1JZDA

Dsbc-dsbdalpha complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
GAMADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thiol:disulfide interchange protein dsbc
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzdA02
4J2FA 2H72A 2MMZA 1RW1A 3I43A 2YPMA 3TUEA 1TJDA 2YZUA 3TDGA 2KP1A 1EEJA 1V58A 3O6TA 4HQZA 3HJPA 3F8UA 1B4QA 5LD0A 3F3QA 3CTGA 1AUCA 2GT5A 2H1AA 4BWQA 2FWEA 3EMPA 4OMVA 3RAZA 1M0UA 4EO3A 1SYRA 3UOMA 2ES7A 3EWLA 4TRXA 4HZ4A 4KB3A 2IJYA 1VF3A 1HNBA 4EDZA 1GTUA 2NTOA 3KD0A 5CRWA 2AJQB 4MLYA 4KE3A 3VWUA 3TKRA 2H75A 5IOXA 4F9ZA 2GZYA 2VLTA 1J0FA 2OADA 2GZPA 1U87A 2L5LA 4K1FA 1OC9A 4MZBA 2FLSA 3EVIA 3FW2A 3UMAA 3DRNA 5H5SA 1EZKA 3QOUA 2PVQA 5E4WA 5KN1A 1O81A 3IAM2 4KCAA 2H73A 2GS3A 4V2MA 3ZVJD 2FWFA 5FWGA 4X43A 3TGZA 4V2LA 5D96A 3F0IA 4TXVA 2O87A 1BQ7A 2A2RA 5F0GA 3U5RE 4PQ1A 1A8LA 2F3MA 1YKCA 1FB0A 4TKYA 4NV5A 1TOFA 3HVXA 5D9VA 1TW9A 5CRDA 2YCDA 4WBJA 4FH8A 4KDXA 1WIKA 2K8VA 3ZRDA 4L5OA 5JCWA 2L57A 3G9BA 2OACA 1HD2A 3FRCA 5C00A 1WMJA 1DSBA 2PVOC 3VWWA 1K3YA 4KSOA 2RIIA 3GH6A 3D6IA 1M2BA 4OFMA 1SK0A 3HHVA 4IJIA 4N10A 2IY2A 5IMAA 5HQPA 1G6WA 1T4YA 1V57A 3M3MA 2OE1A 2H1BA 3LSZA 4IN0A 2GGTA 1GLQA 1YY7A 4QL9A 2YJ7A 1PN9A 1FW1A 1K0BA 4DSSB 2GSTA 3ZMLA 1OKDA 3OR5A 3ZZXA 3ZITA 2FGXA 1QGVA 1KEBA 3CMIA 3BD2A 2YWOA 1O85A 4GLTA 5H5RA 2JZTA 3F4TA 1XCCA 4D73B 4FYUA 3U6VA 17GSA 2DIZA 2IMFA 4G9HA 2G0FA 1TI3A 2H66A 4NXIA 2H6YA 3GTUA 1YZXA 5G1LA 1I9DA 5HR2A 2CQ9A 4K8MA 4HQSA 3D22A 5INYA 2L4QA 3BCKA 3J7Yk 1HYUA 2RUEA 2EC4A 3MDKA 4FIWA 4FYCA 2YANA 3A2VA 2CAQA 1IYHA 2TIRA 2FA8A 4LL4B 3GX8A 5CRHA 5D73A 1X9WB 1TDIA 3Q18A 1K3LA 2N5AA 2NVLA 2LJRA 2ZUPA 3VLNA 2WS2A 3LFLA 2IFQB 4BWSA 1GSYA 3TJFA 2OJLA 2LUSA 1WOUA 3FY7A 5AN1A 2M72A 4GTUA 1K0DA 2IMKA 3W6GA 2LEGA 1OAZA 5CNWA 2VL9A 3UAPA 1H75A 1PKZA 3IE3A 2B5YA 1U88A 1Y6EA 5L71A 3C8EA 1JHBA 4L0WA 18GSA 2WZ9A 4V1Ap 4OO4A 5ECQB 3A5WA 1R5PA 1GUMA 1FOVA 2H01A 1TRUA 1VF4A 3I6AA 3GMFA 3KH9A 2GSSA 2IL3A 4WF4A 4X0XA 4IVFA 1TK0B 3TB2A 3LJRA 2KOKA 1EOGA 2VCQA 4GXZA 3IK7A 2HE3A 3TCOA 4G2EA 3MSZA 1I5GA 4WR4A 3TKSA 5AIVA 1T4ZA 1A2MA 1C72A 1A8YA 1VF2A 5IMCA 4TXOB 4POLA 2LQOA 3ZLPA 2PERA 4TR0A 1ZMAA 4PXOA 3MNGA 3PH9A 3RPPA 1A2LA 3WGDA 3KMNA 1W4VA 2VM2A 1DUGA 3N5OA 6GSSA 5F8BA 4I6XA 3HVSA 2O7KA 2JSYA 1BEDA 5A4WA 4WR5A 5A5KA 4YH2A 4ACSA 3KM6A 4I2TA 4HOJA 4NV2A 3F6FA 5DCHA 3DD3A 1DE1A 1SD8A 1JLWA 4POKA 2IMEA 5CP1A 3ZFLA 1F2EA 2M46A 4JEDA 2JZRA 1GH2A 1ST9A 2IN3A 4LLRA 2HZEA 2C8UA 3TOUA 1XOAA 2MBSA 1OYJA 2VCWA 2CVDA 1W89A 2D2ZA 1B9YC 4RQXA 5J5NA 3GSTA 3IAS2 3D5JA 4LL1B 1VF1A 3CSJA 4EDYA 5DVBA 1GUKA 2HRNA 4F0BA 2GTUA 5KEJA 1EV4A 2F51A 2H1GA 2BJXA 1PRXA 2O8VB 5A4UA 1YEXA 2K8SA 4TR1B 2FA4A 5IMVA 2A2SA 3LQ7A 4DEJA 3DYRA 2PMTA 1SK1A 4N11A 3UIWA 4TR3A 4ML6A 4DSRA 2XBIA 2ON7A 5DALA 3KP9A 1Z7RA 2H1DA 1EWXA 4OCFA 1GTAA 5KN2A 1ERTA 2B7KA 1KTEA 5AGYA 4RI7A 1MDIA 4QQ7A 1B9XC 4ML1A 5CYYA 3ZVJA 1SL2B 4MZWA 3C1RA 2K9FA 3KIJA 1PSQA 4AJ8A 4V2NA 5G2ZA 1TI1A 2E7PA 3LORA 4DSQA 3FYGA 1U6TA 4DVCA 3HZ4A 2R2JA 6GSWA 3IK9A 1G7OA 1FB6A 1URMA 4IQAA 3DVXA 3FK8A 1ML6A 3L0HA 3FR6A 4IP1A 2L6CA 3FZ4A 2I3YA 4I8BA 4BPYA 5G30A 3EU3A 1MD4A 2H19A 3GX0A 4TR4A 1U3IA 4X1UA 3ZIJA 5IO2A 4XHMA 1OE8A 2LRNA 4PNGA 4V1Ag 3LG6A 1FVJA 1MDKA 1R5AA 4KUNA 1TKDB 1Q98A 3M0FA 4MMMA 5H5QA 1TU7A 2HNLA 2GSQA 3ED3A 5B6MA 5J3RA 1QK8A 3APSA 1H4OA 4O92A 4JU5A 3D4MA 2R37A 1O8WA 3UARA 4KSMA 3I9V2 5ECIB 1SENA 5JCUA 2QSIA 3TKSC 4EE0A 1J9BA 2YP6A 5IOWA 2V6OA 1TRSA 2AUVA 1JLVA 1TK8B 4I5QA 4IP6A 2OE3A 2CZ3A 5ID2B 1SJZA 4O5RA 2VIMA 1WP0A 5ELAA 2HRFA 1A0RP 3GL3A 1JZOA 5ENUA 4TVEA 1AC1A 2XPDA 3KJYA 3Q74A 4OFTA 4IW9A 4J56E 4Q5QA 4ZBBA 3QMXA 2WFCA 4KW6A 3F3RA 4XTSA 2DJ3A 2C1YA 4EXJA 1GNWA 3HD5A 1XXUA 4KH7A 4Q5RA 4MJAA 3ZFBA 3APQA 2V6KA 3QAVA 4GSNA 4NHWA 3E0UA 3UVTA 2AHEA 2F9SA 2WGRA 6GSUA 3DWVA 1MDJA 2HFDA 3WGXA 2J9HA 1TRWA 4LA1A 4GQCA 5DJMA 2GQMA 2WJUA 4O7HA 1OKTA 2PGTA 3D0ZA 1TTZA 2L4CA 2TRXA 4JRRA 3BBYA 2IPAA 4EF0A 2QGVA 1K0CA 1X0RA 4KDYA 1V2AA 1V98A 1Z3EA 4EUYA 2LNTA 2REMA 2EIOA 3GNJA 2YV7A 1NW2A 3P8WA 2VD0A 3CYNA 2VCXA 3C1SA 2B1LA 3GL5A 5D8IA 4AJ6A 2LJAA 2K6VA 4ZIJA 2VCZA 1WWJA 2C0FA 2WULA 3W8SA 3TJJA 4HZ2A 2C0DA 1AW9A 1A23A 4ZL7A 3QD9A 3LYKA 5ECKB 1XW6A 4XS1A 4XRDA 4MPFA 3GKKA 5B7CA 1MTCA 3DXBA 2C0EA 4MCUA 2G2QA 2B7JA 4DSSA 3NZNA 2NBSA 2N5FA 1FVKA 8GSSA 1SL0B 1R4WA 2MBTA 4HS1A 5HR0A 1HNAA 1SKWB 4Z7XA 2KP2A 2OKAA 4EKZA 4MPGA 4HJMA 14GSA 3VPQA 4D73A 3ME7A 1F37A 1E6BA 4WEYA 4ISDA 3EYTA 2CX3A 4ZILA 1SJ6A 1XW9A 2CX4A 3O3TA 3RBTA 2IIYA 3P90A 5DQSA 4ZB6A 1ZYQB 5DAKB 5CREA 4WF5A 2B5XA 2JSZA 1AIUA 1Z6NA 3QR6A 2P31A 4AGSA 3F9UA 5J4UA 4F0CA 3IRAA 1X5CA 3APOA 2L59A 1NM3A 3GFKA 4ZB9A 2VD1A 4N0VA 4IKHA 2IFQA 3P7XA 2LSTA 4O32A 1ERWA 3JCML 2OE0A 2CAIA 1YKAA 1N8JA 3A2WA 1O7UA 3W8JA 1CQHA 4PNFA 4K6XA 1X9MB 3PR8A 1K0AA 3QPMA 4POBA 4PX1A 1PX7A 2KHPA 3Q6OA 4ZBDA 4K2DA 3H8QA 3IXRA 4ZBAA 2FD3A 2K18A 2L6DA 3IPZA 2HSHA 4HUAA 3L4NA 2RM6A 2B5EA 3L9UA 2H8LA 5HFGA 4BL7A 4MABA 4MH3A 4FYBA 1XVWA 3TJKA 2ZCTA 2JU5A 3WD6A 1M7TA 3ERGA 2LRCA 1K0MA 1TRVA 2R6KA 1UN2A 1O73A 3QAGA 2VOCA 2LTKA 3H4KA 1ZL9A 7GSSA 2ON5A 1ZGNA 2CA8A 2YV9A 3C71A 4ZL8A 4TXOA 1V40A 2DJJA 3GURA 1A0FA 1PD21 1SU9A 1R26A 4GSSA 4NMUA 3KTBA 2HYXA 4JBBA 3H79A 3G7YA 2F8FA 4RUVA 4GCIA 22GSA 3VPTA 4CHSA 2AAWA 2IMDA 5B8AA 4PURA 2DJKA 3GHAA 2VM1A 1GTBA 1A24A 5AISA 4EVMA 1ILOA 1TK5B 3GYKA 3C73A 1XBSA 1GLPA 4PUFC 5KN3A 3S9FA 2IWTA 6GSYA 1B4PA 1SK2A 1U3AA 1Z9HA 5G31A 3CSHA 4EL1A 4POMA 5IMDA 3GUSA 1YF1A 3J7Yb 2X8HA 2RLIA 2JZSA 2LRTA 2O85A 2P5RA 2LJKA 4ULXA 1IYIA 3HYPA 2DJ0A 3WGEA 4E8EA 1NSWA 3KMOA 5JCGA 4BVYA 1PL1A 5D9TA 2DIYA 3F4RA 2C3NA 2R3XA 3DEXA 2V32A 2HT9A 1PL2A 1ABAA 1GSFA 3LWAA 5COHA 2GQKA 4TOPA 3L9VA 3US3A 1TU8A 3UBKA 2I9HA 5ECHB 3UBLA 4RI6A 2V2GA 3GKMA 3RPNA 5HR1A 3H1NA 2C0GA 2B3SA 4TR1A 3DMLA 1ACVA 1M2AA 3WT2A 3IV4A 1T3BA 2J23A 2MMNA 4KNDA 3HY2A 1HNCA 4MP4A 4PGTA 4AF2A 4K0GA 2B6MA 5GSTA 5HFKA 2FUG2 5ECMB 3HCZA 3HJMA 1GP1A 2BMXA 3FR9A 1EOHA 4MZCA 1ERVA 2YN1A 5LCZA 4KA0A 4K7OA 4I97A 2YZHA 3TKPA 2VO4A 3AY8A 4GWRA 1AAZA 5ECNB 2GSRA 4IGJA 3A2XA 2YNXA 3F63A 2YWNA 4XS4B 3GH9A 3HKRA 4ZL9A 1BJXA 4Q5NA 3F6DA 5D9XA 2NDOA 9GSSA 1MEKA 1OE7A 4HI7A 5J9CA 2DMMA 3BOAA 3HA9A 2VUPA 4P3YB 4ILFA 4OCEA 2H30A 3EC3A 4XS6A 4MJEA 3RHCA 2GLRA 2AYTA 5B6NA 3TJBA 4G19A 3ERWA 1T7PB 2RM5A 4K9ZA 1XWBA 3LXZA 2M80A 1PA3A 3O76A 5F06A 1ZZYA 11GSA 4YAPA 2H0HA 2VL3A 4OO5A 4YQMA 1J08A 3V1WA 1BAYA 2LNSA 3EURA 2FCHA 2OBKA 2NPBA 3CSIA 4IHUA 4XIHA 3VK9A 1F9MA 1F3AA 1YJ6A 3HVVA 1X9SB 5DJLA 4BVXA 4G10A 4KDUA 1PKWA 2DC5A 3IHQA 1M9AA 1G7EA 1KNGA 2PU9C 1OVNA 4JZQA 3NIVA 3UVHA 4NWYA 2XPEA 3DIEA 1V9WA 2XHFA 1GUHA 3EINA 2F8AA 4NHZA 2FHEA 2VAFA 5HR3A 3GKXA 3WYWA 2P5QA 3RDWA 5IIZA 3D4TA 2KUCA 2YOIA 16GSA 3LYPA 1EP8A 1QFNA 4ZB8A 4LMVA 2GQLA 5JWRB 5ECSA 5ID2A 4H86A 4WBRD 2RUFA 4XRAA 2XC2A 3GN3A 4HU9A 3RHBA 1O6JA 1F3BA 1T1VA 2FNOA 1GSDA 4HJ2A 2WCIA 2VCTA 2CVKA 2FY6A 5GSSA 1JZRA 5JWQB 2H76A 1JZWA 1XWGA 1MD3A 3CBUA 3ZTLA 2BTOT 2E2MA 1S3DA 5EL8A 4N30A 4YQVA 3IBHA 1VGLA 2VL2A 4PQIA 5EVOA 5KN0A 4OWYA 1YQ1A 1PQNA 3GRXA 5CO3A 1AQWA 1EEMA 1Z5YE 2ZNMA 3LGCA 4TN8A 1M99A 3TOTA 3KEBA 1OC8A 3UEMA 3IC4A 1PGTA 1OC9B 1ZYEA 4FO5A 5IMFA 2FWGA 1B8XA 2PN8A 2PUKC 3ZYWA 3LEFA 3QFAC 2QKEA 4GQFA 3TRXA 5B8BA 1EP7A 2XBQA 2R5GA 2VLVA 1UVZA 4PUAA 5ECRB 1VRSD 1XIYA 3L78A 2DLXA 2CT6A 1F6MC 3UJ1A 3VURA 4RQRA 2LQQA 4N0ZA 1GNEA 1XVQA 2ALBA 3EU4A 5E59A 2JADA 1HQOA 1QMVA 2AB6A 2H70A 5HFIA 3GSSA 4MDCA 5IO0A 3KCMA 2JL4A 3KP8A 3R2QA 5GAND 1A2JA 2H0IA 3ZL5A 1ERUA 3KTLA 3GIXA 1THOA 3Q19A 2R4VA 3FEUA 1GSUA 2V1MA 4MF7A 4KAEA 2C80A 6GSTA 2H6XA 2Z9SA 1PX6A 4F82A 5DBQA 3WT1A 1O8XA 3E3EA 4BA7A 4K7IA 3F4SA 3MAKA 3EE2A 4I2UA 2HZFA 1X5EA 5DAKA 1G6YA 1XOBA 2CVBA 5LNKe 2PPTA 2H0GA 1RQMA 4CW9A 12GSA 1WPIA 3BJ5A 1B48A 13GSA 1N2AA 3M8NA 3VWXA 2X8GA 5DCGA 4GF0A 1KBNA 2DMLA 2WDUA 1SKSB 1K3OA 2O89A 1XPVA 1GL8A 5F05A 3G7IA 1EV9A 4IBPA 5EPFA 3GTUB 4AJ7A 2EIQA 5JWOB 3GV1A 3VI5A 1Z7PA 1X5DA 3KGKA 2QC7A 4NPBA 4L0UA 2HXKA 3FHKA 3CXGA 5FT3A 4KCEA 1GSEA 3UL3A 2DSAA 1S3AA 2GT6A 4MF6A 2A4VA 2N5BA 2IMIA 3DGQA 3ISOA 5ECLB 4HEA2 1NHOA 1T8EB 1WE0A 3ZMKA 1Z6MA 1ZCPA 3FKFA 4PQHA 2AV4A 2MMOA 1XW5A 3CTFA 3CRTA 5F07A 2MYGA 1FG4A 3CRUA 1JFUA 3I69A 3QDNA 5ECPB 2X64A 5J41A 1GULA 1M9BA 1TXXA 3KXOA 5ELGA 3PGTA 3A3TA 2I81A 2YWIA 1E2YA 2PBJA 1AXDA 4GSTA 5G5FA 4ECCA 2GZZA 2CV4A 2X99A 3ZIVA 1TP9A 4CDOA 2HLSA 1XWAA 3TKQA 3SWLA 4YAVA 1CQGA 2VL2C 2GVPA 1SKRB 1USBA 3QFBC 2H74A 5A4VA 4WKWA 3IA1A 3IOSA 2P0GA 4HDEA 1S3CA 1XWKA 4QL7A 3FZ5A 2GDRA 1NHYA 2H71A 3N9JA 3SBCA 3HZ8A 3M1GA 5CRGA 4IJ3A 3HDCA 4MJBA 5D93A 1FAAA 1LJRA 1THXA 1YF0A 4OFNA 4L5LA 2LKUA 3FZAA 2EIRA 2KLXA 4LMWA 3H93A 1K0NA 3FR3A 3DKSA 4Q5FA 3VFIA 5IMZA 4IELA 5ECOB 1QUWA 1XWCA 1M2DA 4KX4A 2OBIA 3TRQA 1ZOFA 2DBCA 2HZEB 2JACA 5CAXA 1GSQA 4ECBA 1QQ2A 4ID0A 1LU4A 2L5OA 3P2AA 3VWVA 5C04A 2YJHA 1BG5A 1YEPA 5IPHA 1SYXA 4K7NA 2E2GA 3MWHA 1UC7A 1YDKA 2PWJA 1XZOA 4MH2A 1RK4A 4E8HA 4ZXGA 5J9BA 1SJIA 4F03A 1ON4A 4IS0A 1Q4JA 2DJ2A 5FHIA 2CZ2A 2HI7A 5DDLA 4XS4A 4MK3A 4XCSA 5GAPD 2FWHA 4ECJA 2MZCA 4JR6A 3QCPA 1FHEA 2WRTA 2E0QA 3EMXA 1EGRA 2C3QA 2WB9A 3KH7A 1DBYA 3HXSA 5DALB 1EGOA 5IM9A 4MJCA 1PMTA 2I1UA 4KGIA 3NOFA 3K8NA 3BCIA 4GRFA 1GWCA 5DQYA 2I4AA 1WJKA 4ECIA 3L9SA 1BYEA 2LS5A 2H6ZA 2LV3A 3ME8A 1QXHA 1G0TA 4MF5A 3IDVA 2C3TA 3HJOA 3VI7A 3TKSE 4F2IA 4WETA 1SL1B 3TJGA 6GSXA 1GTIA 3C7MA 6GSVA 3G7JA 4YQUA 5G5EA 10GSA 1BX9A 2MMAA 1LBKA 4JR4A 1OC3A 2V41A 3DVWA 1WRYA 4J57E 1FO5A 1T00A 3M9JA 3QAWA 4EC0A 2VCVA 1AQXA 2B1KA 2HSYA 4JE1A 3E9JB 4HU7A 4K0NA 2X8CA 3KZQA 2TRCP 5EY6A 3IR4A 5IQYA 1K0OA 3ZREA 5G1KA 3M9KA 3FZ9A 2YWMA 4L8EA 4NAXA 2VLUA 19GSA 2IYJA 3TRPA 5AIXA 3GKNA 4TW5A 1XFLA 1R7HA 5ABRA 1JZDA 1UA5A 4IQ1A 3GA4A 1GSSA 20GSA 4OD7A 1SD9A 5D9WA 1GRXA 2DJ1A 4MA9A 3ERFA 5IPGA 3D21A 5GZZB 1Y25A 2OA7A 3PINA 2C4JA 3LXTA 1DE2A 1AQVA 4WXTA
chains in the Genus database with same CATH superfamily
4L7KA 4J2FA 3CC23 2H72A 3PYJA 2MMZA 1RW1A 3F40A 3I43A 2YPMA 4EC6A 3TUEA 1TJDA 2YZUA 3TDGA 2KP1A 1W6GA 1EEJA 1V58A 3O6TA 4HQZA 3GZBA 3HJPA 1I3FA 1BU4A 2HMKB 3F8UA 1B4QA 5LD0A 3F3QA 2UX0A 3CTGA 1AUCA 3CCR3 2GT5A 2H1AA 4BWQA 2FWEA 1MOLA 3EMPA 2KRTA 4OMVA 1M0UA 3RAZA 4EO3A 1SYRA 3UOMA 2ES7A 3EWLA 1FUTA 4TRXA 1LQGC 4HZ4A 4KB3A 1HZ1A 2IJYA 1VF3A 3FLJA 1I70A 1HNBA 4FQUA 4EDZA 1GTUA 2NTOA 3KD0A 5CRWA 5HOHA 2AJQB 4MLYA 3FZWA 5BXQA 4KE3A 4BL2A 3VWUA 3TKRA 2H75A 1BSEA 5IOXA 3EJVA 4F9ZA 2GZYA 2VLTA 1J0FA 2OADA 2GZPA 4O02B 1U87A 2L5LA 4K1FA 1OC9A 4MZBA 3I563 2FLSA 3EVIA 4BIKA 3FW2A 3UMAA 3DRNA 3CCS3 4IT7A 3LTAA 1JV2B 5H5SA 1OHPA 2P0XA 1FOHA 4LSOA 1EZKA 2RSXA 3FF0A 3QOUA 2R0GA 2PVQA 2P09A 3ROBA 5E4WA 5KN1A 1O81A 3IAM2 4KCAA 2H73A 2GS3A 4V2MA 3ZVJD 1JKGB 3SXXA 3FGYA 2FWFA 4N6NB 5FWGA 4X43A 3TGZA 4V2LA 2WGQA 3HI7A 4BL3A 5IW9A 5D96A 2Z76A 3F0IA 4TXVA 3D5IA 2O87A 1BQ7A 3LXUX 2A2RA 5F0GA 3U5RE 3K9MC 4EV5A 5D83A 4PQ1A 1A8LA 2F3MA 4R4KA 1N8R4 1YKCA 3F8XA 1FB0A 4TKYA 1RMSA 4NV5A 1BNEA 1OPYA 1I8VA 3HX8A 1RN4A 2V1LA 1TOFA 1QVF2 3HVXA 3Q3FA 5D9VA 1TW9A 5CRDA 4HM1B 2YCDA 2DKIA 4HM8B 4WBJA 2ZL8A 4FH8A 1ULIB 2F5WA 4KDXA 1A2PA 1WIKA 2K8VA 3ZRDA 4L5OA 5JCWA 4XBTA 2L57A 3G9BA 2OACA 1HD2A 4J8TA 3N8BA 1D6YA 2BIRA 3FRCA 5C00A 1WMJA 1DSBA 2PVOC 3VWWA 2ML5A 1K3YA 4KSOA 2RIIA 3GH6A 1IDPA 1X1YA 1A2KA 3D6IA 2GEXA 3JUPA 4GSPA 1M2BA 1SK0A 4OFMA 3HHVA 4IJIA 4N10A 3T8NA 2A4HA 2IY2A 3M8CA 5IMAA 4O2HA 1JB2A 3PPUA 3ALAA 5HQPA 1IYYA 2CK3H 4FCJA 5M19A 1G6WA 1T4YA 1V57A 1B21A 3M3MA 4J5GA 4YKGA 2OE1A 1LOVA 4O3VA 2H1BA 3LSZA 2HMLB 4IN0A 2GGTA 1FGRA 3ER7A 1GLQA 1YY7A 4QL9A 2YJ7A 3EC9A 1PN9A 3WHOA 1FW1A 1K0BA 4DSSB 2GSTA 1M9GA 3ZMLA 1OKDA 3OR5A 3ZZXA 3ZITA 2Z77A 4Z2RA 2FGXA 1QGVA 1ZO2A 1KEBA 3CMIA 3BD2A 2YWOA 1O85A 4GLTA 1T2HA 5H5RA 2JZTA 4G0LA 3DH2A 1XCCA 3F4TA 4D73B 4FYUA 1FGQA 3U6VA 1B2SA 1Q40B 17GSA 2DIZA 2IMFA 1JNQA 4G9HA 1ZYNA 1TI3A 2G0FA 2H66A 1UUGB 4NXIA 2H6YA 4EW5A 3GTUA 1YZXA 1HU9A 2QA1A 5G1LA 1L5GB 1I9DA 5HR2A 2CQ9A 4K8MA 4HQSA 3D22A 1ASKA 2BMQB 2L4VA 1BSBA 5INYA 1OHOA 1VQP3 8CHOA 2L4QA 3BCKA 1RGKA 1JJ22 3J7Yk 1HYUA 2RUEA 3U1WA 3KSED 2EC4A 3MDKA 4FIWA 4H61A 4FYCA 3DGNA 2YANA 3BIRA 3A2VA 2CAQA 1IYHA 1IT7A 2TIRA 2FA8A 4HSCX 4LL4B 3GX8A 5CRHA 4ICYA 5D73A 1X9WB 1TDIA 3Q18A 4XM4A 1K3LA 2N5AA 2IUJA 2NVLA 3D4AA 3MKIA 2LJRA 2ZUPA 1OF5B 1TUHA 1Z1SA 4HM5B 2WS2A 3VLNA 3N9HA 2AAEA 3EF8A 3LFLA 2IFQB 3CCM3 4BWSA 4N6TA 1CEWI 1GSYA 1OHSA 3TJFA 2LQVA 1FUSA 3G0KA 2OJLA 2LUSA 1WOUA 1O7NB 2XH9A 3FY7A 1DMQA 5AN1A 2M72A 4GTUA 2HOHA 1F8NA 1K0DA 2IMKA 3W6GA 2LEGA 4G0KA 1AV4A 1OAZA 4J9AA 5CNWA 2VL9A 1WQLB 3FCSB 1OGZA 2CFGA 3UAPA 3WOFB 1H75A 1PKZA 3IE3A 1PN0A 2R0PA 2B5YA 4PTSA 1U88A 1Y6EA 5L71A 3C8EA 1JHBA 4LEHA 4L0WA 1N9EA 18GSA 4IPBA 2WZ9A 4V1Ap 4STDA 4OO4A 5ECQB 3A5WA 1MNLA 1QVG2 1R5PA 2KXGA 1GUMA 1FOVA 1UCIA 2H01A 1TRUA 1VF4A 3I6AA 2UGIA 3GMFA 3KH9A 1VQQA 5AIFA 2HMMB 2GSSA 4BL7B 2IL3A 4WF4A 4X0XA 4IVFA 3V98A 1TK0B 4N6MA 2YFJB 3TB2A 3LJRA 2KOKA 1B27A 4X4JA 1EOGA 2VCQA 4GXZA 3IK7A 2HE3A 4KFFA 3TCOA 4G2EA 3MSZA 1I5GA 4WR4A 3TKSA 5AIVA 3LOYA 5AYRB 1A2MA 1T4ZA 1C72A 3CPOA 1A8YA 1VF2A 5IMCA 4TXOB 3DXOA 4POLA 2F4YA 1WNHA 2LQOA 3ZLPA 2PERA 1VQK3 4TR0A 1ZMAA 1KSIA 4HJLB 4PXOA 3MNGA 3PH9A 1RRLA 3RPPA 1V74A 3MPHA 1A2LA 3WGDA 3KMNA 1W4VA 2VM2A 1DUGA 3N5OA 6GSSA 5F8BA 4RBNA 3U97A 4I6XA 3HVSA 2O7KA 2JSYA 1BEDA 5A4WA 3SOAA 4WR5A 5A5KA 3OXAA 4YH2A 4ACSA 3KM6A 3WDGB 3ZG0A 4ORLA 2B24B 4FCMA 4I2TA 4HOJA 4NV2A 1K8A4 3F6FA 5DCHA 3DD3A 1DE1A 1BUQA 3J7Yd 1SD8A 1JLWA 4POKA 2IMEA 2XEPA 5CP1A 3ZFLA 1F2EA 1B2MA 4JRFA 2M46A 3PS8A 4JEDA 5KP4A 1TIJA 2JZRA 3FH1A 1GH2A 1ST9A 3JVCA 2IN3A 4LLRA 2HZEA 2C8UA 4FR9A 3TOUA 1XOAA 1GOVA 2W6JH 5CF1A 2MBSA 1OYJA 2VCWA 2HMOB 4HM4B 2CVDA 2E2UA 3AMOA 2CX1A 1W89A 2D2ZA 1B9YC 1SQWA 3RGRA 4RQXA 2YX9A 3AHSA 3BNEA 3GSTA 3IAS2 5J5NA 3D5JA 4LL1B 1T2IA 3FMWA 1TFOA 1VF1A 5AIIA 3CSJA 4EDYA 1KQS2 5DVBA 1GUKA 2HRNA 1UI8A 4F0BA 5KP1A 1JBTA 2GTUA 5KEJA 1EV4A 2F51A 2H1GA 2BJXA 1T5YA 1O7HB 1PRXA 2O8VB 5A4UA 1YEXA 2K8SA 4TR1B 2FA4A 5IMVA 2A2SA 1BUJA 3LQ7A 4DEJA 2CHCA 1Q7HA 3DYRA 2PMTA 1SK1A 2A15A 1PYLA 4HZ9B 2K54A 4O5UA 3S27A 3PXMA 4N11A 3UIWA 1WMNA 4TR3A 4ML6A 4DSRA 2XBIA 2ON7A 2W03A 3GZRA 1I2EA 5DALA 1JRQA 4WWUC 3KP9A 1Z7RA 3H3HA 4MEIA 3URPA 1IVXA 2H1DA 1RGGA 1IV9A 3EN8A 3GZYB 2F86B 1EWXA 1W2B2 4OCFA 1GTAA 5KN2A 1ERTA 2B7KA 1KTEA 5AGYA 4RI7A 1MDIA 4QQ7A 1B9XC 4ML1A 1RGFA 1RJOA 5CYYA 3ZVJA 1SL2B 1TU5A 4MZWA 3SEDA 5AEUB 1KD14 4K2XA 3C1RA 3V92A 4CCVA 2K9FA 1JB4A 3KIJA 1PSQA 4AJ8A 1C7HA 4V2NA 5G2ZA 1TI1A 2E7PA 2Z6BA 3MWZA 3LORA 5IG5A 4DSQA 3FYGA 4AKYA 1U6TA 4DVCA 1BRJA 3HZ4A 1PFPA 5DREA 5M18A 2R2JA 6GSWA 2YFLB 1RCLA 3IK9A 1G7OA 1QALA 3EN1B 2QA43 1FB6A 2Y73A 1URMA 4EYCA 4IQAA 4RNZA 3DVXA 4XBYA 3FK8A 2GBWB 1ML6A 3L0HA 1RHLA 3FR6A 3F14A 2W56B 4NREA 4K61A 3RDEA 4IP1A 1EQKA 2L6CA 3FZ4A 2I3YA 4HVNA 2Q07A 2F5MA 5IERA 1Q7Y4 4I8BA 4DKIA 2DKHA 4BPYA 3B4OA 5G30A 3DM8A 3NBJA 3EU3A 1MD4A 2H19A 1BNFA 3CU3A 3GX0A 1FGTA 1U3IA 4KF9A 4TR4A 4X1UA 3ZIJA 5IO2A 4XHMA 1OE8A 2P05A 2LRNA 4PNGA 3LTBA 3F7XA 1A2VA 1SPUA 3X3YA 4V1Ag 3LG6A 1FVJA 1BRKA 1MDKA 3CCQ3 2OOVA 3ZFZA 1R5AA 1BRNL 4KUNA 1TKDB 3S28A 4BVXB 1BGSA 1Q98A 3M0FA 4MMMA 1HYFA 3EQQB 5H5QA 1TU7A 3LH4A 1YJW3 2L1SA 5JPPA 3NBBA 1I2GA 1VZZA 2HNLA 3K7CA 2GSQA 1B2ZA 1RGCA 1GOUA 3FSDA 3DZLA 3ED3A 5B6MA 1O7PB 1M904 1LOXA 4OUQA 5J3RA 2HMJB 1QK8A 3APSA 1H4OA 3KE7A 4O92A 1W01A 1GY6A 4JU5A 3D4MA 2R37A 2Z7AA 1O8WA 3UARA 4KSMA 3I9V2 5ECIB 1SENA 3EB8A 5JCUA 3X41A 4GHOA 1GYBA 3IHGA 2QSIA 3S67A 3TKSC 4EE0A 1J9BA 2YP6A 5IOWA 1YGWA 1AVKA 1RGLA 2V6OA 1YNVX 1TRSA 2QGUA 2CFLA 2AUVA 3SLUA 2AADA 2WGOA 1JLVA 3X3ZA 1TK8B 4I5QA 4IP6A 2OE3A 2CZ3A 2OTJ3 5ID2B 1SJZA 4O5RA 2CFWA 1RGAA 2VIMA 1WP0A 5ELAA 2HRFA 1A0RP 3GL3A 3I553 1JZOA 5ENUA 4TVEA 4O5QA 1AC1A 2XPDA 3KJYA 3Q74A 4OFTA 3PGBA 1LQMB 4IW9A 4J56E 4Q5QA 4ZBBA 3QMXA 2WFCA 3EBTA 1NJI4 4KW6A 3F3RA 4XTSA 1RN1A 2DJ3A 2C1YA 4EXJA 1GNWA 2C10A 5HGRA 3HD5A 1XXUA 4KH7A 3LYGA 1PY3A 4Q5RA 1ZS7A 1UUWB 3CC73 4R9LA 4MJAA 3ZFBA 1JKGA 3APQA 3NX0A 2V6KA 3QAVA 2M7OA 4GSNA 3E0UA 4NHWA 3UVTA 2AHEA 2F9SA 6RNTA 2WGRA 6GSUA 3DWVA 3MG1A 1MDJA 2HFDA 3PCRA 1MGRA 2E2TA 2WO0A 3WGXA 2HRKA 2J9HA 1TRWA 4LA1A 3CNMA 4GQCA 5DJMA 3MG2A 4R80A 2QA2A 1M1K4 2GQMA 2WJUA 4O7HA 1OKTA 1GY5A 5AYSC 2PGTA 3D0ZA 3AGNA 1TTZA 2L4CA 2TRXA 1N5HA 4FMBA 4OK0A 3VF1A 1IU7A 4JRRA 3BBYA 3LW9A 2XFTA 2IPAA 3D9RA 4EF0A 3JUQA 2QGVA 1K0CA 1X0RA 4KDYA 1V2AA 3F7SA 3B7CA 1V98A 1Z3EA 4EUYA 2LNTA 2REMA 2EIOA 3GNJA 3VGNA 1A90A 2YV7A 1NW2A 3P8WA 2CX0A 1BSAA 2VD0A 5EQLA 3CYNA 4HM7B 2VCXA 3C1SA 2B1LA 3GL5A 5D8IA 4BU4A 4AJ6A 1GOYA 2LJAA 1GMPA 3Q2PA 2K6VA 4ZIJA 1VQ63 2VCZA 1WWJA 2CWVA 2C0FA 2WULA 7RNTA 3W8SA 3LMLA 3TJJA 4HZ2A 2C0DA 1AW9A 3LZAA 1A23A 4ZL7A 3QD9A 3LYKA 5ECKB 1XW6A 4XS1A 4XRDA 7GSPA 4MPFA 3GKKA 5B7CA 1MTCA 3HVNA 3DXBA 1LOYA 2C0EA 4MCUA 3K0ZA 2G2QA 3NBRA 2B7JA 3NZNA 1CH0A 4DSSA 2NBSA 3OWSA 2N5FA 1FVKA 8GSSA 1SL0B 1R4WA 2MBTA 4HS1A 2F98A 4K90B 3G16A 1HNAA 5HR0A 1SKWB 4Z7XA 4N6UA 5FW5A 2KP2A 2OKAA 1NU3A 2INXA 4EKZA 1OGXA 4MPGA 2KF4A 4HJMA 14GSA 3VPQA 3BU4A 3DY5A 4D73A 3S29A 4HOHA 3ME7A 1F37A 4EV2A 1TP6A 1ISKA 1Y4KA 1E6BA 2X49A 4WEYA 1ZX2A 4ISDA 3EYTA 3WODG 1BRHA 1EA2A 2CX3A 1OCVA 4ZILA 1SJ6A 1WTHA 2MF7A 1XW9A 2CX4A 3O3TA 3RBTA 4O8SA 4RNYA 2IIYA 3P90A 4N6OB 5DQSA 4ZB6A 1ZYQB 3LTDA 1E97A 2RGQA 5DAKB 5CREA 4WF5A 2B5XA 2JSZA 5A0OB 1LXEA 1AIUA 1Z6NA 5BIRA 1IV7A 3CCJ3 3QR6A 2P31A 2BMRB 4AGSA 3F9UA 5J4UA 4EBGA 4F0CA 1RRHA 2W9PA 1MWTA 3IRAA 1X5CA 3APOA 2L59A 1NM3A 3GFKA 1OF5A 1IVUA 3MYTA 2VD1A 4N0VA 4ZB9A 2F99A 4IKHA 3CQFA 2IFQA 2Y74A 3P7XA 1YIJ3 2JDIH 2YFIB 5CF2A 2LSTA 4O32A 1O7MB 1LRAA 1ERWA 5DRVA 3NM7A 1RGEA 2OE0A 3JCML 2CAIA 1YKAA 1RSNA 1N8JA 3A2WA 1U8CB 1O7UA 3L0RA 3W8JA 1K41A 4X2HA 1CQHA 4PNFA 4K6XA 1X9MB 3PR8A 1K0AA 3QPMA 1N8QA 4POBA 4PX1A 2W2CA 1PX7A 5ELUA 5AIHA 2CG1A 2KHPA 3Q6OA 2OQEA 4ZBDA 4K2DA 3VSYA 3H8QA 3IXRA 3NV0B 4ZBAA 4X2OA 2FD3A 2K18A 2L6DA 3IPZA 2HSHA 3KZTA 5EVHA 3R3EA 3IPTA 3DGLA 4HUAA 3L4NA 2R4IA 2RM6A 3NQYA 2B5EA 1N9JA 1STDA 3L9UA 2H8LA 5HFGA 4BL7A 2MC8A 4MABA 2GEYA 4MH3A 4FYBA 1XVWA 3TJKA 2ZCTA 2JU5A 3QRDA 3WD6A 1YIT3 1E3RA 1YHQ3 2BU4A 1M7TA 3ERGA 2LRCA 1K0MA 1TRVA 2R6KA 1UN2A 1O73A 3WMDA 3QAGA 5LC7A 3GSPA 3WA3A 2VOCA 3I0YA 2LTKA 3CPW2 3H4KA 1ZL9A 7GSSA 5AIGA 2ON5A 1ZGNA 1UI7A 2CA8A 2YV9A 3C71A 4ZL8A 2QEX3 4TXOA 1MGWA 1QAFA 1V40A 2DJJA 3GURA 1A0FA 1PD21 1YJN3 1SU9A 1R26A 4GSSA 4NMUA 3LT9A 4KT3B 1ZYPA 3KTBA 2HYXA 4JBBA 3H79A 3G7YA 2F8FA 4RUVA 1DVDA 4GCIA 22GSA 4OVMA 3VPTA 4CHSA 2AAWA 2IMDA 5B8AA 2RBIA 4PURA 2DJKA 3GHAA 3PCSA 2VM1A 1GTBA 1A24A 5AISA 4EVMA 1IVVA 1ILOA 1TK5B 4BIRA 1BNIA 4L8OA 3GYKA 3C73A 4FMAA 1XBSA 3KFQC 4EIPA 1JN5B 1GLPA 4PUFC 5KN3A 3S9FA 2IWTA 4EXRA 1VQM3 6GSYA 1B4PA 1SK2A 1U3AA 3CME3 3MIXA 1Q864 3NM2A 1Z9HA 5G31A 3CSHA 4EL1A 3FG4A 4POMA 5IMDA 1TFKA 3A5IA 3GUSA 3F9SA 3CCV3 1YF1A 3J7Yb 4HM2B 2RFRA 2X8HA 2RLIA 2JZSA 5IEOA 2LRTA 4WYKB 2O85A 2P5RA 3KKGA 2LJKA 4ULXA 1IYIA 2CG0A 3HYPA 2DJ0A 3WGEA 1YVBI 3BNBA 4E8EA 1NSWA 3KMOA 5JCGA 4BVYA 1PL1A 1BIRA 5D9TA 2DIYA 3F4RA 2C3NA 2R3XA 3DEXA 1EG9B 1GMQA 1DE3A 2V32A 2HT9A 5BMUA 3OWUA 1PL2A 1ABAA 1D6ZA 1GSFA 3LWAA 5COHA 2GQKA 4TOPA 5IEPA 3L9VA 3US3A 3EPTA 1TU8A 3UBKA 2I9HA 5ECHB 3UBLA 4G1MB 4RI6A 2V2GA 3GKMA 3RPNA 1ROAA 3DGMA 5HR1A 3T8UA 3H1NA 4K5SA 2C0GA 2B3SA 4TR1A 3DMLA 1ACVA 1W6YA 1M2AA 3WT2A 1CQSA 1FUWA 3IV4A 1T3BA 2J23A 1RNTA 2MMNA 4KNDA 3HY2A 3AMOB 1HNCA 4MP4A 4PGTA 1FYSA 4AF2A 4K0GA 1AVLA 2B6MA 2SARA 5GSTA 5HFKA 2FUG2 5ECMB 3NUVA 1G02A 2FGTA 3HCZA 3HJMA 1JBSA 1GP1A 2BMXA 3FR9A 1EOHA 4MZCA 1ERVA 1I0VA 2YN1A 5LCZA 1VQ53 4KA0A 2CWTA 1B2XA 1Q814 4K7OA 4I97A 2YZHA 3TKPA 2VO4A 3AY8A 4GWRA 1X1WA 4XDVA 1AAZA 5ECNB 2CWUA 2GSRA 1OUNA 1YJ93 1FZUA 3A2XA 4IGJA 2YNXA 3F63A 2K3DA 2KF6A 2YWNA 2GBXB 1X1UA 3T0UA 4XS4B 3GH9A 1Q824 3HKRA 3NQZA 4ZL9A 1BJXA 4L8PA 1U5OA 1S5AA 1BSDA 3F6DA 3IMAB 4Q5NA 4CJNA 1DYUA 2W04A 2HRAA 5D9XA 2NDOA 9GSSA 1MEKA 1OE7A 4HI7A 2O9UX 2PZVA 3GZXB 5J9CA 2DMMA 3BOAA 3HA9A 2VUPA 2W56A 1BRSA 4P3YB 4ILFA 4OCEA 2H30A 3EC3A 4XS6A 4MJEA 3RHCA 1LNHA 2GLRA 2AYTA 5B6NA 3TJBA 4G19A 3ERWA 1T7PB 3BLZA 2RM5A 4K9ZA 1D6UA 1XWBA 2D42A 2IMJA 3HOHA 1PA3A 2M80A 3LXZA 1W7CA 3O76A 5F06A 1ZZYA 3MSOA 11GSA 4YAPA 2H0HA 2VL3A 4OO5A 2XR8B 4YQMA 1J08A 1YVSA 3UB1A 3V1WA 4KFDA 1BAYA 2CFDA 2LNSA 3EURA 3AHWA 2FCHA 2OBKA 2NPBA 3CSIA 1IQ8A 4IHUA 4XIHA 3VK9A 1F9MA 1F3AA 1YJ6A 3HVVA 5EEOA 1X9SB 3OX9A 5DJLA 4BVXA 2OQEC 4G10A 1BOXA 4KDUA 1PKWA 2DC5A 3IHQA 1M9AA 1GD3A 1NB5I 1KNGA 2PU9C 1G7EA 1OVNA 4JZQA 3NIVA 4J5KA 3UVHA 3KIIA 2XPEA 4NWYA 3SYUA 3DIEA 3GAXA 1V9WA 2R41A 2XHFA 1GUHA 9RNTA 3EINA 3EE1A 3CMA3 1CYVA 3WR2A 2F8AA 4NHZA 2FHEA 4MJDA 2VAFA 5HR3A 3GKXA 4QWTA 1IK3A 2XF3A 1UCKA 3ZG5A 3WYWA 5D81A 4LZIA 3KSPA 2P5QA 3S5CA 3RDWA 3FG3A 5IIZA 3D4TA 2CH9A 2IA7A 2KUCA 2ML6A 2YOIA 4HM3B 16GSA 3LYPA 1AR0A 1EP8A 1QFNA 1K734 4ZB8A 4LMVA 1FW7A 2GQLA 3CC43 1EKMA 2ZHXB 3A76A 5JWRB 5ECSA 5ID2A 4H86A 1QJGA 4K1VA 4WBRD 1SJWA 2RUFA 4XRAA 3MG3A 2XSOB 1FGOA 2RNTA 2XC2A 3GN3A 4HU9A 1LNIA 3RHBA 3JUMA 1F3BA 1O6JA 1T1VA 3HIIA 1SIIA 2FNOA 5IENA 5TGNA 1GSDA 4HJ2A 2WCIA 2VCTA 1SIHA 3K5TA 3D5GA 2CVKA 4YKFA 3KCHA 2FY6A 5GSSA 2W0QA 1O7GB 1JZRA 5JWQB 2H76A 1JZWA 1XWGA 1MD3A 3CBUA 3ZTLA 3SX1A 2BTOT 3RGAA 2E2MA 3UJMA 1NDOB 1S3DA 1I0XA 5EL8A 4N30A 4YQVA 3PZWA 5JPUA 3IBHA 3HZPA 1UGIA 1VGLA 2VL2A 4PQIA 5EVOA 5KN0A 4OWYA 2E2VA 2STDA 1YQ1A 3FG1A 3GRDA 1PQNA 3GRXA 5CO3A 1RKYA 1AQWA 1EEMA 1Z5YE 4TX4A 2ZNMA 3DGYA 3LGCA 4TN8A 1M99A 3TOTA 3KEBA 5IG0A 1OC8A 3UEMA 3IC4A 4PEJA 1PGTA 1OC9B 1ZYEA 4FO5A 5IMFA 2FWGA 1B8XA 1NWWA 2PN8A 2PUKC 4FMDA 3ZYWA 3LEFA 3QFAC 2QKEA 4GQFA 3TRXA 1IVWA 5B8BA 1EP7A 4NHFA 2XBQA 4HBRA 2R5GA 2VLVA 1UVZA 4PUAA 1W02A 5ECRB 2HMNB 1VRSD 1XIYA 3L78A 4Z2UA 1I3IA 2DLXA 2CT6A 1F6MC 1G96A 3BB9A 1JB5A 3UJ1A 3VURA 4MMXB 3X3XA 1VQN3 4I4KA 1VQ83 1UUVB 3JUNA 1VQO3 4RQRA 2LQQA 4N0ZA 1GNEA 1XVQA 1B3SA 2ALBA 3EU4A 5E59A 1N5PA 2JADA 1QAKA 4LYLB 3DUKA 1HQOA 1QMVA 5CK6A 1M3JA 3G8ZA 2AB6A 2H70A 5HFIA 3GSSA 4MDCA 1OH0A 5IO0A 3KCMA 1R4CA 2JL4A 3Q90A 3KP8A 4WHAA 1RCKA 1BSCA 3R2QA 5GAND 3GWRA 1A2JA 2H0IA 3RNTA 1BANA 3ZL5A 3MYDA 4EIQA 1ERUA 2KAAA 1GD4A 1B20A 3KTLA 4JF8A 3GIXA 1THOA 3Q19A 2R4VA 3FEUA 5GSPA 5ELJA 1GSUA 2V1MA 3E99A 3K63A 4KAEA 4MF7A 4Z2TA 2C80A 4CPKA 2GU3A 2D1WA 5JBSA 6GSTA 2CFKA 2H6XA 8RNTA 2Z9SA 1PX6A 4F82A 5DBQA 3WT1A 1O8XA 1W5ZA 1DMMA 3E3EA 4BA7A 2A2PA 4K7IA 3F4SA 1Q40A 2CC3A 4CY6A 3MAKA 3EE2A 4I2UA 2HZFA 1X5EA 1A67A 5DAKA 1NB3I 4N6V0 3X42A 1G6YA 1XOBA 2CVBA 5LNKe 2PPTA 2H0GA 2K0MA 1RQMA 4CW9A 2C11A 1OACA 3O8YA 12GSA 1WPIA 2CKFB 3BJ5A 4BTWA 2BT3A 1R4YA 1B48A 4N3VA 13GSA 2QIYA 1N2AA 3M8NA 3VWXA 2X8GA 3HIGA 5DCGA 1W4NA 4GF0A 3WOEB 1GS3A 1KBNA 2DMLA 2WDUA 1SKSB 1LVNA 1K3OA 2WOFA 2O89A 1XPVA 3CCU3 1GL8A 5F05A 3G7IA 1RNBA 1EV9A 4KFEA 4IBPA 2CW9A 5EPFA 3GTUB 5AI1A 4AJ7A 1TTOA 3DGOA 3HK4A 2EIQA 5JWOB 3GV1A 3V99A 1ULJB 2BMOB 2XRXB 3VI5A 1Z7PA 1STFI 1X5DA 3G6E3 1RGHA 2OOVC 2X4AA 1UGHI 2GSPA 3KGKA 1O7WB 3NV0A 2QC7A 5IG3A 4NPBA 1SARA 4L0UA 1VQ73 2HXKA 2OWPA 3FHKA 4A5PA 3CXGA 2KF3A 5FT3A 4KCEA 1GSEA 3DMCA 4H3UA 3UL3A 2DSAA 1KC84 2BO9B 4BTXA 3F8HA 4WFOA 1S3AA 1YI23 2GT6A 2P38A 2B1XB 4MF6A 2A4VA 2N5BA 2IMIA 2KCDA 5BVBA 1S3RA 3IJEB 3DGQA 4XDWA 3ISOA 1AY7A 1WMPA 5ECLB 4HEA2 1NHOA 2BHMA 1T8EB 1WE0A 3ZMKA 1BAOA 1Z6MA 1IT8A 3CXC2 1BVIA 2J8XB 1ZCPA 3CCL3 3FKFA 4PQHA 2AV4A 2MMOA 1RDSA 2XSHB 5IG4A 1NO3A 1XW5A 2PNCA 3STDA 3CTFA 2P0MA 3CRTA 5F07A 1ZGXA 2LYXA 2MYGA 1MWSA 2XGLA 3CCE3 5I97A 3Q1CA 1FG4A 4R1KA 3CRUA 1JFUA 1JBRA 3I69A 2BNGA 3QDNA 5ECPB 2X64A 5J41A 1GULA 2W9QA 1M9BA 1TXXA 3KXOA 1X1XA 5ELGA 3PGTA 3A3TA 2I81A 2YWIA 6GSPA 2XFSA 1E2YA 2PBJA 2UUGC 1IQXA 1AXDA 4GSTA 5G5FA 4ECCA 2O3OA 2GZZA 1JN5A 1UCJA 2CV4A 2X99A 1RTUA 5G2GA 3ZIVA 1PU4A 1TP9A 4CDOA 2HLSA 1XWAA 3TKQA 1DETA 3OWYA 3SWLA 4YAVA 1CQGA 2VL2C 2GVPA 1SKRB 1USBA 1M1XB 3QFBC 2GU1A 2H74A 5A4VA 4WKWA 3NXJA 3IA1A 3IOSA 1UDII 2P0GA 2OCTA 3CD63 4HDEA 2I9WA 1WMOA 1IQYA 1S3CA 1XWKA 4QL7A 3FZ5A 2GDRA 1W00A 1NHYA 2H71A 4WYKA 5D82A 1VQL3 3N9JA 3SBCA 5KP3A 1VQ43 4GL6A 3HZ8A 1XG8A 3M1GA 1BRIA 5CRGA 4IJ3A 1DMNA 3HDCA 4MJBA 5D93A 1FAAA 1LJRA 1THXA 1YF0A 4OFNA 4L5LA 1Q9EA 4HYZA 1BNGA 4CDLA 2UZ8A 3EBYA 4R9KA 3EHCA 2LKUA 5FGOA 3FZAA 4MMZB 1KWIA 2EIRA 4ZM8A 1TRPA 2KLXA 4LMWA 4N6LA 3H93A 1K0NA 3B4PA 1BNJA 3FR3A 3DKSA 1AQZA 4Q5FA 2HSMA 3VFIA 5IMZA 2IUKA 4IELA 1FGMA 1MWRA 1RLSA 1BRGA 1QUWA 5ECOB 1US1A 2ZDJA 1XWCA 1M2DA 4KX4A 1C54A 2OBIA 3TRQA 1ZOFA 1Q42A 2DBCA 2HZEB 4XBXA 2JACA 2CIUA 5CAXA 1UW1A 1GSQA 5CXOA 4CY8A 4ECBA 4FCZA 4AKZA 1QQ2A 4ID0A 2C4BA 1LU4A 2L5OA 3P2AA 3VWVA 3H51A 4BVYB 2FXTA 2YJHA 4LMIA 5C04A 1BG5A 1TRQA 1YEPA 2WOHA 1BNRA 1RN7A 4FMCA 5IPHA 1SYXA 4K7NA 3NHXA 2E2GA 3MWHA 1UC7A 1YDKA 2R0CA 2PWJA 1XZOA 1B2UA 4MH2A 2F56A 1RK4A 4E8HA 4ZXGA 5J9BA 4USSA 1SJIA 4F03A 1ON4A 4IS0A 3BNDA 3LT8A 1Q4JA 5BRTA 2DJ2A 5FHIA 2CZ2A 2SBLA 2HI7A 4XS4A 4MK3A 1VQ93 4XCSA 5DDLA 3UNLA 5GAPD 3OW22 1GMRA 1GSPA 2FWHA 4ECJA 2MZCA 3D79A 3N54B 4JR6A 5KOWA 3QCPA 1FHEA 2WRTA 2E0QA 1W2ZA 2FNQA 1K9M4 5IF6A 1I2FA 1EUIC 3EMXA 6STDA 2RCDA 1EGRA 4KVHA 2C3QA 2WB9A 3KH7A 3D3LA 1DBYA 3HXSA 5DALB 3OV4A 1EGOA 4XB5A 5IM9A 4MJCA 1PMTA 2I1UA 3MHEA 4AEQA 4K5RA 4KGIA 3LTCA 4HM6B 3NOFA 1PFOA 3K8NA 3BCIA 4GRFA 1S723 1HKXA 3JUOA 2OTL3 1GWCA 5DQYA 4BTYA 2I4AA 1ROVA 5LC6A 1WJKA 5RNTA 4HKVB 4ECIA 3L9SA 4G0IA 1DVCA 1BYEA 4MMYB 5M1AA 2LS5A 2KF5A 4RZMA 2H6ZA 1NNVA 3WA2X 4HM0B 2LV3A 3ME8A 1QXHA 3X40A 1G0TA 4MF5A 3IC8A 3IDVA 1YGEA 4KZ1A 3B8LA 1E3VA 3ECFA 2C3TA 3G713 1QMAA 3HJOA 3VI7A 3TKSE 4F2IA 2ZA4A 3KN4A 4WETA 3UL6A 1SL1B 1FA3A 3TJGA 5CLKA 6GSXA 1GTIA 3C7MA 6GSVA 3G7JA 4HAAA 1K28A 4YQUA 5BU4A 5G5EA 10GSA 1UCLA 1CYUA 1BX9A 2MMAA 1LBKA 4JR4A 4U13A 1OC3A 2V41A 5KOXA 3DVWA 1WRYA 3EX9A 1GY7A 4J57E 4HZBB 1FO5A 3CNXA 1T00A 3M9JA 4WP5A 3QAWA 4EC0A 2VCVA 3AGOA 1AQXA 2B1KA 2HSYA 3FF2A 4JE1A 3E9JB 4HU7A 1W6CA 4K0NA 2X8CA 3KZQA 2TRCP 5EY6A 3G4S3 3IR4A 5IQYA 1K0OA 3ZREA 2XGNA 4Q53A 5G1KA 3M9KA 3FZ9A 4RNTA 5STDA 2YWMA 4K1UA 1LOWA 1BNSA 1J2BA 4LGQA 4L8EA 4NAXA 2VLUA 3QK9A 19GSA 4MNNA 1MWUA 2IYJA 3SVAA 3TRPA 3SOYA 3BNCA 5AIXA 5AEWB 2JQ5A 3A5EA 3GKNA 4TW5A 4IIAA 2GXFA 1XFLA 7STDA 1R7HA 5ABRA 1JZDA 4GB5A 1UA5A 4IQ1A 3GA4A 1GSSA 20GSA 4OD7A 1SD9A 5D9WA 1GRXA 3UL5A 2DJ1A 3ERFA 4MA9A 5IPGA 1M3IA 3D21A 5GZZB 1Y25A 2OA7A 3PINA 3FKAA 2C4JA 3LXTA 1DE2A 1AQVA 4WXTA
chains in the Genus database with same CATH topology
4J2FA 2H72A 2MMZA 1RW1A 3I43A 2YPMA 3TUEA 1TJDA 2YZUA 3TDGA 2KP1A 1EEJA 1V58A 3O6TA 4HQZA 3HJPA 3F8UA 1B4QA 5LD0A 3F3QA 3CTGA 1AUCA 2GT5A 2H1AA 4BWQA 2FWEA 3EMPA 4OMVA 3RAZA 1M0UA 4EO3A 1SYRA 3UOMA 2ES7A 3EWLA 4TRXA 4HZ4A 4KB3A 2IJYA 1VF3A 1HNBA 4FQUA 4EDZA 1GTUA 2NTOA 3KD0A 5CRWA 2AJQB 4MLYA 4KE3A 3VWUA 3TKRA 2H75A 5IOXA 4F9ZA 2GZYA 2VLTA 1J0FA 2OADA 2GZPA 1U87A 2L5LA 4K1FA 1OC9A 4MZBA 2FLSA 3EVIA 3FW2A 3UMAA 3DRNA 5H5SA 1FOHA 1EZKA 3QOUA 2R0GA 2PVQA 5E4WA 5KN1A 1O81A 3IAM2 4KCAA 2H73A 2GS3A 4V2MA 3ZVJD 2FWFA 5FWGA 4X43A 3TGZA 4V2LA 5D96A 3F0IA 4TXVA 2O87A 1BQ7A 2A2RA 5F0GA 3U5RE 4PQ1A 1A8LA 2F3MA 1YKCA 1FB0A 4TKYA 4NV5A 1TOFA 3HVXA 5D9VA 1TW9A 5CRDA 2YCDA 2DKIA 4WBJA 4FH8A 4KDXA 1WIKA 2K8VA 3ZRDA 4L5OA 5JCWA 2L57A 3G9BA 2OACA 1HD2A 3FRCA 5C00A 1WMJA 1DSBA 2PVOC 3VWWA 1K3YA 4KSOA 2RIIA 3GH6A 3D6IA 1M2BA 4OFMA 1SK0A 3HHVA 4IJIA 4N10A 2A4HA 2IY2A 5IMAA 3PPUA 5HQPA 1G6WA 1T4YA 1V57A 3M3MA 4YKGA 2OE1A 2H1BA 3LSZA 4IN0A 2GGTA 1GLQA 1YY7A 4QL9A 2YJ7A 1PN9A 1FW1A 1K0BA 4DSSB 2GSTA 3ZMLA 1OKDA 3OR5A 3ZZXA 3ZITA 4Z2RA 2FGXA 1QGVA 1KEBA 3CMIA 3BD2A 2YWOA 1O85A 4GLTA 5H5RA 2JZTA 4G0LA 3F4TA 1XCCA 4D73B 4FYUA 3U6VA 17GSA 2DIZA 2IMFA 4G9HA 1ZYNA 1TI3A 2G0FA 2H66A 4NXIA 2H6YA 3GTUA 1YZXA 2QA1A 5G1LA 1I9DA 5HR2A 2CQ9A 4K8MA 4HQSA 3D22A 5INYA 2L4QA 3BCKA 3J7Yk 1HYUA 2RUEA 2EC4A 3MDKA 4FIWA 4FYCA 2YANA 3A2VA 2CAQA 1IYHA 2TIRA 2FA8A 4LL4B 3GX8A 5CRHA 4ICYA 5D73A 1X9WB 1TDIA 3Q18A 1K3LA 2N5AA 2NVLA 2LJRA 2ZUPA 3VLNA 2WS2A 3LFLA 2IFQB 4BWSA 1GSYA 3TJFA 2OJLA 2LUSA 1WOUA 3FY7A 5AN1A 2M72A 4GTUA 1K0DA 2IMKA 3W6GA 2LEGA 4G0KA 1OAZA 5CNWA 2VL9A 3UAPA 1H75A 1PKZA 3IE3A 1PN0A 2R0PA 2B5YA 4PTSA 1U88A 1Y6EA 5L71A 3C8EA 1JHBA 4L0WA 18GSA 2WZ9A 4V1Ap 4OO4A 5ECQB 3A5WA 1R5PA 1GUMA 1FOVA 2H01A 1TRUA 1VF4A 3I6AA 3GMFA 3KH9A 2GSSA 4BL7B 2IL3A 4WF4A 4X0XA 4IVFA 1TK0B 3TB2A 3LJRA 2KOKA 4X4JA 1EOGA 2VCQA 4GXZA 3IK7A 2HE3A 3TCOA 4G2EA 3MSZA 1I5GA 4WR4A 3TKSA 5AIVA 1T4ZA 1A2MA 1C72A 1A8YA 1VF2A 5IMCA 4TXOB 4POLA 2LQOA 3ZLPA 2PERA 4TR0A 1ZMAA 4PXOA 3MNGA 3PH9A 3RPPA 1A2LA 3WGDA 3KMNA 1W4VA 2VM2A 1DUGA 3N5OA 6GSSA 5F8BA 4I6XA 3HVSA 2O7KA 2JSYA 1BEDA 5A4WA 4WR5A 5A5KA 4YH2A 4ACSA 3KM6A 4I2TA 4HOJA 4NV2A 3F6FA 5DCHA 3DD3A 1DE1A 1SD8A 1JLWA 4POKA 2IMEA 5CP1A 3ZFLA 1F2EA 2M46A 4JEDA 2JZRA 1GH2A 1ST9A 2IN3A 4LLRA 2HZEA 2C8UA 3TOUA 1XOAA 2MBSA 1OYJA 2VCWA 2CVDA 1W89A 2D2ZA 1B9YC 4RQXA 5J5NA 3GSTA 3IAS2 3D5JA 4LL1B 3FMWA 1VF1A 3CSJA 4EDYA 5DVBA 1GUKA 2HRNA 4F0BA 2GTUA 5KEJA 1EV4A 2F51A 2H1GA 2BJXA 1PRXA 2O8VB 5A4UA 1YEXA 2K8SA 4TR1B 2FA4A 5IMVA 2A2SA 3LQ7A 4DEJA 3DYRA 2PMTA 1SK1A 4O5UA 4N11A 3UIWA 4TR3A 4ML6A 4DSRA 2XBIA 2ON7A 5DALA 3KP9A 1Z7RA 2H1DA 1EWXA 4OCFA 1GTAA 5KN2A 1ERTA 2B7KA 1KTEA 5AGYA 4RI7A 1MDIA 4QQ7A 1B9XC 4ML1A 5CYYA 3ZVJA 1SL2B 4MZWA 4K2XA 3C1RA 2K9FA 3KIJA 1PSQA 4AJ8A 4V2NA 5G2ZA 1TI1A 2E7PA 3LORA 4DSQA 3FYGA 1U6TA 4DVCA 3HZ4A 2R2JA 6GSWA 3IK9A 1G7OA 1FB6A 1URMA 4IQAA 3DVXA 3FK8A 1ML6A 3L0HA 3FR6A 4IP1A 2L6CA 3FZ4A 2I3YA 4I8BA 2DKHA 4BPYA 5G30A 3EU3A 1MD4A 2H19A 3GX0A 4TR4A 1U3IA 4KF9A 4X1UA 3ZIJA 5IO2A 4XHMA 1OE8A 2LRNA 4PNGA 4V1Ag 3LG6A 1FVJA 1MDKA 1R5AA 4KUNA 1TKDB 4BVXB 1Q98A 3M0FA 4MMMA 5H5QA 1TU7A 2HNLA 2GSQA 3ED3A 5B6MA 5J3RA 1QK8A 3APSA 1H4OA 4O92A 4JU5A 3D4MA 2R37A 1O8WA 3UARA 4KSMA 3I9V2 5ECIB 1SENA 5JCUA 3IHGA 2QSIA 3TKSC 4EE0A 1J9BA 2YP6A 5IOWA 2V6OA 1TRSA 2AUVA 1JLVA 1TK8B 4I5QA 4IP6A 2OE3A 2CZ3A 5ID2B 1SJZA 4O5RA 2VIMA 1WP0A 5ELAA 2HRFA 1A0RP 3GL3A 1JZOA 5ENUA 4TVEA 4O5QA 1AC1A 2XPDA 3KJYA 3Q74A 4OFTA 4IW9A 4J56E 4Q5QA 4ZBBA 3QMXA 2WFCA 4KW6A 3F3RA 4XTSA 2DJ3A 2C1YA 4EXJA 1GNWA 3HD5A 1XXUA 4KH7A 4Q5RA 4MJAA 3ZFBA 3APQA 2V6KA 3QAVA 4GSNA 4NHWA 3E0UA 3UVTA 2AHEA 2F9SA 2WGRA 6GSUA 3DWVA 1MDJA 2HFDA 3WGXA 2HRKA 2J9HA 1TRWA 4LA1A 4GQCA 5DJMA 2QA2A 2GQMA 2WJUA 4O7HA 1OKTA 2PGTA 3D0ZA 1TTZA 2L4CA 2TRXA 4JRRA 3BBYA 3LW9A 2IPAA 4EF0A 2QGVA 1K0CA 1X0RA 4KDYA 1V2AA 1V98A 1Z3EA 4EUYA 2LNTA 2REMA 2EIOA 3GNJA 2YV7A 1NW2A 3P8WA 2VD0A 3CYNA 2VCXA 3C1SA 2B1LA 3GL5A 5D8IA 4AJ6A 2LJAA 2K6VA 4ZIJA 2VCZA 1WWJA 2C0FA 2WULA 3W8SA 3TJJA 4HZ2A 2C0DA 1AW9A 1A23A 4ZL7A 3QD9A 3LYKA 5ECKB 1XW6A 4XS1A 4XRDA 4MPFA 3GKKA 5B7CA 1MTCA 3DXBA 2C0EA 4MCUA 2G2QA 2B7JA 4DSSA 3NZNA 2NBSA 2N5FA 1FVKA 8GSSA 1SL0B 1R4WA 2MBTA 4HS1A 5HR0A 1HNAA 1SKWB 4Z7XA 2KP2A 2OKAA 4EKZA 4MPGA 4HJMA 14GSA 3VPQA 4D73A 3ME7A 1F37A 1E6BA 2X49A 4WEYA 4ISDA 3EYTA 2CX3A 4ZILA 1SJ6A 1XW9A 2CX4A 3O3TA 3RBTA 2IIYA 3P90A 5DQSA 4ZB6A 1ZYQB 5DAKB 5CREA 4WF5A 2B5XA 2JSZA 1AIUA 1Z6NA 3QR6A 2P31A 4AGSA 3F9UA 5J4UA 4F0CA 3IRAA 1X5CA 3APOA 2L59A 1NM3A 3GFKA 4ZB9A 2VD1A 4N0VA 4IKHA 2IFQA 3P7XA 2LSTA 4O32A 1ERWA 3JCML 2OE0A 2CAIA 1YKAA 1N8JA 3A2WA 1O7UA 3W8JA 1CQHA 4PNFA 4K6XA 1X9MB 3PR8A 1K0AA 3QPMA 4POBA 4PX1A 1PX7A 2KHPA 3Q6OA 4ZBDA 4K2DA 3H8QA 3IXRA 4ZBAA 2FD3A 2K18A 2L6DA 3IPZA 2HSHA 3R3EA 4HUAA 3L4NA 2RM6A 2B5EA 3L9UA 2H8LA 5HFGA 4BL7A 4MABA 4MH3A 4FYBA 1XVWA 3TJKA 2ZCTA 2JU5A 3WD6A 1M7TA 3ERGA 2LRCA 1K0MA 1TRVA 2R6KA 1UN2A 1O73A 3QAGA 2VOCA 2LTKA 3H4KA 1ZL9A 7GSSA 2ON5A 1ZGNA 2CA8A 2YV9A 3C71A 4ZL8A 4TXOA 1V40A 2DJJA 3GURA 1A0FA 1PD21 1SU9A 1R26A 4GSSA 4NMUA 1ZYPA 3KTBA 2HYXA 4JBBA 3H79A 3G7YA 2F8FA 4RUVA 4GCIA 22GSA 3VPTA 4CHSA 2AAWA 2IMDA 5B8AA 4PURA 2DJKA 3GHAA 2VM1A 1GTBA 1A24A 5AISA 4EVMA 1ILOA 1TK5B 3GYKA 3C73A 1XBSA 4EIPA 1GLPA 4PUFC 5KN3A 3S9FA 2IWTA 6GSYA 1B4PA 1SK2A 1U3AA 3MIXA 1Z9HA 5G31A 3CSHA 4EL1A 4POMA 5IMDA 3A5IA 3GUSA 1YF1A 3J7Yb 2X8HA 2RLIA 2JZSA 2LRTA 2O85A 2P5RA 2LJKA 4ULXA 1IYIA 3HYPA 2DJ0A 3WGEA 4E8EA 1NSWA 3KMOA 5JCGA 4BVYA 1PL1A 5D9TA 2DIYA 3F4RA 2C3NA 2R3XA 3DEXA 2V32A 2HT9A 5BMUA 1PL2A 1ABAA 1GSFA 3LWAA 5COHA 2GQKA 4TOPA 3L9VA 3US3A 3EPTA 1TU8A 3UBKA 2I9HA 5ECHB 3UBLA 4RI6A 2V2GA 3GKMA 3RPNA 5HR1A 3H1NA 4K5SA 2C0GA 2B3SA 4TR1A 3DMLA 1ACVA 1M2AA 3WT2A 3IV4A 1T3BA 2J23A 2MMNA 4KNDA 3HY2A 1HNCA 4MP4A 4PGTA 4AF2A 4K0GA 2B6MA 5GSTA 5HFKA 2FUG2 5ECMB 3HCZA 3HJMA 1GP1A 2BMXA 3FR9A 1EOHA 4MZCA 1ERVA 2YN1A 5LCZA 4KA0A 4K7OA 4I97A 2YZHA 3TKPA 2VO4A 3AY8A 4GWRA 1AAZA 5ECNB 2GSRA 4IGJA 3A2XA 2YNXA 3F63A 2YWNA 4XS4B 3GH9A 3HKRA 4ZL9A 1BJXA 4Q5NA 3F6DA 2HRAA 5D9XA 2NDOA 9GSSA 1MEKA 1OE7A 4HI7A 5J9CA 2DMMA 3BOAA 3HA9A 2VUPA 4P3YB 4ILFA 4OCEA 2H30A 3EC3A 4XS6A 4MJEA 3RHCA 2GLRA 2AYTA 5B6NA 3TJBA 4G19A 3ERWA 1T7PB 2RM5A 4K9ZA 1XWBA 3LXZA 2M80A 1PA3A 3O76A 5F06A 1ZZYA 11GSA 4YAPA 2H0HA 2VL3A 4OO5A 4YQMA 1J08A 3V1WA 1BAYA 2LNSA 3EURA 2FCHA 2OBKA 2NPBA 3CSIA 4IHUA 4XIHA 3VK9A 1F9MA 1F3AA 1YJ6A 3HVVA 1X9SB 5DJLA 4BVXA 4G10A 4KDUA 1PKWA 2DC5A 3IHQA 1M9AA 1G7EA 1KNGA 2PU9C 1OVNA 4JZQA 3NIVA 3UVHA 4NWYA 2XPEA 3DIEA 1V9WA 2XHFA 1GUHA 3EINA 2F8AA 4NHZA 2FHEA 2VAFA 5HR3A 3GKXA 3WYWA 2P5QA 3RDWA 5IIZA 3D4TA 2KUCA 2YOIA 16GSA 3LYPA 1EP8A 1QFNA 4ZB8A 4LMVA 2GQLA 5JWRB 5ECSA 5ID2A 4H86A 4WBRD 2RUFA 4XRAA 2XC2A 3GN3A 4HU9A 3RHBA 1O6JA 1F3BA 1T1VA 2FNOA 1GSDA 4HJ2A 2WCIA 2VCTA 2CVKA 4YKFA 2FY6A 5GSSA 1JZRA 5JWQB 2H76A 1JZWA 1XWGA 1MD3A 3CBUA 3ZTLA 2BTOT 2E2MA 1S3DA 5EL8A 4N30A 4YQVA 3IBHA 1VGLA 2VL2A 4PQIA 5EVOA 5KN0A 4OWYA 1YQ1A 1PQNA 3GRXA 5CO3A 1AQWA 1EEMA 1Z5YE 2ZNMA 3LGCA 4TN8A 1M99A 3TOTA 3KEBA 1OC8A 3UEMA 3IC4A 1PGTA 1OC9B 1ZYEA 4FO5A 5IMFA 2FWGA 1B8XA 2PN8A 2PUKC 3ZYWA 3LEFA 3QFAC 2QKEA 4GQFA 3TRXA 5B8BA 1EP7A 2XBQA 2R5GA 2VLVA 1UVZA 4PUAA 5ECRB 1VRSD 1XIYA 3L78A 4Z2UA 2DLXA 2CT6A 1F6MC 3UJ1A 3VURA 4RQRA 2LQQA 4N0ZA 1GNEA 1XVQA 2ALBA 3EU4A 5E59A 2JADA 1HQOA 1QMVA 2AB6A 2H70A 5HFIA 3GSSA 4MDCA 5IO0A 3KCMA 2JL4A 3KP8A 3R2QA 5GAND 1A2JA 2H0IA 3ZL5A 3MYDA 4EIQA 1ERUA 3KTLA 3GIXA 1THOA 3Q19A 2R4VA 3FEUA 1GSUA 2V1MA 4MF7A 4Z2TA 4KAEA 2C80A 6GSTA 2H6XA 2Z9SA 1PX6A 4F82A 5DBQA 3WT1A 1O8XA 3E3EA 4BA7A 2A2PA 4K7IA 3F4SA 4CY6A 3MAKA 3EE2A 4I2UA 2HZFA 1X5EA 5DAKA 1G6YA 1XOBA 2CVBA 5LNKe 2PPTA 2H0GA 1RQMA 4CW9A 12GSA 1WPIA 3BJ5A 1B48A 13GSA 1N2AA 3M8NA 3VWXA 2X8GA 5DCGA 4GF0A 1KBNA 2DMLA 2WDUA 1SKSB 1K3OA 2O89A 1XPVA 1GL8A 5F05A 3G7IA 1EV9A 4IBPA 5EPFA 3GTUB 4AJ7A 2EIQA 5JWOB 3GV1A 3VI5A 1Z7PA 1X5DA 2X4AA 3KGKA 2QC7A 4NPBA 4L0UA 2HXKA 3FHKA 4A5PA 3CXGA 5FT3A 4KCEA 1GSEA 3UL3A 2DSAA 1S3AA 2GT6A 4MF6A 2A4VA 2N5BA 2IMIA 3DGQA 3ISOA 5ECLB 4HEA2 1NHOA 1T8EB 1WE0A 3ZMKA 1Z6MA 1ZCPA 3FKFA 4PQHA 2AV4A 2MMOA 1XW5A 3CTFA 3CRTA 5F07A 2MYGA 1FG4A 3CRUA 1JFUA 3I69A 3QDNA 5ECPB 2X64A 5J41A 1GULA 1M9BA 1TXXA 3KXOA 5ELGA 3PGTA 3A3TA 2I81A 2YWIA 1E2YA 2PBJA 1AXDA 4GSTA 5G5FA 4ECCA 2GZZA 2CV4A 2X99A 3ZIVA 1TP9A 4CDOA 2HLSA 1XWAA 3TKQA 3SWLA 4YAVA 1CQGA 2VL2C 2GVPA 1SKRB 1USBA 3QFBC 2H74A 5A4VA 4WKWA 3IA1A 3IOSA 2P0GA 4HDEA 1S3CA 1XWKA 4QL7A 3FZ5A 2GDRA 1NHYA 2H71A 3N9JA 3SBCA 3HZ8A 3M1GA 5CRGA 4IJ3A 3HDCA 4MJBA 5D93A 1FAAA 1LJRA 1THXA 1YF0A 4OFNA 4L5LA 2UZ8A 2LKUA 3FZAA 2EIRA 2KLXA 4LMWA 3H93A 1K0NA 3FR3A 3DKSA 4Q5FA 2HSMA 3VFIA 5IMZA 4IELA 5ECOB 1QUWA 1XWCA 1M2DA 4KX4A 2OBIA 3TRQA 1ZOFA 2DBCA 2HZEB 2JACA 5CAXA 1GSQA 4CY8A 4ECBA 1QQ2A 4ID0A 1LU4A 2L5OA 3P2AA 3VWVA 4BVYB 5C04A 2YJHA 1BG5A 1YEPA 5IPHA 1SYXA 4K7NA 2E2GA 3MWHA 1UC7A 1YDKA 2R0CA 2PWJA 1XZOA 4MH2A 1RK4A 4E8HA 4ZXGA 5J9BA 4USSA 1SJIA 4F03A 1ON4A 4IS0A 1Q4JA 5BRTA 2DJ2A 5FHIA 2CZ2A 2HI7A 5DDLA 4XS4A 4MK3A 4XCSA 5GAPD 2FWHA 4ECJA 2MZCA 4JR6A 5KOWA 3QCPA 1FHEA 2WRTA 2E0QA 3EMXA 1EGRA 2C3QA 2WB9A 3KH7A 1DBYA 3HXSA 5DALB 1EGOA 5IM9A 4MJCA 1PMTA 2I1UA 4K5RA 4KGIA 3NOFA 3K8NA 3BCIA 4GRFA 1GWCA 5DQYA 2I4AA 1WJKA 4ECIA 3L9SA 4G0IA 1BYEA 2LS5A 2H6ZA 2LV3A 3ME8A 1QXHA 1G0TA 4MF5A 3IC8A 3IDVA 2C3TA 3HJOA 3VI7A 3TKSE 4F2IA 4WETA 1SL1B 3TJGA 6GSXA 1GTIA 3C7MA 6GSVA 3G7JA 4YQUA 5G5EA 10GSA 1BX9A 2MMAA 1LBKA 4JR4A 1OC3A 2V41A 5KOXA 3DVWA 1WRYA 4J57E 1FO5A 1T00A 3M9JA 3QAWA 4EC0A 2VCVA 1AQXA 2B1KA 2HSYA 4JE1A 3E9JB 4HU7A 4K0NA 2X8CA 3KZQA 2TRCP 5EY6A 3IR4A 5IQYA 1K0OA 3ZREA 5G1KA 3M9KA 3FZ9A 2YWMA 4L8EA 4NAXA 2VLUA 19GSA 4MNNA 2IYJA 3TRPA 5AIXA 3GKNA 4TW5A 1XFLA 1R7HA 5ABRA 1JZDA 1UA5A 4IQ1A 3GA4A 1GSSA 20GSA 4OD7A 1SD9A 5D9WA 1GRXA 2DJ1A 4MA9A 3ERFA 5IPGA 3D21A 5GZZB 1Y25A 2OA7A 3PINA 2C4JA 3LXTA 1DE2A 1AQVA 4WXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J2F A;  2H72 A;  2MMZ A;  1RW1 A;  3I43 A;  2YPM A;  3TUE A;  1TJD A;  2YZU A;  3TDG A;  2KP1 A;  1EEJ A;  1V58 A;  3O6T A;  4HQZ A;  3HJP A;  3F8U A;  1B4Q A;  5LD0 A;  3F3Q A;  3CTG A;  1AUC A;  2GT5 A;  2H1A A;  4BWQ A;  2FWE A;  3EMP A;  4OMV A;  3RAZ A;  1M0U A;  4EO3 A;  1SYR A;  3UOM A;  2ES7 A;  3EWL A;  4TRX A;  4HZ4 A;  4KB3 A;  2IJY A;  1VF3 A;  1HNB A;  4EDZ A;  1GTU A;  2NTO A;  3KD0 A;  5CRW A;  2AJQ B;  4MLY A;  4KE3 A;  3VWU A;  3TKR A;  2H75 A;  5IOX A;  4F9Z A;  2GZY A;  2VLT A;  1J0F A;  2OAD A;  2GZP A;  1U87 A;  2L5L A;  4K1F A;  1OC9 A;  4MZB A;  2FLS A;  3EVI A;  3FW2 A;  3UMA A;  3DRN A;  5H5S A;  1EZK A;  3QOU A;  2PVQ A;  5E4W A;  5KN1 A;  1O81 A;  3IAM 2;  4KCA A;  2H73 A;  2GS3 A;  4V2M A;  3ZVJ D;  2FWF A;  5FWG A;  4X43 A;  3TGZ A;  4V2L A;  5D96 A;  3F0I A;  4TXV A;  2O87 A;  1BQ7 A;  2A2R A;  5F0G A;  3U5R E;  4PQ1 A;  1A8L A;  2F3M A;  1YKC A;  1FB0 A;  4TKY A;  4NV5 A;  1TOF A;  3HVX A;  5D9V A;  1TW9 A;  5CRD A;  2YCD A;  4WBJ A;  4FH8 A;  4KDX A;  1WIK A;  2K8V A;  3ZRD A;  4L5O A;  5JCW A;  2L57 A;  3G9B A;  2OAC A;  1HD2 A;  3FRC A;  5C00 A;  1WMJ A;  1DSB A;  2PVO C;  3VWW A;  1K3Y A;  4KSO A;  2RII A;  3GH6 A;  3D6I A;  1M2B A;  4OFM A;  1SK0 A;  3HHV A;  4IJI A;  4N10 A;  2IY2 A;  5IMA A;  5HQP A;  1G6W A;  1T4Y A;  1V57 A;  3M3M A;  2OE1 A;  2H1B A;  3LSZ A;  4IN0 A;  2GGT A;  1GLQ A;  1YY7 A;  4QL9 A;  2YJ7 A;  1PN9 A;  1FW1 A;  1K0B A;  4DSS B;  2GST A;  3ZML A;  1OKD A;  3OR5 A;  3ZZX A;  3ZIT A;  2FGX A;  1QGV A;  1KEB A;  3CMI A;  3BD2 A;  2YWO A;  1O85 A;  4GLT A;  5H5R A;  2JZT A;  3F4T A;  1XCC A;  4D73 B;  4FYU A;  3U6V A;  17GS A;  2DIZ A;  2IMF A;  4G9H A;  2G0F A;  1TI3 A;  2H66 A;  4NXI A;  2H6Y A;  3GTU A;  1YZX A;  5G1L A;  1I9D A;  5HR2 A;  2CQ9 A;  4K8M A;  4HQS A;  3D22 A;  5INY A;  2L4Q A;  3BCK A;  3J7Y k;  1HYU A;  2RUE A;  2EC4 A;  3MDK A;  4FIW A;  4FYC A;  2YAN A;  3A2V A;  2CAQ A;  1IYH A;  2TIR A;  2FA8 A;  4LL4 B;  3GX8 A;  5CRH A;  5D73 A;  1X9W B;  1TDI A;  3Q18 A;  1K3L A;  2N5A A;  2NVL A;  2LJR A;  2ZUP A;  3VLN A;  2WS2 A;  3LFL A;  2IFQ B;  4BWS A;  1GSY A;  3TJF A;  2OJL A;  2LUS A;  1WOU A;  3FY7 A;  5AN1 A;  2M72 A;  4GTU A;  1K0D A;  2IMK A;  3W6G A;  2LEG A;  1OAZ A;  5CNW A;  2VL9 A;  3UAP A;  1H75 A;  1PKZ A;  3IE3 A;  2B5Y A;  1U88 A;  1Y6E A;  5L71 A;  3C8E A;  1JHB A;  4L0W A;  18GS A;  2WZ9 A;  4V1A p;  4OO4 A;  5ECQ B;  3A5W A;  1R5P A;  1GUM A;  1FOV A;  2H01 A;  1TRU A;  1VF4 A;  3I6A A;  3GMF A;  3KH9 A;  2GSS A;  2IL3 A;  4WF4 A;  4X0X A;  4IVF A;  1TK0 B;  3TB2 A;  3LJR A;  2KOK A;  1EOG A;  2VCQ A;  4GXZ A;  3IK7 A;  2HE3 A;  3TCO A;  4G2E A;  3MSZ A;  1I5G A;  4WR4 A;  3TKS A;  5AIV A;  1T4Z A;  1A2M A;  1C72 A;  1A8Y A;  1VF2 A;  5IMC A;  4TXO B;  4POL A;  2LQO A;  3ZLP A;  2PER A;  4TR0 A;  1ZMA A;  4PXO A;  3MNG A;  3PH9 A;  3RPP A;  1A2L A;  3WGD A;  3KMN A;  1W4V A;  2VM2 A;  1DUG A;  3N5O A;  6GSS A;  5F8B A;  4I6X A;  3HVS A;  2O7K A;  2JSY A;  1BED A;  5A4W A;  4WR5 A;  5A5K A;  4YH2 A;  4ACS A;  3KM6 A;  4I2T A;  4HOJ A;  4NV2 A;  3F6F A;  5DCH A;  3DD3 A;  1DE1 A;  1SD8 A;  1JLW A;  4POK A;  2IME A;  5CP1 A;  3ZFL A;  1F2E A;  2M46 A;  4JED A;  2JZR A;  1GH2 A;  1ST9 A;  2IN3 A;  4LLR A;  2HZE A;  2C8U A;  3TOU A;  1XOA A;  2MBS A;  1OYJ A;  2VCW A;  2CVD A;  1W89 A;  2D2Z A;  1B9Y C;  4RQX A;  5J5N A;  3GST A;  3IAS 2;  3D5J A;  4LL1 B;  1VF1 A;  3CSJ A;  4EDY A;  5DVB A;  1GUK A;  2HRN A;  4F0B A;  2GTU A;  5KEJ A;  1EV4 A;  2F51 A;  2H1G A;  2BJX A;  1PRX A;  2O8V B;  5A4U A;  1YEX A;  2K8S A;  4TR1 B;  2FA4 A;  5IMV A;  2A2S A;  3LQ7 A;  4DEJ A;  3DYR A;  2PMT A;  1SK1 A;  4N11 A;  3UIW A;  4TR3 A;  4ML6 A;  4DSR A;  2XBI A;  2ON7 A;  5DAL A;  3KP9 A;  1Z7R A;  2H1D A;  1EWX A;  4OCF A;  1GTA A;  5KN2 A;  1ERT A;  2B7K A;  1KTE A;  5AGY A;  4RI7 A;  1MDI A;  4QQ7 A;  1B9X C;  4ML1 A;  5CYY A;  3ZVJ A;  1SL2 B;  4MZW A;  3C1R A;  2K9F A;  3KIJ A;  1PSQ A;  4AJ8 A;  4V2N A;  5G2Z A;  1TI1 A;  2E7P A;  3LOR A;  4DSQ A;  3FYG A;  1U6T A;  4DVC A;  3HZ4 A;  2R2J A;  6GSW A;  3IK9 A;  1G7O A;  1FB6 A;  1URM A;  4IQA A;  3DVX A;  3FK8 A;  1ML6 A;  3L0H A;  3FR6 A;  4IP1 A;  2L6C A;  3FZ4 A;  2I3Y A;  4I8B A;  4BPY A;  5G30 A;  3EU3 A;  1MD4 A;  2H19 A;  3GX0 A;  4TR4 A;  1U3I A;  4X1U A;  3ZIJ A;  5IO2 A;  4XHM A;  1OE8 A;  2LRN A;  4PNG A;  4V1A g;  3LG6 A;  1FVJ A;  1MDK A;  1R5A A;  4KUN A;  1TKD B;  1Q98 A;  3M0F A;  4MMM A;  5H5Q A;  1TU7 A;  2HNL A;  2GSQ A;  3ED3 A;  5B6M A;  5J3R A;  1QK8 A;  3APS A;  1H4O A;  4O92 A;  4JU5 A;  3D4M A;  2R37 A;  1O8W A;  3UAR A;  4KSM A;  3I9V 2;  5ECI B;  1SEN A;  5JCU A;  2QSI A;  3TKS C;  4EE0 A;  1J9B A;  2YP6 A;  5IOW A;  2V6O A;  1TRS A;  2AUV A;  1JLV A;  1TK8 B;  4I5Q A;  4IP6 A;  2OE3 A;  2CZ3 A;  5ID2 B;  1SJZ A;  4O5R A;  2VIM A;  1WP0 A;  5ELA A;  2HRF A;  1A0R P;  3GL3 A;  1JZO A;  5ENU A;  4TVE A;  1AC1 A;  2XPD A;  3KJY A;  3Q74 A;  4OFT A;  4IW9 A;  4J56 E;  4Q5Q A;  4ZBB A;  3QMX A;  2WFC A;  4KW6 A;  3F3R A;  4XTS A;  2DJ3 A;  2C1Y A;  4EXJ A;  1GNW A;  3HD5 A;  1XXU A;  4KH7 A;  4Q5R A;  4MJA A;  3ZFB A;  3APQ A;  2V6K A;  3QAV A;  4GSN A;  4NHW A;  3E0U A;  3UVT A;  2AHE A;  2F9S A;  2WGR A;  6GSU A;  3DWV A;  1MDJ A;  2HFD A;  3WGX A;  2J9H A;  1TRW A;  4LA1 A;  4GQC A;  5DJM A;  2GQM A;  2WJU A;  4O7H A;  1OKT A;  2PGT A;  3D0Z A;  1TTZ A;  2L4C A;  2TRX A;  4JRR A;  3BBY A;  2IPA A;  4EF0 A;  2QGV A;  1K0C A;  1X0R A;  4KDY A;  1V2A A;  1V98 A;  1Z3E A;  4EUY A;  2LNT A;  2REM A;  2EIO A;  3GNJ A;  2YV7 A;  1NW2 A;  3P8W A;  2VD0 A;  3CYN A;  2VCX A;  3C1S A;  2B1L A;  3GL5 A;  5D8I A;  4AJ6 A;  2LJA A;  2K6V A;  4ZIJ A;  2VCZ A;  1WWJ A;  2C0F A;  2WUL A;  3W8S A;  3TJJ A;  4HZ2 A;  2C0D A;  1AW9 A;  1A23 A;  4ZL7 A;  3QD9 A;  3LYK A;  5ECK B;  1XW6 A;  4XS1 A;  4XRD A;  4MPF A;  3GKK A;  5B7C A;  1MTC A;  3DXB A;  2C0E A;  4MCU A;  2G2Q A;  2B7J A;  4DSS A;  3NZN A;  2NBS A;  2N5F A;  1FVK A;  8GSS A;  1SL0 B;  1R4W A;  2MBT A;  4HS1 A;  5HR0 A;  1HNA A;  1SKW B;  4Z7X A;  2KP2 A;  2OKA A;  4EKZ A;  4MPG A;  4HJM A;  14GS A;  3VPQ A;  4D73 A;  3ME7 A;  1F37 A;  1E6B A;  4WEY A;  4ISD A;  3EYT A;  2CX3 A;  4ZIL A;  1SJ6 A;  1XW9 A;  2CX4 A;  3O3T A;  3RBT A;  2IIY A;  3P90 A;  5DQS A;  4ZB6 A;  1ZYQ B;  5DAK B;  5CRE A;  4WF5 A;  2B5X A;  2JSZ A;  1AIU A;  1Z6N A;  3QR6 A;  2P31 A;  4AGS A;  3F9U A;  5J4U A;  4F0C A;  3IRA A;  1X5C A;  3APO A;  2L59 A;  1NM3 A;  3GFK A;  4ZB9 A;  2VD1 A;  4N0V A;  4IKH A;  2IFQ A;  3P7X A;  2LST A;  4O32 A;  1ERW A;  3JCM L;  2OE0 A;  2CAI A;  1YKA A;  1N8J A;  3A2W A;  1O7U A;  3W8J A;  1CQH A;  4PNF A;  4K6X A;  1X9M B;  3PR8 A;  1K0A A;  3QPM A;  4POB A;  4PX1 A;  1PX7 A;  2KHP A;  3Q6O A;  4ZBD A;  4K2D A;  3H8Q A;  3IXR A;  4ZBA A;  2FD3 A;  2K18 A;  2L6D A;  3IPZ A;  2HSH A;  4HUA A;  3L4N A;  2RM6 A;  2B5E A;  3L9U A;  2H8L A;  5HFG A;  4BL7 A;  4MAB A;  4MH3 A;  4FYB A;  1XVW A;  3TJK A;  2ZCT A;  2JU5 A;  3WD6 A;  1M7T A;  3ERG A;  2LRC A;  1K0M A;  1TRV A;  2R6K A;  1UN2 A;  1O73 A;  3QAG A;  2VOC A;  2LTK A;  3H4K A;  1ZL9 A;  7GSS A;  2ON5 A;  1ZGN A;  2CA8 A;  2YV9 A;  3C71 A;  4ZL8 A;  4TXO A;  1V40 A;  2DJJ A;  3GUR A;  1A0F A;  1PD2 1;  1SU9 A;  1R26 A;  4GSS A;  4NMU A;  3KTB A;  2HYX A;  4JBB A;  3H79 A;  3G7Y A;  2F8F A;  4RUV A;  4GCI A;  22GS A;  3VPT A;  4CHS A;  2AAW A;  2IMD A;  5B8A A;  4PUR A;  2DJK A;  3GHA A;  2VM1 A;  1GTB A;  1A24 A;  5AIS A;  4EVM A;  1ILO A;  1TK5 B;  3GYK A;  3C73 A;  1XBS A;  1GLP A;  4PUF C;  5KN3 A;  3S9F A;  2IWT A;  6GSY A;  1B4P A;  1SK2 A;  1U3A A;  1Z9H A;  5G31 A;  3CSH A;  4EL1 A;  4POM A;  5IMD A;  3GUS A;  1YF1 A;  3J7Y b;  2X8H A;  2RLI A;  2JZS A;  2LRT A;  2O85 A;  2P5R A;  2LJK A;  4ULX A;  1IYI A;  3HYP A;  2DJ0 A;  3WGE A;  4E8E A;  1NSW A;  3KMO A;  5JCG A;  4BVY A;  1PL1 A;  5D9T A;  2DIY A;  3F4R A;  2C3N A;  2R3X A;  3DEX A;  2V32 A;  2HT9 A;  1PL2 A;  1ABA A;  1GSF A;  3LWA A;  5COH A;  2GQK A;  4TOP A;  3L9V A;  3US3 A;  1TU8 A;  3UBK A;  2I9H A;  5ECH B;  3UBL A;  4RI6 A;  2V2G A;  3GKM A;  3RPN A;  5HR1 A;  3H1N A;  2C0G A;  2B3S A;  4TR1 A;  3DML A;  1ACV A;  1M2A A;  3WT2 A;  3IV4 A;  1T3B A;  2J23 A;  2MMN A;  4KND A;  3HY2 A;  1HNC A;  4MP4 A;  4PGT A;  4AF2 A;  4K0G A;  2B6M A;  5GST A;  5HFK A;  2FUG 2;  5ECM B;  3HCZ A;  3HJM A;  1GP1 A;  2BMX A;  3FR9 A;  1EOH A;  4MZC A;  1ERV A;  2YN1 A;  5LCZ A;  4KA0 A;  4K7O A;  4I97 A;  2YZH A;  3TKP A;  2VO4 A;  3AY8 A;  4GWR A;  1AAZ A;  5ECN B;  2GSR A;  4IGJ A;  3A2X A;  2YNX A;  3F63 A;  2YWN A;  4XS4 B;  3GH9 A;  3HKR A;  4ZL9 A;  1BJX A;  4Q5N A;  3F6D A;  5D9X A;  2NDO A;  9GSS A;  1MEK A;  1OE7 A;  4HI7 A;  5J9C A;  2DMM A;  3BOA A;  3HA9 A;  2VUP A;  4P3Y B;  4ILF A;  4OCE A;  2H30 A;  3EC3 A;  4XS6 A;  4MJE A;  3RHC A;  2GLR A;  2AYT A;  5B6N A;  3TJB A;  4G19 A;  3ERW A;  1T7P B;  2RM5 A;  4K9Z A;  1XWB A;  3LXZ A;  2M80 A;  1PA3 A;  3O76 A;  5F06 A;  1ZZY A;  11GS A;  4YAP A;  2H0H A;  2VL3 A;  4OO5 A;  4YQM A;  1J08 A;  3V1W A;  1BAY A;  2LNS A;  3EUR A;  2FCH A;  2OBK A;  2NPB A;  3CSI A;  4IHU A;  4XIH A;  3VK9 A;  1F9M A;  1F3A A;  1YJ6 A;  3HVV A;  1X9S B;  5DJL A;  4BVX A;  4G10 A;  4KDU A;  1PKW A;  2DC5 A;  3IHQ A;  1M9A A;  1G7E A;  1KNG A;  2PU9 C;  1OVN A;  4JZQ A;  3NIV A;  3UVH A;  4NWY A;  2XPE A;  3DIE A;  1V9W A;  2XHF A;  1GUH A;  3EIN A;  2F8A A;  4NHZ A;  2FHE A;  2VAF A;  5HR3 A;  3GKX A;  3WYW A;  2P5Q A;  3RDW A;  5IIZ A;  3D4T A;  2KUC A;  2YOI A;  16GS A;  3LYP A;  1EP8 A;  1QFN A;  4ZB8 A;  4LMV A;  2GQL A;  5JWR B;  5ECS A;  5ID2 A;  4H86 A;  4WBR D;  2RUF A;  4XRA A;  2XC2 A;  3GN3 A;  4HU9 A;  3RHB A;  1O6J A;  1F3B A;  1T1V A;  2FNO A;  1GSD A;  4HJ2 A;  2WCI A;  2VCT A;  2CVK A;  2FY6 A;  5GSS A;  1JZR A;  5JWQ B;  2H76 A;  1JZW A;  1XWG A;  1MD3 A;  3CBU A;  3ZTL A;  2BTO T;  2E2M A;  1S3D A;  5EL8 A;  4N30 A;  4YQV A;  3IBH A;  1VGL A;  2VL2 A;  4PQI A;  5EVO A;  5KN0 A;  4OWY A;  1YQ1 A;  1PQN A;  3GRX A;  5CO3 A;  1AQW A;  1EEM A;  1Z5Y E;  2ZNM A;  3LGC A;  4TN8 A;  1M99 A;  3TOT A;  3KEB A;  1OC8 A;  3UEM A;  3IC4 A;  1PGT A;  1OC9 B;  1ZYE A;  4FO5 A;  5IMF A;  2FWG A;  1B8X A;  2PN8 A;  2PUK C;  3ZYW A;  3LEF A;  3QFA C;  2QKE A;  4GQF A;  3TRX A;  5B8B A;  1EP7 A;  2XBQ A;  2R5G A;  2VLV A;  1UVZ A;  4PUA A;  5ECR B;  1VRS D;  1XIY A;  3L78 A;  2DLX A;  2CT6 A;  1F6M C;  3UJ1 A;  3VUR A;  4RQR A;  2LQQ A;  4N0Z A;  1GNE A;  1XVQ A;  2ALB A;  3EU4 A;  5E59 A;  2JAD A;  1HQO A;  1QMV A;  2AB6 A;  2H70 A;  5HFI A;  3GSS A;  4MDC A;  5IO0 A;  3KCM A;  2JL4 A;  3KP8 A;  3R2Q A;  5GAN D;  1A2J A;  2H0I A;  3ZL5 A;  1ERU A;  3KTL A;  3GIX A;  1THO A;  3Q19 A;  2R4V A;  3FEU A;  1GSU A;  2V1M A;  4MF7 A;  4KAE A;  2C80 A;  6GST A;  2H6X A;  2Z9S A;  1PX6 A;  4F82 A;  5DBQ A;  3WT1 A;  1O8X A;  3E3E A;  4BA7 A;  4K7I A;  3F4S A;  3MAK A;  3EE2 A;  4I2U A;  2HZF A;  1X5E A;  5DAK A;  1G6Y A;  1XOB A;  2CVB A;  5LNK e;  2PPT A;  2H0G A;  1RQM A;  4CW9 A;  12GS A;  1WPI A;  3BJ5 A;  1B48 A;  13GS A;  1N2A A;  3M8N A;  3VWX A;  2X8G A;  5DCG A;  4GF0 A;  1KBN A;  2DML A;  2WDU A;  1SKS B;  1K3O A;  2O89 A;  1XPV A;  1GL8 A;  5F05 A;  3G7I A;  1EV9 A;  4IBP A;  5EPF A;  3GTU B;  4AJ7 A;  2EIQ A;  5JWO B;  3GV1 A;  3VI5 A;  1Z7P A;  1X5D A;  3KGK A;  2QC7 A;  4NPB A;  4L0U A;  2HXK A;  3FHK A;  3CXG A;  5FT3 A;  4KCE A;  1GSE A;  3UL3 A;  2DSA A;  1S3A A;  2GT6 A;  4MF6 A;  2A4V A;  2N5B A;  2IMI A;  3DGQ A;  3ISO A;  5ECL B;  4HEA 2;  1NHO A;  1T8E B;  1WE0 A;  3ZMK A;  1Z6M A;  1ZCP A;  3FKF A;  4PQH A;  2AV4 A;  2MMO A;  1XW5 A;  3CTF A;  3CRT A;  5F07 A;  2MYG A;  1FG4 A;  3CRU A;  1JFU A;  3I69 A;  3QDN A;  5ECP B;  2X64 A;  5J41 A;  1GUL A;  1M9B A;  1TXX A;  3KXO A;  5ELG A;  3PGT A;  3A3T A;  2I81 A;  2YWI A;  1E2Y A;  2PBJ A;  1AXD A;  4GST A;  5G5F A;  4ECC A;  2GZZ A;  2CV4 A;  2X99 A;  3ZIV A;  1TP9 A;  4CDO A;  2HLS A;  1XWA A;  3TKQ A;  3SWL A;  4YAV A;  1CQG A;  2VL2 C;  2GVP A;  1SKR B;  1USB A;  3QFB C;  2H74 A;  5A4V A;  4WKW A;  3IA1 A;  3IOS A;  2P0G A;  4HDE A;  1S3C A;  1XWK A;  4QL7 A;  3FZ5 A;  2GDR A;  1NHY A;  2H71 A;  3N9J A;  3SBC A;  3HZ8 A;  3M1G A;  5CRG A;  4IJ3 A;  3HDC A;  4MJB A;  5D93 A;  1FAA A;  1LJR A;  1THX A;  1YF0 A;  4OFN A;  4L5L A;  2LKU A;  3FZA A;  2EIR A;  2KLX A;  4LMW A;  3H93 A;  1K0N A;  3FR3 A;  3DKS A;  4Q5F A;  3VFI A;  5IMZ A;  4IEL A;  5ECO B;  1QUW A;  1XWC A;  1M2D A;  4KX4 A;  2OBI A;  3TRQ A;  1ZOF A;  2DBC A;  2HZE B;  2JAC A;  5CAX A;  1GSQ A;  4ECB A;  1QQ2 A;  4ID0 A;  1LU4 A;  2L5O A;  3P2A A;  3VWV A;  5C04 A;  2YJH A;  1BG5 A;  1YEP A;  5IPH A;  1SYX A;  4K7N A;  2E2G A;  3MWH A;  1UC7 A;  1YDK A;  2PWJ A;  1XZO A;  4MH2 A;  1RK4 A;  4E8H A;  4ZXG A;  5J9B A;  1SJI A;  4F03 A;  1ON4 A;  4IS0 A;  1Q4J A;  2DJ2 A;  5FHI A;  2CZ2 A;  2HI7 A;  5DDL A;  4XS4 A;  4MK3 A;  4XCS A;  5GAP D;  2FWH A;  4ECJ A;  2MZC A;  4JR6 A;  3QCP A;  1FHE A;  2WRT A;  2E0Q A;  3EMX A;  1EGR A;  2C3Q A;  2WB9 A;  3KH7 A;  1DBY A;  3HXS A;  5DAL B;  1EGO A;  5IM9 A;  4MJC A;  1PMT A;  2I1U A;  4KGI A;  3NOF A;  3K8N A;  3BCI A;  4GRF A;  1GWC A;  5DQY A;  2I4A A;  1WJK A;  4ECI A;  3L9S A;  1BYE A;  2LS5 A;  2H6Z A;  2LV3 A;  3ME8 A;  1QXH A;  1G0T A;  4MF5 A;  3IDV A;  2C3T A;  3HJO A;  3VI7 A;  3TKS E;  4F2I A;  4WET A;  1SL1 B;  3TJG A;  6GSX A;  1GTI A;  3C7M A;  6GSV A;  3G7J A;  4YQU A;  5G5E A;  10GS A;  1BX9 A;  2MMA A;  1LBK A;  4JR4 A;  1OC3 A;  2V41 A;  3DVW A;  1WRY A;  4J57 E;  1FO5 A;  1T00 A;  3M9J A;  3QAW A;  4EC0 A;  2VCV A;  1AQX A;  2B1K A;  2HSY A;  4JE1 A;  3E9J B;  4HU7 A;  4K0N A;  2X8C A;  3KZQ A;  2TRC P;  5EY6 A;  3IR4 A;  5IQY A;  1K0O A;  3ZRE A;  5G1K A;  3M9K A;  3FZ9 A;  2YWM A;  4L8E A;  4NAX A;  2VLU A;  19GS A;  2IYJ A;  3TRP A;  5AIX A;  3GKN A;  4TW5 A;  1XFL A;  1R7H A;  5ABR A;  1JZD A;  1UA5 A;  4IQ1 A;  3GA4 A;  1GSS A;  20GS A;  4OD7 A;  1SD9 A;  5D9W A;  1GRX A;  2DJ1 A;  4MA9 A;  3ERF A;  5IPG A;  3D21 A;  5GZZ B;  1Y25 A;  2OA7 A;  3PIN A;  2C4J A;  3LXT A;  1DE2 A;  1AQV A;  4WXT A; 
#chains in the Genus database with same CATH topology
 4L7K A;  4J2F A;  3CC2 3;  2H72 A;  3PYJ A;  2MMZ A;  1RW1 A;  3F40 A;  3I43 A;  2YPM A;  4EC6 A;  3TUE A;  1TJD A;  2YZU A;  3TDG A;  2KP1 A;  1W6G A;  1EEJ A;  1V58 A;  3O6T A;  4HQZ A;  3GZB A;  3HJP A;  1I3F A;  1BU4 A;  2HMK B;  3F8U A;  1B4Q A;  5LD0 A;  3F3Q A;  2UX0 A;  3CTG A;  1AUC A;  3CCR 3;  2GT5 A;  2H1A A;  4BWQ A;  2FWE A;  1MOL A;  3EMP A;  2KRT A;  4OMV A;  1M0U A;  3RAZ A;  4EO3 A;  1SYR A;  3UOM A;  2ES7 A;  3EWL A;  1FUT A;  4TRX A;  1LQG C;  4HZ4 A;  4KB3 A;  1HZ1 A;  2IJY A;  1VF3 A;  3FLJ A;  1I70 A;  1HNB A;  4FQU A;  4EDZ A;  1GTU A;  2NTO A;  3KD0 A;  5CRW A;  5HOH A;  2AJQ B;  4MLY A;  3FZW A;  5BXQ A;  4KE3 A;  4BL2 A;  3VWU A;  3TKR A;  2H75 A;  1BSE A;  5IOX A;  3EJV A;  4F9Z A;  2GZY A;  2VLT A;  1J0F A;  2OAD A;  2GZP A;  4O02 B;  1U87 A;  2L5L A;  4K1F A;  1OC9 A;  4MZB A;  3I56 3;  2FLS A;  3EVI A;  4BIK A;  3FW2 A;  3UMA A;  3DRN A;  3CCS 3;  4IT7 A;  3LTA A;  1JV2 B;  5H5S A;  1OHP A;  2P0X A;  1FOH A;  4LSO A;  1EZK A;  2RSX A;  3FF0 A;  3QOU A;  2R0G A;  2PVQ A;  2P09 A;  3ROB A;  5E4W A;  5KN1 A;  1O81 A;  3IAM 2;  4KCA A;  2H73 A;  2GS3 A;  4V2M A;  3ZVJ D;  1JKG B;  3SXX A;  3FGY A;  2FWF A;  4N6N B;  5FWG A;  4X43 A;  3TGZ A;  4V2L A;  2WGQ A;  3HI7 A;  4BL3 A;  5IW9 A;  5D96 A;  2Z76 A;  3F0I A;  4TXV A;  3D5I A;  2O87 A;  1BQ7 A;  3LXU X;  2A2R A;  5F0G A;  3U5R E;  3K9M C;  4EV5 A;  5D83 A;  4PQ1 A;  1A8L A;  2F3M A;  4R4K A;  1N8R 4;  1YKC A;  3F8X A;  1FB0 A;  4TKY A;  1RMS A;  4NV5 A;  1BNE A;  1OPY A;  1I8V A;  3HX8 A;  1RN4 A;  2V1L A;  1TOF A;  1QVF 2;  3HVX A;  3Q3F A;  5D9V A;  1TW9 A;  5CRD A;  4HM1 B;  2YCD A;  2DKI A;  4HM8 B;  4WBJ A;  2ZL8 A;  4FH8 A;  1ULI B;  2F5W A;  4KDX A;  1A2P A;  1WIK A;  2K8V A;  3ZRD A;  4L5O A;  5JCW A;  4XBT A;  2L57 A;  3G9B A;  2OAC A;  1HD2 A;  4J8T A;  3N8B A;  1D6Y A;  2BIR A;  3FRC A;  5C00 A;  1WMJ A;  1DSB A;  2PVO C;  3VWW A;  2ML5 A;  1K3Y A;  4KSO A;  2RII A;  3GH6 A;  1IDP A;  1X1Y A;  1A2K A;  3D6I A;  2GEX A;  3JUP A;  4GSP A;  1M2B A;  1SK0 A;  4OFM A;  3HHV A;  4IJI A;  4N10 A;  3T8N A;  2A4H A;  2IY2 A;  3M8C A;  5IMA A;  4O2H A;  1JB2 A;  3PPU A;  3ALA A;  5HQP A;  1IYY A;  2CK3 H;  4FCJ A;  5M19 A;  1G6W A;  1T4Y A;  1V57 A;  1B21 A;  3M3M A;  4J5G A;  4YKG A;  2OE1 A;  1LOV A;  4O3V A;  2H1B A;  3LSZ A;  2HML B;  4IN0 A;  2GGT A;  1FGR A;  3ER7 A;  1GLQ A;  1YY7 A;  4QL9 A;  2YJ7 A;  3EC9 A;  1PN9 A;  3WHO A;  1FW1 A;  1K0B A;  4DSS B;  2GST A;  1M9G A;  3ZML A;  1OKD A;  3OR5 A;  3ZZX A;  3ZIT A;  2Z77 A;  4Z2R A;  2FGX A;  1QGV A;  1ZO2 A;  1KEB A;  3CMI A;  3BD2 A;  2YWO A;  1O85 A;  4GLT A;  1T2H A;  5H5R A;  2JZT A;  4G0L A;  3DH2 A;  1XCC A;  3F4T A;  4D73 B;  4FYU A;  1FGQ A;  3U6V A;  1B2S A;  1Q40 B;  17GS A;  2DIZ A;  2IMF A;  1JNQ A;  4G9H A;  1ZYN A;  1TI3 A;  2G0F A;  2H66 A;  1UUG B;  4NXI A;  2H6Y A;  4EW5 A;  3GTU A;  1YZX A;  1HU9 A;  2QA1 A;  5G1L A;  1L5G B;  1I9D A;  5HR2 A;  2CQ9 A;  4K8M A;  4HQS A;  3D22 A;  1ASK A;  2BMQ B;  2L4V A;  1BSB A;  5INY A;  1OHO A;  1VQP 3;  8CHO A;  2L4Q A;  3BCK A;  1RGK A;  1JJ2 2;  3J7Y k;  1HYU A;  2RUE A;  3U1W A;  3KSE D;  2EC4 A;  3MDK A;  4FIW A;  4H61 A;  4FYC A;  3DGN A;  2YAN A;  3BIR A;  3A2V A;  2CAQ A;  1IYH A;  1IT7 A;  2TIR A;  2FA8 A;  4HSC X;  4LL4 B;  3GX8 A;  5CRH A;  4ICY A;  5D73 A;  1X9W B;  1TDI A;  3Q18 A;  4XM4 A;  1K3L A;  2N5A A;  2IUJ A;  2NVL A;  3D4A A;  3MKI A;  2LJR A;  2ZUP A;  1OF5 B;  1TUH A;  1Z1S A;  4HM5 B;  2WS2 A;  3VLN A;  3N9H A;  2AAE A;  3EF8 A;  3LFL A;  2IFQ B;  3CCM 3;  4BWS A;  4N6T A;  1CEW I;  1GSY A;  1OHS A;  3TJF A;  2LQV A;  1FUS A;  3G0K A;  2OJL A;  2LUS A;  1WOU A;  1O7N B;  2XH9 A;  3FY7 A;  1DMQ A;  5AN1 A;  2M72 A;  4GTU A;  2HOH A;  1F8N A;  1K0D A;  2IMK A;  3W6G A;  2LEG A;  4G0K A;  1AV4 A;  1OAZ A;  4J9A A;  5CNW A;  2VL9 A;  1WQL B;  3FCS B;  1OGZ A;  2CFG A;  3UAP A;  3WOF B;  1H75 A;  1PKZ A;  3IE3 A;  1PN0 A;  2R0P A;  2B5Y A;  4PTS A;  1U88 A;  1Y6E A;  5L71 A;  3C8E A;  1JHB A;  4LEH A;  4L0W A;  1N9E A;  18GS A;  4IPB A;  2WZ9 A;  4V1A p;  4STD A;  4OO4 A;  5ECQ B;  3A5W A;  1MNL A;  1QVG 2;  1R5P A;  2KXG A;  1GUM A;  1FOV A;  1UCI A;  2H01 A;  1TRU A;  1VF4 A;  3I6A A;  2UGI A;  3GMF A;  3KH9 A;  1VQQ A;  5AIF A;  2HMM B;  2GSS A;  4BL7 B;  2IL3 A;  4WF4 A;  4X0X A;  4IVF A;  3V98 A;  1TK0 B;  4N6M A;  2YFJ B;  3TB2 A;  3LJR A;  2KOK A;  1B27 A;  4X4J A;  1EOG A;  2VCQ A;  4GXZ A;  3IK7 A;  2HE3 A;  4KFF A;  3TCO A;  4G2E A;  3MSZ A;  1I5G A;  4WR4 A;  3TKS A;  5AIV A;  3LOY A;  5AYR B;  1A2M A;  1T4Z A;  1C72 A;  3CPO A;  1A8Y A;  1VF2 A;  5IMC A;  4TXO B;  3DXO A;  4POL A;  2F4Y A;  1WNH A;  2LQO A;  3ZLP A;  2PER A;  1VQK 3;  4TR0 A;  1ZMA A;  1KSI A;  4HJL B;  4PXO A;  3MNG A;  3PH9 A;  1RRL A;  3RPP A;  1V74 A;  3MPH A;  1A2L A;  3WGD A;  3KMN A;  1W4V A;  2VM2 A;  1DUG A;  3N5O A;  6GSS A;  5F8B A;  4RBN A;  3U97 A;  4I6X A;  3HVS A;  2O7K A;  2JSY A;  1BED A;  5A4W A;  3SOA A;  4WR5 A;  5A5K A;  3OXA A;  4YH2 A;  4ACS A;  3KM6 A;  3WDG B;  3ZG0 A;  4ORL A;  2B24 B;  4FCM A;  4I2T A;  4HOJ A;  4NV2 A;  1K8A 4;  3F6F A;  5DCH A;  3DD3 A;  1DE1 A;  1BUQ A;  3J7Y d;  1SD8 A;  1JLW A;  4POK A;  2IME A;  2XEP A;  5CP1 A;  3ZFL A;  1F2E A;  1B2M A;  4JRF A;  2M46 A;  3PS8 A;  4JED A;  5KP4 A;  1TIJ A;  2JZR A;  3FH1 A;  1GH2 A;  1ST9 A;  3JVC A;  2IN3 A;  4LLR A;  2HZE A;  2C8U A;  4FR9 A;  3TOU A;  1XOA A;  1GOV A;  2W6J H;  5CF1 A;  2MBS A;  1OYJ A;  2VCW A;  2HMO B;  4HM4 B;  2CVD A;  2E2U A;  3AMO A;  2CX1 A;  1W89 A;  2D2Z A;  1B9Y C;  1SQW A;  3RGR A;  4RQX A;  2YX9 A;  3AHS A;  3BNE A;  3GST A;  3IAS 2;  5J5N A;  3D5J A;  4LL1 B;  1T2I A;  3FMW A;  1TFO A;  1VF1 A;  5AII A;  3CSJ A;  4EDY A;  1KQS 2;  5DVB A;  1GUK A;  2HRN A;  1UI8 A;  4F0B A;  5KP1 A;  1JBT A;  2GTU A;  5KEJ A;  1EV4 A;  2F51 A;  2H1G A;  2BJX A;  1T5Y A;  1O7H B;  1PRX A;  2O8V B;  5A4U A;  1YEX A;  2K8S A;  4TR1 B;  2FA4 A;  5IMV A;  2A2S A;  1BUJ A;  3LQ7 A;  4DEJ A;  2CHC A;  1Q7H A;  3DYR A;  2PMT A;  1SK1 A;  2A15 A;  1PYL A;  4HZ9 B;  2K54 A;  4O5U A;  3S27 A;  3PXM A;  4N11 A;  3UIW A;  1WMN A;  4TR3 A;  4ML6 A;  4DSR A;  2XBI A;  2ON7 A;  2W03 A;  3GZR A;  1I2E A;  5DAL A;  1JRQ A;  4WWU C;  3KP9 A;  1Z7R A;  3H3H A;  4MEI A;  3URP A;  1IVX A;  2H1D A;  1RGG A;  1IV9 A;  3EN8 A;  3GZY B;  2F86 B;  1EWX A;  1W2B 2;  4OCF A;  1GTA A;  5KN2 A;  1ERT A;  2B7K A;  1KTE A;  5AGY A;  4RI7 A;  1MDI A;  4QQ7 A;  1B9X C;  4ML1 A;  1RGF A;  1RJO A;  5CYY A;  3ZVJ A;  1SL2 B;  1TU5 A;  4MZW A;  3SED A;  5AEU B;  1KD1 4;  4K2X A;  3C1R A;  3V92 A;  4CCV A;  2K9F A;  1JB4 A;  3KIJ A;  1PSQ A;  4AJ8 A;  1C7H A;  4V2N A;  5G2Z A;  1TI1 A;  2E7P A;  2Z6B A;  3MWZ A;  3LOR A;  5IG5 A;  4DSQ A;  3FYG A;  4AKY A;  1U6T A;  4DVC A;  1BRJ A;  3HZ4 A;  1PFP A;  5DRE A;  5M18 A;  2R2J A;  6GSW A;  2YFL B;  1RCL A;  3IK9 A;  1G7O A;  1QAL A;  3EN1 B;  2QA4 3;  1FB6 A;  2Y73 A;  1URM A;  4EYC A;  4IQA A;  4RNZ A;  3DVX A;  4XBY A;  3FK8 A;  2GBW B;  1ML6 A;  3L0H A;  1RHL A;  3FR6 A;  3F14 A;  2W56 B;  4NRE A;  4K61 A;  3RDE A;  4IP1 A;  1EQK A;  2L6C A;  3FZ4 A;  2I3Y A;  4HVN A;  2Q07 A;  2F5M A;  5IER A;  1Q7Y 4;  4I8B A;  4DKI A;  2DKH A;  4BPY A;  3B4O A;  5G30 A;  3DM8 A;  3NBJ A;  3EU3 A;  1MD4 A;  2H19 A;  1BNF A;  3CU3 A;  3GX0 A;  1FGT A;  1U3I A;  4KF9 A;  4TR4 A;  4X1U A;  3ZIJ A;  5IO2 A;  4XHM A;  1OE8 A;  2P05 A;  2LRN A;  4PNG A;  3LTB A;  3F7X A;  1A2V A;  1SPU A;  3X3Y A;  4V1A g;  3LG6 A;  1FVJ A;  1BRK A;  1MDK A;  3CCQ 3;  2OOV A;  3ZFZ A;  1R5A A;  1BRN L;  4KUN A;  1TKD B;  3S28 A;  4BVX B;  1BGS A;  1Q98 A;  3M0F A;  4MMM A;  1HYF A;  3EQQ B;  5H5Q A;  1TU7 A;  3LH4 A;  1YJW 3;  2L1S A;  5JPP A;  3NBB A;  1I2G A;  1VZZ A;  2HNL A;  3K7C A;  2GSQ A;  1B2Z A;  1RGC A;  1GOU A;  3FSD A;  3DZL A;  3ED3 A;  5B6M A;  1O7P B;  1M90 4;  1LOX A;  4OUQ A;  5J3R A;  2HMJ B;  1QK8 A;  3APS A;  1H4O A;  3KE7 A;  4O92 A;  1W01 A;  1GY6 A;  4JU5 A;  3D4M A;  2R37 A;  2Z7A A;  1O8W A;  3UAR A;  4KSM A;  3I9V 2;  5ECI B;  1SEN A;  3EB8 A;  5JCU A;  3X41 A;  4GHO A;  1GYB A;  3IHG A;  2QSI A;  3S67 A;  3TKS C;  4EE0 A;  1J9B A;  2YP6 A;  5IOW A;  1YGW A;  1AVK A;  1RGL A;  2V6O A;  1YNV X;  1TRS A;  2QGU A;  2CFL A;  2AUV A;  3SLU A;  2AAD A;  2WGO A;  1JLV A;  3X3Z A;  1TK8 B;  4I5Q A;  4IP6 A;  2OE3 A;  2CZ3 A;  2OTJ 3;  5ID2 B;  1SJZ A;  4O5R A;  2CFW A;  1RGA A;  2VIM A;  1WP0 A;  5ELA A;  2HRF A;  1A0R P;  3GL3 A;  3I55 3;  1JZO A;  5ENU A;  4TVE A;  4O5Q A;  1AC1 A;  2XPD A;  3KJY A;  3Q74 A;  4OFT A;  3PGB A;  1LQM B;  4IW9 A;  4J56 E;  4Q5Q A;  4ZBB A;  3QMX A;  2WFC A;  3EBT A;  1NJI 4;  4KW6 A;  3F3R A;  4XTS A;  1RN1 A;  2DJ3 A;  2C1Y A;  4EXJ A;  1GNW A;  2C10 A;  5HGR A;  3HD5 A;  1XXU A;  4KH7 A;  3LYG A;  1PY3 A;  4Q5R A;  1ZS7 A;  1UUW B;  3CC7 3;  4R9L A;  4MJA A;  3ZFB A;  1JKG A;  3APQ A;  3NX0 A;  2V6K A;  3QAV A;  2M7O A;  4GSN A;  3E0U A;  4NHW A;  3UVT A;  2AHE A;  2F9S A;  6RNT A;  2WGR A;  6GSU A;  3DWV A;  3MG1 A;  1MDJ A;  2HFD A;  3PCR A;  1MGR A;  2E2T A;  2WO0 A;  3WGX A;  2HRK A;  2J9H A;  1TRW A;  4LA1 A;  3CNM A;  4GQC A;  5DJM A;  3MG2 A;  4R80 A;  2QA2 A;  1M1K 4;  2GQM A;  2WJU A;  4O7H A;  1OKT A;  1GY5 A;  5AYS C;  2PGT A;  3D0Z A;  3AGN A;  1TTZ A;  2L4C A;  2TRX A;  1N5H A;  4FMB A;  4OK0 A;  3VF1 A;  1IU7 A;  4JRR A;  3BBY A;  3LW9 A;  2XFT A;  2IPA A;  3D9R A;  4EF0 A;  3JUQ A;  2QGV A;  1K0C A;  1X0R A;  4KDY A;  1V2A A;  3F7S A;  3B7C A;  1V98 A;  1Z3E A;  4EUY A;  2LNT A;  2REM A;  2EIO A;  3GNJ A;  3VGN A;  1A90 A;  2YV7 A;  1NW2 A;  3P8W A;  2CX0 A;  1BSA A;  2VD0 A;  5EQL A;  3CYN A;  4HM7 B;  2VCX A;  3C1S A;  2B1L A;  3GL5 A;  5D8I A;  4BU4 A;  4AJ6 A;  1GOY A;  2LJA A;  1GMP A;  3Q2P A;  2K6V A;  4ZIJ A;  1VQ6 3;  2VCZ A;  1WWJ A;  2CWV A;  2C0F A;  2WUL A;  7RNT A;  3W8S A;  3LML A;  3TJJ A;  4HZ2 A;  2C0D A;  1AW9 A;  3LZA A;  1A23 A;  4ZL7 A;  3QD9 A;  3LYK A;  5ECK B;  1XW6 A;  4XS1 A;  4XRD A;  7GSP A;  4MPF A;  3GKK A;  5B7C A;  1MTC A;  3HVN A;  3DXB A;  1LOY A;  2C0E A;  4MCU A;  3K0Z A;  2G2Q A;  3NBR A;  2B7J A;  3NZN A;  1CH0 A;  4DSS A;  2NBS A;  3OWS A;  2N5F A;  1FVK A;  8GSS A;  1SL0 B;  1R4W A;  2MBT A;  4HS1 A;  2F98 A;  4K90 B;  3G16 A;  1HNA A;  5HR0 A;  1SKW B;  4Z7X A;  4N6U A;  5FW5 A;  2KP2 A;  2OKA A;  1NU3 A;  2INX A;  4EKZ A;  1OGX A;  4MPG A;  2KF4 A;  4HJM A;  14GS A;  3VPQ A;  3BU4 A;  3DY5 A;  4D73 A;  3S29 A;  4HOH A;  3ME7 A;  1F37 A;  4EV2 A;  1TP6 A;  1ISK A;  1Y4K A;  1E6B A;  2X49 A;  4WEY A;  1ZX2 A;  4ISD A;  3EYT A;  3WOD G;  1BRH A;  1EA2 A;  2CX3 A;  1OCV A;  4ZIL A;  1SJ6 A;  1WTH A;  2MF7 A;  1XW9 A;  2CX4 A;  3O3T A;  3RBT A;  4O8S A;  4RNY A;  2IIY A;  3P90 A;  4N6O B;  5DQS A;  4ZB6 A;  1ZYQ B;  3LTD A;  1E97 A;  2RGQ A;  5DAK B;  5CRE A;  4WF5 A;  2B5X A;  2JSZ A;  5A0O B;  1LXE A;  1AIU A;  1Z6N A;  5BIR A;  1IV7 A;  3CCJ 3;  3QR6 A;  2P31 A;  2BMR B;  4AGS A;  3F9U A;  5J4U A;  4EBG A;  4F0C A;  1RRH A;  2W9P A;  1MWT A;  3IRA A;  1X5C A;  3APO A;  2L59 A;  1NM3 A;  3GFK A;  1OF5 A;  1IVU A;  3MYT A;  2VD1 A;  4N0V A;  4ZB9 A;  2F99 A;  4IKH A;  3CQF A;  2IFQ A;  2Y74 A;  3P7X A;  1YIJ 3;  2JDI H;  2YFI B;  5CF2 A;  2LST A;  4O32 A;  1O7M B;  1LRA A;  1ERW A;  5DRV A;  3NM7 A;  1RGE A;  2OE0 A;  3JCM L;  2CAI A;  1YKA A;  1RSN A;  1N8J A;  3A2W A;  1U8C B;  1O7U A;  3L0R A;  3W8J A;  1K41 A;  4X2H A;  1CQH A;  4PNF A;  4K6X A;  1X9M B;  3PR8 A;  1K0A A;  3QPM A;  1N8Q A;  4POB A;  4PX1 A;  2W2C A;  1PX7 A;  5ELU A;  5AIH A;  2CG1 A;  2KHP A;  3Q6O A;  2OQE A;  4ZBD A;  4K2D A;  3VSY A;  3H8Q A;  3IXR A;  3NV0 B;  4ZBA A;  4X2O A;  2FD3 A;  2K18 A;  2L6D A;  3IPZ A;  2HSH A;  3KZT A;  5EVH A;  3R3E A;  3IPT A;  3DGL A;  4HUA A;  3L4N A;  2R4I A;  2RM6 A;  3NQY A;  2B5E A;  1N9J A;  1STD A;  3L9U A;  2H8L A;  5HFG A;  4BL7 A;  2MC8 A;  4MAB A;  2GEY A;  4MH3 A;  4FYB A;  1XVW A;  3TJK A;  2ZCT A;  2JU5 A;  3QRD A;  3WD6 A;  1YIT 3;  1E3R A;  1YHQ 3;  2BU4 A;  1M7T A;  3ERG A;  2LRC A;  1K0M A;  1TRV A;  2R6K A;  1UN2 A;  1O73 A;  3WMD A;  3QAG A;  5LC7 A;  3GSP A;  3WA3 A;  2VOC A;  3I0Y A;  2LTK A;  3CPW 2;  3H4K A;  1ZL9 A;  7GSS A;  5AIG A;  2ON5 A;  1ZGN A;  1UI7 A;  2CA8 A;  2YV9 A;  3C71 A;  4ZL8 A;  2QEX 3;  4TXO A;  1MGW A;  1QAF A;  1V40 A;  2DJJ A;  3GUR A;  1A0F A;  1PD2 1;  1YJN 3;  1SU9 A;  1R26 A;  4GSS A;  4NMU A;  3LT9 A;  4KT3 B;  1ZYP A;  3KTB A;  2HYX A;  4JBB A;  3H79 A;  3G7Y A;  2F8F A;  4RUV A;  1DVD A;  4GCI A;  22GS A;  4OVM A;  3VPT A;  4CHS A;  2AAW A;  2IMD A;  5B8A A;  2RBI A;  4PUR A;  2DJK A;  3GHA A;  3PCS A;  2VM1 A;  1GTB A;  1A24 A;  5AIS A;  4EVM A;  1IVV A;  1ILO A;  1TK5 B;  4BIR A;  1BNI A;  4L8O A;  3GYK A;  3C73 A;  4FMA A;  1XBS A;  3KFQ C;  4EIP A;  1JN5 B;  1GLP A;  4PUF C;  5KN3 A;  3S9F A;  2IWT A;  4EXR A;  1VQM 3;  6GSY A;  1B4P A;  1SK2 A;  1U3A A;  3CME 3;  3MIX A;  1Q86 4;  3NM2 A;  1Z9H A;  5G31 A;  3CSH A;  4EL1 A;  3FG4 A;  4POM A;  5IMD A;  1TFK A;  3A5I A;  3GUS A;  3F9S A;  3CCV 3;  1YF1 A;  3J7Y b;  4HM2 B;  2RFR A;  2X8H A;  2RLI A;  2JZS A;  5IEO A;  2LRT A;  4WYK B;  2O85 A;  2P5R A;  3KKG A;  2LJK A;  4ULX A;  1IYI A;  2CG0 A;  3HYP A;  2DJ0 A;  3WGE A;  1YVB I;  3BNB A;  4E8E A;  1NSW A;  3KMO A;  5JCG A;  4BVY A;  1PL1 A;  1BIR A;  5D9T A;  2DIY A;  3F4R A;  2C3N A;  2R3X A;  3DEX A;  1EG9 B;  1GMQ A;  1DE3 A;  2V32 A;  2HT9 A;  5BMU A;  3OWU A;  1PL2 A;  1ABA A;  1D6Z A;  1GSF A;  3LWA A;  5COH A;  2GQK A;  4TOP A;  5IEP A;  3L9V A;  3US3 A;  3EPT A;  1TU8 A;  3UBK A;  2I9H A;  5ECH B;  3UBL A;  4G1M B;  4RI6 A;  2V2G A;  3GKM A;  3RPN A;  1ROA A;  3DGM A;  5HR1 A;  3T8U A;  3H1N A;  4K5S A;  2C0G A;  2B3S A;  4TR1 A;  3DML A;  1ACV A;  1W6Y A;  1M2A A;  3WT2 A;  1CQS A;  1FUW A;  3IV4 A;  1T3B A;  2J23 A;  1RNT A;  2MMN A;  4KND A;  3HY2 A;  3AMO B;  1HNC A;  4MP4 A;  4PGT A;  1FYS A;  4AF2 A;  4K0G A;  1AVL A;  2B6M A;  2SAR A;  5GST A;  5HFK A;  2FUG 2;  5ECM B;  3NUV A;  1G02 A;  2FGT A;  3HCZ A;  3HJM A;  1JBS A;  1GP1 A;  2BMX A;  3FR9 A;  1EOH A;  4MZC A;  1ERV A;  1I0V A;  2YN1 A;  5LCZ A;  1VQ5 3;  4KA0 A;  2CWT A;  1B2X A;  1Q81 4;  4K7O A;  4I97 A;  2YZH A;  3TKP A;  2VO4 A;  3AY8 A;  4GWR A;  1X1W A;  4XDV A;  1AAZ A;  5ECN B;  2CWU A;  2GSR A;  1OUN A;  1YJ9 3;  1FZU A;  3A2X A;  4IGJ A;  2YNX A;  3F63 A;  2K3D A;  2KF6 A;  2YWN A;  2GBX B;  1X1U A;  3T0U A;  4XS4 B;  3GH9 A;  1Q82 4;  3HKR A;  3NQZ A;  4ZL9 A;  1BJX A;  4L8P A;  1U5O A;  1S5A A;  1BSD A;  3F6D A;  3IMA B;  4Q5N A;  4CJN A;  1DYU A;  2W04 A;  2HRA A;  5D9X A;  2NDO A;  9GSS A;  1MEK A;  1OE7 A;  4HI7 A;  2O9U X;  2PZV A;  3GZX B;  5J9C A;  2DMM A;  3BOA A;  3HA9 A;  2VUP A;  2W56 A;  1BRS A;  4P3Y B;  4ILF A;  4OCE A;  2H30 A;  3EC3 A;  4XS6 A;  4MJE A;  3RHC A;  1LNH A;  2GLR A;  2AYT A;  5B6N A;  3TJB A;  4G19 A;  3ERW A;  1T7P B;  3BLZ A;  2RM5 A;  4K9Z A;  1D6U A;  1XWB A;  2D42 A;  2IMJ A;  3HOH A;  1PA3 A;  2M80 A;  3LXZ A;  1W7C A;  3O76 A;  5F06 A;  1ZZY A;  3MSO A;  11GS A;  4YAP A;  2H0H A;  2VL3 A;  4OO5 A;  2XR8 B;  4YQM A;  1J08 A;  1YVS A;  3UB1 A;  3V1W A;  4KFD A;  1BAY A;  2CFD A;  2LNS A;  3EUR A;  3AHW A;  2FCH A;  2OBK A;  2NPB A;  3CSI A;  1IQ8 A;  4IHU A;  4XIH A;  3VK9 A;  1F9M A;  1F3A A;  1YJ6 A;  3HVV A;  5EEO A;  1X9S B;  3OX9 A;  5DJL A;  4BVX A;  2OQE C;  4G10 A;  1BOX A;  4KDU A;  1PKW A;  2DC5 A;  3IHQ A;  1M9A A;  1GD3 A;  1NB5 I;  1KNG A;  2PU9 C;  1G7E A;  1OVN A;  4JZQ A;  3NIV A;  4J5K A;  3UVH A;  3KII A;  2XPE A;  4NWY A;  3SYU A;  3DIE A;  3GAX A;  1V9W A;  2R41 A;  2XHF A;  1GUH A;  9RNT A;  3EIN A;  3EE1 A;  3CMA 3;  1CYV A;  3WR2 A;  2F8A A;  4NHZ A;  2FHE A;  4MJD A;  2VAF A;  5HR3 A;  3GKX A;  4QWT A;  1IK3 A;  2XF3 A;  1UCK A;  3ZG5 A;  3WYW A;  5D81 A;  4LZI A;  3KSP A;  2P5Q A;  3S5C A;  3RDW A;  3FG3 A;  5IIZ A;  3D4T A;  2CH9 A;  2IA7 A;  2KUC A;  2ML6 A;  2YOI A;  4HM3 B;  16GS A;  3LYP A;  1AR0 A;  1EP8 A;  1QFN A;  1K73 4;  4ZB8 A;  4LMV A;  1FW7 A;  2GQL A;  3CC4 3;  1EKM A;  2ZHX B;  3A76 A;  5JWR B;  5ECS A;  5ID2 A;  4H86 A;  1QJG A;  4K1V A;  4WBR D;  1SJW A;  2RUF A;  4XRA A;  3MG3 A;  2XSO B;  1FGO A;  2RNT A;  2XC2 A;  3GN3 A;  4HU9 A;  1LNI A;  3RHB A;  3JUM A;  1F3B A;  1O6J A;  1T1V A;  3HII A;  1SII A;  2FNO A;  5IEN A;  5TGN A;  1GSD A;  4HJ2 A;  2WCI A;  2VCT A;  1SIH A;  3K5T A;  3D5G A;  2CVK A;  4YKF A;  3KCH A;  2FY6 A;  5GSS A;  2W0Q A;  1O7G B;  1JZR A;  5JWQ B;  2H76 A;  1JZW A;  1XWG A;  1MD3 A;  3CBU A;  3ZTL A;  3SX1 A;  2BTO T;  3RGA A;  2E2M A;  3UJM A;  1NDO B;  1S3D A;  1I0X A;  5EL8 A;  4N30 A;  4YQV A;  3PZW A;  5JPU A;  3IBH A;  3HZP A;  1UGI A;  1VGL A;  2VL2 A;  4PQI A;  5EVO A;  5KN0 A;  4OWY A;  2E2V A;  2STD A;  1YQ1 A;  3FG1 A;  3GRD A;  1PQN A;  3GRX A;  5CO3 A;  1RKY A;  1AQW A;  1EEM A;  1Z5Y E;  4TX4 A;  2ZNM A;  3DGY A;  3LGC A;  4TN8 A;  1M99 A;  3TOT A;  3KEB A;  5IG0 A;  1OC8 A;  3UEM A;  3IC4 A;  4PEJ A;  1PGT A;  1OC9 B;  1ZYE A;  4FO5 A;  5IMF A;  2FWG A;  1B8X A;  1NWW A;  2PN8 A;  2PUK C;  4FMD A;  3ZYW A;  3LEF A;  3QFA C;  2QKE A;  4GQF A;  3TRX A;  1IVW A;  5B8B A;  1EP7 A;  4NHF A;  2XBQ A;  4HBR A;  2R5G A;  2VLV A;  1UVZ A;  4PUA A;  1W02 A;  5ECR B;  2HMN B;  1VRS D;  1XIY A;  3L78 A;  4Z2U A;  1I3I A;  2DLX A;  2CT6 A;  1F6M C;  1G96 A;  3BB9 A;  1JB5 A;  3UJ1 A;  3VUR A;  4MMX B;  3X3X A;  1VQN 3;  4I4K A;  1VQ8 3;  1UUV B;  3JUN A;  1VQO 3;  4RQR A;  2LQQ A;  4N0Z A;  1GNE A;  1XVQ A;  1B3S A;  2ALB A;  3EU4 A;  5E59 A;  1N5P A;  2JAD A;  1QAK A;  4LYL B;  3DUK A;  1HQO A;  1QMV A;  5CK6 A;  1M3J A;  3G8Z A;  2AB6 A;  2H70 A;  5HFI A;  3GSS A;  4MDC A;  1OH0 A;  5IO0 A;  3KCM A;  1R4C A;  2JL4 A;  3Q90 A;  3KP8 A;  4WHA A;  1RCK A;  1BSC A;  3R2Q A;  5GAN D;  3GWR A;  1A2J A;  2H0I A;  3RNT A;  1BAN A;  3ZL5 A;  3MYD A;  4EIQ A;  1ERU A;  2KAA A;  1GD4 A;  1B20 A;  3KTL A;  4JF8 A;  3GIX A;  1THO A;  3Q19 A;  2R4V A;  3FEU A;  5GSP A;  5ELJ A;  1GSU A;  2V1M A;  3E99 A;  3K63 A;  4KAE A;  4MF7 A;  4Z2T A;  2C80 A;  4CPK A;  2GU3 A;  2D1W A;  5JBS A;  6GST A;  2CFK A;  2H6X A;  8RNT A;  2Z9S A;  1PX6 A;  4F82 A;  5DBQ A;  3WT1 A;  1O8X A;  1W5Z A;  1DMM A;  3E3E A;  4BA7 A;  2A2P A;  4K7I A;  3F4S A;  1Q40 A;  2CC3 A;  4CY6 A;  3MAK A;  3EE2 A;  4I2U A;  2HZF A;  1X5E A;  1A67 A;  5DAK A;  1NB3 I;  4N6V 0;  3X42 A;  1G6Y A;  1XOB A;  2CVB A;  5LNK e;  2PPT A;  2H0G A;  2K0M A;  1RQM A;  4CW9 A;  2C11 A;  1OAC A;  3O8Y A;  12GS A;  1WPI A;  2CKF B;  3BJ5 A;  4BTW A;  2BT3 A;  1R4Y A;  1B48 A;  4N3V A;  13GS A;  2QIY A;  1N2A A;  3M8N A;  3VWX A;  2X8G A;  3HIG A;  5DCG A;  1W4N A;  4GF0 A;  3WOE B;  1GS3 A;  1KBN A;  2DML A;  2WDU A;  1SKS B;  1LVN A;  1K3O A;  2WOF A;  2O89 A;  1XPV A;  3CCU 3;  1GL8 A;  5F05 A;  3G7I A;  1RNB A;  1EV9 A;  4KFE A;  4IBP A;  2CW9 A;  5EPF A;  3GTU B;  5AI1 A;  4AJ7 A;  1TTO A;  3DGO A;  3HK4 A;  2EIQ A;  5JWO B;  3GV1 A;  3V99 A;  1ULJ B;  2BMO B;  2XRX B;  3VI5 A;  1Z7P A;  1STF I;  1X5D A;  3G6E 3;  1RGH A;  2OOV C;  2X4A A;  1UGH I;  2GSP A;  3KGK A;  1O7W B;  3NV0 A;  2QC7 A;  5IG3 A;  4NPB A;  1SAR A;  4L0U A;  1VQ7 3;  2HXK A;  2OWP A;  3FHK A;  4A5P A;  3CXG A;  2KF3 A;  5FT3 A;  4KCE A;  1GSE A;  3DMC A;  4H3U A;  3UL3 A;  2DSA A;  1KC8 4;  2BO9 B;  4BTX A;  3F8H A;  4WFO A;  1S3A A;  1YI2 3;  2GT6 A;  2P38 A;  2B1X B;  4MF6 A;  2A4V A;  2N5B A;  2IMI A;  2KCD A;  5BVB A;  1S3R A;  3IJE B;  3DGQ A;  4XDW A;  3ISO A;  1AY7 A;  1WMP A;  5ECL B;  4HEA 2;  1NHO A;  2BHM A;  1T8E B;  1WE0 A;  3ZMK A;  1BAO A;  1Z6M A;  1IT8 A;  3CXC 2;  1BVI A;  2J8X B;  1ZCP A;  3CCL 3;  3FKF A;  4PQH A;  2AV4 A;  2MMO A;  1RDS A;  2XSH B;  5IG4 A;  1NO3 A;  1XW5 A;  2PNC A;  3STD A;  3CTF A;  2P0M A;  3CRT A;  5F07 A;  1ZGX A;  2LYX A;  2MYG A;  1MWS A;  2XGL A;  3CCE 3;  5I97 A;  3Q1C A;  1FG4 A;  4R1K A;  3CRU A;  1JFU A;  1JBR A;  3I69 A;  2BNG A;  3QDN A;  5ECP B;  2X64 A;  5J41 A;  1GUL A;  2W9Q A;  1M9B A;  1TXX A;  3KXO A;  1X1X A;  5ELG A;  3PGT A;  3A3T A;  2I81 A;  2YWI A;  6GSP A;  2XFS A;  1E2Y A;  2PBJ A;  2UUG C;  1IQX A;  1AXD A;  4GST A;  5G5F A;  4ECC A;  2O3O A;  2GZZ A;  1JN5 A;  1UCJ A;  2CV4 A;  2X99 A;  1RTU A;  5G2G A;  3ZIV A;  1PU4 A;  1TP9 A;  4CDO A;  2HLS A;  1XWA A;  3TKQ A;  1DET A;  3OWY A;  3SWL A;  4YAV A;  1CQG A;  2VL2 C;  2GVP A;  1SKR B;  1USB A;  1M1X B;  3QFB C;  2GU1 A;  2H74 A;  5A4V A;  4WKW A;  3NXJ A;  3IA1 A;  3IOS A;  1UDI I;  2P0G A;  2OCT A;  3CD6 3;  4HDE A;  2I9W A;  1WMO A;  1IQY A;  1S3C A;  1XWK A;  4QL7 A;  3FZ5 A;  2GDR A;  1W00 A;  1NHY A;  2H71 A;  4WYK A;  5D82 A;  1VQL 3;  3N9J A;  3SBC A;  5KP3 A;  1VQ4 3;  4GL6 A;  3HZ8 A;  1XG8 A;  3M1G A;  1BRI A;  5CRG A;  4IJ3 A;  1DMN A;  3HDC A;  4MJB A;  5D93 A;  1FAA A;  1LJR A;  1THX A;  1YF0 A;  4OFN A;  4L5L A;  1Q9E A;  4HYZ A;  1BNG A;  4CDL A;  2UZ8 A;  3EBY A;  4R9K A;  3EHC A;  2LKU A;  5FGO A;  3FZA A;  4MMZ B;  1KWI A;  2EIR A;  4ZM8 A;  1TRP A;  2KLX A;  4LMW A;  4N6L A;  3H93 A;  1K0N A;  3B4P A;  1BNJ A;  3FR3 A;  3DKS A;  1AQZ A;  4Q5F A;  2HSM A;  3VFI A;  5IMZ A;  2IUK A;  4IEL A;  1FGM A;  1MWR A;  1RLS A;  1BRG A;  1QUW A;  5ECO B;  1US1 A;  2ZDJ A;  1XWC A;  1M2D A;  4KX4 A;  1C54 A;  2OBI A;  3TRQ A;  1ZOF A;  1Q42 A;  2DBC A;  2HZE B;  4XBX A;  2JAC A;  2CIU A;  5CAX A;  1UW1 A;  1GSQ A;  5CXO A;  4CY8 A;  4ECB A;  4FCZ A;  4AKZ A;  1QQ2 A;  4ID0 A;  2C4B A;  1LU4 A;  2L5O A;  3P2A A;  3VWV A;  3H51 A;  4BVY B;  2FXT A;  2YJH A;  4LMI A;  5C04 A;  1BG5 A;  1TRQ A;  1YEP A;  2WOH A;  1BNR A;  1RN7 A;  4FMC A;  5IPH A;  1SYX A;  4K7N A;  3NHX A;  2E2G A;  3MWH A;  1UC7 A;  1YDK A;  2R0C A;  2PWJ A;  1XZO A;  1B2U A;  4MH2 A;  2F56 A;  1RK4 A;  4E8H A;  4ZXG A;  5J9B A;  4USS A;  1SJI A;  4F03 A;  1ON4 A;  4IS0 A;  3BND A;  3LT8 A;  1Q4J A;  5BRT A;  2DJ2 A;  5FHI A;  2CZ2 A;  2SBL A;  2HI7 A;  4XS4 A;  4MK3 A;  1VQ9 3;  4XCS A;  5DDL A;  3UNL A;  5GAP D;  3OW2 2;  1GMR A;  1GSP A;  2FWH A;  4ECJ A;  2MZC A;  3D79 A;  3N54 B;  4JR6 A;  5KOW A;  3QCP A;  1FHE A;  2WRT A;  2E0Q A;  1W2Z A;  2FNQ A;  1K9M 4;  5IF6 A;  1I2F A;  1EUI C;  3EMX A;  6STD A;  2RCD A;  1EGR A;  4KVH A;  2C3Q A;  2WB9 A;  3KH7 A;  3D3L A;  1DBY A;  3HXS A;  5DAL B;  3OV4 A;  1EGO A;  4XB5 A;  5IM9 A;  4MJC A;  1PMT A;  2I1U A;  3MHE A;  4AEQ A;  4K5R A;  4KGI A;  3LTC A;  4HM6 B;  3NOF A;  1PFO A;  3K8N A;  3BCI A;  4GRF A;  1S72 3;  1HKX A;  3JUO A;  2OTL 3;  1GWC A;  5DQY A;  4BTY A;  2I4A A;  1ROV A;  5LC6 A;  1WJK A;  5RNT A;  4HKV B;  4ECI A;  3L9S A;  4G0I A;  1DVC A;  1BYE A;  4MMY B;  5M1A A;  2LS5 A;  2KF5 A;  4RZM A;  2H6Z A;  1NNV A;  3WA2 X;  4HM0 B;  2LV3 A;  3ME8 A;  1QXH A;  3X40 A;  1G0T A;  4MF5 A;  3IC8 A;  3IDV A;  1YGE A;  4KZ1 A;  3B8L A;  1E3V A;  3ECF A;  2C3T A;  3G71 3;  1QMA A;  3HJO A;  3VI7 A;  3TKS E;  4F2I A;  2ZA4 A;  3KN4 A;  4WET A;  3UL6 A;  1SL1 B;  1FA3 A;  3TJG A;  5CLK A;  6GSX A;  1GTI A;  3C7M A;  6GSV A;  3G7J A;  4HAA A;  1K28 A;  4YQU A;  5BU4 A;  5G5E A;  10GS A;  1UCL A;  1CYU A;  1BX9 A;  2MMA A;  1LBK A;  4JR4 A;  4U13 A;  1OC3 A;  2V41 A;  5KOX A;  3DVW A;  1WRY A;  3EX9 A;  1GY7 A;  4J57 E;  4HZB B;  1FO5 A;  3CNX A;  1T00 A;  3M9J A;  4WP5 A;  3QAW A;  4EC0 A;  2VCV A;  3AGO A;  1AQX A;  2B1K A;  2HSY A;  3FF2 A;  4JE1 A;  3E9J B;  4HU7 A;  1W6C A;  4K0N A;  2X8C A;  3KZQ A;  2TRC P;  5EY6 A;  3G4S 3;  3IR4 A;  5IQY A;  1K0O A;  3ZRE A;  2XGN A;  4Q53 A;  5G1K A;  3M9K A;  3FZ9 A;  4RNT A;  5STD A;  2YWM A;  4K1U A;  1LOW A;  1BNS A;  1J2B A;  4LGQ A;  4L8E A;  4NAX A;  2VLU A;  3QK9 A;  19GS A;  4MNN A;  1MWU A;  2IYJ A;  3SVA A;  3TRP A;  3SOY A;  3BNC A;  5AIX A;  5AEW B;  2JQ5 A;  3A5E A;  3GKN A;  4TW5 A;  4IIA A;  2GXF A;  1XFL A;  7STD A;  1R7H A;  5ABR A;  1JZD A;  4GB5 A;  1UA5 A;  4IQ1 A;  3GA4 A;  1GSS A;  20GS A;  4OD7 A;  1SD9 A;  5D9W A;  1GRX A;  3UL5 A;  2DJ1 A;  3ERF A;  4MA9 A;  5IPG A;  1M3I A;  3D21 A;  5GZZ B;  1Y25 A;  2OA7 A;  3PIN A;  3FKA A;  2C4J A;  3LXT A;  1DE2 A;  1AQV A;  4WXT A; 
#chains in the Genus database with same CATH homology
 4J2F A;  2H72 A;  2MMZ A;  1RW1 A;  3I43 A;  2YPM A;  3TUE A;  1TJD A;  2YZU A;  3TDG A;  2KP1 A;  1EEJ A;  1V58 A;  3O6T A;  4HQZ A;  3HJP A;  3F8U A;  1B4Q A;  5LD0 A;  3F3Q A;  3CTG A;  1AUC A;  2GT5 A;  2H1A A;  4BWQ A;  2FWE A;  3EMP A;  4OMV A;  3RAZ A;  1M0U A;  4EO3 A;  1SYR A;  3UOM A;  2ES7 A;  3EWL A;  4TRX A;  4HZ4 A;  4KB3 A;  2IJY A;  1VF3 A;  1HNB A;  4FQU A;  4EDZ A;  1GTU A;  2NTO A;  3KD0 A;  5CRW A;  2AJQ B;  4MLY A;  4KE3 A;  3VWU A;  3TKR A;  2H75 A;  5IOX A;  4F9Z A;  2GZY A;  2VLT A;  1J0F A;  2OAD A;  2GZP A;  1U87 A;  2L5L A;  4K1F A;  1OC9 A;  4MZB A;  2FLS A;  3EVI A;  3FW2 A;  3UMA A;  3DRN A;  5H5S A;  1FOH A;  1EZK A;  3QOU A;  2R0G A;  2PVQ A;  5E4W A;  5KN1 A;  1O81 A;  3IAM 2;  4KCA A;  2H73 A;  2GS3 A;  4V2M A;  3ZVJ D;  2FWF A;  5FWG A;  4X43 A;  3TGZ A;  4V2L A;  5D96 A;  3F0I A;  4TXV A;  2O87 A;  1BQ7 A;  2A2R A;  5F0G A;  3U5R E;  4PQ1 A;  1A8L A;  2F3M A;  1YKC A;  1FB0 A;  4TKY A;  4NV5 A;  1TOF A;  3HVX A;  5D9V A;  1TW9 A;  5CRD A;  2YCD A;  2DKI A;  4WBJ A;  4FH8 A;  4KDX A;  1WIK A;  2K8V A;  3ZRD A;  4L5O A;  5JCW A;  2L57 A;  3G9B A;  2OAC A;  1HD2 A;  3FRC A;  5C00 A;  1WMJ A;  1DSB A;  2PVO C;  3VWW A;  1K3Y A;  4KSO A;  2RII A;  3GH6 A;  3D6I A;  1M2B A;  4OFM A;  1SK0 A;  3HHV A;  4IJI A;  4N10 A;  2A4H A;  2IY2 A;  5IMA A;  3PPU A;  5HQP A;  1G6W A;  1T4Y A;  1V57 A;  3M3M A;  4YKG A;  2OE1 A;  2H1B A;  3LSZ A;  4IN0 A;  2GGT A;  1GLQ A;  1YY7 A;  4QL9 A;  2YJ7 A;  1PN9 A;  1FW1 A;  1K0B A;  4DSS B;  2GST A;  3ZML A;  1OKD A;  3OR5 A;  3ZZX A;  3ZIT A;  4Z2R A;  2FGX A;  1QGV A;  1KEB A;  3CMI A;  3BD2 A;  2YWO A;  1O85 A;  4GLT A;  5H5R A;  2JZT A;  4G0L A;  3F4T A;  1XCC A;  4D73 B;  4FYU A;  3U6V A;  17GS A;  2DIZ A;  2IMF A;  4G9H A;  1ZYN A;  1TI3 A;  2G0F A;  2H66 A;  4NXI A;  2H6Y A;  3GTU A;  1YZX A;  2QA1 A;  5G1L A;  1I9D A;  5HR2 A;  2CQ9 A;  4K8M A;  4HQS A;  3D22 A;  5INY A;  2L4Q A;  3BCK A;  3J7Y k;  1HYU A;  2RUE A;  2EC4 A;  3MDK A;  4FIW A;  4FYC A;  2YAN A;  3A2V A;  2CAQ A;  1IYH A;  2TIR A;  2FA8 A;  4LL4 B;  3GX8 A;  5CRH A;  4ICY A;  5D73 A;  1X9W B;  1TDI A;  3Q18 A;  1K3L A;  2N5A A;  2NVL A;  2LJR A;  2ZUP A;  3VLN A;  2WS2 A;  3LFL A;  2IFQ B;  4BWS A;  1GSY A;  3TJF A;  2OJL A;  2LUS A;  1WOU A;  3FY7 A;  5AN1 A;  2M72 A;  4GTU A;  1K0D A;  2IMK A;  3W6G A;  2LEG A;  4G0K A;  1OAZ A;  5CNW A;  2VL9 A;  3UAP A;  1H75 A;  1PKZ A;  3IE3 A;  1PN0 A;  2R0P A;  2B5Y A;  4PTS A;  1U88 A;  1Y6E A;  5L71 A;  3C8E A;  1JHB A;  4L0W A;  18GS A;  2WZ9 A;  4V1A p;  4OO4 A;  5ECQ B;  3A5W A;  1R5P A;  1GUM A;  1FOV A;  2H01 A;  1TRU A;  1VF4 A;  3I6A A;  3GMF A;  3KH9 A;  2GSS A;  4BL7 B;  2IL3 A;  4WF4 A;  4X0X A;  4IVF A;  1TK0 B;  3TB2 A;  3LJR A;  2KOK A;  4X4J A;  1EOG A;  2VCQ A;  4GXZ A;  3IK7 A;  2HE3 A;  3TCO A;  4G2E A;  3MSZ A;  1I5G A;  4WR4 A;  3TKS A;  5AIV A;  1T4Z A;  1A2M A;  1C72 A;  1A8Y A;  1VF2 A;  5IMC A;  4TXO B;  4POL A;  2LQO A;  3ZLP A;  2PER A;  4TR0 A;  1ZMA A;  4PXO A;  3MNG A;  3PH9 A;  3RPP A;  1A2L A;  3WGD A;  3KMN A;  1W4V A;  2VM2 A;  1DUG A;  3N5O A;  6GSS A;  5F8B A;  4I6X A;  3HVS A;  2O7K A;  2JSY A;  1BED A;  5A4W A;  4WR5 A;  5A5K A;  4YH2 A;  4ACS A;  3KM6 A;  4I2T A;  4HOJ A;  4NV2 A;  3F6F A;  5DCH A;  3DD3 A;  1DE1 A;  1SD8 A;  1JLW A;  4POK A;  2IME A;  5CP1 A;  3ZFL A;  1F2E A;  2M46 A;  4JED A;  2JZR A;  1GH2 A;  1ST9 A;  2IN3 A;  4LLR A;  2HZE A;  2C8U A;  3TOU A;  1XOA A;  2MBS A;  1OYJ A;  2VCW A;  2CVD A;  1W89 A;  2D2Z A;  1B9Y C;  4RQX A;  5J5N A;  3GST A;  3IAS 2;  3D5J A;  4LL1 B;  3FMW A;  1VF1 A;  3CSJ A;  4EDY A;  5DVB A;  1GUK A;  2HRN A;  4F0B A;  2GTU A;  5KEJ A;  1EV4 A;  2F51 A;  2H1G A;  2BJX A;  1PRX A;  2O8V B;  5A4U A;  1YEX A;  2K8S A;  4TR1 B;  2FA4 A;  5IMV A;  2A2S A;  3LQ7 A;  4DEJ A;  3DYR A;  2PMT A;  1SK1 A;  4O5U A;  4N11 A;  3UIW A;  4TR3 A;  4ML6 A;  4DSR A;  2XBI A;  2ON7 A;  5DAL A;  3KP9 A;  1Z7R A;  2H1D A;  1EWX A;  4OCF A;  1GTA A;  5KN2 A;  1ERT A;  2B7K A;  1KTE A;  5AGY A;  4RI7 A;  1MDI A;  4QQ7 A;  1B9X C;  4ML1 A;  5CYY A;  3ZVJ A;  1SL2 B;  4MZW A;  4K2X A;  3C1R A;  2K9F A;  3KIJ A;  1PSQ A;  4AJ8 A;  4V2N A;  5G2Z A;  1TI1 A;  2E7P A;  3LOR A;  4DSQ A;  3FYG A;  1U6T A;  4DVC A;  3HZ4 A;  2R2J A;  6GSW A;  3IK9 A;  1G7O A;  1FB6 A;  1URM A;  4IQA A;  3DVX A;  3FK8 A;  1ML6 A;  3L0H A;  3FR6 A;  4IP1 A;  2L6C A;  3FZ4 A;  2I3Y A;  4I8B A;  2DKH A;  4BPY A;  5G30 A;  3EU3 A;  1MD4 A;  2H19 A;  3GX0 A;  4TR4 A;  1U3I A;  4KF9 A;  4X1U A;  3ZIJ A;  5IO2 A;  4XHM A;  1OE8 A;  2LRN A;  4PNG A;  4V1A g;  3LG6 A;  1FVJ A;  1MDK A;  1R5A A;  4KUN A;  1TKD B;  4BVX B;  1Q98 A;  3M0F A;  4MMM A;  5H5Q A;  1TU7 A;  2HNL A;  2GSQ A;  3ED3 A;  5B6M A;  5J3R A;  1QK8 A;  3APS A;  1H4O A;  4O92 A;  4JU5 A;  3D4M A;  2R37 A;  1O8W A;  3UAR A;  4KSM A;  3I9V 2;  5ECI B;  1SEN A;  5JCU A;  3IHG A;  2QSI A;  3TKS C;  4EE0 A;  1J9B A;  2YP6 A;  5IOW A;  2V6O A;  1TRS A;  2AUV A;  1JLV A;  1TK8 B;  4I5Q A;  4IP6 A;  2OE3 A;  2CZ3 A;  5ID2 B;  1SJZ A;  4O5R A;  2VIM A;  1WP0 A;  5ELA A;  2HRF A;  1A0R P;  3GL3 A;  1JZO A;  5ENU A;  4TVE A;  4O5Q A;  1AC1 A;  2XPD A;  3KJY A;  3Q74 A;  4OFT A;  4IW9 A;  4J56 E;  4Q5Q A;  4ZBB A;  3QMX A;  2WFC A;  4KW6 A;  3F3R A;  4XTS A;  2DJ3 A;  2C1Y A;  4EXJ A;  1GNW A;  3HD5 A;  1XXU A;  4KH7 A;  4Q5R A;  4MJA A;  3ZFB A;  3APQ A;  2V6K A;  3QAV A;  4GSN A;  4NHW A;  3E0U A;  3UVT A;  2AHE A;  2F9S A;  2WGR A;  6GSU A;  3DWV A;  1MDJ A;  2HFD A;  3WGX A;  2HRK A;  2J9H A;  1TRW A;  4LA1 A;  4GQC A;  5DJM A;  2QA2 A;  2GQM A;  2WJU A;  4O7H A;  1OKT A;  2PGT A;  3D0Z A;  1TTZ A;  2L4C A;  2TRX A;  4JRR A;  3BBY A;  3LW9 A;  2IPA A;  4EF0 A;  2QGV A;  1K0C A;  1X0R A;  4KDY A;  1V2A A;  1V98 A;  1Z3E A;  4EUY A;  2LNT A;  2REM A;  2EIO A;  3GNJ A;  2YV7 A;  1NW2 A;  3P8W A;  2VD0 A;  3CYN A;  2VCX A;  3C1S A;  2B1L A;  3GL5 A;  5D8I A;  4AJ6 A;  2LJA A;  2K6V A;  4ZIJ A;  2VCZ A;  1WWJ A;  2C0F A;  2WUL A;  3W8S A;  3TJJ A;  4HZ2 A;  2C0D A;  1AW9 A;  1A23 A;  4ZL7 A;  3QD9 A;  3LYK A;  5ECK B;  1XW6 A;  4XS1 A;  4XRD A;  4MPF A;  3GKK A;  5B7C A;  1MTC A;  3DXB A;  2C0E A;  4MCU A;  2G2Q A;  2B7J A;  4DSS A;  3NZN A;  2NBS A;  2N5F A;  1FVK A;  8GSS A;  1SL0 B;  1R4W A;  2MBT A;  4HS1 A;  5HR0 A;  1HNA A;  1SKW B;  4Z7X A;  2KP2 A;  2OKA A;  4EKZ A;  4MPG A;  4HJM A;  14GS A;  3VPQ A;  4D73 A;  3ME7 A;  1F37 A;  1E6B A;  2X49 A;  4WEY A;  4ISD A;  3EYT A;  2CX3 A;  4ZIL A;  1SJ6 A;  1XW9 A;  2CX4 A;  3O3T A;  3RBT A;  2IIY A;  3P90 A;  5DQS A;  4ZB6 A;  1ZYQ B;  5DAK B;  5CRE A;  4WF5 A;  2B5X A;  2JSZ A;  1AIU A;  1Z6N A;  3QR6 A;  2P31 A;  4AGS A;  3F9U A;  5J4U A;  4F0C A;  3IRA A;  1X5C A;  3APO A;  2L59 A;  1NM3 A;  3GFK A;  4ZB9 A;  2VD1 A;  4N0V A;  4IKH A;  2IFQ A;  3P7X A;  2LST A;  4O32 A;  1ERW A;  3JCM L;  2OE0 A;  2CAI A;  1YKA A;  1N8J A;  3A2W A;  1O7U A;  3W8J A;  1CQH A;  4PNF A;  4K6X A;  1X9M B;  3PR8 A;  1K0A A;  3QPM A;  4POB A;  4PX1 A;  1PX7 A;  2KHP A;  3Q6O A;  4ZBD A;  4K2D A;  3H8Q A;  3IXR A;  4ZBA A;  2FD3 A;  2K18 A;  2L6D A;  3IPZ A;  2HSH A;  3R3E A;  4HUA A;  3L4N A;  2RM6 A;  2B5E A;  3L9U A;  2H8L A;  5HFG A;  4BL7 A;  4MAB A;  4MH3 A;  4FYB A;  1XVW A;  3TJK A;  2ZCT A;  2JU5 A;  3WD6 A;  1M7T A;  3ERG A;  2LRC A;  1K0M A;  1TRV A;  2R6K A;  1UN2 A;  1O73 A;  3QAG A;  2VOC A;  2LTK A;  3H4K A;  1ZL9 A;  7GSS A;  2ON5 A;  1ZGN A;  2CA8 A;  2YV9 A;  3C71 A;  4ZL8 A;  4TXO A;  1V40 A;  2DJJ A;  3GUR A;  1A0F A;  1PD2 1;  1SU9 A;  1R26 A;  4GSS A;  4NMU A;  1ZYP A;  3KTB A;  2HYX A;  4JBB A;  3H79 A;  3G7Y A;  2F8F A;  4RUV A;  4GCI A;  22GS A;  3VPT A;  4CHS A;  2AAW A;  2IMD A;  5B8A A;  4PUR A;  2DJK A;  3GHA A;  2VM1 A;  1GTB A;  1A24 A;  5AIS A;  4EVM A;  1ILO A;  1TK5 B;  3GYK A;  3C73 A;  1XBS A;  4EIP A;  1GLP A;  4PUF C;  5KN3 A;  3S9F A;  2IWT A;  6GSY A;  1B4P A;  1SK2 A;  1U3A A;  3MIX A;  1Z9H A;  5G31 A;  3CSH A;  4EL1 A;  4POM A;  5IMD A;  3A5I A;  3GUS A;  1YF1 A;  3J7Y b;  2X8H A;  2RLI A;  2JZS A;  2LRT A;  2O85 A;  2P5R A;  2LJK A;  4ULX A;  1IYI A;  3HYP A;  2DJ0 A;  3WGE A;  4E8E A;  1NSW A;  3KMO A;  5JCG A;  4BVY A;  1PL1 A;  5D9T A;  2DIY A;  3F4R A;  2C3N A;  2R3X A;  3DEX A;  2V32 A;  2HT9 A;  5BMU A;  1PL2 A;  1ABA A;  1GSF A;  3LWA A;  5COH A;  2GQK A;  4TOP A;  3L9V A;  3US3 A;  3EPT A;  1TU8 A;  3UBK A;  2I9H A;  5ECH B;  3UBL A;  4RI6 A;  2V2G A;  3GKM A;  3RPN A;  5HR1 A;  3H1N A;  4K5S A;  2C0G A;  2B3S A;  4TR1 A;  3DML A;  1ACV A;  1M2A A;  3WT2 A;  3IV4 A;  1T3B A;  2J23 A;  2MMN A;  4KND A;  3HY2 A;  1HNC A;  4MP4 A;  4PGT A;  4AF2 A;  4K0G A;  2B6M A;  5GST A;  5HFK A;  2FUG 2;  5ECM B;  3HCZ A;  3HJM A;  1GP1 A;  2BMX A;  3FR9 A;  1EOH A;  4MZC A;  1ERV A;  2YN1 A;  5LCZ A;  4KA0 A;  4K7O A;  4I97 A;  2YZH A;  3TKP A;  2VO4 A;  3AY8 A;  4GWR A;  1AAZ A;  5ECN B;  2GSR A;  4IGJ A;  3A2X A;  2YNX A;  3F63 A;  2YWN A;  4XS4 B;  3GH9 A;  3HKR A;  4ZL9 A;  1BJX A;  4Q5N A;  3F6D A;  2HRA A;  5D9X A;  2NDO A;  9GSS A;  1MEK A;  1OE7 A;  4HI7 A;  5J9C A;  2DMM A;  3BOA A;  3HA9 A;  2VUP A;  4P3Y B;  4ILF A;  4OCE A;  2H30 A;  3EC3 A;  4XS6 A;  4MJE A;  3RHC A;  2GLR A;  2AYT A;  5B6N A;  3TJB A;  4G19 A;  3ERW A;  1T7P B;  2RM5 A;  4K9Z A;  1XWB A;  3LXZ A;  2M80 A;  1PA3 A;  3O76 A;  5F06 A;  1ZZY A;  11GS A;  4YAP A;  2H0H A;  2VL3 A;  4OO5 A;  4YQM A;  1J08 A;  3V1W A;  1BAY A;  2LNS A;  3EUR A;  2FCH A;  2OBK A;  2NPB A;  3CSI A;  4IHU A;  4XIH A;  3VK9 A;  1F9M A;  1F3A A;  1YJ6 A;  3HVV A;  1X9S B;  5DJL A;  4BVX A;  4G10 A;  4KDU A;  1PKW A;  2DC5 A;  3IHQ A;  1M9A A;  1G7E A;  1KNG A;  2PU9 C;  1OVN A;  4JZQ A;  3NIV A;  3UVH A;  4NWY A;  2XPE A;  3DIE A;  1V9W A;  2XHF A;  1GUH A;  3EIN A;  2F8A A;  4NHZ A;  2FHE A;  2VAF A;  5HR3 A;  3GKX A;  3WYW A;  2P5Q A;  3RDW A;  5IIZ A;  3D4T A;  2KUC A;  2YOI A;  16GS A;  3LYP A;  1EP8 A;  1QFN A;  4ZB8 A;  4LMV A;  2GQL A;  5JWR B;  5ECS A;  5ID2 A;  4H86 A;  4WBR D;  2RUF A;  4XRA A;  2XC2 A;  3GN3 A;  4HU9 A;  3RHB A;  1O6J A;  1F3B A;  1T1V A;  2FNO A;  1GSD A;  4HJ2 A;  2WCI A;  2VCT A;  2CVK A;  4YKF A;  2FY6 A;  5GSS A;  1JZR A;  5JWQ B;  2H76 A;  1JZW A;  1XWG A;  1MD3 A;  3CBU A;  3ZTL A;  2BTO T;  2E2M A;  1S3D A;  5EL8 A;  4N30 A;  4YQV A;  3IBH A;  1VGL A;  2VL2 A;  4PQI A;  5EVO A;  5KN0 A;  4OWY A;  1YQ1 A;  1PQN A;  3GRX A;  5CO3 A;  1AQW A;  1EEM A;  1Z5Y E;  2ZNM A;  3LGC A;  4TN8 A;  1M99 A;  3TOT A;  3KEB A;  1OC8 A;  3UEM A;  3IC4 A;  1PGT A;  1OC9 B;  1ZYE A;  4FO5 A;  5IMF A;  2FWG A;  1B8X A;  2PN8 A;  2PUK C;  3ZYW A;  3LEF A;  3QFA C;  2QKE A;  4GQF A;  3TRX A;  5B8B A;  1EP7 A;  2XBQ A;  2R5G A;  2VLV A;  1UVZ A;  4PUA A;  5ECR B;  1VRS D;  1XIY A;  3L78 A;  4Z2U A;  2DLX A;  2CT6 A;  1F6M C;  3UJ1 A;  3VUR A;  4RQR A;  2LQQ A;  4N0Z A;  1GNE A;  1XVQ A;  2ALB A;  3EU4 A;  5E59 A;  2JAD A;  1HQO A;  1QMV A;  2AB6 A;  2H70 A;  5HFI A;  3GSS A;  4MDC A;  5IO0 A;  3KCM A;  2JL4 A;  3KP8 A;  3R2Q A;  5GAN D;  1A2J A;  2H0I A;  3ZL5 A;  3MYD A;  4EIQ A;  1ERU A;  3KTL A;  3GIX A;  1THO A;  3Q19 A;  2R4V A;  3FEU A;  1GSU A;  2V1M A;  4MF7 A;  4Z2T A;  4KAE A;  2C80 A;  6GST A;  2H6X A;  2Z9S A;  1PX6 A;  4F82 A;  5DBQ A;  3WT1 A;  1O8X A;  3E3E A;  4BA7 A;  2A2P A;  4K7I A;  3F4S A;  4CY6 A;  3MAK A;  3EE2 A;  4I2U A;  2HZF A;  1X5E A;  5DAK A;  1G6Y A;  1XOB A;  2CVB A;  5LNK e;  2PPT A;  2H0G A;  1RQM A;  4CW9 A;  12GS A;  1WPI A;  3BJ5 A;  1B48 A;  13GS A;  1N2A A;  3M8N A;  3VWX A;  2X8G A;  5DCG A;  4GF0 A;  1KBN A;  2DML A;  2WDU A;  1SKS B;  1K3O A;  2O89 A;  1XPV A;  1GL8 A;  5F05 A;  3G7I A;  1EV9 A;  4IBP A;  5EPF A;  3GTU B;  4AJ7 A;  2EIQ A;  5JWO B;  3GV1 A;  3VI5 A;  1Z7P A;  1X5D A;  2X4A A;  3KGK A;  2QC7 A;  4NPB A;  4L0U A;  2HXK A;  3FHK A;  4A5P A;  3CXG A;  5FT3 A;  4KCE A;  1GSE A;  3UL3 A;  2DSA A;  1S3A A;  2GT6 A;  4MF6 A;  2A4V A;  2N5B A;  2IMI A;  3DGQ A;  3ISO A;  5ECL B;  4HEA 2;  1NHO A;  1T8E B;  1WE0 A;  3ZMK A;  1Z6M A;  1ZCP A;  3FKF A;  4PQH A;  2AV4 A;  2MMO A;  1XW5 A;  3CTF A;  3CRT A;  5F07 A;  2MYG A;  1FG4 A;  3CRU A;  1JFU A;  3I69 A;  3QDN A;  5ECP B;  2X64 A;  5J41 A;  1GUL A;  1M9B A;  1TXX A;  3KXO A;  5ELG A;  3PGT A;  3A3T A;  2I81 A;  2YWI A;  1E2Y A;  2PBJ A;  1AXD A;  4GST A;  5G5F A;  4ECC A;  2GZZ A;  2CV4 A;  2X99 A;  3ZIV A;  1TP9 A;  4CDO A;  2HLS A;  1XWA A;  3TKQ A;  3SWL A;  4YAV A;  1CQG A;  2VL2 C;  2GVP A;  1SKR B;  1USB A;  3QFB C;  2H74 A;  5A4V A;  4WKW A;  3IA1 A;  3IOS A;  2P0G A;  4HDE A;  1S3C A;  1XWK A;  4QL7 A;  3FZ5 A;  2GDR A;  1NHY A;  2H71 A;  3N9J A;  3SBC A;  3HZ8 A;  3M1G A;  5CRG A;  4IJ3 A;  3HDC A;  4MJB A;  5D93 A;  1FAA A;  1LJR A;  1THX A;  1YF0 A;  4OFN A;  4L5L A;  2UZ8 A;  2LKU A;  3FZA A;  2EIR A;  2KLX A;  4LMW A;  3H93 A;  1K0N A;  3FR3 A;  3DKS A;  4Q5F A;  2HSM A;  3VFI A;  5IMZ A;  4IEL A;  5ECO B;  1QUW A;  1XWC A;  1M2D A;  4KX4 A;  2OBI A;  3TRQ A;  1ZOF A;  2DBC A;  2HZE B;  2JAC A;  5CAX A;  1GSQ A;  4CY8 A;  4ECB A;  1QQ2 A;  4ID0 A;  1LU4 A;  2L5O A;  3P2A A;  3VWV A;  4BVY B;  5C04 A;  2YJH A;  1BG5 A;  1YEP A;  5IPH A;  1SYX A;  4K7N A;  2E2G A;  3MWH A;  1UC7 A;  1YDK A;  2R0C A;  2PWJ A;  1XZO A;  4MH2 A;  1RK4 A;  4E8H A;  4ZXG A;  5J9B A;  4USS A;  1SJI A;  4F03 A;  1ON4 A;  4IS0 A;  1Q4J A;  5BRT A;  2DJ2 A;  5FHI A;  2CZ2 A;  2HI7 A;  5DDL A;  4XS4 A;  4MK3 A;  4XCS A;  5GAP D;  2FWH A;  4ECJ A;  2MZC A;  4JR6 A;  5KOW A;  3QCP A;  1FHE A;  2WRT A;  2E0Q A;  3EMX A;  1EGR A;  2C3Q A;  2WB9 A;  3KH7 A;  1DBY A;  3HXS A;  5DAL B;  1EGO A;  5IM9 A;  4MJC A;  1PMT A;  2I1U A;  4K5R A;  4KGI A;  3NOF A;  3K8N A;  3BCI A;  4GRF A;  1GWC A;  5DQY A;  2I4A A;  1WJK A;  4ECI A;  3L9S A;  4G0I A;  1BYE A;  2LS5 A;  2H6Z A;  2LV3 A;  3ME8 A;  1QXH A;  1G0T A;  4MF5 A;  3IC8 A;  3IDV A;  2C3T A;  3HJO A;  3VI7 A;  3TKS E;  4F2I A;  4WET A;  1SL1 B;  3TJG A;  6GSX A;  1GTI A;  3C7M A;  6GSV A;  3G7J A;  4YQU A;  5G5E A;  10GS A;  1BX9 A;  2MMA A;  1LBK A;  4JR4 A;  1OC3 A;  2V41 A;  5KOX A;  3DVW A;  1WRY A;  4J57 E;  1FO5 A;  1T00 A;  3M9J A;  3QAW A;  4EC0 A;  2VCV A;  1AQX A;  2B1K A;  2HSY A;  4JE1 A;  3E9J B;  4HU7 A;  4K0N A;  2X8C A;  3KZQ A;  2TRC P;  5EY6 A;  3IR4 A;  5IQY A;  1K0O A;  3ZRE A;  5G1K A;  3M9K A;  3FZ9 A;  2YWM A;  4L8E A;  4NAX A;  2VLU A;  19GS A;  4MNN A;  2IYJ A;  3TRP A;  5AIX A;  3GKN A;  4TW5 A;  1XFL A;  1R7H A;  5ABR A;  1JZD A;  1UA5 A;  4IQ1 A;  3GA4 A;  1GSS A;  20GS A;  4OD7 A;  1SD9 A;  5D9W A;  1GRX A;  2DJ1 A;  4MA9 A;  3ERF A;  5IPG A;  3D21 A;  5GZZ B;  1Y25 A;  2OA7 A;  3PIN A;  2C4J A;  3LXT A;  1DE2 A;  1AQV A;  4WXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...