 2YP6A 2CX3A 2ZUPA 1K0AA 4JR6A 4V2LA 3DRNA 1MTCA 6GSYA 1MDKA 1VRSD 1RW1A 1X5EA 3EMPA 4XHMA 4EDYA 3FZAA 4OFNA 1QGVA 3FY7A 2V6OA 1EOGA 5GZZB 4RI6A 4WKWA 1R5AA 2CX4A 2HE3A 4IKHA 1JZWA 2J23A 5IMAA 1O6JA 4TR4A 1PD21 2OJLA 3GA4A 5F05A 1XOBA 3TKQA 2HYXA 2HXKA 1ACVA 3KH9A 3O6TA 2X8HA 3GN3A 2A2SA 3KD0A 1GTBA 1OKTA 1CQHA 1T3BA 3EE2A 5HR2A 3HVXA 3GSTA 1F2EA 4ILFA 1TU7A 5DJLA 5DVBA 4O5QA 5ELGA 3HDCA 5IPHA 1A23A 4GSNA 2X4AA 1TU8A 4O5RA 1XWAA 1O7UA 4XTSA 2M72A 1LJRA 3TGZA 1K0DA 1Y6EA 4BL7B 4MLYA 3G7IA 1XVWA 1T00A 5EVOA 2DJKA 3L78A 2K6VA 1E6BA 1IYIA 1XCCA 2R0PA 3HA9A 1UA5A 1YEXA 5ECSA 1H4OA 2OADA 2N5BA 2VL2C 2CAQA 4EO3A 1ABAA 1NSWA 1PA3A 1JZDA 2YOIA 2ON7A 4HJ2A 2R4VA 2IMKA 4PNGA 1Y25A 3PGTA 4I2TA 3VFIA 2DSAA 4MZCA 2MZCA 1XWBA 1YQ1A 2ON5A 5D96A 2C80A 3MIXA 4WR4A 2UZ8A 1TW9A 2WS2A 2H1BA 3QCPA 4POLA 3EVIA 5JCUA 5ECQB 3GX8A 2TIRA 2OKAA 2PWJA 3IAS2 3P2AA 1MDIA 2Z9SA 1PKWA 3LXTA 4I97A 5ENUA 1SKSB 2IWTA 1ERUA 5LNKe 1JZOA 1AQWA 4K1FA 1GUMA 4O5UA 1SD8A 2YZUA 1TKDB 5ELAA 3NZNA 4IGJA 3C73A 3G9BA 2VL3A 5C00A 3IV4A 3TKSC 3TRPA 3QR6A 1WPIA 1SK2A 2VAFA 6GSUA 4E8EA 3CBUA 1SYXA 4K9ZA 2H19A 1ZL9A 1SKRB 11GSA 4FO5A 2WB9A 1V9WA 2X49A 2V1MA 4LL4B 3RPPA 4K8MA 1B48A 2H0GA 3F8UA 4RI7A 2H6XA 5D9WA 2GT6A 5HFIA 1G6YA 3D4TA 3KZQA 1N8JA 3KTBA 3VLNA 3WGDA 4GQFA 1DUGA 4IBPA 4MMMA 4IQAA 4MABA 3GKMA 4PUAA 3GURA 4EE0A 3MYDA 1XW5A 4G0LA 2E7PA 2R0GA 3GKXA 4ECJA 2MBTA 1WP0A 4EIQA 8GSSA 1G0TA 2PVQA 3SBCA 5J9CA 3LYKA 5BMUA 3F3RA 1QQ2A 3OR5A 2PBJA 2XPEA 2B5EA 3C7MA 3CSHA 3TJKA 4Z7XA 2M46A 3QFBC 3D0ZA 3EINA 3HHVA 1YF0A 1R5PA 4PQ1A 2CA8A 4EDZA 3HVVA 3IOSA 3QDNA 4MZBA 3VWUA 4KSMA 2IY2A 1HNBA 4GRFA 3SWLA 4LLRA 3MAKA 3ZLPA 3RDWA 2NVLA 5HFGA 2KHPA 4FQUA 5H5SA 1PX7A 4IP6A 4TXOA 1YDKA 4WXTA 1GSFA 3BCKA 4OO5A 3IE3A 4E8HA 4MJAA 2VOCA 3CMIA 4YKGA 1Z6MA 4V2NA 2YWNA 4G19A 4HU9A 2D2ZA 2YWOA 4D73A 2O7KA 3M9JA 1K0OA 1EZKA 2OBKA 4OCEA 2E0QA 5KN2A 1M2BA 4G0IA 1JHBA 4JU5A 4KUNA 3GH6A 4MA9A 5D73A 4HUAA 3L4NA 4RQRA 3APSA 4EL1A 1BYEA 3NOFA 2FA8A 2DC5A 2VCQA 3P90A 1OKDA 2C3QA 4JBBA 3UMAA 1ST9A 5DAKA 2MBSA 1V57A 2PUKC 3VI7A 1W4VA 2REMA 4AJ6A 4XS4A 4MJEA 4YQUA 2IYJA 1SKWB 3KP9A 1FVJA 4PXOA 1A2MA 3IHQA 3CSIA 3PINA 3ZZXA 5D8IA 3KXOA 5CYYA 4PQIA 2H30A 1GLQA 1XWKA 2DIYA 4LMWA 5G2ZA 4MF6A 5AN1A 1EEMA 1TI1A 2VUPA 1TXXA 3PPUA 1TTZA 4TOPA 2B1KA 1ERTA 1GWCA 3A2WA 1DSBA 3UBKA 2FA4A 1U3IA 5EPFA 3UVHA 1GUKA 2X64A 1MEKA 2BJXA 4KDUA 1GSUA 3EMXA 3LJRA 2NDOA 2V32A 1ON4A 3LSZA 1ZMAA 3M1GA 3NIVA 4ECIA 5AIVA 3ISOA 2IL3A 3H79A 1GL8A 3WT1A 4N0ZA 2GSQA 2CVBA 4OD7A 4PX1A 4G10A 1FOHA 3ZIJA 2BTOT 3QAWA 4ACSA 4L0WA 9GSSA 4YKFA 3IC8A 5FT3A 3ZRDA 1HQOA 3HY2A 3LWAA 2ZNMA 4ZIJA 3IR4A 4KDXA 1J9BA 3UEMA 1SJZA 2AJQB 2H72A 3Q74A 4POKA 1EWXA 4TR0A 3KCMA 1UN2A 3DYRA 2B3SA 2PGTA 3ERFA 4KNDA 3TOTA 2YNXA 3VWVA 4EC0A 1AQXA 2F8AA 1F9MA 1OC9A 2C0FA 4TR3A 5ECRB 4Q5QA 2E2MA 4K0NA 2HZEB 4ZB8A 1U87A 2HRFA 3FR9A 5KOXA 1X5CA 1T1VA 1KNGA 4WBRD 1F3BA 3TJBA 2C3TA 2EIQA 1FG4A 1SENA 2VCVA 5IO2A 2R3XA 2NTOA 2VLUA 5FHIA 4YAPA 3CTGA 2DMLA 1A0FA 2H76A 2OA7A 1ZYNA 1ZGNA 3A5WA 4X0XA 1FB6A 2LS5A 3G7JA 2EC4A 2WZ9A 4X1UA 3J7Yb 1YY7A 1EV4A 4TKYA 3IK9A 4JE1A 1J0FA 2GSSA 4GSSA 1PSQA 1THXA 2IFQA 5DALA 4V1Ag 4YQVA 3EWLA 1K3LA 2FUG2 1Q98A 5A5KA 2AAWA 2DJJA 2VCZA 4EVMA 2H66A 4Z2RA 1YEPA 2XC2A 2H0HA 3L9UA 5DJMA 3F63A 3KMNA 2RLIA 2DJ0A 3ZVJA 2KLXA 4J2FA 4J57E 3TCOA 1X9MB 2LJKA 1EEJA 3FKFA 1A8LA 5A4VA 1GP1A 1GSDA 3H1NA 3HJMA 3ZTLA 4IJ3A 4NXIA 1M9BA 5DDLA 4NHZA 20GSA 3CRUA 3QFAC 3LG6A 1YF1A 3UIWA 3EU4A 1PN0A 1A2JA 2IJYA 4LMVA 5CREA 2CQ9A 4LA1A 5CRGA 2YCDA 3I69A 2H8LA 5HR0A 2A4VA 2PERA 2GQLA 3H4KA 5G30A 4AJ7A 4K5RA 5F07A 3CSJA 4K2DA 14GSA 1YKCA 3M3MA 5B6NA 4FYCA 4DSRA 3Q18A 1EGOA 2LNTA 3F0IA 1V98A 1KBNA 18GSA 1N2AA 4POBA 2B1LA 4IN0A 4G2EA 5D9XA 4ZL9A 5L71A 4X4JA 2JSZA 1XWCA 3CRTA 1AUCA 5J41A 1OAZA 3KH7A 5GAND 4NV5A 3WT2A 1QXHA 3IAM2 4RUVA 3KGKA 4KE3A 1HNAA 4KCAA 5ECIB 5COHA 2WJUA 2O89A 4ZBBA 3I9V2 1YZXA 4GSTA 3LEFA 4N0VA 4N30A 2X8CA 3UJ1A 4GCIA 2V6KA 4WETA 1FW1A 3VI5A 2DKHA 6GSSA 4OFMA 4YAVA 4BVYB 3IBHA 3KEBA 4QL9A 1X5DA 4JR4A 4DEJA 1AIUA 4BPYA 1YKAA 3RHCA 3FRCA 3TJFA 3HXSA 4K7OA 4WBJA 2PVOC 2AYTA 2GSTA 2HZEA 3C8EA 3AY8A 1TOFA 3WD6A 2GT5A 4RQXA 3GSSA 1VF2A 2FWFA 3DWVA 1CQGA 1FHEA 2GS3A 3I6AA 1GULA 4IVFA 2DKIA 3GL5A 3Q6OA 3ZYWA 3F4RA 1AQVA 1JLWA 4IQ1A 2DMMA 1SJIA 1URMA 3F3QA 4WF4A 4HJMA 3W6GA 2XPDA 4NAXA 3IA1A 3W8SA 1LU4A 5ID2B 3GMFA 2GVPA 2KUCA 2C1YA 4TVEA 4HDEA 2NPBA 1O85A 4IW9A 4GQCA 2OE1A 3A3TA 4K5SA 5HR3A 3LXZA 3DD3A 1ZYEA 4IP1A 4CY8A 1EP7A 4HZ2A 4PNFA 1WIKA 1M9AA 2VLVA 4BVXB 4MF7A 2O85A 1EOHA 2IMDA 1DE2A 2RM6A 1GSSA 1AXDA 1ERVA 4I8BA 4CW9A 3H8QA 2H6YA 1F6MC 5IOXA 2O8VB 2F3MA 2LV3A 3CYNA 3C71A 4F9ZA 5F0GA 1F37A 2XHFA 1MD4A 3KTLA 2YN1A 4F0CA 1LBKA 3G7YA 2KP2A 3EC3A 2YWMA 4OCFA 4IELA 2LQQA 3U5RE 2OE0A 1K3OA 4O7HA 4OO4A 3ZVJD 4HEA2 1X0RA 2I4AA 3ZMLA 1SL1B 2FWHA 4ECBA 3FMWA 2HLSA 2G2QA 2H74A 3F6DA 1GSYA 5LD0A 1WJKA 3PH9A 2JACA 3C1RA 4LL1B 4XIHA 5CAXA 1WMJA 2QSIA 3F6FA 1EGRA 1GLPA 3BOAA 2DJ1A 1FO5A 4FYBA 3GTUB 5ECLB 2CZ3A 4NPBA 1Z7PA 4BWSA 2I1UA 1U88A 3UOMA 1OE7A 4YQMA 1B9XC 1HYUA 4HS1A 5ECKB 1V58A 1R4WA 4PTSA 5JWRB 4HU7A 2LQOA 1I5GA 4MJBA 1TK0B 2VO4A 4BL7A 2E2GA 1XFLA 3RAZA 3LYPA 3IPZA 5A4WA 1T8EB 3DKSA 4CY6A 3D4MA 4V1Ap 5GAPD 4XS6A 3GL3A 1VGLA 2L59A 3L0HA 3TRQA 2C0DA 2YV7A 1B4PA 1ZYPA 4L5LA 1B4QA 5IOWA 3IC4A 2EIOA 2FY6A 4KAEA 4EXJA 1G7OA 2B5YA 2G0FA 3C1SA 5JWQB 2HI7A 1TRVA 2H73A 2NBSA 5CNWA 2V2GA 4BVYA 1PL2A 1TRSA 2J9HA 3RHBA 2K8VA 5G1KA 1K0BA 3GIXA 1QK8A 5KOWA 2WCIA 2YJ7A 1GTAA 2QKEA 1PRXA 1PN9A 1JLVA 5J5NA 3M8NA 1FVKA 1BJXA 1Q4JA 1XIYA 2GTUA 2VM1A 3BCIA 1M2DA 2GLRA 2IMFA 1SJ6A 4HQZA 3VWWA 2H0IA 4KB3A 3IXRA 3ZFLA 5ECHB 1KEBA 2HRKA 3GUSA 1GTUA 1WWJA 2BMXA 2LRCA 3GV1A 4AF2A 1VF4A 5IM9A 3QD9A 3KM6A 2ES7A 3DXBA 2GGTA 5ECMB 3TUEA 3UL3A 4FIWA 1K0MA 2A2PA 2H01A 4L5OA 2FGXA 4MPFA 3ED3A 4GWRA 2B6MA 5D9VA 2RM5A 1SD9A 1BEDA 2H1GA 3K8NA 4BVXA 1SL0B 3UBLA 4ID0A 1NHOA 3VK9A 4F2IA 1MDJA 5B6MA 3I43A 2L5OA 3TKRA 2XBQA 3VPTA 5D93A 1O8WA 2GDRA 4Z2UA 1T4ZA 2VL2A 3R3EA 1XW6A 2HT9A 4POMA 4JZQA 1B8XA 2R2JA 4NWYA 5H5QA 1QFNA 4MF5A 3TB2A 2GQMA 1BAYA 5ECNB 4HQSA 5G1LA 2H6ZA 2YPMA 4XS1A 1Z9HA 3M9KA 2R6KA 1Z6NA 3FHKA 2OE3A 4G0KA 4MCUA 5IMZA 1U3AA 5JWOB 2QGVA 3CXGA 4G9HA 4ZL7A 1NM3A 2VCXA 5E59A 2CZ2A 3F4TA 1C72A 4JRRA 1AC1A 1VF1A 4MK3A 1XPVA 4NMUA 2MMOA 4GTUA 5J4UA 2MMAA 12GSA 4KCEA 1WOUA 2GZPA 4ML1A 1ML6A 4PURA 2JADA 1BX9A 2GSRA 2WFCA 4ZILA 3HJOA 3QAVA 3EYTA 2DIZA 3V1WA 3QOUA 3FR6A 2HRAA 2H1AA 2VL9A 4MZWA 4HZ4A 2L57A 5JCWA 3FW2A 3IDVA 2PN8A 4ZL8A 4EIPA 1I9DA 2RIIA 1B9YC 2B7JA 2YZHA 3TKSA 2VM2A 2C3NA 3RBTA 1TK5B 2IIYA 2F51A 1F3AA 1W89A 4K2XA 2P0GA 3ZMKA 2RUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUF A;  5G5F A;  2QC7 A;  2K8S A;  3APO A;  3ERG A;  4GXZ A;  3WGE A;  5KN1 A;  4X43 A;  2TRX A;  1T4Y A;  1S3C A;  3FZ4 A;  1A8Y A;  5DQY A;  1QMV A;  1VF3 A;  3TRX A;  3DEX A;  3U6V A;  1M7T A;  4ZB6 A;  3D21 A;  4Q5F A;  2N5F A;  3MNG A;  4AGS A;  3Q19 A;  1XWG A;  2DBC A;  4NV2 A;  3HJP A;  2JZS A;  3IK7 A;  1GNW A;  1M99 A;  3PR8 A;  5JCG A;  3GNJ A;  1KTE A;  1WE0 A;  1U6T A;  1SU9 A;  4ISD A;  2VCW A;  1PMT A;  5HR1 A;  4K7N A;  4BA7 A;  3IRA A;  3EU3 A;  2X8G A;  2YWI A;  4KH7 A;  3VUR A;  2F8F A;  4IS0 A;  5IO0 A;  2X99 A;  3FZ9 A;  3N9J A;  2B7K A;  2LST A;  1BQ7 A;  1Z5Y E;  3DML A;  1X9S B;  4XRD A;  4TN8 A;  3ERW A;  2AHE A;  1XW9 A;  1HD2 A;  4TXO B;  1O81 A;  3GFK A;  3E9J B;  4PQH A;  6GSV A;  2L4C A;  2CT6 A;  3ME8 A;  1S3D A;  5DQS A;  4D73 B;  4EKZ A;  3F4S A;  2B5X A;  5IMC A;  3E3E A;  1JFU A;  1TRU A;  1FB0 A;  5G5E A;  4JED A;  4CDO A;  2I9H A;  1FAA A;  3HYP A;  4F0B A;  16GS A;  3TDG A;  2FWE A;  2IME A;  2HSH A;  2H1D A;  2C0G A;  1H75 A;  3FZ5 A;  4EUY A;  2AUV A;  1EV9 A;  4AJ8 A;  3ZFB A;  3JCM L;  4PUF C;  2HNL A;  1SYR A;  5DAK B;  4L8E A;  4KW6 A;  2AV4 A;  3UVT A;  4XS4 B;  2P5R A;  5INY A;  4GLT A;  5F06 A;  1GNE A;  4I5Q A;  3GX0 A;  5C04 A;  4TR1 B;  3S9F A;  2JZR A;  5HFK A;  2VD0 A;  4L0U A;  1PGT A;  3GHA A;  5ECP B;  4DVC A;  2FCH A;  1M2A A;  2C0E A;  3CTF A;  5AIX A;  3FR3 A;  4OMV A;  4P3Y B;  3HD5 A;  4F03 A;  1QUW A;  4CHS A;  5B8A A;  2VIM A;  3LQ7 A;  2WDU A;  3HCZ A;  2IMI A;  3O76 A;  4TXV A;  1RK4 A;  19GS A;  3L9V A;  2L5L A;  3TJG A;  1K3Y A;  4KSO A;  3N5O A;  1AW9 A;  2PMT A;  2DLX A;  3A2X A;  2P5Q A;  3VPQ A;  2JSY A;  1XOA A;  4FYU A;  5CRH A;  2R5G A;  2YV9 A;  1TK8 B;  2ALB A;  3DVX A;  3FK8 A;  3QMX A;  1Z3E A;  4NHW A;  3TKS E;  2MMN A;  3ZL5 A;  3ZIT A;  2LJA A;  2ZCT A;  22GS A;  3J7Y k;  2H75 A;  1X9W B;  2C4J A;  2L4Q A;  3FYG A;  4XCS A;  1ILO A;  2EIR A;  2MMZ A;  1UC7 A;  3D5J A;  6GST A;  3HVS A;  2LEG A;  6GSX A;  1OVN A;  5HQP A;  3O3T A;  1A2L A;  1A24 A;  17GS A;  1OC9 B;  1XBS A;  5H5R A;  1ZYQ B;  4K6X A;  3M0F A;  5IIZ A;  3LFL A;  4ZXG A;  4BWQ A;  1YJ6 A;  4I2U A;  3WGX A;  1A0R P;  5CRD A;  2AB6 A;  1TP9 A;  2A2R A;  2WRT A;  1S3A A;  1OYJ A;  4I6X A;  3GH9 A;  4DSS B;  2GQK A;  1E2Y A;  3F9U A;  5DCH A;  4EF0 A;  1OC3 A;  5KN3 A;  3HZ4 A;  4O32 A;  5E4W A;  5CRW A;  1ZZY A;  1THO A;  3HKR A;  1PKZ A;  5J3R A;  3UAP A;  4OWY A;  3KMO A;  2DJ2 A;  2N5A A;  3BBY A;  4V2M A;  2FNO A;  6GSW A;  2IFQ B;  2OAC A;  4N10 A;  5DAL B;  3FEU A;  3WYW A;  2LUS A;  4IHU A;  1DE1 A;  5B7C A;  2LKU A;  5IMF A;  2PU9 C;  4ULX A;  5GST A;  1TI3 A;  1GUH A;  2K9F A;  3TKP A;  1HNC A;  4IJI A;  1GH2 A;  2LRN A;  1SK1 A;  4J56 E;  1R26 A;  4YH2 A;  2FHE A;  5IQY A;  2LRT A;  3TJJ A;  3GKN A;  2VCT A;  5DBQ A;  3A2V A;  3R2Q A;  4H86 A;  3LGC A;  4HOJ A;  3APQ A;  2F9S A;  3KIJ A;  3ME7 A;  2KP1 A;  3H93 A;  2H70 A;  5AGY A;  5DCG A;  1M0U A;  1OE8 A;  4MP4 A;  3GKK A;  3GRX A;  5EY6 A;  1XVQ A;  10GS A;  1JZR A;  5ID2 A;  1GSE A;  2JL4 A;  1SL2 B;  2I81 A;  4TR1 A;  1BG5 A;  4QQ7 A;  1K0C A;  2WGR A;  1DBY A;  2WUL A;  3ZRE A;  3DVW A;  4WF5 A;  2IN3 A;  1OC8 A;  1R7H A;  5IPG A;  4TW5 A;  4KX4 A;  2H71 A;  5J9B A;  3DIE A;  5AIS A;  1NW2 A;  3BD2 A;  3HZ8 A;  4MJC A;  2K18 A;  3ZIV A;  2GZY A;  1G7E A;  2JZT A;  2OBI A;  1AAZ A;  1Z7R A;  2PPT A;  2O87 A;  2CAI A;  4KA0 A;  3P8W A;  4TRX A;  5KEJ A;  1V2A A;  5IMD A;  2M80 A;  1T7P B;  2TRC P;  2LJR A;  2V41 A;  3RPN A;  3VWX A;  5GSS A;  3MWH A;  5A4U A;  1ZCP A;  1RQM A;  2YAN A;  2MYG A;  1K0N A;  2YJH A;  4ZB9 A;  2FD3 A;  4MDC A;  1PX6 A;  2HFD A;  5CP1 A;  2CVK A;  2R37 A;  3QPM A;  4ZBD A;  2LTK A;  2HRN A;  1O8X A;  3MSZ A;  4F82 A;  1GSQ A;  2FLS A;  3KJY A;  1USB A;  3W8J A;  4ECC A;  1FOV A;  1ZOF A;  5FWG A;  3GTU A;  1J08 A;  3LOR A;  3TOU A;  4MH3 A;  2C8U A;  2DJ3 A;  3D6I A;  1XXU A;  4DSS A;  2L6C A;  2CVD A;  1GRX A;  1NHY A;  4KGI A;  2LNS A;  4DSQ A;  4XRA A;  5EL8 A;  4N11 A;  2JU5 A;  4QL7 A;  3GYK A;  3BJ5 A;  5CO3 A;  2I3Y A;  3UAR A;  1GTI A;  1IYH A;  13GS A;  1O73 A;  1PL1 A;  3P7X A;  4HI7 A;  2P31 A;  4ML6 A;  2XBI A;  5B8B A;  1EP8 A;  4FH8 A;  2IPA A;  5ECO B;  3QAG A;  4GF0 A;  1PQN A;  3L9S A;  4WEY A;  1TRW A;  1G6W A;  3EUR A;  3E0U A;  5IMV A;  4Q5R A;  5LCZ A;  1XZO A;  4Q5N A;  5D9T A;  5F8B A;  3KP8 A;  5KN0 A;  4K0G A;  3DGQ A;  4PGT A;  1V40 A;  4K7I A;  4WR5 A;  2HSY A;  1UVZ A;  1MD3 A;  1ERW A;  4KDY A;  1TJD A;  5ABR A;  4MH2 A;  2KOK A;  4MPG A;  2VD1 A;  2L6D A;  1WRY A;  4OFT A;  2GZZ A;  1SK0 A;  3MDK A;  3US3 A;  4O92 A;  2CV4 A;  2VLT A;  7GSS A;  2HZF A;  2FWG A;  3D22 A;  4ZBA A;  5G31 A;  1TDI A;  2YP6 A;  2CX3 A;  2ZUP A;  1K0A A;  4JR6 A;  4V2L A;  3DRN A;  1MTC A;  6GSY A;  1MDK A;  1VRS D;  1RW1 A;  1X5E A;  3EMP A;  4XHM A;  4EDY A;  3FZA A;  4OFN A;  1QGV A;  3FY7 A;  2V6O A;  1EOG A;  5GZZ B;  4RI6 A;  4WKW A;  1R5A A;  2CX4 A;  2HE3 A;  4IKH A;  1JZW A;  2J23 A;  5IMA A;  1O6J A;  4TR4 A;  1PD2 1;  2OJL A;  3GA4 A;  5F05 A;  1XOB A;  3TKQ A;  2HYX A;  2HXK A;  1ACV A;  3KH9 A;  3O6T A;  2X8H A;  3GN3 A;  2A2S A;  3KD0 A;  1GTB A;  1OKT A;  1CQH A;  1T3B A;  3EE2 A;  5HR2 A;  3HVX A;  3GST A;  1F2E A;  4ILF A;  1TU7 A;  5DJL A;  5DVB A;  5ELG A;  3HDC A;  5IPH A;  1A23 A;  4GSN A;  1TU8 A;  1XWA A;  4O5R A;  1O7U A;  4XTS A;  2M72 A;  1LJR A;  3TGZ A;  1K0D A;  1Y6E A;  4MLY A;  3G7I A;  1XVW A;  1T00 A;  5EVO A;  2DJK A;  3L78 A;  2K6V A;  1E6B A;  1IYI A;  1XCC A;  3HA9 A;  1UA5 A;  1YEX A;  5ECS A;  1H4O A;  2OAD A;  2N5B A;  2VL2 C;  2CAQ A;  4EO3 A;  1ABA A;  1NSW A;  1PA3 A;  1JZD A;  2YOI A;  2ON7 A;  4HJ2 A;  2R4V A;  2IMK A;  4PNG A;  1Y25 A;  3PGT A;  4I2T A;  3VFI A;  2DSA A;  4MZC A;  2MZC A;  1XWB A;  1YQ1 A;  2ON5 A;  5D96 A;  2C80 A;  4WR4 A;  1TW9 A;  2WS2 A;  2H1B A;  3QCP A;  4POL A;  3EVI A;  5JCU A;  5ECQ B;  3GX8 A;  2TIR A;  2OKA A;  2PWJ A;  3IAS 2;  3P2A A;  1MDI A;  2Z9S A;  1PKW A;  3LXT A;  4I97 A;  5ENU A;  1SKS B;  2IWT A;  1ERU A;  5LNK e;  1JZO A;  1AQW A;  4K1F A;  1GUM A;  1SD8 A;  2YZU A;  1TKD B;  5ELA A;  3NZN A;  4IGJ A;  3C73 A;  3G9B A;  2VL3 A;  5C00 A;  3IV4 A;  3TKS C;  3TRP A;  3QR6 A;  1WPI A;  1SK2 A;  2VAF A;  6GSU A;  4E8E A;  3CBU A;  1SYX A;  4K9Z A;  2H19 A;  1ZL9 A;  1SKR B;  11GS A;  4FO5 A;  2WB9 A;  1V9W A;  2V1M A;  4LL4 B;  3RPP A;  4K8M A;  1B48 A;  2H0G A;  3F8U A;  4RI7 A;  2H6X A;  5D9W A;  2GT6 A;  5HFI A;  1G6Y A;  3D4T A;  3KZQ A;  1N8J A;  3KTB A;  3VLN A;  3WGD A;  4GQF A;  1DUG A;  4IBP A;  4MMM A;  4IQA A;  4MAB A;  3GKM A;  4PUA A;  3GUR A;  4EE0 A;  1XW5 A;  2E7P A;  3GKX A;  4ECJ A;  2MBT A;  1WP0 A;  8GSS A;  1G0T A;  2PVQ A;  3SBC A;  5J9C A;  3LYK A;  3F3R A;  1QQ2 A;  3OR5 A;  2PBJ A;  2XPE A;  2B5E A;  3C7M A;  3CSH A;  3TJK A;  4Z7X A;  2M46 A;  3QFB C;  3D0Z A;  3EIN A;  3HHV A;  1YF0 A;  1R5P A;  4PQ1 A;  2CA8 A;  4EDZ A;  3HVV A;  3IOS A;  3QDN A;  4MZB A;  3VWU A;  4KSM A;  2IY2 A;  1HNB A;  4GRF A;  3SWL A;  4LLR A;  3MAK A;  3ZLP A;  3RDW A;  2NVL A;  5HFG A;  2KHP A;  5H5S A;  1PX7 A;  4IP6 A;  4TXO A;  1YDK A;  4WXT A;  1GSF A;  3BCK A;  4OO5 A;  3IE3 A;  4E8H A;  4MJA A;  2VOC A;  3CMI A;  1Z6M A;  4V2N A;  2YWN A;  4G19 A;  4HU9 A;  2D2Z A;  2YWO A;  4D73 A;  2O7K A;  3M9J A;  1K0O A;  1EZK A;  2OBK A;  4OCE A;  2E0Q A;  5KN2 A;  1M2B A;  1JHB A;  4JU5 A;  4KUN A;  3GH6 A;  4MA9 A;  5D73 A;  4HUA A;  3L4N A;  4RQR A;  3APS A;  4EL1 A;  1BYE A;  3NOF A;  2FA8 A;  2DC5 A;  2VCQ A;  3P90 A;  1OKD A;  2C3Q A;  4JBB A;  3UMA A;  1ST9 A;  5DAK A;  2MBS A;  1V57 A;  2PUK C;  3VI7 A;  1W4V A;  2REM A;  4AJ6 A;  4XS4 A;  4MJE A;  4YQU A;  2IYJ A;  1SKW B;  3KP9 A;  1FVJ A;  4PXO A;  1A2M A;  3IHQ A;  3CSI A;  3PIN A;  3ZZX A;  5D8I A;  3KXO A;  5CYY A;  4PQI A;  2H30 A;  1GLQ A;  1XWK A;  2DIY A;  4LMW A;  5G2Z A;  4MF6 A;  5AN1 A;  1EEM A;  1TI1 A;  2VUP A;  1TXX A;  1TTZ A;  4TOP A;  2B1K A;  1ERT A;  1GWC A;  3A2W A;  1DSB A;  3UBK A;  2FA4 A;  1U3I A;  5EPF A;  3UVH A;  1GUK A;  2X64 A;  1MEK A;  2BJX A;  4KDU A;  1GSU A;  3EMX A;  3LJR A;  2NDO A;  2V32 A;  1ON4 A;  3LSZ A;  1ZMA A;  3M1G A;  3NIV A;  4ECI A;  5AIV A;  3ISO A;  2IL3 A;  3H79 A;  1GL8 A;  3WT1 A;  4N0Z A;  2GSQ A;  2CVB A;  4OD7 A;  4PX1 A;  4G10 A;  3ZIJ A;  2BTO T;  3QAW A;  4ACS A;  4L0W A;  9GSS A;  5FT3 A;  3ZRD A;  1HQO A;  3HY2 A;  3LWA A;  2ZNM A;  4ZIJ A;  3IR4 A;  4KDX A;  1J9B A;  3UEM A;  1SJZ A;  2AJQ B;  2H72 A;  3Q74 A;  4POK A;  1EWX A;  4TR0 A;  3KCM A;  1UN2 A;  3DYR A;  2B3S A;  2PGT A;  3ERF A;  4KND A;  3TOT A;  2YNX A;  3VWV A;  4EC0 A;  1AQX A;  2F8A A;  1F9M A;  1OC9 A;  2C0F A;  4TR3 A;  5ECR B;  4Q5Q A;  2E2M A;  4K0N A;  2HZE B;  4ZB8 A;  1U87 A;  2HRF A;  3FR9 A;  1X5C A;  1T1V A;  1KNG A;  4WBR D;  1F3B A;  3TJB A;  2C3T A;  2EIQ A;  1FG4 A;  1SEN A;  2VCV A;  5IO2 A;  2R3X A;  2NTO A;  2VLU A;  5FHI A;  4YAP A;  3CTG A;  2DML A;  1A0F A;  2H76 A;  2OA7 A;  1ZGN A;  3A5W A;  4X0X A;  1FB6 A;  2LS5 A;  3G7J A;  2EC4 A;  2WZ9 A;  4X1U A;  3J7Y b;  1YY7 A;  1EV4 A;  4TKY A;  3IK9 A;  4JE1 A;  1J0F A;  2GSS A;  4GSS A;  1PSQ A;  1THX A;  2IFQ A;  5DAL A;  4V1A g;  4YQV A;  3EWL A;  1K3L A;  2FUG 2;  1Q98 A;  5A5K A;  2AAW A;  2DJJ A;  2VCZ A;  4EVM A;  2H66 A;  1YEP A;  2XC2 A;  2H0H A;  3L9U A;  5DJM A;  3F63 A;  3KMN A;  2RLI A;  2DJ0 A;  3ZVJ A;  2KLX A;  4J2F A;  4J57 E;  3TCO A;  1X9M B;  2LJK A;  1EEJ A;  3FKF A;  1A8L A;  5A4V A;  1GP1 A;  1GSD A;  3H1N A;  3HJM A;  3ZTL A;  4IJ3 A;  4NXI A;  1M9B A;  5DDL A;  4NHZ A;  20GS A;  3CRU A;  3QFA C;  3LG6 A;  1YF1 A;  3UIW A;  3EU4 A;  1A2J A;  2IJY A;  4LMV A;  5CRE A;  2CQ9 A;  4LA1 A;  5CRG A;  2YCD A;  3I69 A;  2H8L A;  5HR0 A;  2A4V A;  2PER A;  2GQL A;  3H4K A;  5G30 A;  4AJ7 A;  5F07 A;  3CSJ A;  4K2D A;  14GS A;  1YKC A;  3M3M A;  5B6N A;  4FYC A;  4DSR A;  3Q18 A;  1EGO A;  2LNT A;  3F0I A;  1V98 A;  1KBN A;  18GS A;  1N2A A;  4POB A;  2B1L A;  4IN0 A;  4G2E A;  5D9X A;  4ZL9 A;  5L71 A;  2JSZ A;  1XWC A;  3CRT A;  1AUC A;  5J41 A;  1OAZ A;  3KH7 A;  5GAN D;  4NV5 A;  3WT2 A;  1QXH A;  3IAM 2;  4RUV A;  3KGK A;  4KE3 A;  1HNA A;  4KCA A;  5ECI B;  5COH A;  2WJU A;  2O89 A;  4ZBB A;  3I9V 2;  1YZX A;  4GST A;  3LEF A;  4N0V A;  4N30 A;  2X8C A;  3UJ1 A;  4GCI A;  2V6K A;  4WET A;  1FW1 A;  3VI5 A;  6GSS A;  4OFM A;  4YAV A;  3IBH A;  3KEB A;  4QL9 A;  1X5D A;  4JR4 A;  4DEJ A;  1AIU A;  4BPY A;  1YKA A;  3RHC A;  3FRC A;  3TJF A;  3HXS A;  4K7O A;  4WBJ A;  2PVO C;  2AYT A;  2GST A;  2HZE A;  3C8E A;  3AY8 A;  1TOF A;  3WD6 A;  2GT5 A;  4RQX A;  3GSS A;  1VF2 A;  2FWF A;  3DWV A;  1CQG A;  1FHE A;  2GS3 A;  3I6A A;  1GUL A;  4IVF A;  3ZYW A;  3GL5 A;  3Q6O A;  3F4R A;  1AQV A;  1JLW A;  4IQ1 A;  2DMM A;  1SJI A;  1URM A;  3F3Q A;  4WF4 A;  4HJM A;  3W6G A;  2XPD A;  4NAX A;  3IA1 A;  3W8S A;  1LU4 A;  5ID2 B;  3GMF A;  2GVP A;  2KUC A;  2C1Y A;  4TVE A;  4HDE A;  2NPB A;  1O85 A;  4IW9 A;  4GQC A;  2OE1 A;  3A3T A;  5HR3 A;  3LXZ A;  3DD3 A;  1ZYE A;  4IP1 A;  1EP7 A;  4HZ2 A;  4PNF A;  1WIK A;  1M9A A;  2VLV A;  4MF7 A;  2O85 A;  1EOH A;  2IMD A;  1DE2 A;  2RM6 A;  1GSS A;  1AXD A;  1ERV A;  4I8B A;  4CW9 A;  3H8Q A;  2H6Y A;  1F6M C;  5IOX A;  2O8V B;  2F3M A;  2LV3 A;  3CYN A;  3C71 A;  4F9Z A;  5F0G A;  1F37 A;  2XHF A;  1MD4 A;  3KTL A;  2YN1 A;  4F0C A;  1LBK A;  3G7Y A;  2KP2 A;  3EC3 A;  2YWM A;  4OCF A;  4IEL A;  2LQQ A;  3U5R E;  2OE0 A;  1K3O A;  4O7H A;  4OO4 A;  3ZVJ D;  4HEA 2;  1X0R A;  2I4A A;  3ZML A;  1SL1 B;  2FWH A;  4ECB A;  2HLS A;  2G2Q A;  2H74 A;  3F6D A;  1GSY A;  5LD0 A;  1WJK A;  3PH9 A;  2JAC A;  3C1R A;  4LL1 B;  4XIH A;  5CAX A;  1WMJ A;  2QSI A;  3F6F A;  1EGR A;  1GLP A;  3BOA A;  2DJ1 A;  1FO5 A;  4FYB A;  3GTU B;  5ECL B;  2CZ3 A;  4NPB A;  1Z7P A;  4BWS A;  2I1U A;  1U88 A;  3UOM A;  1OE7 A;  4YQM A;  1B9X C;  1HYU A;  4HS1 A;  5ECK B;  1V58 A;  1R4W A;  5JWR B;  4HU7 A;  2LQO A;  1I5G A;  4MJB A;  1TK0 B;  2VO4 A;  4BL7 A;  2E2G A;  1XFL A;  3RAZ A;  3LYP A;  3IPZ A;  5A4W A;  1T8E B;  3DKS A;  3D4M A;  4V1A p;  5GAP D;  4XS6 A;  3GL3 A;  1VGL A;  2L59 A;  3L0H A;  3TRQ A;  2C0D A;  2YV7 A;  1B4P A;  1B4Q A;  4L5L A;  5IOW A;  3IC4 A;  2EIO A;  2FY6 A;  4KAE A;  4EXJ A;  1G7O A;  2B5Y A;  2G0F A;  3C1S A;  5JWQ B;  2HI7 A;  1TRV A;  2H73 A;  2NBS A;  5CNW A;  2V2G A;  4BVY A;  1PL2 A;  1TRS A;  2J9H A;  3RHB A;  2K8V A;  5G1K A;  1K0B A;  3GIX A;  1QK8 A;  2WCI A;  2YJ7 A;  1GTA A;  2QKE A;  1PRX A;  1PN9 A;  1JLV A;  5J5N A;  3M8N A;  1FVK A;  1BJX A;  1Q4J A;  1XIY A;  2GTU A;  2VM1 A;  3BCI A;  1M2D A;  2GLR A;  2IMF A;  1SJ6 A;  4HQZ A;  3VWW A;  2H0I A;  4KB3 A;  3IXR A;  3ZFL A;  5ECH B;  1KEB A;  3GUS A;  1GTU A;  1WWJ A;  2BMX A;  2LRC A;  3GV1 A;  4AF2 A;  1VF4 A;  5IM9 A;  3QD9 A;  3KM6 A;  2ES7 A;  3DXB A;  2GGT A;  5ECM B;  3TUE A;  3UL3 A;  4FIW A;  1K0M A;  2H01 A;  4L5O A;  2FGX A;  4MPF A;  3ED3 A;  4GWR A;  2B6M A;  5D9V A;  2RM5 A;  1SD9 A;  1BED A;  2H1G A;  3K8N A;  4BVX A;  1SL0 B;  3UBL A;  4ID0 A;  1NHO A;  3VK9 A;  4F2I A;  1MDJ A;  5B6M A;  3I43 A;  2L5O A;  3TKR A;  2XBQ A;  3VPT A;  5D93 A;  1O8W A;  2GDR A;  1T4Z A;  2VL2 A;  1XW6 A;  2HT9 A;  4POM A;  4JZQ A;  1B8X A;  2R2J A;  4NWY A;  5H5Q A;  1QFN A;  4MF5 A;  3TB2 A;  2GQM A;  1BAY A;  5ECN B;  4HQS A;  5G1L A;  2H6Z A;  2YPM A;  4XS1 A;  1Z9H A;  3M9K A;  2R6K A;  1Z6N A;  3FHK A;  2OE3 A;  4MCU A;  5IMZ A;  1U3A A;  5JWO B;  2QGV A;  3CXG A;  4G9H A;  4ZL7 A;  1NM3 A;  2VCX A;  5E59 A;  2CZ2 A;  3F4T A;  1C72 A;  4JRR A;  1AC1 A;  1VF1 A;  4MK3 A;  1XPV A;  4NMU A;  2MMO A;  4GTU A;  5J4U A;  2MMA A;  12GS A;  4KCE A;  1WOU A;  2GZP A;  4ML1 A;  1ML6 A;  4PUR A;  2JAD A;  1BX9 A;  2GSR A;  2WFC A;  4ZIL A;  3HJO A;  3QAV A;  3EYT A;  2DIZ A;  3V1W A;  3QOU A;  3FR6 A;  2H1A A;  2VL9 A;  4MZW A;  4HZ4 A;  2L57 A;  5JCW A;  3FW2 A;  3IDV A;  2PN8 A;  4ZL8 A;  1I9D A;  2RII A;  1B9Y C;  2B7J A;  2YZH A;  3TKS A;  2VM2 A;  2C3N A;  3RBT A;  1TK5 B;  2IIY A;  2F51 A;  1F3A A;  1W89 A;  2P0G A;  3ZMK A;  2RUE A; 
#chains in the Genus database with same CATH topology
 2RUF A;  5G5F A;  2KCD A;  2QC7 A;  1Z1S A;  1RTU A;  2K8S A;  3APO A;  3ERG A;  4GXZ A;  3WGE A;  5KN1 A;  4X43 A;  2TRX A;  4MEI A;  1T4Y A;  1S3C A;  3FZ4 A;  4KF9 A;  1A8Y A;  2B24 B;  3NBR A;  2HSM A;  5DQY A;  1QMV A;  1VF3 A;  3TRX A;  3DEX A;  3U6V A;  2PNC A;  1M7T A;  1OH0 A;  2MF7 A;  4ZB6 A;  1UCI A;  3D21 A;  3S29 A;  5AEW B;  4Q5F A;  2N5F A;  2OOV C;  4R9K A;  3VSY A;  5G2G A;  3MNG A;  1MNL A;  4IPB A;  4BTW A;  4AGS A;  3Q19 A;  1XWG A;  2DBC A;  4NV2 A;  3NX0 A;  3HJP A;  2JZS A;  3IK7 A;  3UB1 A;  2A4H A;  1GNW A;  1M99 A;  3PR8 A;  5JCG A;  3GNJ A;  1KTE A;  1JBS A;  1WE0 A;  1LQG C;  3CPO A;  1U6T A;  2CIU A;  2BO9 B;  1SU9 A;  3Q1C A;  4ISD A;  4AEQ A;  5LC7 A;  1GY7 A;  1LXE A;  2VCW A;  3F7S A;  1BSD A;  1PMT A;  5HR1 A;  4K7N A;  4BA7 A;  3IRA A;  1PU4 A;  2QEX 3;  3EU3 A;  2X8G A;  2YWI A;  2QA4 3;  4KH7 A;  1RLS A;  2RGQ A;  3VUR A;  2WOH A;  1F8N A;  2F8F A;  5GSP A;  4IS0 A;  1VQ6 3;  5IO0 A;  2X99 A;  3FZ9 A;  3N9J A;  1W4N A;  3KN4 A;  2B7K A;  1RGL A;  2CX0 A;  2LST A;  4HVN A;  1BQ7 A;  1Z5Y E;  1DMQ A;  1BAN A;  3DML A;  1X9S B;  5M1A A;  2D1W A;  4XRD A;  4TN8 A;  4KFD A;  1BRN L;  1I8V A;  3FLJ A;  2F4Y A;  3ERW A;  2AHE A;  1N9E A;  1XW9 A;  1X1X A;  1HD2 A;  4J5G A;  4TXO B;  3KCH A;  1O81 A;  3GFK A;  3E9J B;  1J2B A;  2ZA4 A;  4PQH A;  1MGR A;  6GSV A;  4N6M A;  1DE3 A;  2L4C A;  2STD A;  2CT6 A;  3ME8 A;  3BB9 A;  1S3D A;  5DQS A;  4D73 B;  4CDL A;  4EKZ A;  3FG3 A;  2XH9 A;  3F4S A;  2B5X A;  3T8N A;  5IMC A;  3E3E A;  3MWZ A;  1JFU A;  1ASK A;  1TRU A;  1FB0 A;  5G5E A;  3MG1 A;  1VQL 3;  4JED A;  4CDO A;  2I9H A;  1FAA A;  3HYP A;  4F0B A;  2OTL 3;  16GS A;  4EC6 A;  3L0R A;  4O02 B;  3BLZ A;  3TDG A;  2FWE A;  2ZL8 A;  3NM7 A;  1V74 A;  2IME A;  3F7X A;  2HSH A;  2H1D A;  2C0G A;  3LT8 A;  1H75 A;  3V99 A;  3FZ5 A;  3CNX A;  1RGE A;  3LTB A;  4EUY A;  2AUV A;  2KXG A;  1EV9 A;  4AJ8 A;  3ZFB A;  3JCM L;  8CHO A;  4PUF C;  2HNL A;  1SYR A;  5DAK B;  4L8E A;  4KW6 A;  2AV4 A;  3UVT A;  1OF5 B;  4XS4 B;  2P5R A;  5INY A;  4GLT A;  5F06 A;  1GNE A;  4I5Q A;  3GX0 A;  4QWT A;  5C04 A;  4TR1 B;  3S9F A;  3AGO A;  3UL6 A;  3EC9 A;  2JZR A;  4EBG A;  5HFK A;  2VD0 A;  3ER7 A;  4L0U A;  1BAO A;  2ZDJ A;  1PGT A;  2GSP A;  3GHA A;  5ECP B;  4DVC A;  2HMM B;  2FCH A;  1M2A A;  2C0E A;  3CTF A;  5AIX A;  3FR3 A;  1NWW A;  3T8U A;  4OMV A;  3NV0 A;  4P3Y B;  3HD5 A;  1W6C A;  2HOH A;  4F03 A;  1QUW A;  4CHS A;  5B8A A;  2VIM A;  3LQ7 A;  2WDU A;  3D79 A;  2CWU A;  3HCZ A;  2IMI A;  3O76 A;  4TXV A;  1O7W B;  4X2H A;  1RK4 A;  19GS A;  3L9V A;  2L5L A;  3TJG A;  1K3Y A;  4KSO A;  3N5O A;  3NBJ A;  1AW9 A;  2PMT A;  5EEO A;  3CQF A;  2DLX A;  3A2X A;  2PZV A;  2P5Q A;  3VPQ A;  5ELU A;  2JSY A;  1XOA A;  4FYU A;  5CRH A;  2R5G A;  1RCL A;  2YV9 A;  1TK8 B;  2GEY A;  2ALB A;  3CD6 3;  3DVX A;  3FK8 A;  3QMX A;  1Z3E A;  4NHW A;  3PCS A;  2CFK A;  3TKS E;  4Z2T A;  3D9R A;  2MMN A;  3ZL5 A;  3SOY A;  3ZIT A;  2HMN B;  1N5H A;  2LJA A;  2ZCT A;  22GS A;  5CLK A;  1HYF A;  3EF8 A;  2H75 A;  3J7Y k;  3B7C A;  1X9W B;  4FR9 A;  2C4J A;  2L4Q A;  3FYG A;  4XCS A;  3D3L A;  1BVI A;  1ILO A;  4WHA A;  1KQS 2;  2EIR A;  2MMZ A;  3X42 A;  1LOV A;  1UC7 A;  1FA3 A;  3D5J A;  6GST A;  1SJW A;  1Q86 4;  3HVS A;  2LEG A;  6GSX A;  4XDW A;  1OVN A;  1I2E A;  5HQP A;  3O3T A;  1A2L A;  1A24 A;  4J5K A;  17GS A;  1OC9 B;  1XBS A;  5H5R A;  2RBI A;  5JPU A;  1ZYQ B;  4K6X A;  4IT7 A;  3M0F A;  3ZYW A;  5IIZ A;  5BRT A;  3LFL A;  4ZXG A;  4BWQ A;  1YJ6 A;  1IV9 A;  4I2U A;  3WGX A;  1A0R P;  1HKX A;  5CRD A;  1X1W A;  2AB6 A;  1TP9 A;  2A2R A;  2WRT A;  5IER A;  1MWS A;  1S3A A;  1OYJ A;  3MG2 A;  4I6X A;  3GH9 A;  4DSS B;  2V1L A;  2GQK A;  1E2Y A;  3F9U A;  4K61 A;  5DCH A;  1FGT A;  4EF0 A;  1OC3 A;  5KN3 A;  5A0O B;  4FCZ A;  3HZ4 A;  4O32 A;  5E4W A;  5CRW A;  3QK9 A;  3H51 A;  1ZZY A;  1HZ1 A;  4N6V 0;  1THO A;  3RGR A;  4RNT A;  1JN5 B;  1ULJ B;  1I3I A;  3MYT A;  1SIH A;  3HKR A;  4BIR A;  1IT8 A;  1PKZ A;  5J3R A;  4LYL B;  5BU4 A;  3JUM A;  3UAP A;  4OWY A;  3DUK A;  3KMO A;  2DJ2 A;  2N5A A;  3BBY A;  4V2M A;  2R0C A;  3I56 3;  2FNO A;  1BIR A;  4BIK A;  3CC4 3;  6GSW A;  5AIH A;  5AIG A;  2IFQ B;  2OAC A;  1RN7 A;  3CCU 3;  5HGR A;  4N10 A;  3FEU A;  5DAL B;  3Q3F A;  2LUS A;  3WYW A;  1IVV A;  4IHU A;  1DE1 A;  5B7C A;  2LKU A;  4ICY A;  5IMF A;  2PU9 C;  4ULX A;  1DET A;  5GST A;  1TI3 A;  3GZY B;  1GUH A;  2K9F A;  3TKP A;  1MWU A;  3CCQ 3;  1HNC A;  4IJI A;  2OWP A;  1GH2 A;  2CC3 A;  1UGI A;  2LRN A;  1ZGX A;  1SK1 A;  4J56 E;  1R26 A;  2FNQ A;  4YH2 A;  1N8Q A;  1VQQ A;  1XG8 A;  2FHE A;  1YJ9 3;  4WYK B;  5IQY A;  1GMP A;  2LRT A;  2QIY A;  3TJJ A;  1VQ4 3;  3GKN A;  2VCT A;  5DBQ A;  3A2V A;  3R2Q A;  4H86 A;  3LGC A;  4HOJ A;  1OAC A;  3APQ A;  2F9S A;  3KIJ A;  3BIR A;  3ME7 A;  4NHF A;  2KP1 A;  3IHG A;  3H93 A;  2BMO B;  2H70 A;  1BNG A;  5AGY A;  5DCG A;  1M0U A;  1IK3 A;  3ALA A;  1NO3 A;  1OE8 A;  4MP4 A;  1X1U A;  3GKK A;  3GRX A;  2E2U A;  2KF6 A;  1NU3 A;  5EY6 A;  1XVQ A;  10GS A;  2QA1 A;  4K1V A;  4A5P A;  1JZR A;  5ID2 A;  1GSE A;  5BVB A;  2JL4 A;  1SL2 B;  2I81 A;  4TR1 A;  1IQX A;  3IPT A;  1BG5 A;  4QQ7 A;  1K0C A;  2WGR A;  1DBY A;  4FMA A;  2WUL A;  1IQ8 A;  1T2H A;  3ZRE A;  3URP A;  3DVW A;  1TRP A;  4WF5 A;  2OQE A;  4BL2 A;  5IEP A;  1RN4 A;  2BNG A;  1OC8 A;  1R7H A;  2IN3 A;  4LZI A;  5DRE A;  4RNY A;  3U97 A;  1TTO A;  5IPG A;  4TW5 A;  4KX4 A;  1FYS A;  2P0M A;  5IG5 A;  3HI7 A;  2H71 A;  1GMR A;  5J9B A;  3DIE A;  5JBS A;  5AIS A;  3UJM A;  3JVC A;  3LXU X;  1NW2 A;  3BD2 A;  3HZ8 A;  4MJC A;  4N6L A;  3RDE A;  2K18 A;  3S67 A;  2QA2 A;  3ZIV A;  5FW5 A;  2GZY A;  2UUG C;  1G7E A;  1OGZ A;  2JZT A;  4USS A;  2OBI A;  1AAZ A;  4JRF A;  1SQW A;  2XRX B;  1Z7R A;  2PPT A;  2O87 A;  2CAI A;  4KA0 A;  1O7M B;  3P8W A;  1IDP A;  2R41 A;  6RNT A;  1S3R A;  2Z76 A;  4TRX A;  5KEJ A;  3VGN A;  1V2A A;  3I0Y A;  2AAE A;  2W2C A;  3IJE B;  5IMD A;  2M80 A;  3PS8 A;  2M7O A;  1U8C B;  1T7P B;  2TRC P;  2LJR A;  1RKY A;  4BTX A;  1TIJ A;  1BNJ A;  2V41 A;  3RPN A;  3VWX A;  5GSS A;  3MWH A;  5A4U A;  1CEW I;  4HM0 B;  4U13 A;  1IQY A;  1ZCP A;  1RQM A;  2YAN A;  2MYG A;  5BIR A;  1K0N A;  3S5C A;  2YJH A;  4ZB9 A;  2FD3 A;  4MDC A;  1PX6 A;  2HFD A;  5CP1 A;  2CVK A;  2R37 A;  3QPM A;  1B2Z A;  4ZBD A;  1UW1 A;  3DGO A;  3A5I A;  2LTK A;  2HRN A;  1O8X A;  3MSZ A;  3N8B A;  4OK0 A;  3EPT A;  4F82 A;  1GSQ A;  3BNB A;  1K8A 4;  1LOX A;  2FLS A;  3KJY A;  1USB A;  3W8J A;  1W2Z A;  2CH9 A;  4ECC A;  1FOV A;  4HM3 B;  1ZOF A;  4HYZ A;  3JUQ A;  5FWG A;  2BMR B;  3GTU A;  1J08 A;  4KFF A;  3LOR A;  3TOU A;  1I0V A;  1GOY A;  2B1X B;  4MH3 A;  5IG3 A;  2C8U A;  3CMA 3;  4MNN A;  2DJ3 A;  3D6I A;  1ZX2 A;  1K9M 4;  2Z6B A;  1AVL A;  1XXU A;  7RNT A;  3EBT A;  1YIJ 3;  4K90 B;  1KWI A;  4DSS A;  4FMD A;  2L6C A;  4HAA A;  2CVD A;  1GRX A;  2HMO B;  4KZ1 A;  1VQ9 3;  5ELJ A;  1DMN A;  7GSP A;  1JBT A;  1NHY A;  4KGI A;  1OHO A;  4KVH A;  2LNS A;  4DSQ A;  4XRA A;  1HU9 A;  4N11 A;  5EL8 A;  1JN5 A;  2JU5 A;  4QL7 A;  3GYK A;  3BJ5 A;  5CO3 A;  2I3Y A;  3UAR A;  1GTI A;  1RMS A;  1IYH A;  6STD A;  13GS A;  1O73 A;  1PL1 A;  3P7X A;  4HI7 A;  2P31 A;  4ML6 A;  2XBI A;  5B8B A;  1A2P A;  1EP8 A;  4FH8 A;  2IPA A;  5ECO B;  2Q07 A;  3QAG A;  4GF0 A;  1PQN A;  3L9S A;  4WEY A;  3GRD A;  3DH2 A;  4H3U A;  1TRW A;  1G6W A;  3EUR A;  3G71 3;  3E0U A;  2HML B;  1UI7 A;  5IMV A;  4Q5R A;  5LCZ A;  1XZO A;  4Q5N A;  5D9T A;  5F8B A;  3KP8 A;  4BU4 A;  1Q42 A;  4MMY B;  4K0G A;  5KN0 A;  4EV5 A;  3DGQ A;  4PGT A;  1V40 A;  4K7I A;  4WR5 A;  5AYR B;  3SXX A;  2HSY A;  1RGF A;  1UVZ A;  1MD3 A;  1ERW A;  3PCR A;  1NB5 I;  4KDY A;  3EJV A;  1TJD A;  2BHM A;  5ABR A;  4MH2 A;  2KOK A;  4R9L A;  4MPG A;  2VD1 A;  2L6D A;  3Q90 A;  1RHL A;  3EX9 A;  1WRY A;  3NQZ A;  5IF6 A;  4OFT A;  2GZZ A;  1SK0 A;  3LW9 A;  5M18 A;  2L4V A;  3MDK A;  3US3 A;  4O92 A;  2CV4 A;  2VLT A;  2W6J H;  3G4S 3;  1D6U A;  7GSS A;  2HZF A;  3BU4 A;  1MWT A;  3GZB A;  2FWG A;  3D22 A;  4ZBA A;  5G31 A;  1TDI A;  2YP6 A;  2CX3 A;  1B3S A;  2ZUP A;  4HM8 B;  3D5I A;  1K0A A;  4JR6 A;  4V2L A;  1UCL A;  3DRN A;  1MTC A;  2W56 B;  6GSY A;  3KKG A;  1MDK A;  1VRS D;  1RW1 A;  1X5E A;  3EMP A;  4XHM A;  2WOF A;  4EDY A;  3FZA A;  4OFN A;  1QGV A;  5I97 A;  3FY7 A;  2V6O A;  1EOG A;  2BMQ B;  2XGN A;  5GZZ B;  1B2S A;  4RI6 A;  4WKW A;  1R5A A;  1YVS A;  2CX4 A;  2HE3 A;  4IKH A;  2CWV A;  2IUK A;  1JZW A;  2J23 A;  5IMA A;  1O6J A;  1BRH A;  4TR4 A;  1PD2 1;  2OJL A;  3GA4 A;  5F05 A;  1XOB A;  3TKQ A;  1M9G A;  2HXK A;  1ACV A;  1W01 A;  3X41 A;  2HYX A;  2X8H A;  3KH9 A;  3O6T A;  3GN3 A;  3AMO A;  2F5M A;  4N6N B;  2A2S A;  3KD0 A;  1GTB A;  1OKT A;  1MWR A;  3SYU A;  1CQH A;  1T3B A;  3EE2 A;  5HR2 A;  9RNT A;  3HVX A;  3WA2 X;  3GST A;  1TP6 A;  1RSN A;  1YGE A;  1ZO2 A;  1F2E A;  4ILF A;  1TU7 A;  5DJL A;  5DVB A;  1MGW A;  4O5Q A;  5ELG A;  1NB3 I;  1M3J A;  3HDC A;  5IPH A;  1A23 A;  5AIF A;  4GSN A;  2X4A A;  1TU8 A;  1XWA A;  4O5R A;  1O7U A;  4PEJ A;  4XTS A;  2M72 A;  3JUP A;  1LJR A;  3TGZ A;  1K0D A;  1Y6E A;  1FW7 A;  4BL7 B;  1N8R 4;  4MLY A;  3G7I A;  5IEO A;  3OXA A;  1XVW A;  3CU3 A;  3F8X A;  1T00 A;  5EVO A;  2DJK A;  2XEP A;  2QGU A;  1GSP A;  3FG1 A;  3L78 A;  2HMK B;  2K6V A;  2W9Q A;  5CK6 A;  1E6B A;  1IYI A;  1XCC A;  2R0P A;  3HA9 A;  1OHS A;  1UA5 A;  1YEX A;  5ECS A;  1H4O A;  2OAD A;  2N5B A;  1UUV B;  2VL2 C;  3EE1 A;  2CAQ A;  1EKM A;  1ABA A;  4EO3 A;  1NSW A;  1PA3 A;  3CXC 2;  1PFP A;  1JZD A;  2YOI A;  2ON7 A;  3NM2 A;  1A90 A;  4HJ2 A;  1G02 A;  2R4V A;  2IMK A;  4G1M B;  3FSD A;  4PNG A;  1Y25 A;  3PGT A;  1JKG A;  1LOY A;  4I2T A;  3CME 3;  3VFI A;  5EQL A;  2DSA A;  4MZC A;  2KF3 A;  1VZZ A;  2MZC A;  1XWB A;  1O7H B;  1GYB A;  1YQ1 A;  1UCJ A;  2ON5 A;  5D96 A;  3RGA A;  2C80 A;  3B8L A;  3MIX A;  3STD A;  4WR4 A;  2UZ8 A;  1TW9 A;  2WS2 A;  2H1B A;  3QCP A;  4POL A;  4NRE A;  3EVI A;  1IV7 A;  5JCU A;  1Q81 4;  5ECQ B;  3DGN A;  3GX8 A;  3LYG A;  2TIR A;  1LQM B;  2OKA A;  2PWJ A;  3IAS 2;  1KSI A;  3P2A A;  1MDI A;  2Z9S A;  1PKW A;  3LT9 A;  3LXT A;  4I97 A;  5ENU A;  1BRG A;  1SKS B;  2IWT A;  1ERU A;  3N54 B;  5LNK e;  1JZO A;  3AGN A;  1IVU A;  2W9P A;  3OWY A;  1AQW A;  4K1F A;  1GUM A;  4O5U A;  2SAR A;  1SD8 A;  2YZU A;  1TKD B;  3DGM A;  5ELA A;  5IEN A;  4TX4 A;  1BRS A;  3NZN A;  4IGJ A;  3C73 A;  3G9B A;  2VL3 A;  5C00 A;  2KF4 A;  3IV4 A;  4JF8 A;  3TKS C;  1W7C A;  3GZX B;  1SPU A;  3TRP A;  3QR6 A;  4ORL A;  1WPI A;  2WGO A;  1SK2 A;  2VAF A;  3SVA A;  6GSU A;  4E8E A;  2ZHX B;  3CBU A;  1SYX A;  4K9Z A;  2H19 A;  1ZL9 A;  2P38 A;  1SKR B;  11GS A;  4FO5 A;  3FH1 A;  4HZ9 B;  3WA3 A;  1V9W A;  2WB9 A;  2X49 A;  2V1M A;  1TFK A;  4LL4 B;  1QJG A;  3RPP A;  4K8M A;  1B48 A;  2H0G A;  3F8U A;  4RI7 A;  2H6X A;  5D9W A;  5AI1 A;  2GT6 A;  5HFI A;  1G6Y A;  3D4T A;  3KZQ A;  1N8J A;  4EW5 A;  1BRI A;  1CQS A;  3KTB A;  1B2M A;  3VLN A;  1JRQ A;  3WGD A;  4GQF A;  3V98 A;  3HVN A;  1DUG A;  4IIA A;  4IBP A;  4MMM A;  3F8H A;  4IQA A;  1OUN A;  4MAB A;  1FZU A;  3CCS 3;  3GKM A;  4PUA A;  3GUR A;  4HBR A;  4EE0 A;  1W6Y A;  3MYD A;  1XW5 A;  1M1X B;  2GBX B;  4G0L A;  3SED A;  2E7P A;  2R0G A;  3GKX A;  4ECJ A;  2MBT A;  1WP0 A;  1UUG B;  4EIQ A;  8GSS A;  1YNV X;  1G0T A;  2PVQ A;  3SBC A;  2Y73 A;  5J9C A;  3LYK A;  5BMU A;  3F3R A;  3KFQ C;  1QQ2 A;  3WDG B;  3OR5 A;  2PBJ A;  2XPE A;  2B5E A;  3C7M A;  3CSH A;  3TJK A;  4Z7X A;  2M46 A;  3QFB C;  1R4Y A;  3D0Z A;  3CC2 3;  3EIN A;  1JB4 A;  3S27 A;  3HHV A;  1YF0 A;  1R5P A;  4PQ1 A;  2CA8 A;  1EUI C;  7STD A;  4EDZ A;  3HVV A;  3IOS A;  3QDN A;  4MZB A;  1I0X A;  3VWU A;  4KSM A;  2IY2 A;  3KSP A;  1HNB A;  4GRF A;  3SWL A;  4LLR A;  3MAK A;  4R4K A;  3ZLP A;  3RDW A;  2NVL A;  5HFG A;  2KHP A;  4FQU A;  5H5S A;  1PX7 A;  4IP6 A;  4TXO A;  1YDK A;  4WXT A;  1GSF A;  2CW9 A;  3BCK A;  4OO5 A;  3IE3 A;  4E8H A;  4MJA A;  2VOC A;  3FZW A;  3CMI A;  4YKG A;  1Z6M A;  4V2N A;  2MC8 A;  1VQ5 3;  1IU7 A;  4J9A A;  2YWN A;  4G19 A;  4HU9 A;  2D2Z A;  1Q40 B;  5CXO A;  2YWO A;  2RFR A;  1RDS A;  4D73 A;  1QVF 2;  1E3R A;  2CG0 A;  2CX1 A;  2O7K A;  2CWT A;  1BRK A;  5AII A;  3M9J A;  1K0O A;  3FGY A;  1EZK A;  2OBK A;  2LQV A;  4OCE A;  1NNV A;  3F40 A;  2W04 A;  2E0Q A;  5KN2 A;  1M2B A;  2YFL B;  4G0I A;  3NQY A;  1JHB A;  3AHS A;  4JU5 A;  4KUN A;  1DVD A;  3GH6 A;  4MA9 A;  5D73 A;  4HUA A;  3L4N A;  1KD1 4;  5LC6 A;  1VQO 3;  4RQR A;  2CFG A;  1PFO A;  3APS A;  1B2X A;  4GHO A;  1JJ2 2;  4EL1 A;  1BYE A;  1G96 A;  3NOF A;  2FA8 A;  2DC5 A;  2VCQ A;  3P90 A;  2OOV A;  3BNE A;  1OKD A;  2C3Q A;  4JBB A;  3UMA A;  1ST9 A;  3CC7 3;  5DAK A;  1STF I;  2MBS A;  2K54 A;  1V57 A;  2PUK C;  3VI7 A;  4FMC A;  1QAF A;  1W4V A;  4FCJ A;  2REM A;  1OF5 A;  4AJ6 A;  5KP4 A;  4XS4 A;  4MJE A;  4YQU A;  2IYJ A;  3DXO A;  3KP9 A;  1SKW B;  1FVJ A;  2OCT A;  4PXO A;  1A2M A;  3IHQ A;  3CSI A;  3PIN A;  3ZZX A;  1B2U A;  1KC8 4;  1JBR A;  3KXO A;  5D8I A;  3OW2 2;  1W00 A;  1O7N B;  5CYY A;  4PQI A;  2H30 A;  1GLQ A;  3PZW A;  1LRA A;  3ZG5 A;  1XWK A;  2DIY A;  4LMW A;  5G2Z A;  4MF6 A;  5AN1 A;  1D6Y A;  1EEM A;  1TI1 A;  4CPK A;  2VUP A;  2GU3 A;  1TXX A;  5JPP A;  2K0M A;  3PPU A;  1BGS A;  1GY5 A;  1TTZ A;  4TOP A;  2B1K A;  1YI2 3;  2YFJ B;  1ERT A;  1GWC A;  3A2W A;  1E3V A;  1NJI 4;  1DSB A;  4X2O A;  3UBK A;  2FA4 A;  1U3I A;  5EPF A;  1AR0 A;  2WGQ A;  3UVH A;  2HMJ B;  3JUO A;  1GUK A;  2X64 A;  1MEK A;  1BRJ A;  1OPY A;  2BJX A;  4KDU A;  3FKA A;  1GSU A;  3EMX A;  3WOE B;  3LJR A;  2NDO A;  2V32 A;  1ON4 A;  3LSZ A;  2IMJ A;  3HK4 A;  3K5T A;  1ZMA A;  3M1G A;  3NIV A;  4ECI A;  5AIV A;  2BT3 A;  3ISO A;  2IL3 A;  1LOW A;  3H79 A;  4J8T A;  1GL8 A;  3WT1 A;  4N0Z A;  3EBY A;  2SBL A;  4ZM8 A;  2GSQ A;  2CVB A;  4K1U A;  4OD7 A;  4PX1 A;  4G10 A;  1W02 A;  1FOH A;  3ZIJ A;  3AHW A;  1BNE A;  1OCV A;  2BTO T;  3DGL A;  3QAW A;  4N3V A;  4ACS A;  1IVW A;  3CCM 3;  1QVG 2;  5KP3 A;  4L0W A;  3D5G A;  4YKF A;  9GSS A;  2Y74 A;  3IC8 A;  5FT3 A;  3ZRD A;  2XFT A;  1HQO A;  3HY2 A;  3LWA A;  2ZNM A;  4ZIJ A;  3IR4 A;  1YIT 3;  1FUS A;  1J9B A;  4KDX A;  3UEM A;  1SJZ A;  3K63 A;  4CJN A;  2AJQ B;  2H72 A;  3Q74 A;  1EA2 A;  4POK A;  1EWX A;  3WHO A;  3KCM A;  1UN2 A;  4TR0 A;  3DYR A;  3WR2 A;  2B3S A;  2PGT A;  3ERF A;  1BSE A;  2KAA A;  4KND A;  3TOT A;  3OWS A;  2YNX A;  3VWV A;  2CFL A;  1JB5 A;  4EC0 A;  1AQX A;  3J7Y d;  2F8A A;  1FUT A;  4O2H A;  1F9M A;  1OC9 A;  1FGM A;  3GZR A;  2C0F A;  1RGA A;  4MMX B;  4TR3 A;  5ECR B;  4Q5Q A;  2E2M A;  4AKZ A;  4K0N A;  2HZE B;  4ZB8 A;  1U87 A;  2HRF A;  2F56 A;  3FR9 A;  5KOX A;  3B4P A;  4XDV A;  1X5C A;  1T1V A;  3N9H A;  3EN1 B;  2KF5 A;  1KNG A;  1WMN A;  5HOH A;  4WBR D;  1F3B A;  5M19 A;  3TJB A;  2C3T A;  2EIQ A;  3LTD A;  3O8Y A;  3KSE D;  3PGB A;  1FG4 A;  1SEN A;  2VCV A;  2R3X A;  2NTO A;  5IO2 A;  2O9U X;  2VLU A;  4HOH A;  1RGH A;  4YAP A;  5FHI A;  3NXJ A;  3CTG A;  3T0U A;  3WMD A;  2DML A;  4STD A;  1LVN A;  4L7K A;  2XSO B;  1A0F A;  2H76 A;  3LTC A;  4O8S A;  2OA7 A;  1ZYN A;  1ZGN A;  4XB5 A;  3A5W A;  4X0X A;  1FB6 A;  1W2B 2;  2LS5 A;  3G7J A;  4RNZ A;  2EC4 A;  2WZ9 A;  3SLU A;  4X1U A;  1WQL B;  3H3H A;  3J7Y b;  1ISK A;  1YY7 A;  3X3Z A;  1EV4 A;  4TKY A;  2CHC A;  3IK9 A;  4JE1 A;  5AEU B;  1TFO A;  2GSS A;  1J0F A;  4GSS A;  3LTA A;  1LNH A;  1PSQ A;  1BUQ A;  1THX A;  1O7P B;  2IFQ A;  5DAL A;  4V1A g;  4YQV A;  3EWL A;  1UUW B;  1K3L A;  2FUG 2;  1Q98 A;  5A5K A;  2AAW A;  2DJJ A;  2VCZ A;  4EVM A;  2H66 A;  3CCE 3;  4Z2R A;  1YEP A;  2XC2 A;  2H0H A;  3L9U A;  5DJM A;  3F63 A;  3KMN A;  2RLI A;  1T5Y A;  1VQ8 3;  4LSO A;  2DJ0 A;  3ZVJ A;  2KLX A;  4J2F A;  4J57 E;  3TCO A;  1X9M B;  1Q7H A;  2LJK A;  1I3F A;  4WYK A;  1EEJ A;  1SAR A;  1FGQ A;  3FKF A;  1TRQ A;  1A8L A;  3MPH A;  1GP1 A;  5A4V A;  1GSD A;  3H1N A;  3HJM A;  3ZTL A;  4L8P A;  4IJ3 A;  4NXI A;  4HM4 B;  2GU1 A;  1L5G B;  1M9B A;  5DDL A;  4NHZ A;  20GS A;  3CRU A;  3QFA C;  3LG6 A;  2D42 A;  1YF1 A;  3UIW A;  3EB8 A;  3EU4 A;  1PN0 A;  1K28 A;  1A2J A;  2IJY A;  4LMV A;  5CRE A;  1JV2 B;  6GSP A;  2CQ9 A;  4LA1 A;  5CRG A;  2YCD A;  4HM7 B;  3I69 A;  2H8L A;  5CF1 A;  5HR0 A;  3KZT A;  4HM6 B;  1AY7 A;  1YJW 3;  2A4V A;  2PER A;  2GQL A;  3H4K A;  2C10 A;  5IG4 A;  3EN8 A;  5G30 A;  4AJ7 A;  1TU5 A;  2P05 A;  4K5R A;  5F07 A;  3CSJ A;  4K2D A;  1YGW A;  4N6T A;  4AKY A;  14GS A;  1CYV A;  1B27 A;  1YKC A;  3HZP A;  3M3M A;  5B6N A;  1RNT A;  4Q53 A;  4FYC A;  1C7H A;  4DSR A;  4MMZ B;  3Q18 A;  2XFS A;  1EGO A;  1K73 4;  2LNT A;  3F0I A;  1Q9E A;  1V98 A;  1BNS A;  5D81 A;  1KBN A;  18GS A;  2OQE C;  1N9J A;  1N2A A;  4POB A;  4MJD A;  2B1L A;  1STD A;  8RNT A;  4IN0 A;  4G2E A;  3BND A;  1EQK A;  5D9X A;  3LML A;  1RN1 A;  2A15 A;  4ZL9 A;  5L71 A;  4X4J A;  4LEH A;  1YHQ 3;  1D6Z A;  2JSZ A;  1XWC A;  4O3V A;  1AUC A;  3CRT A;  5J41 A;  3JUN A;  2JQ5 A;  1OAZ A;  4HM5 B;  1B20 A;  1GOV A;  2XR8 B;  2GBW B;  1BUJ A;  3DY5 A;  3KH7 A;  5GAN D;  4NV5 A;  3WT2 A;  3SX1 A;  1QXH A;  5D82 A;  3IAM 2;  4OVM A;  4RUV A;  3KGK A;  4KE3 A;  1T2I A;  1HNA A;  4KCA A;  1WTH A;  5ECI B;  5COH A;  2WJU A;  2O89 A;  3NBB A;  3CCJ 3;  4ZBB A;  3I9V 2;  1YZX A;  2F86 B;  4GST A;  3LEF A;  4N0V A;  3HIG A;  2CFW A;  4N30 A;  2X8C A;  3UJ1 A;  3A76 A;  4GCI A;  2V6K A;  4WET A;  3K9M C;  4L8O A;  1FW1 A;  3VF1 A;  3VI5 A;  2DKH A;  1M1K 4;  6GSS A;  2R4I A;  1R4C A;  4OFM A;  4YAV A;  4BVY B;  3IBH A;  4WFO A;  3KEB A;  2J8X B;  4QL9 A;  1X5D A;  3CCR 3;  4JR4 A;  4DEJ A;  1AIU A;  4BPY A;  5STD A;  1YKA A;  3UL5 A;  3RHC A;  3FRC A;  3TJF A;  2BU4 A;  3GAX A;  3HXS A;  4K7O A;  2FXT A;  4WBJ A;  1FGO A;  2PVO C;  2AYT A;  2GST A;  2HZE A;  1MOL A;  1RRH A;  1WMO A;  1QAL A;  3AY8 A;  3C8E A;  3M8C A;  1TOF A;  2F5W A;  3HII A;  2IA7 A;  4LGQ A;  3HOH A;  3WD6 A;  2GT5 A;  4RQX A;  3GSS A;  1VF2 A;  1GS3 A;  4WWU C;  2FWF A;  3DWV A;  1CQG A;  1FHE A;  2GS3 A;  1I70 A;  1GUL A;  3I6A A;  4IVF A;  2F98 A;  2RCD A;  2DKI A;  2UX0 A;  3GL5 A;  3F4R A;  1UGH I;  1AQV A;  1JLW A;  3Q6O A;  3DMC A;  3SOA A;  3ZFZ A;  4IQ1 A;  2DMM A;  3GSP A;  1SJI A;  1URM A;  3F3Q A;  4WF4 A;  4HJM A;  2YFI B;  3W6G A;  2XPD A;  4NAX A;  5KP1 A;  3IA1 A;  2E2V A;  3FG4 A;  2L1S A;  3W8S A;  1FGR A;  2UGI A;  1VQ7 3;  1LU4 A;  5ID2 B;  3GMF A;  5DRV A;  2GVP A;  2KUC A;  5TGN A;  2C1Y A;  4XBT A;  4TVE A;  4HDE A;  2NPB A;  3ROB A;  3A5E A;  1O85 A;  4IW9 A;  3GWR A;  3G16 A;  2OE1 A;  4GQC A;  1X1Y A;  2GEX A;  3A3T A;  1QAK A;  5BXQ A;  1CYU A;  3X40 A;  4K5S A;  5HR3 A;  3LXZ A;  3RNT A;  3EHC A;  3DD3 A;  4XBY A;  1RJO A;  1ZYE A;  4IP1 A;  1FUW A;  3Q2P A;  4CY8 A;  1EP7 A;  4HZ2 A;  4I4K A;  2C4B A;  1B21 A;  4PNF A;  1VQK 3;  1M9A A;  1WIK A;  2VLV A;  4HJL B;  4BVX B;  4MF7 A;  4DKI A;  2O85 A;  1UCK A;  1EOH A;  1QMA A;  2IMD A;  1DE2 A;  2RM6 A;  2W0Q A;  1GSS A;  1AXD A;  1ERV A;  4I8B A;  4CW9 A;  3H8Q A;  5EVH A;  4CCV A;  2H6Y A;  3K0Z A;  4LMI A;  1M90 4;  1IVX A;  1F6M C;  5IOX A;  1A67 A;  2O8V B;  1RCK A;  2F3M A;  3I55 3;  2LV3 A;  3CYN A;  4BL3 A;  3LZA A;  3C71 A;  4F9Z A;  3CPW 2;  3IMA B;  5F0G A;  1F37 A;  2CK3 H;  1RGK A;  2CFD A;  2XHF A;  1MD4 A;  3KTL A;  3OWU A;  2YN1 A;  4F0C A;  1LBK A;  3G7Y A;  2KP2 A;  1S5A A;  3EC3 A;  2YWM A;  3D4A A;  4OCF A;  4IEL A;  3U1W A;  2LQQ A;  3U5R E;  2OE0 A;  2W56 A;  2YX9 A;  4HM2 B;  1K3O A;  4O7H A;  4OO4 A;  2W03 A;  5AYS C;  3ZVJ D;  4HEA 2;  1X0R A;  3NUV A;  1W6G A;  2IUJ A;  2I4A A;  3ZML A;  1SL1 B;  2FWH A;  4ECB A;  1NDO B;  3FMW A;  2CKF B;  2HLS A;  3G8Z A;  2G2Q A;  2WO0 A;  2H74 A;  3F6D A;  2Z7A A;  3F14 A;  4RBN A;  1GSY A;  3FCS B;  5LD0 A;  1WJK A;  3PH9 A;  1Q82 4;  2JAC A;  3C1R A;  5IW9 A;  4LL1 B;  2K3D A;  4XIH A;  1WMJ A;  4H61 A;  2QSI A;  3F6F A;  5CAX A;  1EGR A;  1GLP A;  3BOA A;  2XGL A;  2DJ1 A;  3CNM A;  4FYB A;  1FO5 A;  1OHP A;  3UNL A;  1RGC A;  3GTU B;  5ECL B;  2CZ3 A;  4NPB A;  1Z7P A;  3ECF A;  4BWS A;  2I1U A;  1U88 A;  3UOM A;  1OE7 A;  4YQM A;  4FCM A;  3BNC A;  1B9X C;  1HYU A;  4GB5 A;  4R80 A;  4HS1 A;  5ECK B;  1V58 A;  3LOY A;  4N6U A;  1R4W A;  3WOD G;  4PTS A;  5JWR B;  3MG3 A;  4HU7 A;  2LQO A;  1I5G A;  1IYY A;  4MJB A;  1TK0 B;  2VO4 A;  2XF3 A;  4BL7 A;  2E2G A;  1XFL A;  3RAZ A;  3DGY A;  1A2V A;  5IG0 A;  1US1 A;  3LYP A;  3IPZ A;  5A4W A;  1T8E B;  3DKS A;  3KE7 A;  4CY6 A;  4R1K A;  3D4M A;  4V1A p;  3WOF B;  5GAP D;  1PYL A;  4XS6 A;  3NHX A;  3GL3 A;  1VGL A;  2L59 A;  1SII A;  3L0H A;  3TRQ A;  1C54 A;  2C0D A;  1ULI B;  2YV7 A;  1B4P A;  1ZYP A;  4L5L A;  1B4Q A;  5IOW A;  1UI8 A;  3IC4 A;  1Q7Y 4;  2EIO A;  2FY6 A;  4KAE A;  4EXJ A;  4OUQ A;  1G7O A;  2B5Y A;  2G0F A;  3V92 A;  3C1S A;  5JWQ B;  2HI7 A;  1TRV A;  2H73 A;  2NBS A;  5CNW A;  2V2G A;  4BVY A;  1PL2 A;  1TRS A;  2J9H A;  1N5P A;  3RHB A;  3MHE A;  2K8V A;  4HSC X;  1LNI A;  5G1K A;  4HM1 B;  3HX8 A;  1K0B A;  3GIX A;  3S28 A;  1QK8 A;  5KOW A;  2WCI A;  2JDI H;  2YJ7 A;  1GTA A;  3CCL 3;  2QKE A;  1PRX A;  1PN9 A;  1DVC A;  4XBX A;  1JLV A;  2AAD A;  1ROA A;  5J5N A;  3M8N A;  4KFE A;  3X3Y A;  3K7C A;  1FVK A;  1BJX A;  1Q4J A;  1XIY A;  2GTU A;  2VM1 A;  2BIR A;  1BU4 A;  3BCI A;  1M2D A;  2GLR A;  2IMF A;  1SJ6 A;  4HQZ A;  1BNR A;  3VWW A;  1BOX A;  1ROV A;  2H0I A;  4KB3 A;  3IXR A;  3QRD A;  3ZFL A;  5ECH B;  1KEB A;  5CF2 A;  1GMQ A;  1S72 3;  2RNT A;  2HRK A;  3GUS A;  5D83 A;  1GTU A;  1WWJ A;  2BMX A;  1GD3 A;  2LRC A;  3GV1 A;  1GD4 A;  4AF2 A;  4EXR A;  3E99 A;  4HKV B;  3LH4 A;  1U5O A;  1VF4 A;  1O7G B;  4HZB B;  5IM9 A;  3QD9 A;  3KM6 A;  2ES7 A;  2F99 A;  2ML6 A;  1DYU A;  1YVB I;  4KT3 B;  2GGT A;  1EG9 B;  1RNB A;  3DXB A;  5ECM B;  3TUE A;  3UL3 A;  4FIW A;  2P0X A;  3AMO B;  1K0M A;  2A2P A;  1VQP 3;  2H01 A;  3CCV 3;  3G6E 3;  3MSO A;  4L5O A;  3MKI A;  2FGX A;  1AVK A;  4MPF A;  3ED3 A;  4GWR A;  2B6M A;  5D9V A;  2RM5 A;  1SD9 A;  1IT7 A;  1BED A;  2H1G A;  3K8N A;  4BVX A;  4BTY A;  1SL0 B;  3UBL A;  4ID0 A;  1NHO A;  3VK9 A;  2RSX A;  1WMP A;  4F2I A;  1K41 A;  1MDJ A;  1UDI I;  5B6M A;  3I43 A;  2L5O A;  3TKR A;  1VQM 3;  2XBQ A;  2INX A;  3VPT A;  5D93 A;  2Z77 A;  1O8W A;  2GDR A;  4Z2U A;  1BSB A;  1W5Z A;  1WNH A;  2I9W A;  1T4Z A;  2LYX A;  2VL2 A;  3R3E A;  4GL6 A;  3PYJ A;  1BSC A;  1XW6 A;  2HT9 A;  3FF2 A;  4POM A;  4JZQ A;  1B8X A;  2R2J A;  4NWY A;  5H5Q A;  1QFN A;  3G0K A;  4MF5 A;  3TB2 A;  2GQM A;  1BAY A;  4FMB A;  5ECN B;  4HQS A;  3PXM A;  1A2K A;  5G1L A;  1AQZ A;  2H6Z A;  3X3X A;  2YPM A;  2XSH B;  2P09 A;  3FF0 A;  4XS1 A;  1Z9H A;  4GSP A;  3M9K A;  1RRL A;  2R6K A;  1Z6N A;  1ZS7 A;  3F9S A;  3FHK A;  1JB2 A;  2OE3 A;  4G0K A;  4MCU A;  1RGG A;  1Y4K A;  5IMZ A;  1U3A A;  5JWO B;  2QGV A;  3CXG A;  1BNI A;  4G9H A;  4ZL7 A;  1M3I A;  1NM3 A;  2VCX A;  3DZL A;  5E59 A;  2CZ2 A;  3F4T A;  1JKG B;  1C72 A;  1OGX A;  3KII A;  4JRR A;  1AC1 A;  1VF1 A;  4MK3 A;  1BSA A;  3B4O A;  3OX9 A;  1XPV A;  1AV4 A;  4NMU A;  2MMO A;  4GTU A;  1E97 A;  3OV4 A;  5J4U A;  1YJN 3;  2MMA A;  12GS A;  4KCE A;  1WOU A;  2GZP A;  4ML1 A;  1ML6 A;  4PUR A;  2JAD A;  1BX9 A;  5FGO A;  2GSR A;  2WFC A;  4ZIL A;  2FGT A;  1CH0 A;  3HJO A;  3QAV A;  3EYT A;  2DIZ A;  1I2G A;  1I2F A;  3V1W A;  1TUH A;  3QOU A;  3FR6 A;  2HRA A;  2H1A A;  2VL9 A;  1PY3 A;  4MZW A;  4HZ4 A;  2L57 A;  5JCW A;  3FW2 A;  3ZG0 A;  4RZM A;  3IDV A;  4XM4 A;  2PN8 A;  4ZL8 A;  1GOU A;  1VQN 3;  4WP5 A;  4EIP A;  1I9D A;  2CG1 A;  1JNQ A;  1Q40 A;  1BNF A;  1GY6 A;  2RII A;  4EYC A;  1B9Y C;  2B7J A;  2YZH A;  3TKS A;  2VM2 A;  2C3N A;  4EV2 A;  3EQQ B;  3NV0 B;  3DM8 A;  2OTJ 3;  3RBT A;  2O3O A;  5RNT A;  1TK5 B;  1DMM A;  2E2T A;  2IIY A;  2F51 A;  1F3A A;  2KRT A;  2ML5 A;  2C11 A;  1W89 A;  4K2X A;  2P0G A;  2GXF A;  3ZMK A;  2RUE A;  4N6O B; 
#chains in the Genus database with same CATH homology
 2RUF A;  5G5F A;  2QC7 A;  2K8S A;  3APO A;  3ERG A;  4GXZ A;  3WGE A;  5KN1 A;  4X43 A;  2TRX A;  1T4Y A;  1S3C A;  3FZ4 A;  4KF9 A;  1A8Y A;  2HSM A;  5DQY A;  1QMV A;  1VF3 A;  3TRX A;  3DEX A;  3U6V A;  1M7T A;  4ZB6 A;  3D21 A;  4Q5F A;  2N5F A;  3MNG A;  4AGS A;  3Q19 A;  1XWG A;  2DBC A;  4NV2 A;  3HJP A;  2JZS A;  3IK7 A;  2A4H A;  1GNW A;  1M99 A;  3PR8 A;  5JCG A;  3GNJ A;  1KTE A;  1WE0 A;  1U6T A;  1SU9 A;  4ISD A;  2VCW A;  1PMT A;  5HR1 A;  4K7N A;  4BA7 A;  3IRA A;  3EU3 A;  2X8G A;  2YWI A;  4KH7 A;  3VUR A;  2F8F A;  4IS0 A;  5IO0 A;  2X99 A;  3FZ9 A;  3N9J A;  2B7K A;  2LST A;  1BQ7 A;  1Z5Y E;  3DML A;  1X9S B;  4XRD A;  4TN8 A;  3ERW A;  2AHE A;  1XW9 A;  1HD2 A;  4TXO B;  1O81 A;  3GFK A;  3E9J B;  4PQH A;  6GSV A;  2L4C A;  2CT6 A;  3ME8 A;  1S3D A;  5DQS A;  4D73 B;  4EKZ A;  3F4S A;  2B5X A;  5IMC A;  3E3E A;  1JFU A;  1TRU A;  1FB0 A;  5G5E A;  4JED A;  4CDO A;  2I9H A;  1FAA A;  3HYP A;  4F0B A;  16GS A;  3TDG A;  2FWE A;  2IME A;  2HSH A;  2H1D A;  2C0G A;  1H75 A;  3FZ5 A;  4EUY A;  2AUV A;  1EV9 A;  4AJ8 A;  3ZFB A;  3JCM L;  4PUF C;  2HNL A;  1SYR A;  5DAK B;  4L8E A;  4KW6 A;  2AV4 A;  3UVT A;  4XS4 B;  2P5R A;  5INY A;  4GLT A;  5F06 A;  1GNE A;  4I5Q A;  3GX0 A;  5C04 A;  4TR1 B;  3S9F A;  2JZR A;  5HFK A;  2VD0 A;  4L0U A;  1PGT A;  3GHA A;  5ECP B;  4DVC A;  2FCH A;  1M2A A;  2C0E A;  3CTF A;  5AIX A;  3FR3 A;  4OMV A;  4P3Y B;  3HD5 A;  4F03 A;  1QUW A;  4CHS A;  5B8A A;  2VIM A;  3LQ7 A;  2WDU A;  3HCZ A;  2IMI A;  3O76 A;  4TXV A;  1RK4 A;  19GS A;  3L9V A;  2L5L A;  3TJG A;  1K3Y A;  4KSO A;  3N5O A;  1AW9 A;  2PMT A;  2DLX A;  3A2X A;  2P5Q A;  3VPQ A;  2JSY A;  1XOA A;  4FYU A;  5CRH A;  2R5G A;  2YV9 A;  1TK8 B;  2ALB A;  3DVX A;  3FK8 A;  3QMX A;  1Z3E A;  4NHW A;  3TKS E;  4Z2T A;  2MMN A;  3ZL5 A;  3ZIT A;  2LJA A;  2ZCT A;  22GS A;  3J7Y k;  2H75 A;  1X9W B;  2C4J A;  2L4Q A;  3FYG A;  4XCS A;  1ILO A;  2EIR A;  2MMZ A;  1UC7 A;  3D5J A;  6GST A;  3HVS A;  2LEG A;  6GSX A;  1OVN A;  5HQP A;  3O3T A;  1A2L A;  1A24 A;  17GS A;  1OC9 B;  1XBS A;  5H5R A;  1ZYQ B;  4K6X A;  3M0F A;  5IIZ A;  5BRT A;  3LFL A;  4ZXG A;  4BWQ A;  1YJ6 A;  4I2U A;  3WGX A;  1A0R P;  5CRD A;  2AB6 A;  1TP9 A;  2A2R A;  2WRT A;  1S3A A;  1OYJ A;  4I6X A;  3GH9 A;  4DSS B;  2GQK A;  1E2Y A;  3F9U A;  5DCH A;  4EF0 A;  1OC3 A;  5KN3 A;  3HZ4 A;  4O32 A;  5E4W A;  5CRW A;  1ZZY A;  1THO A;  3HKR A;  1PKZ A;  5J3R A;  3UAP A;  4OWY A;  3KMO A;  2DJ2 A;  2N5A A;  3BBY A;  4V2M A;  2R0C A;  2FNO A;  6GSW A;  2IFQ B;  2OAC A;  4N10 A;  5DAL B;  3FEU A;  3WYW A;  2LUS A;  4IHU A;  1DE1 A;  5B7C A;  2LKU A;  4ICY A;  5IMF A;  2PU9 C;  4ULX A;  5GST A;  1TI3 A;  1GUH A;  2K9F A;  3TKP A;  1HNC A;  4IJI A;  1GH2 A;  2LRN A;  1SK1 A;  4J56 E;  1R26 A;  4YH2 A;  2FHE A;  5IQY A;  2LRT A;  3TJJ A;  3GKN A;  2VCT A;  5DBQ A;  3A2V A;  3R2Q A;  4H86 A;  3LGC A;  4HOJ A;  3APQ A;  2F9S A;  3KIJ A;  3ME7 A;  2KP1 A;  3IHG A;  3H93 A;  2H70 A;  5AGY A;  5DCG A;  1M0U A;  1OE8 A;  4MP4 A;  3GKK A;  3GRX A;  5EY6 A;  1XVQ A;  10GS A;  2QA1 A;  4A5P A;  1JZR A;  5ID2 A;  1GSE A;  2JL4 A;  1SL2 B;  2I81 A;  4TR1 A;  1BG5 A;  4QQ7 A;  1K0C A;  2WGR A;  1DBY A;  2WUL A;  3ZRE A;  3DVW A;  4WF5 A;  2IN3 A;  1OC8 A;  1R7H A;  5IPG A;  4TW5 A;  4KX4 A;  2H71 A;  5J9B A;  3DIE A;  5AIS A;  1NW2 A;  3BD2 A;  3HZ8 A;  4MJC A;  2K18 A;  2QA2 A;  3ZIV A;  2GZY A;  1G7E A;  2JZT A;  4USS A;  2OBI A;  1AAZ A;  1Z7R A;  2PPT A;  2O87 A;  2CAI A;  4KA0 A;  3P8W A;  4TRX A;  5KEJ A;  1V2A A;  5IMD A;  2M80 A;  1T7P B;  2TRC P;  2LJR A;  2V41 A;  3RPN A;  3VWX A;  5GSS A;  3MWH A;  5A4U A;  1ZCP A;  1RQM A;  2YAN A;  2MYG A;  1K0N A;  2YJH A;  4ZB9 A;  2FD3 A;  4MDC A;  1PX6 A;  2HFD A;  5CP1 A;  2CVK A;  2R37 A;  3QPM A;  4ZBD A;  3A5I A;  2LTK A;  2HRN A;  1O8X A;  3MSZ A;  3EPT A;  4F82 A;  1GSQ A;  2FLS A;  3KJY A;  1USB A;  3W8J A;  4ECC A;  1FOV A;  1ZOF A;  5FWG A;  3GTU A;  1J08 A;  3LOR A;  3TOU A;  4MH3 A;  2C8U A;  4MNN A;  2DJ3 A;  3D6I A;  1XXU A;  4DSS A;  2L6C A;  2CVD A;  1GRX A;  1NHY A;  4KGI A;  2LNS A;  4DSQ A;  4XRA A;  5EL8 A;  4N11 A;  2JU5 A;  4QL7 A;  3GYK A;  3BJ5 A;  5CO3 A;  2I3Y A;  3UAR A;  1GTI A;  1IYH A;  13GS A;  1O73 A;  1PL1 A;  3P7X A;  4HI7 A;  2P31 A;  4ML6 A;  2XBI A;  5B8B A;  1EP8 A;  4FH8 A;  2IPA A;  5ECO B;  3QAG A;  4GF0 A;  1PQN A;  3L9S A;  4WEY A;  1TRW A;  1G6W A;  3EUR A;  3E0U A;  5IMV A;  4Q5R A;  5LCZ A;  1XZO A;  4Q5N A;  5D9T A;  5F8B A;  3KP8 A;  5KN0 A;  4K0G A;  3DGQ A;  4PGT A;  1V40 A;  4K7I A;  4WR5 A;  2HSY A;  1UVZ A;  1MD3 A;  1ERW A;  4KDY A;  1TJD A;  5ABR A;  4MH2 A;  2KOK A;  4MPG A;  2VD1 A;  2L6D A;  1WRY A;  4OFT A;  2GZZ A;  1SK0 A;  3LW9 A;  3MDK A;  3US3 A;  4O92 A;  2CV4 A;  2VLT A;  7GSS A;  2HZF A;  2FWG A;  3D22 A;  4ZBA A;  5G31 A;  1TDI A;  2YP6 A;  2CX3 A;  2ZUP A;  1K0A A;  4JR6 A;  4V2L A;  3DRN A;  1MTC A;  6GSY A;  1MDK A;  1VRS D;  1RW1 A;  1X5E A;  3EMP A;  4XHM A;  4EDY A;  3FZA A;  4OFN A;  1QGV A;  3FY7 A;  2V6O A;  1EOG A;  5GZZ B;  4RI6 A;  4WKW A;  1R5A A;  2CX4 A;  2HE3 A;  4IKH A;  1JZW A;  2J23 A;  5IMA A;  1O6J A;  4TR4 A;  1PD2 1;  2OJL A;  3GA4 A;  5F05 A;  1XOB A;  3TKQ A;  2HYX A;  2HXK A;  1ACV A;  3KH9 A;  3O6T A;  2X8H A;  3GN3 A;  2A2S A;  3KD0 A;  1GTB A;  1OKT A;  1CQH A;  1T3B A;  3EE2 A;  5HR2 A;  3HVX A;  3GST A;  1F2E A;  4ILF A;  1TU7 A;  5DJL A;  5DVB A;  4O5Q A;  5ELG A;  3HDC A;  5IPH A;  1A23 A;  4GSN A;  2X4A A;  1TU8 A;  4O5R A;  1XWA A;  1O7U A;  4XTS A;  2M72 A;  1LJR A;  3TGZ A;  1K0D A;  1Y6E A;  4BL7 B;  4MLY A;  3G7I A;  1XVW A;  1T00 A;  5EVO A;  2DJK A;  3L78 A;  2K6V A;  1E6B A;  1IYI A;  1XCC A;  2R0P A;  3HA9 A;  1UA5 A;  1YEX A;  5ECS A;  1H4O A;  2OAD A;  2N5B A;  2VL2 C;  2CAQ A;  4EO3 A;  1ABA A;  1NSW A;  1PA3 A;  1JZD A;  2YOI A;  2ON7 A;  4HJ2 A;  2R4V A;  2IMK A;  4PNG A;  1Y25 A;  3PGT A;  4I2T A;  3VFI A;  2DSA A;  4MZC A;  2MZC A;  1XWB A;  1YQ1 A;  2ON5 A;  5D96 A;  2C80 A;  3MIX A;  4WR4 A;  2UZ8 A;  1TW9 A;  2WS2 A;  2H1B A;  3QCP A;  4POL A;  3EVI A;  5JCU A;  5ECQ B;  3GX8 A;  2TIR A;  2OKA A;  2PWJ A;  3IAS 2;  3P2A A;  1MDI A;  2Z9S A;  1PKW A;  3LXT A;  4I97 A;  5ENU A;  1SKS B;  2IWT A;  1ERU A;  5LNK e;  1JZO A;  1AQW A;  4K1F A;  1GUM A;  4O5U A;  1SD8 A;  2YZU A;  1TKD B;  5ELA A;  3NZN A;  4IGJ A;  3C73 A;  3G9B A;  2VL3 A;  5C00 A;  3IV4 A;  3TKS C;  3TRP A;  3QR6 A;  1WPI A;  1SK2 A;  2VAF A;  6GSU A;  4E8E A;  3CBU A;  1SYX A;  4K9Z A;  2H19 A;  1ZL9 A;  1SKR B;  11GS A;  4FO5 A;  2WB9 A;  1V9W A;  2X49 A;  2V1M A;  4LL4 B;  3RPP A;  4K8M A;  1B48 A;  2H0G A;  3F8U A;  4RI7 A;  2H6X A;  5D9W A;  2GT6 A;  5HFI A;  1G6Y A;  3D4T A;  3KZQ A;  1N8J A;  3KTB A;  3VLN A;  3WGD A;  4GQF A;  1DUG A;  4IBP A;  4MMM A;  4IQA A;  4MAB A;  3GKM A;  4PUA A;  3GUR A;  4EE0 A;  3MYD A;  1XW5 A;  4G0L A;  2E7P A;  2R0G A;  3GKX A;  4ECJ A;  2MBT A;  1WP0 A;  4EIQ A;  8GSS A;  1G0T A;  2PVQ A;  3SBC A;  5J9C A;  3LYK A;  5BMU A;  3F3R A;  1QQ2 A;  3OR5 A;  2PBJ A;  2XPE A;  2B5E A;  3C7M A;  3CSH A;  3TJK A;  4Z7X A;  2M46 A;  3QFB C;  3D0Z A;  3EIN A;  3HHV A;  1YF0 A;  1R5P A;  4PQ1 A;  2CA8 A;  4EDZ A;  3HVV A;  3IOS A;  3QDN A;  4MZB A;  3VWU A;  4KSM A;  2IY2 A;  1HNB A;  4GRF A;  3SWL A;  4LLR A;  3MAK A;  3ZLP A;  3RDW A;  2NVL A;  5HFG A;  2KHP A;  4FQU A;  5H5S A;  1PX7 A;  4IP6 A;  4TXO A;  1YDK A;  4WXT A;  1GSF A;  3BCK A;  4OO5 A;  3IE3 A;  4E8H A;  4MJA A;  2VOC A;  3CMI A;  4YKG A;  1Z6M A;  4V2N A;  2YWN A;  4G19 A;  4HU9 A;  2D2Z A;  2YWO A;  4D73 A;  2O7K A;  3M9J A;  1K0O A;  1EZK A;  2OBK A;  4OCE A;  2E0Q A;  5KN2 A;  1M2B A;  4G0I A;  1JHB A;  4JU5 A;  4KUN A;  3GH6 A;  4MA9 A;  5D73 A;  4HUA A;  3L4N A;  4RQR A;  3APS A;  4EL1 A;  1BYE A;  3NOF A;  2FA8 A;  2DC5 A;  2VCQ A;  3P90 A;  1OKD A;  2C3Q A;  4JBB A;  3UMA A;  1ST9 A;  5DAK A;  2MBS A;  1V57 A;  2PUK C;  3VI7 A;  1W4V A;  2REM A;  4AJ6 A;  4XS4 A;  4MJE A;  4YQU A;  2IYJ A;  1SKW B;  3KP9 A;  1FVJ A;  4PXO A;  1A2M A;  3IHQ A;  3CSI A;  3PIN A;  3ZZX A;  5D8I A;  3KXO A;  5CYY A;  4PQI A;  2H30 A;  1GLQ A;  1XWK A;  2DIY A;  4LMW A;  5G2Z A;  4MF6 A;  5AN1 A;  1EEM A;  1TI1 A;  2VUP A;  1TXX A;  3PPU A;  1TTZ A;  4TOP A;  2B1K A;  1ERT A;  1GWC A;  3A2W A;  1DSB A;  3UBK A;  2FA4 A;  1U3I A;  5EPF A;  3UVH A;  1GUK A;  2X64 A;  1MEK A;  2BJX A;  4KDU A;  1GSU A;  3EMX A;  3LJR A;  2NDO A;  2V32 A;  1ON4 A;  3LSZ A;  1ZMA A;  3M1G A;  3NIV A;  4ECI A;  5AIV A;  3ISO A;  2IL3 A;  3H79 A;  1GL8 A;  3WT1 A;  4N0Z A;  2GSQ A;  2CVB A;  4OD7 A;  4PX1 A;  4G10 A;  1FOH A;  3ZIJ A;  2BTO T;  3QAW A;  4ACS A;  4L0W A;  9GSS A;  4YKF A;  3IC8 A;  5FT3 A;  3ZRD A;  1HQO A;  3HY2 A;  3LWA A;  2ZNM A;  4ZIJ A;  3IR4 A;  4KDX A;  1J9B A;  3UEM A;  1SJZ A;  2AJQ B;  2H72 A;  3Q74 A;  4POK A;  1EWX A;  4TR0 A;  3KCM A;  1UN2 A;  3DYR A;  2B3S A;  2PGT A;  3ERF A;  4KND A;  3TOT A;  2YNX A;  3VWV A;  4EC0 A;  1AQX A;  2F8A A;  1F9M A;  1OC9 A;  2C0F A;  4TR3 A;  5ECR B;  4Q5Q A;  2E2M A;  4K0N A;  2HZE B;  4ZB8 A;  1U87 A;  2HRF A;  3FR9 A;  5KOX A;  1X5C A;  1T1V A;  1KNG A;  4WBR D;  1F3B A;  3TJB A;  2C3T A;  2EIQ A;  1FG4 A;  1SEN A;  2VCV A;  5IO2 A;  2R3X A;  2NTO A;  2VLU A;  5FHI A;  4YAP A;  3CTG A;  2DML A;  1A0F A;  2H76 A;  2OA7 A;  1ZYN A;  1ZGN A;  3A5W A;  4X0X A;  1FB6 A;  2LS5 A;  3G7J A;  2EC4 A;  2WZ9 A;  4X1U A;  3J7Y b;  1YY7 A;  1EV4 A;  4TKY A;  3IK9 A;  4JE1 A;  1J0F A;  2GSS A;  4GSS A;  1PSQ A;  1THX A;  2IFQ A;  5DAL A;  4V1A g;  4YQV A;  3EWL A;  1K3L A;  2FUG 2;  1Q98 A;  5A5K A;  2AAW A;  2DJJ A;  2VCZ A;  4EVM A;  2H66 A;  4Z2R A;  1YEP A;  2XC2 A;  2H0H A;  3L9U A;  5DJM A;  3F63 A;  3KMN A;  2RLI A;  2DJ0 A;  3ZVJ A;  2KLX A;  4J2F A;  4J57 E;  3TCO A;  1X9M B;  2LJK A;  1EEJ A;  3FKF A;  1A8L A;  5A4V A;  1GP1 A;  1GSD A;  3H1N A;  3HJM A;  3ZTL A;  4IJ3 A;  4NXI A;  1M9B A;  5DDL A;  4NHZ A;  20GS A;  3CRU A;  3QFA C;  3LG6 A;  1YF1 A;  3UIW A;  3EU4 A;  1PN0 A;  1A2J A;  2IJY A;  4LMV A;  5CRE A;  2CQ9 A;  4LA1 A;  5CRG A;  2YCD A;  3I69 A;  2H8L A;  5HR0 A;  2A4V A;  2PER A;  2GQL A;  3H4K A;  5G30 A;  4AJ7 A;  4K5R A;  5F07 A;  3CSJ A;  4K2D A;  14GS A;  1YKC A;  3M3M A;  5B6N A;  4FYC A;  4DSR A;  3Q18 A;  1EGO A;  2LNT A;  3F0I A;  1V98 A;  1KBN A;  18GS A;  1N2A A;  4POB A;  2B1L A;  4IN0 A;  4G2E A;  5D9X A;  4ZL9 A;  5L71 A;  4X4J A;  2JSZ A;  1XWC A;  3CRT A;  1AUC A;  5J41 A;  1OAZ A;  3KH7 A;  5GAN D;  4NV5 A;  3WT2 A;  1QXH A;  3IAM 2;  4RUV A;  3KGK A;  4KE3 A;  1HNA A;  4KCA A;  5ECI B;  5COH A;  2WJU A;  2O89 A;  4ZBB A;  3I9V 2;  1YZX A;  4GST A;  3LEF A;  4N0V A;  4N30 A;  2X8C A;  3UJ1 A;  4GCI A;  2V6K A;  4WET A;  1FW1 A;  3VI5 A;  2DKH A;  6GSS A;  4OFM A;  4YAV A;  4BVY B;  3IBH A;  3KEB A;  4QL9 A;  1X5D A;  4JR4 A;  4DEJ A;  1AIU A;  4BPY A;  1YKA A;  3RHC A;  3FRC A;  3TJF A;  3HXS A;  4K7O A;  4WBJ A;  2PVO C;  2AYT A;  2GST A;  2HZE A;  3C8E A;  3AY8 A;  1TOF A;  3WD6 A;  2GT5 A;  4RQX A;  3GSS A;  1VF2 A;  2FWF A;  3DWV A;  1CQG A;  1FHE A;  2GS3 A;  3I6A A;  1GUL A;  4IVF A;  2DKI A;  3GL5 A;  3Q6O A;  3ZYW A;  3F4R A;  1AQV A;  1JLW A;  4IQ1 A;  2DMM A;  1SJI A;  1URM A;  3F3Q A;  4WF4 A;  4HJM A;  3W6G A;  2XPD A;  4NAX A;  3IA1 A;  3W8S A;  1LU4 A;  5ID2 B;  3GMF A;  2GVP A;  2KUC A;  2C1Y A;  4TVE A;  4HDE A;  2NPB A;  1O85 A;  4IW9 A;  4GQC A;  2OE1 A;  3A3T A;  4K5S A;  5HR3 A;  3LXZ A;  3DD3 A;  1ZYE A;  4IP1 A;  4CY8 A;  1EP7 A;  4HZ2 A;  4PNF A;  1WIK A;  1M9A A;  2VLV A;  4BVX B;  4MF7 A;  2O85 A;  1EOH A;  2IMD A;  1DE2 A;  2RM6 A;  1GSS A;  1AXD A;  1ERV A;  4I8B A;  4CW9 A;  3H8Q A;  2H6Y A;  1F6M C;  5IOX A;  2O8V B;  2F3M A;  2LV3 A;  3CYN A;  3C71 A;  4F9Z A;  5F0G A;  1F37 A;  2XHF A;  1MD4 A;  3KTL A;  2YN1 A;  4F0C A;  1LBK A;  3G7Y A;  2KP2 A;  3EC3 A;  2YWM A;  4OCF A;  4IEL A;  2LQQ A;  3U5R E;  2OE0 A;  1K3O A;  4O7H A;  4OO4 A;  3ZVJ D;  4HEA 2;  1X0R A;  2I4A A;  3ZML A;  1SL1 B;  2FWH A;  4ECB A;  3FMW A;  2HLS A;  2G2Q A;  2H74 A;  3F6D A;  1GSY A;  5LD0 A;  1WJK A;  3PH9 A;  2JAC A;  3C1R A;  4LL1 B;  4XIH A;  5CAX A;  1WMJ A;  2QSI A;  3F6F A;  1EGR A;  1GLP A;  3BOA A;  2DJ1 A;  1FO5 A;  4FYB A;  3GTU B;  5ECL B;  2CZ3 A;  4NPB A;  1Z7P A;  4BWS A;  2I1U A;  1U88 A;  3UOM A;  1OE7 A;  4YQM A;  1B9X C;  1HYU A;  4HS1 A;  5ECK B;  1V58 A;  1R4W A;  4PTS A;  5JWR B;  4HU7 A;  2LQO A;  1I5G A;  4MJB A;  1TK0 B;  2VO4 A;  4BL7 A;  2E2G A;  1XFL A;  3RAZ A;  3LYP A;  3IPZ A;  5A4W A;  1T8E B;  3DKS A;  4CY6 A;  3D4M A;  4V1A p;  5GAP D;  4XS6 A;  3GL3 A;  1VGL A;  2L59 A;  3L0H A;  3TRQ A;  2C0D A;  2YV7 A;  1B4P A;  1ZYP A;  4L5L A;  1B4Q A;  5IOW A;  3IC4 A;  2EIO A;  2FY6 A;  4KAE A;  4EXJ A;  1G7O A;  2B5Y A;  2G0F A;  3C1S A;  5JWQ B;  2HI7 A;  1TRV A;  2H73 A;  2NBS A;  5CNW A;  2V2G A;  4BVY A;  1PL2 A;  1TRS A;  2J9H A;  3RHB A;  2K8V A;  5G1K A;  1K0B A;  3GIX A;  1QK8 A;  5KOW A;  2WCI A;  2YJ7 A;  1GTA A;  2QKE A;  1PRX A;  1PN9 A;  1JLV A;  5J5N A;  3M8N A;  1FVK A;  1BJX A;  1Q4J A;  1XIY A;  2GTU A;  2VM1 A;  3BCI A;  1M2D A;  2GLR A;  2IMF A;  1SJ6 A;  4HQZ A;  3VWW A;  2H0I A;  4KB3 A;  3IXR A;  3ZFL A;  5ECH B;  1KEB A;  2HRK A;  3GUS A;  1GTU A;  1WWJ A;  2BMX A;  2LRC A;  3GV1 A;  4AF2 A;  1VF4 A;  5IM9 A;  3QD9 A;  3KM6 A;  2ES7 A;  3DXB A;  2GGT A;  5ECM B;  3TUE A;  3UL3 A;  4FIW A;  1K0M A;  2A2P A;  2H01 A;  4L5O A;  2FGX A;  4MPF A;  3ED3 A;  4GWR A;  2B6M A;  5D9V A;  2RM5 A;  1SD9 A;  1BED A;  2H1G A;  3K8N A;  4BVX A;  1SL0 B;  3UBL A;  4ID0 A;  1NHO A;  3VK9 A;  4F2I A;  1MDJ A;  5B6M A;  3I43 A;  2L5O A;  3TKR A;  2XBQ A;  3VPT A;  5D93 A;  1O8W A;  2GDR A;  4Z2U A;  1T4Z A;  2VL2 A;  3R3E A;  1XW6 A;  2HT9 A;  4POM A;  4JZQ A;  1B8X A;  2R2J A;  4NWY A;  5H5Q A;  1QFN A;  4MF5 A;  3TB2 A;  2GQM A;  1BAY A;  5ECN B;  4HQS A;  5G1L A;  2H6Z A;  2YPM A;  4XS1 A;  1Z9H A;  3M9K A;  2R6K A;  1Z6N A;  3FHK A;  2OE3 A;  4G0K A;  4MCU A;  5IMZ A;  1U3A A;  5JWO B;  2QGV A;  3CXG A;  4G9H A;  4ZL7 A;  1NM3 A;  2VCX A;  5E59 A;  2CZ2 A;  3F4T A;  1C72 A;  4JRR A;  1AC1 A;  1VF1 A;  4MK3 A;  1XPV A;  4NMU A;  2MMO A;  4GTU A;  5J4U A;  2MMA A;  12GS A;  4KCE A;  1WOU A;  2GZP A;  4ML1 A;  1ML6 A;  4PUR A;  2JAD A;  1BX9 A;  2GSR A;  2WFC A;  4ZIL A;  3HJO A;  3QAV A;  3EYT A;  2DIZ A;  3V1W A;  3QOU A;  3FR6 A;  2HRA A;  2H1A A;  2VL9 A;  4MZW A;  4HZ4 A;  2L57 A;  5JCW A;  3FW2 A;  3IDV A;  2PN8 A;  4ZL8 A;  4EIP A;  1I9D A;  2RII A;  1B9Y C;  2B7J A;  2YZH A;  3TKS A;  2VM2 A;  2C3N A;  3RBT A;  1TK5 B;  2IIY A;  2F51 A;  1F3A A;  1W89 A;  4K2X A;  2P0G A;  3ZMK A;  2RUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...