1JZDA

Dsbc-dsbdalpha complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
GAMADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thiol:disulfide interchange protein dsbc
publication title The Disulfide Bond Isomerase DsbC is Activated by an Immunoglobulin-fold Thiol Oxidoreductase: Crystal structure of the DsbC-DsbDalpha complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 66
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1jzdA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jzdA02
2L57A 2N5BA 4F03A 1N8JA 2CZ2A 1AW9A 3GL3A 1Z5YE 3KTLA 2K9FA 4L5OA 3UVTA 2YN1A 2PPTA 3GH6A 4IQAA 4GSSA 3APOA 2I9HA 5H5SA 1DSBA 3IE3A 1KTEA 5IPHA 2B1LA 3ERWA 4QL9A 1C72A 3QAGA 3HCZA 3CSHA 1OVNA 3TJKA 5IOXA 1PL2A 1GRXA 2VCVA 3NIVA 3O76A 4V2LA 4XS4A 2XC2A 2OACA 5B8BA 2I81A 1XWGA 4J56E 4D73A 6GSXA 3UOMA 3PINA 3GTUB 1GTIA 1GTAA 1QQ2A 20GSA 3GMFA 1AQXA 2LNSA 4HZ2A 4IVFA 1ZOFA 1JLWA 1J9BA 3QCPA 3L9UA 3CTGA 4ZB8A 4CDOA 2H1GA 4EE0A 2VD1A 2HE3A 3FZ5A 3HJPA 1SL0B 3VWVA 4BPYA 5DALB 2CAIA 1K0BA 11GSA 3GKKA 4MJEA 4L5LA 4XRDA 2R4VA 2I1UA 1SD8A 4DSSA 1YDKA 3MNGA 2M46A 4F2IA 2H6XA 3Q6OA 2C3NA 3J7Yb 1T4YA 4GTUA 4POLA 2TRXA 3ME7A 1GNWA 4GF0A 3VWUA 1JLVA 3A2XA 5IMDA 2EIQA 2F3MA 4TR1A 1GSSA 5CAXA 5KN0A 3FZAA 3DD3A 3QFAC 2X8HA 4KCAA 2GT6A 2CQ9A 5F8BA 3KD0A 1EP7A 2B7JA 1OAZA 1TP9A 3CMIA 2X8GA 1ML6A 1WE0A 3IK7A 3EURA 1SK2A 1M2AA 5INYA 5DCGA 3RPPA 3ISOA 3KM6A 2IMKA 5JWQB 4TXOA 4LL1B 2Z9SA 2LEGA 1WRYA 1SYXA 2KHPA 2F9SA 3P7XA 1MDKA 4PNGA 2C3TA 2ES7A 1O8XA 1XXUA 3KH9A 3FEUA 4JEDA 2EIRA 3M1GA 1ZYQB 5LCZA 2CZ3A 3TKPA 1JZWA 2LV3A 5JCGA 4KCEA 2VL3A 4JR6A 3DYRA 2OBKA 3IC4A 2EC4A 5LNKe 3CRTA 3H79A 4KW6A 5DVBA 2YWNA 4J57E 2J23A 2WGRA 1GSUA 3I43A 4IELA 1TXXA 4EC0A 2VUPA 2M80A 4HU7A 1BG5A 4KDYA 3ZRDA 1A8LA 4N11A 5ECOB 4ULXA 2V6OA 1PX6A 3FR3A 1A2MA 3M8NA 4TR4A 1AC1A 1VGLA 4V1Ap 4XRAA 4TKYA 2WFCA 4ML6A 2DMMA 4O5RA 1ZGNA 3FKFA 2OA7A 2DLXA 1AQVA 3VWWA 9GSSA 4HQZA 2C0FA 1FB0A 1ERVA 4ECIA 4N10A 3Q74A 4LLRA 3HKRA 4DSQA 2R37A 2J9HA 2BTOT 1SKSB 1VF3A 2GSQA 3VK9A 4MZBA 5IMCA 2K18A 3CTFA 3GX8A 5DCHA 4RI7A 2LS5A 2YWMA 2O7KA 2GQMA 3IDVA 4NV2A 3D4MA 3ZIVA 3ZFLA 1TDIA 3GFKA 4GSTA 2CA8A 3G7YA 1R7HA 2H70A 1SK1A 2YJHA 5GSSA 3TKQA 2DC5A 4EL1A 2ZNMA 1X9WB 4G9HA 1YKAA 3IAS2 3HJOA 1R5AA 5G1KA 3AY8A 4RI6A 2MMOA 2G2QA 1NM3A 4XIHA 2H1AA 3WT2A 2ZCTA 3P8WA 3H93A 4OO4A 1SJIA 1GSFA 1SK0A 1Z6NA 4MF5A 1YF1A 2C1YA 2PN8A 1EZKA 2C3QA 4EF0A 3D4TA 1LU4A 5F06A 1FAAA 3ERFA 2V32A 2HRNA 1DBYA 1LJRA 2HLSA 4OFTA 1YF0A 1TKDB 1BX9A 1TI1A 3KP9A 2MBSA 6GSTA 1ABAA 1NHOA 1OC9B 4QQ7A 4GXZA 3TOUA 5G30A 4MJCA 3EE2A 4ZBAA 1XBSA 1PMTA 3M9JA 5D9WA 1CQHA 1A23A 2AB6A 1XWKA 1B9YC 2OE0A 3P90A 5IMVA 2KP2A 1TRSA 1SL1B 1OE8A 2AUVA 2B1KA 3KZQA 1GSQA 2VLUA 1EOGA 5DDLA 5ECMB 2IMDA 3GH9A 1WP0A 5CRWA 2WJUA 5G2ZA 5GSTA 3TKRA 1B8XA 2QKEA 2DJJA 3CXGA 1V98A 2E0QA 2P5QA 3O3TA 3ZMKA 1U87A 2L5LA 4HEA2 1OC3A 1ERTA 2DMLA 4NMUA 14GSA 1A8YA 2OE3A 1TK8B 3F4RA 1WWJA 3U6VA 3NZNA 2H1DA 1UC7A 5AN1A 1FG4A 3A2WA 2JL4A 1HQOA 1OC8A 1JZRA 2HI7A 2OKAA 1QFNA 1SKWB 4HUAA 1ZL9A 2P31A 18GSA 2LUSA 4D73B 1K0MA 2WRTA 3BJ5A 2VLVA 3SWLA 3TJGA 4XS1A 3E9JB 3DGQA 3DXBA 4FYCA 2VAFA 2FD3A 3RHBA 3QOUA 2IJYA 2X99A 2HZEA 5JWRB 1M2BA 2YCDA 1ON4A 2PVQA 1QK8A 3KIJA 4EDYA 4K7IA 4MLYA 1FW1A 4CHSA 4EO3A 4IBPA 3GIXA 5F05A 2H1BA 1CQGA 3F8UA 5IOWA 4ECBA 5C04A 4N30A 13GSA 1YZXA 5CREA 1TJDA 2GZZA 1Y6EA 3CSIA 4OFNA 4O7HA 3APQA 2L4QA 3ERGA 1GUHA 1TRUA 1WJKA 1A0FA 4BWQA 4MP4A 1PGTA 1WPIA 1AIUA 5G31A 1Q4JA 5IO2A 3D5JA 4PXOA 3TRXA 1J0FA 4WBRD 3QFBC 1JFUA 1BYEA 2GS3A 3EU4A 4CW9A 1M0UA 3I6AA 6GSSA 3EINA 1T00A 3GHAA 4Q5FA 2L6DA 1URMA 3DEXA 3GYKA 1THOA 1KNGA 4IJ3A 2NPBA 1UN2A 5FHIA 5B8AA 1DE1A 1HNBA 4WBJA 4K7OA 2R6KA 2OE1A 3EMPA 1TTZA 1KEBA 3GUSA 2VIMA 2JACA 3GN3A 3CBUA 4PX1A 2H72A 4HOJA 1K0OA 2E2MA 2QGVA 1H75A 3DMLA 1NSWA 4ZXGA 1TW9A 1GUKA 2YV9A 4TXVA 4F0BA 1SJ6A 1M9BA 5DQYA 3FZ9A 4OO5A 4I5QA 2MZCA 3LGCA 2O8VB 2IIYA 2GZPA 1SYRA 3Q18A 5CO3A 5G5EA 4HQSA 5D93A 5L71A 4F0CA 2DIYA 4GLTA 1X9SB 2FY6A 1IYIA 3F4TA 4JE1A 2FGXA 4MZCA 1SD9A 3RPNA 1XVWA 2KP1A 1K3LA 4DSRA 4EUYA 1W4VA 1ERUA 1PD21 2GT5A 4MA9A 3TB2A 2ON7A 2REMA 2RM5A 2QSIA 3VPQA 1T1VA 4WKWA 4E8HA 3LWAA 3SBCA 4PGTA 3WD6A 2IMEA 2GSSA 5F0GA 4IN0A 5G1LA 1AXDA 2PVOC 5CP1A 4IJIA 4BA7A 3KMOA 2YWIA 5EL8A 2F8AA 1OE7A 2WS2A 3IBHA 2BMXA 4ZL7A 3IV4A 1PKWA 2TRCP 2FA4A 5E59A 4H86A 3EVIA 1XVQA 1XOBA 4PUFC 4YH2A 4F9ZA 4GSNA 4J2FA 5HR2A 3KTBA 4ISDA 1XWAA 1FVKA 2B5XA 2L4CA 2HXKA 4IQ1A 3FK8A 4L0UA 4G10A 4OCFA 5DJMA 2K8SA 2WCIA 1EEMA 1XWCA 1PN9A 2HFDA 3ZVJA 2PERA 1X5DA 1M2DA 2MBTA 3FW2A 1T8EB 2GVPA 3FHKA 3LXZA 5J41A 2JZSA 3DKSA 5J9BA 4XCSA 1E2YA 2LSTA 2H30A 1K0DA 1GSDA 1I9DA 3BCKA 2A2RA 4NHZA 2PGTA 4POBA 3WYWA 5ABRA 5FT3A 2I4AA 2VM1A 3CRUA 4WXTA 4WETA 4O92A 4KDUA 1YY7A 1GNEA 4L0WA 1PL1A 2R3XA 5H5RA 3VWXA 3WGEA 2A4VA 1BJXA 2V1MA 5J3RA 19GSA 4DVCA 3A2VA 3KCMA 4O32A 1X5EA 5EY6A 4I6XA 3GNJA 1O85A 5J5NA 1K3OA 4HU9A 1Q98A 4POKA 3H4KA 5H5QA 4NWYA 2VD0A 4XHMA 3ZIJA 1V2AA 2AAWA 1ILOA 1QXHA 3O6TA 5GAND 3LEFA 1RK4A 3C8EA 5LD0A 1XWBA 10GSA 1MD3A 1M7TA 1TU8A 5DAKA 1EOHA 2F8FA 1S3DA 1LBKA 4HI7A 3F3QA 2LKUA 4OD7A 4XS6A 5IM9A 3GKMA 2YZHA 5HFIA 2GGTA 1V58A 3I69A 3LFLA 2MMZA 3FY7A 1N2AA 1T4ZA 3GKNA 4HZ4A 4GWRA 4EKZA 4OFMA 2GQKA 2YOIA 3D21A 3L78A 5ECPB 3VI7A 3ZLPA 1IYHA 3FR6A 3W8JA 1G6YA 2IFQB 5G5FA 2CX3A 5DQSA 3KEBA 4FIWA 3VURA 1AAZA 4YQMA 2C4JA 4PNFA 5E4WA 2ALBA 1GTBA 1F3AA 4WR5A 3TDGA 1HD2A 3TKSE 3ED3A 5DJLA 5GAPD 3ME8A 3W8SA 5D96A 4YAVA 3A5WA 2AV4A 4ILFA 5DALA 4Q5RA 2VCZA 3L9SA 2B5YA 3K8NA 4ZL8A 1B9XC 5ELGA 5IO0A 2FWEA 2DSAA 2DIZA 5ID2B 4ECCA 1Z9HA 2V6KA 2IL3A 2CVDA 3GX0A 1OYJA 1O73A 3M9KA 4KNDA 3IXRA 2C0DA 1GP1A 2L59A 2H0HA 2L6CA 4BWSA 2VCTA 2FCHA 2C80A 5J9CA 4ZB9A 3JCML 4K0NA 3TCOA 3C1RA 3UMAA 2X64A 2V41A 3HYPA 2NDOA 5ECIB 4MCUA 1TU7A 1WMJA 4V1Ag 4XTSA 1XIYA 1GLPA 2MYGA 1NW2A 4IW9A 4PQ1A 2L5OA 3GRXA 2KUCA 1V9WA 2YWOA 5ENUA 2XBIA 5KN1A 2H01A 4AJ6A 2JZTA 3DVXA 1ST9A 1O7UA 5CRGA 2PWJA 1QGVA 6GSWA 3RBTA 4ZIJA 1EWXA 3G9BA 5EPFA 3GKXA 2RM6A 5ECRB 1YEPA 1PQNA 2WZ9A 2CX4A 3CYNA 2KLXA 3PH9A 1EGRA 1R4WA 2RUFA 3MAKA 2GDRA 1GUMA 2HRFA 1GTUA 4KDXA 2G0FA 1NHYA 1F9MA 2LRTA 3VPTA 2OBIA 5HR0A 1T3BA 1O6JA 2LQOA 4JU5A 1JZOA 2HT9A 2JU5A 1K0CA 4RUVA 5IMAA 1EV4A 1X9MB 4MF6A 1KBNA 2H66A 5AIXA 1U3IA 4F82A 4MABA 5B7CA 4P3YB 5JCWA 3HD5A 1F37A 1THXA 1PX7A 3HDCA 1GULA 4ZBBA 4ML1A 1QUWA 4XS4B 4V2MA 4TVEA 2PBJA 5ECLB 2PMTA 1MEKA 3GL5A 3GURA 2LQQA 4N0ZA 3W6GA 1V57A 3E0UA 4NXIA 1SKRB 2CT6A 5ECQB 4QL7A 1Z6MA 2IMIA 3RAZA 1GH2A 4ECJA 1K3YA 1HYUA 3D22A 2FA8A 3N9JA 4TW5A 2AHEA 1GLQA 4ZB6A 2B6MA 3LQ7A 3TKSC 2GQLA 3ZREA 3J7Yk 4X43A 2B3SA 1A2JA 1EV9A 4HJ2A 4KE3A 2VL2C 22GSA 5HFKA 1FB6A 4FYUA 1G7OA 4DSSB 2JADA 5D8IA 5ELAA 1DE2A 4AF2A 3IRAA 1GL8A 2XPEA 3C7MA 2IWTA 2FWFA 2IY2A 1SL2B 1B4PA 1ZMAA 5D73A 4TR1B 2VCWA 1H4OA 2OADA 4KAEA 4K2DA 4K0GA 1XW9A 2IN3A 2RLIA 2FWGA 1GWCA 5IPGA 5HFGA 3UVHA 2LTKA 1DUGA 2C0EA 1FO5A 2YANA 4IGJA 16GSA 3CSJA 4MZWA 3GA4A 4MH2A 1OC9A 2O87A 2LJRA 3UAPA 1J08A 3BBYA 4TXOB 2NBSA 3TJBA 5J4UA 3D6IA 4K1FA 2K6VA 4TOPA 3EWLA 4K9ZA 2LJKA 3C73A 2H8LA 3IR4A 4I8BA 5GZZB 4PQIA 2VLTA 3DVWA 3H8QA 4KGIA 2JZRA 1PRXA 2XHFA 5ECSA 2R2JA 5HQPA 2LRCA 3ZTLA 7GSSA 5CRHA 2X8CA 3HHVA 3ZFBA 3FRCA 3PGTA 4X0XA 2DJ0A 1FHEA 2EIOA 3LG6A 3UEMA 3LYKA 3QAWA 1E6BA 3IHQA 1ACVA 4KSMA 1O8WA 3QR6A 4NV5A 4IP6A 2VOCA 3DWVA 4LA1A 3F63A 3M0FA 1YQ1A 2H6YA 2I3YA 5JWOB 3KXOA 2YJ7A 17GSA 5IQYA 4FYBA 1F6MC 2PUKC 1Z3EA 4I2UA 3F6DA 5DAKB 1PSQA 4HDEA 3TJFA 5AGYA 1UVZA 4TR3A 1X5CA 3FZ4A 5HR3A 2IMFA 4JRRA 1XCCA 4MK3A 3R2QA 5COHA 1MD4A 3V1WA 3KJYA 4PQHA 5B6MA 3D0ZA 3MSZA 3TOTA 2K8VA 1A0RP 1VF2A 3UJ1A 2A2SA 5A5KA 3RDWA 1XZOA 4MDCA 1OKDA 5ECNB 3MWHA 1FOVA 1W89A 2B5EA 3RHCA 3S9FA 3GSTA 1B4QA 2C8UA 3N5OA 2D2ZA 4POMA 4WF5A 2RUEA 3HY2A 1S3AA 4BVYA 1MDJA 3HA9A 4KUNA 4RQRA 3APSA 4KB3A 2H75A 2GZYA 2LRNA 4HJMA 5CYYA 2N5AA 2WULA 1WOUA 1TRVA 4LMVA 2IYJA 4JBBA 4K7NA 2P0GA 5JCUA 4ID0A 4MJBA 1TK0B 3HZ8A 3WGDA 3UARA 2MMNA 3TUEA 3VFIA 2TIRA 2WDUA 3C71A 2CVKA 3UIWA 2FHEA 5DBQA 2CV4A 3L9VA 2H74A 4IKHA 4JZQA 1M9AA 2V2GA 1EP8A 1SENA 1FVJA 3LYPA 3Q19A 2QC7A 1PKZA 3F4SA 2H76A 3U5RE 1VRSD 1TOFA 5D9VA 2NTOA 4IP1A 4X1UA 4NHWA 1EEJA 3IPZA 1R5PA 1BEDA 3KGKA 5KN2A 4Z7XA 3MDKA 1B48A 4GRFA 2N5FA 3ZVJD 4IHUA 5CNWA 3GTUA 2B7KA 3E3EA 5D9XA 4G19A 4MH3A 3LSZA 2JSZA 3KH7A 1ZCPA 1AQWA 4K6XA 2HYXA 3FYGA 4OCEA 2DJ2A 3WGXA 2MMAA 3US3A 1F3BA 2XPDA 1UA5A 4HS1A 3H1NA 3HXSA 4OMVA 2O85A 1V40A 1XPVA 4G2EA 4BVXA 1XFLA 1XW6A 1I5GA 4DEJA 5A4VA 3ZZXA 4GQFA 3HVVA 4EVMA 2F51A 3BOAA 3F6FA 5A4WA 1G0TA 2DBCA 2KOKA 2C0GA 2VL9A 3BD2A 1YJ6A 5ECHB 2HZEB 2DJ3A 2CVBA 4KX4A 4I2TA 3IOSA 4WR4A 2CAQA 2OJLA 1XW5A 3HJMA 3HZ4A 4K8MA 3G7JA 2AJQB 3FR9A 4MMMA 3UBKA 3IAM2 4TN8A 2HZFA 4MF7A 2AYTA 5KN3A 1HNAA 4E8EA 4EDZA 4NAXA 2O89A 2FWHA 3A3TA 3UL3A 5IMFA 1F2EA 1A24A 3QPMA 1G7EA 6GSUA 4YAPA 1JZDA 1Y25A 2LJAA 3LJRA 2DJKA 2GSRA 4JR4A 2HSYA 3UBLA 4IS0A 4BL7A 6GSYA 4TRXA 3TRPA 2H71A 4KA0A 5CRDA 4PURA 2GLRA 1M99A 3VLNA 1USBA 4PUAA 1AUCA 2VO4A 1U6TA 4V2NA 2E7PA 2XBQA 3P2AA 3KMNA 4EXJA 1S3CA 1SJZA 4YQVA 2P5RA 1XOAA 1ZYEA 5C00A 5EVOA 2GTUA 1G6WA 4YQUA 2YV7A 2VCXA 3L0HA 4AJ7A 1QMVA 4WEYA 1O81A 4MJAA 5AISA 3VI5A 2VCQA 5HR1A 3GV1A 3LORA 5IMZA 2VM2A 5B6NA 2JSYA 4I97A 2IPAA 1TRWA 4OWYA 1WIKA 3TRQA 1TK5B 5FWGA 4TR0A 2FUG2 3EU3A 1GSYA 2H19A 1OKTA 1R26A 3EMXA 1Z7PA 1RW1A 4FO5A 4AGSA 2M72A 1ZZYA 4NPBA 4GCIA 1GSEA 4LMWA 2RIIA 1A2LA 2IFQA 4RQXA 3NOFA 4GQCA 3DIEA 2PU9C 1MTCA 1K0NA 2GSTA 4N0VA 12GSA 5A4UA 2YNXA 3G7IA 5F07A 1K0AA 3F9UA 1YKCA 3TKSA 1Z7RA 1HNCA 3BCIA 2BJXA 4AJ8A 3QDNA 4ZILA 1SU9A 5IIZA 2VL2A 3DRNA 3TGZA 3LXTA 3F3RA 4ZL9A 3EC3A 4Q5QA 4ACSA 3ZYWA 2ZUPA 3ZITA 1U3AA 3C1SA 3M3MA 4KSOA 3GSSA 5ID2A 3KP8A 3IK9A 1YEXA 3HVXA 5ECKB 3L4NA 4L8EA 2H0GA 4MPFA 3QAVA 3OR5A 2WB9A 3IA1A 2FLSA 3EYTA 4LL4B 3QMXA 1T7PB 3HVSA 3I9V2 2H6ZA 2LNTA 4MPGA 1X0RA 1MDIA 2E2GA 1RQMA 3F0IA 5AIVA 1VF4A 2NVLA 2YZUA 1U88A 2YPMA 4WF4A 2FNOA 1VF1A 3ZL5A 1PA3A 3PR8A 1JHBA 2H73A 2R5GA 4ZBDA 2DJ1A 3TJJA 5D9TA 2ON5A 2H0IA 3WT1A 8GSSA 4FH8A 4KH7A 1BQ7A 3ZMLA 1BAYA 3QD9A 2HNLA 6GSVA 4Q5NA 1TI3A 2HSHA 1ERWA 5KEJA 2YP6A 1EGOA
chains in the Genus database with same CATH superfamily
2L57A 2N5BA 4F03A 1UCIA 2P38A 1N8JA 2CZ2A 2WGQA 1AW9A 3JUPA 3GL3A 1Z5YE 2IUKA 3KTLA 2K9FA 1B2ZA 4L5OA 1I70A 3UVTA 1MOLA 4O02B 2YN1A 2PPTA 3GH6A 1JRQA 4IQAA 1ZYPA 3D9RA 4GSSA 1M1XB 1BANA 3APOA 2I9HA 5H5SA 2GBXB 3KIIA 1DSBA 3IE3A 3UB1A 2R0PA 2KF5A 3G6E3 1KTEA 5IPHA 2B1LA 3ERWA 4K2XA 4QL9A 1C72A 4IPBA 3QAGA 2HRKA 3HCZA 1Q824 3CSHA 1OVNA 3TJKA 3MPHA 5IOXA 1PL2A 4LSOA 1GRXA 2W2CA 2VCVA 1A67A 3NIVA 2D42A 5RNTA 3WA3A 2QA2A 3O76A 3GSPA 4V2LA 4XS4A 2XC2A 2OACA 5B8BA 2I81A 1XWGA 4J56E 4D73A 6GSXA 4JF8A 3UOMA 3PINA 2BMRB 5ELJA 3S28A 3GTUB 3LYGA 1IT8A 1GTIA 1GTAA 4HOHA 1QQ2A 3F40A 20GSA 3GMFA 1LOWA 1D6UA 1AQXA 2LNSA 4HZ2A 1S723 1VQL3 4IVFA 1ZOFA 1JLWA 4HM4B 2WOHA 1N8R4 1J9BA 3QCPA 1JB4A 1TTOA 4WYKA 1QJGA 1VQQA 3FGYA 1ULJB 1R4YA 4K5RA 1BNRA 3L9UA 3CTGA 4ZB8A 1BSCA 2H1GA 4CDOA 4EE0A 3F14A 3FG3A 2VD1A 2HE3A 1RKYA 3FZ5A 4H3UA 3HJPA 1SL0B 3VWVA 3FG1A 3DGNA 4PTSA 1B2UA 5DALB 4BPYA 2CAIA 1K0BA 11GSA 4ICYA 3B4OA 3GKKA 2GXFA 4MJEA 4L5LA 4XRDA 2BMOB 2R4VA 1YHQ3 2I1UA 4BU4A 1SD8A 2XGLA 4DSSA 4G0KA 1YDKA 3MNGA 2M46A 4F2IA 1OH0A 2H6XA 3Q6OA 2C3NA 1UUWB 3J7Yd 3J7Yb 1T4YA 4GTUA 1A2PA 4POLA 2ML5A 2TRXA 1DYUA 3H51A 1GNWA 3ME7A 4GF0A 1TU5A 1UCKA 3VWUA 4OVMA 5AEWB 1JLVA 3A2XA 5IMDA 2EIQA 2F3MA 3SX1A 4TR1A 1GSSA 5CAXA 5AIIA 3NV0B 5KN0A 3B7CA 3FZAA 3DD3A 3QFAC 4PEJA 2X8HA 4KCAA 3FSDA 3EHCA 1GY6A 3PGBA 2GT6A 2CQ9A 5F8BA 3KD0A 1W7CA 1EP7A 4R4KA 2B7JA 1OAZA 4XBYA 3S5CA 1TP9A 3CMIA 2X8GA 2OTL3 1ML6A 1WE0A 1X1XA 3IK7A 3EURA 3F8XA 4STDA 1JKGB 5AIHA 1EA2A 4RZMA 1SK2A 2V1LA 1M2AA 5INYA 5DCGA 3RPPA 3ISOA 3IMAB 1VQP3 1QMAA 3KM6A 2IMKA 5JWQB 1I8VA 3CCU3 1VQ43 4TXOA 4LL1B 2Z9SA 2LEGA 1WRYA 2CC3A 1SYXA 2KHPA 2F9SA 4J8TA 2SBLA 3P7XA 1NO3A 4N6NB 1MDKA 4PNGA 4BL7B 2C3TA 3URPA 2ES7A 1BAOA 1JV2B 5AYRB 1O8XA 1XXUA 3KH9A 3FEUA 5GSPA 2OTJ3 4JEDA 2EIRA 3M1GA 1YGWA 5LCZA 1ZYQB 5CF1A 2CZ3A 4G0IA 3TKPA 1RDSA 1JZWA 1IVVA 5DREA 2LV3A 5JCGA 4KCEA 3UJMA 1BUJA 2AAEA 2VL3A 2CIUA 4JR6A 3DYRA 2OBKA 3IC4A 2EC4A 3WOEB 2JQ5A 3PS8A 5LNKe 3CRTA 3H79A 4KW6A 2QEX3 4EV2A 5DVBA 2YWNA 4J57E 2J23A 2WGRA 1GSUA 2WGOA 3I43A 4IELA 3NQZA 1TXXA 4TX4A 4EC0A 2VUPA 4K5SA 1CEWI 2YFLB 1A2VA 2M80A 4HU7A 4R80A 1FGRA 1IV9A 1BG5A 1FW7A 4KDYA 3ZRDA 4HSCX 1IQXA 1A8LA 4N11A 3F9SA 5ECOB 2HMLB 4ULXA 1K28A 2V6OA 1PX6A 3FR3A 1A2MA 3NUVA 1BNFA 3M8NA 4TR4A 2OOVC 3RGRA 1AC1A 1VGLA 2P05A 1QAFA 4V1Ap 4XRAA 4CY6A 1B21A 4TKYA 4YKFA 2W0QA 2WFCA 5CK6A 2DMMA 4ML6A 4O5RA 1ZGNA 3FKFA 4HM1B 2OA7A 2DLXA 1AQVA 3VWWA 3L0RA 1W2B2 1RLSA 9GSSA 4HQZA 2C0FA 1KWIA 1FGQA 4HBRA 5D81A 1JB2A 1FB0A 1ERVA 4ECIA 4N10A 3Q74A 4LLRA 1RCLA 1O7NB 1OPYA 5JPUA 3HKRA 4DSQA 4X4JA 2R37A 3CNMA 2J9HA 4KF9A 3HZPA 2BTOT 1SKSB 1VF3A 2GSQA 1SIIA 3VK9A 1RGEA 3CME3 4MZBA 2K18A 5IMCA 3CTFA 3GX8A 5DCHA 4RI7A 3CPW2 2LS5A 2YWMA 3N9HA 2O7KA 3R3EA 2GQMA 3IDVA 4NV2A 3D4MA 3ZIVA 3ZFLA 1TDIA 3GFKA 4GSTA 2CA8A 3G7YA 3BIRA 1R7HA 2H70A 3ZG5A 1SK1A 3SVAA 3ZG0A 2YJHA 3MSOA 5GSSA 3TKQA 2DC5A 1NB5I 1I3FA 2PZVA 4EL1A 3LTCA 2ZNMA 4USSA 1X9WB 4G9HA 3E99A 1YKAA 2CWTA 3IAS2 4FMBA 3HJOA 1R5AA 5G1KA 3MG1A 2E2VA 3AY8A 4RI6A 2MMOA 3IHGA 2G2QA 2CFLA 2DKIA 2E2TA 3ECFA 1NM3A 3OWYA 2H1AA 2OCTA 4XIHA 3WT2A 4QWTA 2ZCTA 3P8WA 1CQSA 3Q90A 3H93A 4OO4A 1FGMA 2IUJA 1SJIA 1GSFA 1SK0A 1Z6NA 4MF5A 1YF1A 2C1YA 2PN8A 3D4AA 1EZKA 2C3QA 4EF0A 3D4TA 1LU4A 1MWUA 5F06A 1FAAA 3ERFA 3Q3FA 4X2HA 2V32A 1BSDA 2HRNA 1DBYA 1LJRA 2HLSA 4LZIA 4OFTA 1YF0A 1TKDB 1TFOA 3NX0A 1BX9A 3GAXA 1TI1A 4CJNA 3KP9A 2MBSA 6GSTA 1UUVB 1ABAA 4HKVB 1NHOA 1BNJA 1OC9B 4QQ7A 4GXZA 3TOUA 5G30A 4MJCA 4ZM8A 3EE2A 4IT7A 5A0OB 4ZBAA 1XBSA 1PMTA 3HOHA 1PN0A 3M9JA 1VQ83 5D9WA 1CQHA 1A23A 1M3IA 2AB6A 1XWKA 1B9YC 2OE0A 3P90A 5IMVA 2KP2A 1LVNA 1TRSA 2Y74A 1MWSA 4GL6A 5BIRA 4NREA 1ZYNA 1SL1B 4HM3B 1OE8A 2AUVA 3SOAA 2B1KA 4EYCA 1GSQA 3KZQA 2VLUA 1EOGA 5DDLA 5ECMB 2IMDA 3GH9A 1WP0A 2X49A 5CRWA 3D3LA 5BU4A 2WJUA 1Q7Y4 5G2ZA 5GSTA 3TKRA 3JUMA 1B8XA 3SXXA 2QKEA 2DJJA 3CXGA 3AHSA 1F8NA 1V98A 2E0QA 2P5QA 1JBRA 1B2SA 3O3TA 2RNTA 3A76A 4CCVA 3ZMKA 3G0KA 1U87A 2L5LA 4HEA2 1OC3A 1ERTA 2DMLA 4NMUA 14GSA 3CC23 1A8YA 1ZS7A 2OE3A 3EBTA 1TK8B 3F4RA 1WWJA 4JRFA 3U6VA 1PFOA 3NZNA 3MKIA 2H1DA 1BRNL 3K5TA 1UC7A 5AN1A 1FG4A 2Q07A 4MMYB 2UX0A 1N5PA 4XDWA 1RNBA 3A2WA 1E97A 2JL4A 1HQOA 1OC8A 4WWUC 4CDLA 4FCJA 4EW5A 1B20A 1JZRA 1JN5A 2HI7A 2OKAA 1QFNA 5KP4A 1SKWB 4HUAA 1ZL9A 2P31A 18GSA 1RN7A 2LUSA 4D73B 1U8CB 2QGUA 1K0MA 2WRTA 3BJ5A 1OF5A 2VLVA 3SWLA 3SYUA 3TJGA 4OUQA 4XS1A 2XSOB 3E9JB 3MYTA 1W02A 3N8BA 5IG3A 3DGQA 3DXBA 4FYCA 2C11A 2VAFA 2UUGC 2FD3A 3RHBA 1FUTA 3QOUA 2IJYA 2X99A 2HZEA 5JWRB 1M2BA 2YCDA 3CCL3 2HMNB 3D79A 2R0CA 1ON4A 2PVQA 1D6ZA 1QK8A 3KIJA 3LXUX 1DVCA 3MHEA 4EDYA 4K7IA 5IEOA 4MLYA 1FW1A 1EQKA 4GSPA 2A4HA 4CHSA 1Q42A 4EO3A 4IBPA 3DXOA 5AEUB 3GIXA 5F05A 2H1BA 4HM8B 1CQGA 3CC73 1BIRA 1IVWA 3F8UA 3M8CA 1K9M4 1WQLB 5IOWA 1HZ1A 4ECBA 5C04A 4BVYB 3LT8A 13GSA 4N30A 2KF3A 2C4BA 4WFOA 3G713 2CKFB 1DE3A 1YZXA 2CFDA 1UCJA 5CREA 1TJDA 4HM0B 4RNYA 1Y6EA 2GZZA 3CSIA 4O7HA 3APQA 4OFNA 2L4QA 3STDA 3ERGA 1GUHA 1TRUA 1WJKA 1IQ8A 1GMPA 1A0FA 4BWQA 1O7HB 4MP4A 1BRHA 1PGTA 1WPIA 1AIUA 5G31A 2W04A 1Q4JA 5IO2A 1RSNA 3D5JA 2XH9A 4PXOA 4GHOA 4FQUA 3TRXA 1J0FA 4WBRD 3UL6A 3QFBC 1JFUA 3HI7A 3H3HA 3GRDA 1BYEA 3BLZA 2GS3A 3EU4A 2XFTA 4CW9A 1M0UA 3I6AA 1BRKA 2L1SA 1U5OA 4KFFA 1W6YA 6GSSA 2CHCA 3EINA 1PYLA 2GEYA 1G96A 1T00A 3GHAA 4HVNA 4Q5FA 2L6DA 1URMA 3KSED 3DEXA 3GYKA 1THOA 1KNGA 4IJ3A 2NPBA 1UN2A 3NM7A 1IU7A 5FHIA 5B8AA 1DE1A 1HNBA 4WBJA 4KT3B 5AYSC 4K7OA 2R6KA 1BGSA 2OE1A 3EMPA 1ZX2A 4XB5A 1TTZA 2WOFA 1ZO2A 3N54B 3ROBA 1KEBA 2KRTA 3GUSA 2VIMA 2JACA 3GN3A 1UUGB 3DGOA 3CBUA 4PX1A 2H72A 4HOJA 1K0OA 2E2MA 2QGVA 5IENA 1CH0A 1BU4A 1H75A 3DMLA 3LH4A 4KFDA 1NSWA 4ZXGA 1TW9A 1GUKA 2YV9A 4TXVA 1IQYA 4F0BA 1SJ6A 1M9BA 5DQYA 5TGNA 3FZ9A 4OO5A 3BNBA 2SARA 4I5QA 5KOWA 4HYZA 2MZCA 2RSXA 1YNVX 3LGCA 2O8VB 3IPTA 3F8HA 3LOYA 2IIYA 2GU3A 2GZPA 4H61A 1SYRA 3Q18A 5CO3A 4HM7B 4HQSA 5G5EA 4HZ9B 5D93A 3CCQ3 5L71A 4F0CA 2Y73A 4Z2TA 3JUNA 2DIYA 4GLTA 1X9SB 2FY6A 1W6CA 1M3JA 1IYIA 5AI1A 3F4TA 5LC6A 3U97A 2FGXA 3S27A 1SD9A 4JE1A 4MZCA 3RPNA 3Q2PA 4O5UA 1XVWA 2KP1A 1K3LA 4DSRA 1GMQA 4EUYA 1N5HA 1W4VA 1ERUA 1PD21 2GT5A 1STFI 4MA9A 2CWVA 3TB2A 2ON7A 2REMA 2RM5A 2QSIA 3VPQA 1T1VA 4WKWA 2XRXB 4N6MA 4E8HA 3LWAA 3SBCA 2W03A 1LNIA 4PGTA 2RCDA 1I2GA 1RRLA 2CX0A 3WD6A 3NBJA 2IMEA 4L8OA 1N9JA 2KAAA 2GSSA 5F0GA 2LYXA 2A15A 4IN0A 5G1LA 1AXDA 2PVOC 1W4NA 1TP6A 1JB5A 2W9PA 5CP1A 4IJIA 4BVXB 4RNZA 4L7KA 4BA7A 3KMOA 3X41A 2YWIA 5EL8A 2F8AA 2BO9B 2I9WA 1OE7A 2WS2A 2MF7A 4N6V0 3HVNA 3IBHA 1ROAA 2BMXA 4ZL7A 2QA43 3IV4A 1PKWA 2TRCP 2FA4A 1X1UA 3I553 5E59A 4K90B 1YIT3 4H86A 4LEHA 5BXQA 3RGAA 3CCR3 1RN1A 3EVIA 3AMOB 1XVQA 4EIQA 1XOBA 4PUFC 2W56B 4YH2A 4F9ZA 4GSNA 5JPPA 4J2FA 4EV5A 5HR2A 3KTBA 4ISDA 1XWAA 2BU4A 1FVKA 2B5XA 2L4CA 2HXKA 4IQ1A 3NBBA 4GB5A 3FK8A 4L0UA 4G10A 3EE1A 4R1KA 1G02A 4OCFA 5DJMA 4XM4A 2K8SA 2WCIA 1US1A 1EEMA 1SQWA 1XWCA 1PN9A 2HFDA 1W00A 3ZVJA 3AGNA 1W6GA 2PERA 4U13A 3HIGA 1X5DA 1M2DA 2MBTA 3FW2A 1T8EB 2GVPA 3FHKA 3LXZA 5J41A 2JZSA 3DKSA 5J9BA 5STDA 3K9MC 2F5WA 1E2YA 4XCSA 2CFWA 2LSTA 1DMMA 2H30A 2F5MA 3MIXA 1BNIA 2RGQA 1K0DA 1GSDA 4RNTA 1I9DA 2Z76A 4AKZA 3BCKA 2A2RA 4NHZA 2PGTA 1OHSA 4POBA 1RGFA 3WYWA 3EF8A 1O7GB 5ABRA 5FT3A 3DZLA 2I4AA 3KN4A 2VM1A 4Z2RA 3CRUA 4WXTA 4BTXA 4WETA 3EBYA 4O92A 4KDUA 5IERA 3EC9A 1YY7A 3FKAA 1RRHA 5IF6A 3AGOA 1GNEA 4L0WA 1UI7A 3WHOA 1PL1A 2R3XA 5H5RA 4YKGA 3WMDA 2OWPA 3VSYA 3VWXA 3WGEA 2A4VA 1BJXA 1W2ZA 2V1MA 1PY3A 5J3RA 1WMPA 2O9UX 19GSA 1T2IA 4DVCA 3A2VA 3HK4A 4N3VA 2CG1A 3KCMA 4O32A 1X5EA 3LMLA 4I6XA 5EY6A 3HIIA 3GNJA 1NDOB 1O85A 3DY5A 5J5NA 1K3OA 4HU9A 3CCM3 1Q98A 3HX8A 2OOVA 5G2GA 4POKA 3H4KA 5H5QA 4NWYA 2VD0A 4XHMA 1YJN3 1YVSA 4X2OA 3X42A 3PXMA 3ZIJA 1V2AA 2AAWA 1ILOA 1QXHA 3G4S3 4N6UA 3UL5A 3O6TA 5GAND 2BIRA 3LEFA 1RK4A 3C8EA 5LD0A 1XWBA 10GSA 1MD3A 1M7TA 1Q9EA 2CW9A 1TU8A 5DAKA 1EOHA 2F8FA 1S3DA 1LBKA 4HI7A 3F3QA 2LKUA 1FZUA 1AY7A 1SARA 4OD7A 4XS6A 5IM9A 1LQGC 3GKMA 4O2HA 1V74A 2YZHA 5HFIA 1LOVA 3V98A 2GGTA 1V58A 3I69A 3IC8A 2BT3A 3LFLA 3KSPA 2XSHB 2MMZA 3FY7A 1N2AA 1T4ZA 3GKNA 4HZ4A 4GWRA 4EKZA 4OFMA 2GQKA 2YOIA 3OXAA 3D21A 3L78A 5ECPB 3VGNA 1RGHA 3VI7A 3ZLPA 3OWUA 1IYHA 2ZDJA 3FR6A 1EG9B 3W8JA 5FGOA 1G6YA 2IFQB 5G5FA 2OQEA 5M18A 6STDA 2CX3A 1YIJ3 5DQSA 3KEBA 4FIWA 3VURA 1AAZA 4YQMA 2C4JA 3V92A 4PNFA 5E4WA 2ALBA 1GTBA 3CPOA 1F3AA 4WR5A 3A5EA 3TDGA 1HD2A 3TKSE 3ED3A 5DJLA 5GAPD 3FF0A 3ME8A 3W8SA 5D96A 4YAVA 3A5WA 2AV4A 4ILFA 5DALA 2OQEC 4Q5RA 2VCZA 1K734 4EXRA 3L9SA 2B5YA 3K8NA 4ZL8A 1B9XC 5ELGA 5IO0A 4XDVA 2FWEA 4FMDA 1ROVA 2DSAA 2DIZA 5ID2B 3I563 4ECCA 1Z9HA 2V6KA 2IL3A 2CVDA 5EEOA 3GX0A 1OYJA 1O73A 3M9KA 4KNDA 3IXRA 2C0DA 1GP1A 2L59A 2H0HA 2L6CA 1GY5A 4BWSA 2VCTA 1VQ63 1X1WA 3NV0A 2Z77A 2C80A 2FCHA 4ZB9A 5J9CA 1JBSA 3JCML 3G16A 3GZXB 1C54A 4K0NA 3TCOA 3EJVA 1IT7A 2FGTA 3C1RA 3UMAA 2X64A 1N8QA 2V41A 3HYPA 2NDOA 5ECIB 4MJDA 4A5PA 4MCUA 1TU7A 2J8XB 1WMJA 4N6TA 1STDA 4V1Ag 1XIYA 1GLPA 2MYGA 1NW2A 4XTSA 4BL3A 1CYVA 4IW9A 4PQ1A 2L5OA 5I97A 3GRXA 3K63A 4EBGA 1WMOA 1LRAA 2KUCA 5AIGA 1V9WA 3PYJA 2YWOA 5ENUA 2XBIA 5KN1A 2H01A 4AJ6A 1SPUA 2JZTA 1DMNA 3T8UA 4R9KA 3DVXA 1ST9A 1Q40B 1RJOA 1O7UA 5CRGA 2PWJA 1QGVA 2AADA 6GSWA 2JDIH 3RBTA 4ZIJA 1NB3I 5HGRA 1EWXA 3G9BA 5EPFA 3GKXA 3B8LA 2RM6A 5ECRB 1YEPA 1PQNA 2WZ9A 1Z1SA 5CXOA 3CQFA 2CX4A 3CYNA 2KLXA 3PH9A 3BU4A 1EGRA 1R4WA 2RUFA 3MAKA 4O8SA 1GUMA 2GDRA 2HRFA 1GTUA 4KDXA 2G0FA 4N6LA 1NHYA 1MWRA 2R41A 3MWZA 6GSPA 1F9MA 2LRTA 3VPTA 2OBIA 5HR0A 1T3BA 1O6JA 2LQOA 4JU5A 4FCZA 3DH2A 3OW22 1JZOA 1WMNA 2HT9A 1YGEA 3V99A 2JU5A 1K0CA 4K1UA 4RUVA 5IMAA 3GZYB 1EV4A 1BOXA 1X9MB 2CG0A 3VF1A 4MF6A 3D5IA 1KBNA 2H66A 2KXGA 5AIXA 2K0MA 1U3IA 4HM5B 5HOHA 4F82A 4MABA 5B7CA 1HKXA 4G1MB 4P3YB 5JCWA 3HD5A 1F37A 4L8PA 1RNTA 1THXA 1PX7A 3HDCA 2GU1A 3CU3A 1GULA 1VZZA 2UGIA 4ZBBA 1GY7A 4ML1A 1QUWA 3WR2A 1OGXA 4XS4B 4V2MA 4TVEA 2PBJA 1RTUA 5ECLB 3DGYA 4LMIA 2PMTA 1LOXA 1MEKA 3GL5A 3T8NA 2GEXA 3GURA 1FA3A 3CCJ3 4OK0A 4O5QA 1GOUA 2LQQA 4N0ZA 3W6GA 1V57A 3E0UA 4NXIA 1SKRB 1MGWA 2CT6A 5ECQB 1KD14 4QL7A 1Z6MA 2IMIA 6RNTA 3RAZA 1GH2A 4ECJA 1VQ53 1K3YA 2B24B 3ALAA 1HYUA 2LQVA 4HJLB 3FCSB 1UCLA 3D22A 2FA8A 1S3RA 4WYKB 2HMKB 5IW9A 3N9JA 4TW5A 2AHEA 1GD3A 1GLQA 4ZB6A 2B6MA 3LQ7A 3TKSC 2GQLA 3ZREA 3J7Yk 3MG2A 4X43A 3PCSA 2B3SA 1A2JA 1RGGA 1EV9A 4HJ2A 4KE3A 2VL2C 22GSA 5HFKA 1ULIB 3SLUA 1I0XA 3CCE3 1FB6A 4FYUA 2CH9A 1G7OA 4DSSB 1QAKA 1BRSA 5BRTA 2JADA 5D8IA 5ELAA 1YJW3 1DE2A 4AF2A 3IRAA 1GL8A 2HMOB 2XPEA 3C7MA 2IWTA 2FWFA 2IY2A 1SL2B 1B4PA 3WDGB 1ZMAA 1B27A 2E2UA 3CD63 2FNQA 5D73A 4TR1B 1VQK3 2VCWA 5CF2A 3K0ZA 1H4OA 1GS3A 2OADA 4KAEA 3JVCA 1T5YA 3JUOA 4K2DA 4K0GA 1UW1A 2K54A 1XW9A 2IN3A 1RGAA 2RLIA 2FWGA 1K8A4 3NQYA 3LZAA 1GWCA 4BIKA 5HFGA 5IPGA 1AVKA 3UVHA 2LTKA 1DUGA 2C0EA 1FO5A 2YANA 4IGJA 3RDEA 16GSA 3CSJA 4MZWA 3GA4A 4MH2A 1OC9A 4IIAA 1J2BA 3IJEB 2O87A 1BSAA 3PZWA 2LJRA 3UAPA 1J08A 9RNTA 3BBYA 4TXOB 2NBSA 3FZWA 3TJBA 2P09A 4J5GA 3CXC2 5J4UA 3SOYA 3QK9A 3D6IA 4K1FA 2K6VA 4TOPA 3EWLA 4K9ZA 2LJKA 1ISKA 3GZRA 3C73A 1OCVA 2H8LA 3IR4A 4I8BA 5GZZB 4PQIA 2VLTA 3DVWA 1OHPA 3H8QA 4KGIA 2F99A 2JZRA 1PRXA 2XHFA 5KP3A 2GBWB 1IVUA 2M7OA 5ECSA 2R2JA 5HQPA 2LRCA 3ZTLA 7GSSA 5CRHA 2X8CA 1TFKA 3HHVA 3ZFBA 3FRCA 3PGTA 4X0XA 2DJ0A 1FHEA 2EIOA 3LG6A 3UEMA 4HAAA 2P0MA 3LYKA 3QAWA 1E6BA 3LTBA 1HYFA 3IHQA 1ACVA 4KSMA 1O8WA 3QR6A 4MEIA 4NV5A 5M19A 4BL2A 4IP6A 1AVLA 2VOCA 3DWVA 4LA1A 1MGRA 2HOHA 1TIJA 3F63A 3M0FA 3NBRA 2STDA 1YQ1A 2H6YA 2I3YA 1ASKA 5JWOB 1FOHA 5FW5A 3KXOA 2YJ7A 3AHWA 2HRAA 2WO0A 17GSA 3BNEA 5IQYA 4FYBA 1F6MC 1KQS2 2PUKC 1Z3EA 4I2UA 3F6DA 2BHMA 4K61A 1MWTA 2ZHXB 3PCRA 4J5KA 1PSQA 1E3RA 1UGHI 3WODG 4HDEA 5AGYA 5DAKB 3TJFA 1UVZA 4TR3A 1X5CA 3FZ4A 2FXTA 5HR3A 2IMFA 4JRRA 3CC43 1XCCA 1KSIA 4MK3A 5IG0A 1S5AA 2P0XA 3F7SA 1JNQA 1UGIA 3R2QA 5COHA 1FGOA 1MD4A 3KZTA 3KJYA 3V1WA 4PQHA 5B6MA 3D0ZA 3MSZA 3TOTA 3FLJA 2HMJB 1RHLA 1Y4KA 1O7MB 2K8VA 1A0RP 1VF2A 3UJ1A 4EC6A 2A2SA 5A5KA 1UDII 3RDWA 2CWUA 1XZOA 4MDCA 1LOYA 1OKDA 3X3XA 5ECNB 5IG5A 3MWHA 1FOVA 1W89A 4MMXB 2B5EA 1OHOA 1EKMA 3RHCA 3S9FA 4I4KA 3GSTA 2L4VA 1B4QA 2C8UA 3N5OA 1BVIA 3EN8A 2D2ZA 2IA7A 4POMA 4WF5A 1AQZA 2RUEA 1RGLA 3HY2A 1S3AA 4BVYA 3NM2A 1MDJA 3HA9A 3BB9A 4HM2B 4KUNA 1GYBA 7STDA 4Z2UA 4RQRA 3APSA 4KB3A 1JJ22 1OGZA 2H75A 3KE7A 3DUKA 2GZYA 2LRNA 4HJMA 4ORLA 5CYYA 2N5AA 2WULA 1WOUA 1TRVA 2CFGA 1VQN3 4LMVA 2IYJA 4JBBA 4K7NA 2P0GA 5JCUA 4ID0A 2XEPA 4MJBA 1TK0B 1VQO3 3NHXA 3HZ8A 1GOVA 3WGDA 3EQQB 3UARA 2MMNA 3TUEA 1Q864 3VFIA 1BSEA 2TIRA 5D83A 2WDUA 3U1WA 1ZGXA 2CVKA 3C71A 3UIWA 4BTYA 3CCV3 3CCS3 2FHEA 4MNNA 4HZBB 7RNTA 5DBQA 2CV4A 3L9VA 1I0VA 2H74A 5D82A 4FMCA 4IKHA 1C7HA 1W01A 5IG4A 4JZQA 1M9AA 2MC8A 2V2GA 1EP8A 1SENA 1BNEA 3CMA3 1SIHA 1FVJA 3FMWA 3LYPA 1R4CA 3Q19A 1OUNA 2QC7A 1PKZA 3F4SA 2O3OA 2H76A 1YI23 2KF6A 3U5RE 1VRSD 1TOFA 5D9VA 1AV4A 1SJWA 4LYLB 2NTOA 4IP1A 1A90A 1IV7A 3F7XA 4X1UA 8RNTA 1B2MA 4NHWA 3KFQC 1EEJA 3IPZA 1R5PA 5IEPA 1BEDA 3WOFB 3KGKA 2XR8B 5BMUA 5KN2A 4Z7XA 3UNLA 1NJI4 3MDKA 1B48A 4GRFA 1DETA 2N5FA 3ZVJD 4IHUA 5CNWA 3EX9A 3GTUA 1BSBA 2B7KA 3E3EA 5D9XA 1FUWA 4G19A 3EPTA 1OACA 4MH3A 2ZA4A 3LSZA 2JSZA 3WA2X 2B1XB 3KH7A 1ZCPA 1AQWA 4K6XA 2HYXA 3FYGA 3OV4A 2ML6A 4OCEA 3GWRA 2DJ2A 3SEDA 3WGXA 1UI8A 2MMAA 3US3A 1YJ93 4DKIA 1F3BA 2W6JH 1T2HA 2XPDA 1UA5A 1GD4A 4HS1A 3H1NA 2PNCA 3HXSA 4OMVA 2O85A 1V40A 3D5GA 1HU9A 5JBSA 1XPVA 1QVG2 1RMSA 3MG3A 4G2EA 1JN5B 4WHAA 4BVXA 1XFLA 1XW6A 1I5GA 4DEJA 5A4VA 3ZZXA 4GQFA 4WP5A 4KZ1A 3KCHA 3FH1A 3LTAA 1OF5B 2GSPA 3HVVA 1MNLA 4EVMA 2F51A 1QALA 3BOAA 3F6FA 1BNSA 5A4WA 1G0TA 1LNHA 2DBCA 1RGKA 2KOKA 3AMOA 3Q1CA 2W56A 2C0GA 3S29A 2VL9A 1YJ6A 3A5IA 3BD2A 1FYSA 1BRGA 2BMQB 5ECHB 2HZEB 3NXJA 4KVHA 1O7PB 5LC7A 2DJ3A 1RCKA 2CVBA 4EIPA 4KX4A 4I2TA 3MYDA 3IOSA 1NWWA 4WR4A 3S67A 1BRJA 2CAQA 2OJLA 1XW5A 3HJMA 1GMRA 1D6YA 2YFJB 4MMZB 3HZ4A 4K8MA 3ER7A 4HM6B 3G7JA 2AJQB 3FR9A 1BRIA 1DMQA 4MMMA 3UBKA 4LGQA 3IAM2 4KFEA 4TN8A 5ELUA 2F86B 2R4IA 2HZFA 4MF7A 5M1AA 4NHFA 2AYTA 5KN3A 5CLKA 1HNAA 1I3IA 4E8EA 4EDZA 4NAXA 2O89A 4FR9A 2FWHA 3A3TA 4BIRA 2YX9A 1JKGA 3UL3A 5IMFA 1DVDA 1F2EA 2INXA 1KC84 1A24A 3QPMA 1G7EA 6GSUA 4YAPA 1JZDA 1Y25A 2LJAA 3LJRA 2HSMA 2Z6BA 2DJKA 2GSRA 4JR4A 3RNTA 2XGNA 3OX9A 2HSYA 3UBLA 4IS0A 4BL7A 6GSYA 2C10A 1QVF2 2RFRA 1VQM3 4TRXA 3LTDA 3TRPA 2H71A 4KA0A 2D1WA 5CRDA 8CHOA 1I2FA 4PURA 2GLRA 2Z7AA 1M99A 3VLNA 1USBA 4AEQA 4PUAA 1AUCA 2VO4A 2XF3A 1U6TA 4V2NA 1M904 1IK3A 2E7PA 2XBQA 3P2AA 3KMNA 4EXJA 4AKYA 1S3CA 1SJZA 4YQVA 1LQMB 2P5RA 1XOAA 1EUIC 1ZYEA 5C00A 3X40A 3B4PA 1B2XA 5EVOA 3FF2A 2GTUA 1NU3A 1G6WA 4YQUA 2YV7A 2K3DA 2VCXA 5EQLA 3K7CA 1RGCA 3L0HA 4AJ7A 1QMVA 1VQ93 1L5GB 4WEYA 1O81A 4MJAA 4O3VA 1NNVA 5AISA 3VI5A 2VCQA 5HR1A 3GV1A 3LORA 5IMZA 2IMJA 2VM2A 5B6NA 2JSYA 4I97A 3JUQA 2IPAA 1TRWA 3OWSA 4OWYA 1WIKA 3TRQA 1IYYA 1TK5B 5FWGA 4N6OB 1IDPA 2UZ8A 1AR0A 4TR0A 3EN1B 2FUG2 3EU3A 1GSYA 2H19A 1OKTA 3G8ZA 3BNCA 1R26A 3EMXA 1Z7PA 1RW1A 1TRPA 4FO5A 4J9AA 4AGSA 2M72A 1ZZYA 4NPBA 3DMCA 4RBNA 1E3VA 4GCIA 1GSEA 4LMWA 2RIIA 2XFSA 4FMAA 2CK3H 1A2LA 2IFQA 4RQXA 1RN4A 3NOFA 4CPKA 4GQCA 3DIEA 3LW9A 4XBXA 2PU9C 1MTCA 1K0NA 2GSTA 4N0VA 12GSA 5A4UA 4R9LA 2YNXA 2A2PA 3G7IA 3ZFZA 5BVBA 5F07A 1WNHA 1X1YA 1I2EA 3LT9A 1K0AA 2CFKA 3F9UA 1YKCA 2F98A 3BNDA 3TKSA 1Z7RA 1HNCA 1K41A 1XG8A 3BCIA 2BJXA 2F56A 4AJ8A 5DRVA 3X3ZA 3QDNA 4ZILA 1SU9A 5IIZA 2VL2A 3CNXA 3DRNA 3TGZA 3LXTA 3F3RA 3GZBA 3EC3A 4ZL9A 4Q5QA 4ACSA 1GSPA 3ZYWA 2YFIB 2QIYA 2ZUPA 3ZITA 4G0LA 1M9GA 3DGLA 1U3AA 3C1SA 3M3MA 4KSOA 2KF4A 1LXEA 2QA1A 3GSSA 3T0UA 5ID2A 3KP8A 1FGTA 4BTWA 5EVHA 3IK9A 1YEXA 3HVXA 5ECKB 3L4NA 4L8EA 7GSPA 2H0GA 1YVBI 4MPFA 3QAVA 3OR5A 2WB9A 3IA1A 1N9EA 1A2KA 2HMMB 3DM8A 3DGMA 2KCDA 2FLSA 3PPUA 3EYTA 4LL4B 3QMXA 1T7PB 3HVSA 3I9V2 2H6ZA 2LNTA 3FG4A 3QRDA 4MPGA 1TRQA 1X0RA 3O8YA 1W5ZA 3KKGA 4Q53A 1MDIA 2E2GA 1RQMA 2BNGA 3F0IA 5AIVA 2RBIA 1VF4A 4XBTA 2NVLA 4CY8A 5KOXA 1O7WB 2YZUA 1CYUA 1U88A 2YPMA 4FCMA 4WF4A 3EB8A 1GOYA 1IVXA 2FNOA 1VF1A 3ZL5A 1BUQA 1PA3A 3PR8A 1M1K4 5KP1A 1JHBA 1Q814 2H73A 2R5GA 4ZBDA 2CX1A 2DJ1A 3TJJA 1PFPA 1Q40A 2W9QA 5D9TA 2ON5A 1B3SA 3I0YA 2H0IA 3WT1A 1TUHA 8GSSA 1JBTA 4FH8A 4KH7A 1BQ7A 3ZMLA 2F4YA 1BAYA 3QD9A 1BNGA 2DKHA 2R0GA 2HNLA 6GSVA 4Q5NA 1WTHA 2X4AA 1FUSA 2ZL8A 1TI3A 1PU4A 5AIFA 3X3YA 2HSHA 1Q7HA 1ERWA 5KEJA 4K1VA 2YP6A 1VQ73 1EGOA
chains in the Genus database with same CATH topology
2L57A 2N5BA 4F03A 1N8JA 2CZ2A 1AW9A 3GL3A 1Z5YE 3KTLA 2K9FA 4L5OA 3UVTA 2YN1A 2PPTA 3GH6A 4IQAA 1ZYPA 4GSSA 3APOA 2I9HA 5H5SA 1DSBA 3IE3A 2R0PA 1KTEA 5IPHA 2B1LA 3ERWA 4K2XA 4QL9A 1C72A 3QAGA 2HRKA 3HCZA 3CSHA 1OVNA 3TJKA 5IOXA 1PL2A 1GRXA 2VCVA 3NIVA 2QA2A 3O76A 4V2LA 4XS4A 2XC2A 2OACA 5B8BA 2I81A 1XWGA 4J56E 4D73A 6GSXA 3UOMA 3PINA 3GTUB 1GTIA 1GTAA 1QQ2A 20GSA 3GMFA 1AQXA 2LNSA 4HZ2A 4IVFA 1ZOFA 1JLWA 1J9BA 3QCPA 4K5RA 3L9UA 3CTGA 4ZB8A 4CDOA 2H1GA 4EE0A 2VD1A 2HE3A 3FZ5A 3HJPA 1SL0B 3VWVA 4BPYA 4PTSA 5DALB 2CAIA 1K0BA 11GSA 4ICYA 3GKKA 4MJEA 4L5LA 4XRDA 2R4VA 2I1UA 1SD8A 4DSSA 4G0KA 1YDKA 3MNGA 2M46A 4F2IA 2H6XA 3Q6OA 2C3NA 3J7Yb 1T4YA 4GTUA 4POLA 2TRXA 3ME7A 1GNWA 4GF0A 3VWUA 1JLVA 3A2XA 5IMDA 2EIQA 2F3MA 4TR1A 1GSSA 5CAXA 5KN0A 3FZAA 3DD3A 3QFAC 2X8HA 4KCAA 2GT6A 2CQ9A 5F8BA 3KD0A 1EP7A 2B7JA 1OAZA 1TP9A 3CMIA 2X8GA 1ML6A 1WE0A 3IK7A 3EURA 1SK2A 1M2AA 5INYA 5DCGA 3RPPA 3ISOA 3KM6A 2IMKA 5JWQB 4TXOA 4LL1B 2Z9SA 2LEGA 1WRYA 1SYXA 2KHPA 2F9SA 3P7XA 1MDKA 4PNGA 4BL7B 2C3TA 2ES7A 1O8XA 1XXUA 3KH9A 3FEUA 4JEDA 2EIRA 3M1GA 1ZYQB 5LCZA 4G0IA 2CZ3A 3TKPA 1JZWA 2LV3A 5JCGA 4KCEA 2VL3A 4JR6A 3DYRA 2OBKA 3IC4A 2EC4A 5LNKe 3CRTA 3H79A 4KW6A 5DVBA 2YWNA 4J57E 2J23A 2WGRA 1GSUA 3I43A 4IELA 1TXXA 4EC0A 2VUPA 4K5SA 2M80A 4HU7A 1BG5A 4KDYA 3ZRDA 1A8LA 4N11A 5ECOB 4ULXA 2V6OA 1PX6A 3FR3A 1A2MA 3M8NA 4TR4A 1AC1A 1VGLA 4V1Ap 4XRAA 4CY6A 4TKYA 4YKFA 2WFCA 4ML6A 2DMMA 4O5RA 1ZGNA 3FKFA 2OA7A 2DLXA 1AQVA 3VWWA 9GSSA 4HQZA 2C0FA 1FB0A 1ERVA 4ECIA 4N10A 3Q74A 4LLRA 3HKRA 4DSQA 4X4JA 2R37A 2J9HA 4KF9A 2BTOT 1SKSB 1VF3A 2GSQA 3VK9A 4MZBA 5IMCA 2K18A 3CTFA 3GX8A 5DCHA 4RI7A 2LS5A 2YWMA 2O7KA 3R3EA 2GQMA 3IDVA 4NV2A 3D4MA 3ZIVA 3ZFLA 1TDIA 3GFKA 4GSTA 2CA8A 3G7YA 1R7HA 2H70A 1SK1A 2YJHA 5GSSA 3TKQA 2DC5A 4EL1A 2ZNMA 4USSA 1X9WB 4G9HA 1YKAA 3IAS2 3HJOA 1R5AA 5G1KA 3AY8A 4RI6A 2MMOA 3IHGA 2G2QA 2DKIA 1NM3A 4XIHA 2H1AA 3WT2A 2ZCTA 3P8WA 3H93A 4OO4A 1SJIA 1GSFA 1SK0A 1Z6NA 4MF5A 1YF1A 2C1YA 2PN8A 1EZKA 2C3QA 4EF0A 3D4TA 1LU4A 5F06A 1FAAA 3ERFA 2V32A 2HRNA 1DBYA 1LJRA 2HLSA 4OFTA 1YF0A 1TKDB 1BX9A 1TI1A 3KP9A 2MBSA 6GSTA 1ABAA 1NHOA 1OC9B 4QQ7A 4GXZA 3TOUA 5G30A 4MJCA 3EE2A 4ZBAA 1XBSA 1PMTA 1PN0A 3M9JA 5D9WA 1CQHA 1A23A 2AB6A 1XWKA 1B9YC 2OE0A 3P90A 5IMVA 2KP2A 1TRSA 1ZYNA 1SL1B 1OE8A 2AUVA 2B1KA 3KZQA 1GSQA 2VLUA 1EOGA 5DDLA 5ECMB 2IMDA 3GH9A 1WP0A 2X49A 5CRWA 2WJUA 5G2ZA 5GSTA 3TKRA 1B8XA 2QKEA 2DJJA 3CXGA 1V98A 2E0QA 2P5QA 3O3TA 3ZMKA 1U87A 2L5LA 4HEA2 1OC3A 1ERTA 2DMLA 4NMUA 14GSA 1A8YA 2OE3A 1TK8B 3F4RA 1WWJA 3U6VA 3NZNA 2H1DA 1UC7A 5AN1A 1FG4A 3A2WA 2JL4A 1HQOA 1OC8A 1JZRA 2HI7A 2OKAA 1QFNA 1SKWB 4HUAA 1ZL9A 2P31A 18GSA 2LUSA 4D73B 1K0MA 2WRTA 3BJ5A 2VLVA 3SWLA 3TJGA 4XS1A 3E9JB 3DGQA 3DXBA 4FYCA 2VAFA 2FD3A 3RHBA 3QOUA 2IJYA 2X99A 2HZEA 5JWRB 1M2BA 2YCDA 2R0CA 1ON4A 2PVQA 1QK8A 3KIJA 4EDYA 4K7IA 4MLYA 1FW1A 2A4HA 4CHSA 4EO3A 4IBPA 3GIXA 5F05A 2H1BA 1CQGA 3F8UA 5IOWA 4ECBA 5C04A 4BVYB 4N30A 13GSA 1YZXA 5CREA 1TJDA 2GZZA 1Y6EA 3CSIA 4OFNA 4O7HA 3APQA 2L4QA 3ERGA 1GUHA 1TRUA 1WJKA 1A0FA 4BWQA 4MP4A 1PGTA 1WPIA 1AIUA 5G31A 1Q4JA 5IO2A 3D5JA 4PXOA 4FQUA 3TRXA 1J0FA 4WBRD 3QFBC 1JFUA 1BYEA 2GS3A 3EU4A 4CW9A 1M0UA 3I6AA 6GSSA 3EINA 1T00A 3GHAA 4Q5FA 2L6DA 1URMA 3DEXA 3GYKA 1THOA 1KNGA 4IJ3A 2NPBA 1UN2A 5FHIA 5B8AA 1DE1A 1HNBA 4WBJA 4K7OA 2R6KA 2OE1A 3EMPA 1TTZA 1KEBA 3GUSA 2VIMA 2JACA 3GN3A 3CBUA 4PX1A 2H72A 4HOJA 1K0OA 2E2MA 2QGVA 1H75A 3DMLA 1NSWA 4ZXGA 1TW9A 1GUKA 2YV9A 4TXVA 4F0BA 1SJ6A 1M9BA 5DQYA 3FZ9A 4OO5A 4I5QA 5KOWA 2MZCA 3LGCA 2O8VB 2IIYA 2GZPA 1SYRA 3Q18A 5CO3A 5G5EA 4HQSA 5D93A 5L71A 4F0CA 4Z2TA 2DIYA 4GLTA 1X9SB 2FY6A 1IYIA 3F4TA 4JE1A 2FGXA 4MZCA 1SD9A 3RPNA 4O5UA 1XVWA 2KP1A 1K3LA 4DSRA 4EUYA 1W4VA 1ERUA 1PD21 2GT5A 4MA9A 3TB2A 2ON7A 2REMA 2RM5A 2QSIA 3VPQA 1T1VA 4WKWA 4E8HA 3LWAA 3SBCA 4PGTA 3WD6A 2IMEA 2GSSA 5F0GA 4IN0A 5G1LA 1AXDA 2PVOC 5CP1A 4IJIA 4BVXB 4BA7A 3KMOA 2YWIA 5EL8A 2F8AA 1OE7A 2WS2A 3IBHA 2BMXA 4ZL7A 3IV4A 1PKWA 2TRCP 2FA4A 5E59A 4H86A 3EVIA 4EIQA 1XVQA 1XOBA 4PUFC 4YH2A 4F9ZA 4GSNA 4J2FA 5HR2A 3KTBA 4ISDA 1XWAA 1FVKA 2B5XA 2L4CA 2HXKA 4IQ1A 3FK8A 4L0UA 4G10A 4OCFA 5DJMA 2K8SA 2WCIA 1EEMA 1XWCA 1PN9A 2HFDA 3ZVJA 2PERA 1X5DA 1M2DA 2MBTA 3FW2A 1T8EB 2GVPA 3FHKA 3LXZA 5J41A 2JZSA 3DKSA 5J9BA 4XCSA 1E2YA 2LSTA 2H30A 3MIXA 1K0DA 1GSDA 1I9DA 3BCKA 2A2RA 4NHZA 2PGTA 4POBA 3WYWA 5ABRA 5FT3A 2I4AA 2VM1A 4Z2RA 3CRUA 4WXTA 4WETA 4O92A 4KDUA 1YY7A 4YKGA 1GNEA 4L0WA 1PL1A 2R3XA 5H5RA 3VWXA 3WGEA 2A4VA 1BJXA 2V1MA 5J3RA 19GSA 4DVCA 3A2VA 3KCMA 4O32A 1X5EA 4I6XA 5EY6A 3GNJA 1O85A 5J5NA 1K3OA 4HU9A 1Q98A 4POKA 3H4KA 5H5QA 4NWYA 2VD0A 4XHMA 3ZIJA 1V2AA 2AAWA 1ILOA 1QXHA 3O6TA 5GAND 3LEFA 1RK4A 3C8EA 5LD0A 1XWBA 10GSA 1MD3A 1M7TA 1TU8A 5DAKA 1EOHA 2F8FA 1S3DA 1LBKA 4HI7A 3F3QA 2LKUA 4OD7A 4XS6A 5IM9A 3GKMA 2YZHA 5HFIA 2GGTA 3IC8A 1V58A 3I69A 3LFLA 2MMZA 3FY7A 1N2AA 1T4ZA 3GKNA 4HZ4A 4GWRA 4EKZA 4OFMA 2GQKA 2YOIA 3D21A 3L78A 5ECPB 3VI7A 3ZLPA 1IYHA 3FR6A 3W8JA 1G6YA 2IFQB 5G5FA 2CX3A 5DQSA 3KEBA 4FIWA 3VURA 1AAZA 4YQMA 2C4JA 4PNFA 5E4WA 2ALBA 1GTBA 1F3AA 4WR5A 3TDGA 1HD2A 3TKSE 3ED3A 5DJLA 5GAPD 3ME8A 3W8SA 5D96A 4YAVA 3A5WA 2AV4A 4ILFA 5DALA 4Q5RA 2VCZA 3L9SA 2B5YA 3K8NA 4ZL8A 1B9XC 5ELGA 5IO0A 2FWEA 2DSAA 2DIZA 5ID2B 4ECCA 1Z9HA 2V6KA 2IL3A 2CVDA 3GX0A 1OYJA 1O73A 3M9KA 4KNDA 3IXRA 2C0DA 1GP1A 2L59A 2H0HA 2L6CA 4BWSA 2VCTA 2FCHA 2C80A 5J9CA 4ZB9A 3JCML 4K0NA 3TCOA 3C1RA 3UMAA 2X64A 2V41A 3HYPA 2NDOA 5ECIB 4A5PA 4MCUA 1TU7A 1WMJA 4V1Ag 4XTSA 1XIYA 1GLPA 2MYGA 1NW2A 4IW9A 4PQ1A 2L5OA 3GRXA 2KUCA 1V9WA 2YWOA 5ENUA 2XBIA 5KN1A 2H01A 4AJ6A 2JZTA 3DVXA 1ST9A 1O7UA 5CRGA 2PWJA 1QGVA 6GSWA 3RBTA 4ZIJA 1EWXA 3G9BA 5EPFA 3GKXA 2RM6A 5ECRB 1YEPA 1PQNA 2WZ9A 2CX4A 3CYNA 2KLXA 3PH9A 1EGRA 1R4WA 2RUFA 3MAKA 2GDRA 1GUMA 2HRFA 1GTUA 4KDXA 2G0FA 1NHYA 1F9MA 2LRTA 3VPTA 2OBIA 5HR0A 1T3BA 1O6JA 2LQOA 4JU5A 1JZOA 2HT9A 2JU5A 1K0CA 4RUVA 5IMAA 1EV4A 1X9MB 4MF6A 1KBNA 2H66A 5AIXA 1U3IA 4F82A 4MABA 5B7CA 4P3YB 5JCWA 3HD5A 1F37A 1THXA 1PX7A 3HDCA 1GULA 4ZBBA 4ML1A 1QUWA 4XS4B 4V2MA 4TVEA 2PBJA 5ECLB 2PMTA 1MEKA 3GL5A 3GURA 4O5QA 2LQQA 4N0ZA 3W6GA 1V57A 3E0UA 4NXIA 1SKRB 2CT6A 5ECQB 4QL7A 1Z6MA 2IMIA 3RAZA 1GH2A 4ECJA 1K3YA 1HYUA 3D22A 2FA8A 3N9JA 4TW5A 2AHEA 1GLQA 4ZB6A 2B6MA 3LQ7A 3TKSC 2GQLA 3ZREA 3J7Yk 4X43A 2B3SA 1A2JA 1EV9A 4HJ2A 4KE3A 2VL2C 22GSA 5HFKA 1FB6A 4FYUA 1G7OA 4DSSB 5BRTA 2JADA 5D8IA 5ELAA 1DE2A 4AF2A 3IRAA 1GL8A 2XPEA 3C7MA 2IWTA 2FWFA 2IY2A 1SL2B 1B4PA 1ZMAA 5D73A 4TR1B 2VCWA 1H4OA 2OADA 4KAEA 4K2DA 4K0GA 1XW9A 2IN3A 2RLIA 2FWGA 1GWCA 5IPGA 5HFGA 3UVHA 2LTKA 1DUGA 2C0EA 1FO5A 2YANA 4IGJA 16GSA 3CSJA 4MZWA 3GA4A 4MH2A 1OC9A 2O87A 2LJRA 3UAPA 1J08A 3BBYA 4TXOB 2NBSA 3TJBA 5J4UA 3D6IA 4K1FA 2K6VA 4TOPA 3EWLA 4K9ZA 2LJKA 3C73A 2H8LA 3IR4A 4I8BA 5GZZB 4PQIA 2VLTA 3DVWA 3H8QA 4KGIA 2JZRA 1PRXA 2XHFA 5ECSA 2R2JA 5HQPA 2LRCA 3ZTLA 7GSSA 5CRHA 2X8CA 3HHVA 3ZFBA 3FRCA 3PGTA 4X0XA 2DJ0A 1FHEA 2EIOA 3LG6A 3UEMA 3LYKA 3QAWA 1E6BA 3IHQA 1ACVA 4KSMA 1O8WA 3QR6A 4NV5A 4IP6A 2VOCA 3DWVA 4LA1A 3F63A 3M0FA 1YQ1A 2H6YA 2I3YA 5JWOB 1FOHA 3KXOA 2YJ7A 2HRAA 17GSA 5IQYA 4FYBA 1F6MC 2PUKC 1Z3EA 4I2UA 3F6DA 5DAKB 1PSQA 4HDEA 3TJFA 5AGYA 1UVZA 4TR3A 1X5CA 3FZ4A 5HR3A 2IMFA 4JRRA 1XCCA 4MK3A 3R2QA 5COHA 1MD4A 3V1WA 3KJYA 4PQHA 5B6MA 3D0ZA 3MSZA 3TOTA 2K8VA 1A0RP 1VF2A 3UJ1A 2A2SA 5A5KA 3RDWA 1XZOA 4MDCA 1OKDA 5ECNB 3MWHA 1FOVA 1W89A 2B5EA 3RHCA 3S9FA 3GSTA 1B4QA 2C8UA 3N5OA 2D2ZA 4POMA 4WF5A 2RUEA 3HY2A 1S3AA 4BVYA 1MDJA 3HA9A 4KUNA 4Z2UA 4RQRA 3APSA 4KB3A 2H75A 2GZYA 2LRNA 4HJMA 5CYYA 2N5AA 2WULA 1WOUA 1TRVA 4LMVA 2IYJA 4JBBA 4K7NA 2P0GA 5JCUA 4ID0A 4MJBA 1TK0B 3HZ8A 3WGDA 3UARA 2MMNA 3TUEA 3VFIA 2TIRA 2WDUA 3C71A 2CVKA 3UIWA 2FHEA 4MNNA 5DBQA 2CV4A 3L9VA 2H74A 4IKHA 4JZQA 1M9AA 2V2GA 1EP8A 1SENA 1FVJA 3FMWA 3LYPA 3Q19A 2QC7A 1PKZA 3F4SA 2H76A 3U5RE 1VRSD 1TOFA 5D9VA 2NTOA 4IP1A 4X1UA 4NHWA 1EEJA 3IPZA 1R5PA 1BEDA 3KGKA 5BMUA 5KN2A 4Z7XA 3MDKA 1B48A 4GRFA 2N5FA 3ZVJD 4IHUA 5CNWA 3GTUA 2B7KA 3E3EA 5D9XA 4G19A 3EPTA 4MH3A 3LSZA 2JSZA 3KH7A 1ZCPA 1AQWA 4K6XA 2HYXA 3FYGA 4OCEA 2DJ2A 3WGXA 2MMAA 3US3A 1F3BA 2XPDA 1UA5A 4HS1A 3H1NA 3HXSA 4OMVA 2O85A 1V40A 1XPVA 4G2EA 4BVXA 1XFLA 1XW6A 1I5GA 4DEJA 5A4VA 3ZZXA 4GQFA 3HVVA 4EVMA 2F51A 3BOAA 3F6FA 5A4WA 1G0TA 2DBCA 2KOKA 2C0GA 2VL9A 3A5IA 1YJ6A 3BD2A 5ECHB 2HZEB 2DJ3A 4EIPA 2CVBA 4KX4A 4I2TA 3MYDA 3IOSA 4WR4A 2CAQA 2OJLA 1XW5A 3HJMA 3HZ4A 4K8MA 3G7JA 2AJQB 3FR9A 4MMMA 3UBKA 3IAM2 4TN8A 2HZFA 4MF7A 2AYTA 5KN3A 1HNAA 4E8EA 4EDZA 4NAXA 2O89A 2FWHA 3A3TA 3UL3A 5IMFA 1F2EA 1A24A 3QPMA 1G7EA 6GSUA 4YAPA 1JZDA 1Y25A 2LJAA 3LJRA 2HSMA 2DJKA 2GSRA 4JR4A 2HSYA 3UBLA 4IS0A 4BL7A 6GSYA 4TRXA 3TRPA 2H71A 4KA0A 5CRDA 4PURA 2GLRA 1M99A 3VLNA 1USBA 4PUAA 1AUCA 2VO4A 1U6TA 4V2NA 2E7PA 2XBQA 3P2AA 3KMNA 4EXJA 1S3CA 1SJZA 4YQVA 2P5RA 1XOAA 1ZYEA 5C00A 5EVOA 2GTUA 1G6WA 4YQUA 2YV7A 2VCXA 3L0HA 4AJ7A 1QMVA 4WEYA 1O81A 4MJAA 5AISA 3VI5A 2VCQA 5HR1A 3GV1A 3LORA 5IMZA 2VM2A 5B6NA 2JSYA 4I97A 2IPAA 1TRWA 4OWYA 1WIKA 3TRQA 1TK5B 5FWGA 2UZ8A 4TR0A 2FUG2 3EU3A 1GSYA 2H19A 1OKTA 1R26A 3EMXA 1Z7PA 1RW1A 4FO5A 4AGSA 2M72A 1ZZYA 4NPBA 4GCIA 1GSEA 4LMWA 2RIIA 1A2LA 2IFQA 4RQXA 3NOFA 4GQCA 3DIEA 3LW9A 2PU9C 1MTCA 1K0NA 2GSTA 4N0VA 12GSA 5A4UA 2YNXA 2A2PA 3G7IA 5F07A 1K0AA 3F9UA 1YKCA 3TKSA 1Z7RA 1HNCA 3BCIA 2BJXA 4AJ8A 3QDNA 4ZILA 1SU9A 5IIZA 2VL2A 3DRNA 3TGZA 3LXTA 3F3RA 4ZL9A 3EC3A 4Q5QA 4ACSA 3ZYWA 2ZUPA 3ZITA 4G0LA 1U3AA 3C1SA 3M3MA 4KSOA 2QA1A 3GSSA 5ID2A 3KP8A 3IK9A 1YEXA 3HVXA 5ECKB 3L4NA 4L8EA 2H0GA 4MPFA 3QAVA 3OR5A 2WB9A 3IA1A 3PPUA 2FLSA 3EYTA 4LL4B 3QMXA 1T7PB 3HVSA 3I9V2 2H6ZA 2LNTA 4MPGA 1X0RA 1MDIA 2E2GA 1RQMA 3F0IA 5AIVA 1VF4A 2NVLA 4CY8A 5KOXA 2YZUA 1U88A 2YPMA 4WF4A 2FNOA 1VF1A 3ZL5A 1PA3A 3PR8A 1JHBA 2H73A 2R5GA 4ZBDA 2DJ1A 3TJJA 5D9TA 2ON5A 2H0IA 3WT1A 8GSSA 4FH8A 4KH7A 1BQ7A 3ZMLA 1BAYA 3QD9A 2DKHA 2R0GA 2HNLA 6GSVA 4Q5NA 2X4AA 1TI3A 2HSHA 1ERWA 5KEJA 2YP6A 1EGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L57 A;  2N5B A;  4F03 A;  1N8J A;  2CZ2 A;  1AW9 A;  3GL3 A;  1Z5Y E;  3KTL A;  2K9F A;  4L5O A;  3UVT A;  2YN1 A;  2PPT A;  3GH6 A;  4IQA A;  4GSS A;  3APO A;  2I9H A;  5H5S A;  1DSB A;  3IE3 A;  1KTE A;  5IPH A;  2B1L A;  3ERW A;  4QL9 A;  1C72 A;  3QAG A;  3HCZ A;  3CSH A;  1OVN A;  3TJK A;  5IOX A;  1PL2 A;  1GRX A;  2VCV A;  3NIV A;  3O76 A;  4V2L A;  4XS4 A;  2XC2 A;  2OAC A;  5B8B A;  2I81 A;  1XWG A;  4J56 E;  4D73 A;  6GSX A;  3UOM A;  3PIN A;  3GTU B;  1GTI A;  1GTA A;  1QQ2 A;  20GS A;  3GMF A;  1AQX A;  2LNS A;  4HZ2 A;  4IVF A;  1ZOF A;  1JLW A;  1J9B A;  3QCP A;  3L9U A;  3CTG A;  4ZB8 A;  4CDO A;  2H1G A;  4EE0 A;  2VD1 A;  2HE3 A;  3FZ5 A;  3HJP A;  1SL0 B;  3VWV A;  4BPY A;  5DAL B;  2CAI A;  1K0B A;  11GS A;  3GKK A;  4MJE A;  4L5L A;  4XRD A;  2R4V A;  2I1U A;  1SD8 A;  4DSS A;  1YDK A;  3MNG A;  2M46 A;  4F2I A;  2H6X A;  3Q6O A;  2C3N A;  3J7Y b;  1T4Y A;  4GTU A;  4POL A;  2TRX A;  3ME7 A;  1GNW A;  4GF0 A;  3VWU A;  1JLV A;  3A2X A;  5IMD A;  2EIQ A;  2F3M A;  4TR1 A;  1GSS A;  5CAX A;  5KN0 A;  3FZA A;  3DD3 A;  3QFA C;  2X8H A;  4KCA A;  2GT6 A;  2CQ9 A;  5F8B A;  3KD0 A;  1EP7 A;  2B7J A;  1OAZ A;  1TP9 A;  3CMI A;  2X8G A;  1ML6 A;  1WE0 A;  3IK7 A;  3EUR A;  1SK2 A;  1M2A A;  5INY A;  5DCG A;  3RPP A;  3ISO A;  3KM6 A;  2IMK A;  5JWQ B;  4TXO A;  4LL1 B;  2Z9S A;  2LEG A;  1WRY A;  1SYX A;  2KHP A;  2F9S A;  3P7X A;  1MDK A;  4PNG A;  2C3T A;  2ES7 A;  1O8X A;  1XXU A;  3KH9 A;  3FEU A;  4JED A;  2EIR A;  3M1G A;  1ZYQ B;  5LCZ A;  2CZ3 A;  3TKP A;  1JZW A;  2LV3 A;  5JCG A;  4KCE A;  2VL3 A;  4JR6 A;  3DYR A;  2OBK A;  3IC4 A;  2EC4 A;  5LNK e;  3CRT A;  3H79 A;  4KW6 A;  5DVB A;  2YWN A;  4J57 E;  2J23 A;  2WGR A;  1GSU A;  3I43 A;  4IEL A;  1TXX A;  4EC0 A;  2VUP A;  2M80 A;  4HU7 A;  1BG5 A;  4KDY A;  3ZRD A;  1A8L A;  4N11 A;  5ECO B;  4ULX A;  2V6O A;  1PX6 A;  3FR3 A;  1A2M A;  3M8N A;  4TR4 A;  1AC1 A;  1VGL A;  4V1A p;  4XRA A;  4TKY A;  2WFC A;  4ML6 A;  2DMM A;  4O5R A;  1ZGN A;  3FKF A;  2OA7 A;  2DLX A;  1AQV A;  3VWW A;  9GSS A;  4HQZ A;  2C0F A;  1FB0 A;  1ERV A;  4ECI A;  4N10 A;  3Q74 A;  4LLR A;  3HKR A;  4DSQ A;  2R37 A;  2J9H A;  2BTO T;  1SKS B;  1VF3 A;  2GSQ A;  3VK9 A;  4MZB A;  5IMC A;  2K18 A;  3CTF A;  3GX8 A;  5DCH A;  4RI7 A;  2LS5 A;  2YWM A;  2O7K A;  2GQM A;  3IDV A;  4NV2 A;  3D4M A;  3ZIV A;  3ZFL A;  1TDI A;  3GFK A;  4GST A;  2CA8 A;  3G7Y A;  1R7H A;  2H70 A;  1SK1 A;  2YJH A;  5GSS A;  3TKQ A;  2DC5 A;  4EL1 A;  2ZNM A;  1X9W B;  4G9H A;  1YKA A;  3IAS 2;  3HJO A;  1R5A A;  5G1K A;  3AY8 A;  4RI6 A;  2MMO A;  2G2Q A;  1NM3 A;  4XIH A;  2H1A A;  3WT2 A;  2ZCT A;  3P8W A;  3H93 A;  4OO4 A;  1SJI A;  1GSF A;  1SK0 A;  1Z6N A;  4MF5 A;  1YF1 A;  2C1Y A;  2PN8 A;  1EZK A;  2C3Q A;  4EF0 A;  3D4T A;  1LU4 A;  5F06 A;  1FAA A;  3ERF A;  2V32 A;  2HRN A;  1DBY A;  1LJR A;  2HLS A;  4OFT A;  1YF0 A;  1TKD B;  1BX9 A;  1TI1 A;  3KP9 A;  2MBS A;  6GST A;  1ABA A;  1NHO A;  1OC9 B;  4QQ7 A;  4GXZ A;  3TOU A;  5G30 A;  4MJC A;  3EE2 A;  4ZBA A;  1XBS A;  1PMT A;  3M9J A;  5D9W A;  1CQH A;  1A23 A;  2AB6 A;  1XWK A;  1B9Y C;  2OE0 A;  3P90 A;  5IMV A;  2KP2 A;  1TRS A;  1SL1 B;  1OE8 A;  2AUV A;  2B1K A;  3KZQ A;  1GSQ A;  2VLU A;  1EOG A;  5DDL A;  5ECM B;  2IMD A;  3GH9 A;  1WP0 A;  5CRW A;  2WJU A;  5G2Z A;  5GST A;  3TKR A;  1B8X A;  2QKE A;  2DJJ A;  3CXG A;  1V98 A;  2E0Q A;  2P5Q A;  3O3T A;  3ZMK A;  1U87 A;  2L5L A;  4HEA 2;  1OC3 A;  1ERT A;  2DML A;  4NMU A;  14GS A;  1A8Y A;  2OE3 A;  1TK8 B;  3F4R A;  1WWJ A;  3U6V A;  3NZN A;  2H1D A;  1UC7 A;  5AN1 A;  1FG4 A;  3A2W A;  2JL4 A;  1HQO A;  1OC8 A;  1JZR A;  2HI7 A;  2OKA A;  1QFN A;  1SKW B;  4HUA A;  1ZL9 A;  2P31 A;  18GS A;  2LUS A;  4D73 B;  1K0M A;  2WRT A;  3BJ5 A;  2VLV A;  3SWL A;  3TJG A;  4XS1 A;  3E9J B;  3DGQ A;  3DXB A;  4FYC A;  2VAF A;  2FD3 A;  3RHB A;  3QOU A;  2IJY A;  2X99 A;  2HZE A;  5JWR B;  1M2B A;  2YCD A;  1ON4 A;  2PVQ A;  1QK8 A;  3KIJ A;  4EDY A;  4K7I A;  4MLY A;  1FW1 A;  4CHS A;  4EO3 A;  4IBP A;  3GIX A;  5F05 A;  2H1B A;  1CQG A;  3F8U A;  5IOW A;  4ECB A;  5C04 A;  4N30 A;  13GS A;  1YZX A;  5CRE A;  1TJD A;  2GZZ A;  1Y6E A;  3CSI A;  4OFN A;  4O7H A;  3APQ A;  2L4Q A;  3ERG A;  1GUH A;  1TRU A;  1WJK A;  1A0F A;  4BWQ A;  4MP4 A;  1PGT A;  1WPI A;  1AIU A;  5G31 A;  1Q4J A;  5IO2 A;  3D5J A;  4PXO A;  3TRX A;  1J0F A;  4WBR D;  3QFB C;  1JFU A;  1BYE A;  2GS3 A;  3EU4 A;  4CW9 A;  1M0U A;  3I6A A;  6GSS A;  3EIN A;  1T00 A;  3GHA A;  4Q5F A;  2L6D A;  1URM A;  3DEX A;  3GYK A;  1THO A;  1KNG A;  4IJ3 A;  2NPB A;  1UN2 A;  5FHI A;  5B8A A;  1DE1 A;  1HNB A;  4WBJ A;  4K7O A;  2R6K A;  2OE1 A;  3EMP A;  1TTZ A;  1KEB A;  3GUS A;  2VIM A;  2JAC A;  3GN3 A;  3CBU A;  4PX1 A;  2H72 A;  4HOJ A;  1K0O A;  2E2M A;  2QGV A;  1H75 A;  3DML A;  1NSW A;  4ZXG A;  1TW9 A;  1GUK A;  2YV9 A;  4TXV A;  4F0B A;  1SJ6 A;  1M9B A;  5DQY A;  3FZ9 A;  4OO5 A;  4I5Q A;  2MZC A;  3LGC A;  2O8V B;  2IIY A;  2GZP A;  1SYR A;  3Q18 A;  5CO3 A;  5G5E A;  4HQS A;  5D93 A;  5L71 A;  4F0C A;  2DIY A;  4GLT A;  1X9S B;  2FY6 A;  1IYI A;  3F4T A;  4JE1 A;  2FGX A;  4MZC A;  1SD9 A;  3RPN A;  1XVW A;  2KP1 A;  1K3L A;  4DSR A;  4EUY A;  1W4V A;  1ERU A;  1PD2 1;  2GT5 A;  4MA9 A;  3TB2 A;  2ON7 A;  2REM A;  2RM5 A;  2QSI A;  3VPQ A;  1T1V A;  4WKW A;  4E8H A;  3LWA A;  3SBC A;  4PGT A;  3WD6 A;  2IME A;  2GSS A;  5F0G A;  4IN0 A;  5G1L A;  1AXD A;  2PVO C;  5CP1 A;  4IJI A;  4BA7 A;  3KMO A;  2YWI A;  5EL8 A;  2F8A A;  1OE7 A;  2WS2 A;  3IBH A;  2BMX A;  4ZL7 A;  3IV4 A;  1PKW A;  2TRC P;  2FA4 A;  5E59 A;  4H86 A;  3EVI A;  1XVQ A;  1XOB A;  4PUF C;  4YH2 A;  4F9Z A;  4GSN A;  4J2F A;  5HR2 A;  3KTB A;  4ISD A;  1XWA A;  1FVK A;  2B5X A;  2L4C A;  2HXK A;  4IQ1 A;  3FK8 A;  4L0U A;  4G10 A;  4OCF A;  5DJM A;  2K8S A;  2WCI A;  1EEM A;  1XWC A;  1PN9 A;  2HFD A;  3ZVJ A;  2PER A;  1X5D A;  1M2D A;  2MBT A;  3FW2 A;  1T8E B;  2GVP A;  3FHK A;  3LXZ A;  5J41 A;  2JZS A;  3DKS A;  5J9B A;  4XCS A;  1E2Y A;  2LST A;  2H30 A;  1K0D A;  1GSD A;  1I9D A;  3BCK A;  2A2R A;  4NHZ A;  2PGT A;  4POB A;  3WYW A;  5ABR A;  5FT3 A;  2I4A A;  2VM1 A;  3CRU A;  4WXT A;  4WET A;  4O92 A;  4KDU A;  1YY7 A;  1GNE A;  4L0W A;  1PL1 A;  2R3X A;  5H5R A;  3VWX A;  3WGE A;  2A4V A;  1BJX A;  2V1M A;  5J3R A;  19GS A;  4DVC A;  3A2V A;  3KCM A;  4O32 A;  1X5E A;  5EY6 A;  4I6X A;  3GNJ A;  1O85 A;  5J5N A;  1K3O A;  4HU9 A;  1Q98 A;  4POK A;  3H4K A;  5H5Q A;  4NWY A;  2VD0 A;  4XHM A;  3ZIJ A;  1V2A A;  2AAW A;  1ILO A;  1QXH A;  3O6T A;  5GAN D;  3LEF A;  1RK4 A;  3C8E A;  5LD0 A;  1XWB A;  10GS A;  1MD3 A;  1M7T A;  1TU8 A;  5DAK A;  1EOH A;  2F8F A;  1S3D A;  1LBK A;  4HI7 A;  3F3Q A;  2LKU A;  4OD7 A;  4XS6 A;  5IM9 A;  3GKM A;  2YZH A;  5HFI A;  2GGT A;  1V58 A;  3I69 A;  3LFL A;  2MMZ A;  3FY7 A;  1N2A A;  1T4Z A;  3GKN A;  4HZ4 A;  4GWR A;  4EKZ A;  4OFM A;  2GQK A;  2YOI A;  3D21 A;  3L78 A;  5ECP B;  3VI7 A;  3ZLP A;  1IYH A;  3FR6 A;  3W8J A;  1G6Y A;  2IFQ B;  5G5F A;  2CX3 A;  5DQS A;  3KEB A;  4FIW A;  3VUR A;  1AAZ A;  4YQM A;  2C4J A;  4PNF A;  5E4W A;  2ALB A;  1GTB A;  1F3A A;  4WR5 A;  3TDG A;  1HD2 A;  3TKS E;  3ED3 A;  5DJL A;  5GAP D;  3ME8 A;  3W8S A;  5D96 A;  4YAV A;  3A5W A;  2AV4 A;  4ILF A;  5DAL A;  4Q5R A;  2VCZ A;  3L9S A;  2B5Y A;  3K8N A;  4ZL8 A;  1B9X C;  5ELG A;  5IO0 A;  2FWE A;  2DSA A;  2DIZ A;  5ID2 B;  4ECC A;  1Z9H A;  2V6K A;  2IL3 A;  2CVD A;  3GX0 A;  1OYJ A;  1O73 A;  3M9K A;  4KND A;  3IXR A;  2C0D A;  1GP1 A;  2L59 A;  2H0H A;  2L6C A;  4BWS A;  2VCT A;  2FCH A;  2C80 A;  5J9C A;  4ZB9 A;  3JCM L;  4K0N A;  3TCO A;  3C1R A;  3UMA A;  2X64 A;  2V41 A;  3HYP A;  2NDO A;  5ECI B;  4MCU A;  1TU7 A;  1WMJ A;  4V1A g;  4XTS A;  1XIY A;  1GLP A;  2MYG A;  1NW2 A;  4IW9 A;  4PQ1 A;  2L5O A;  3GRX A;  2KUC A;  1V9W A;  2YWO A;  5ENU A;  2XBI A;  5KN1 A;  2H01 A;  4AJ6 A;  2JZT A;  3DVX A;  1ST9 A;  1O7U A;  5CRG A;  2PWJ A;  1QGV A;  6GSW A;  3RBT A;  4ZIJ A;  1EWX A;  3G9B A;  5EPF A;  3GKX A;  2RM6 A;  5ECR B;  1YEP A;  1PQN A;  2WZ9 A;  2CX4 A;  3CYN A;  2KLX A;  3PH9 A;  1EGR A;  1R4W A;  2RUF A;  3MAK A;  2GDR A;  1GUM A;  2HRF A;  1GTU A;  4KDX A;  2G0F A;  1NHY A;  1F9M A;  2LRT A;  3VPT A;  2OBI A;  5HR0 A;  1T3B A;  1O6J A;  2LQO A;  4JU5 A;  1JZO A;  2HT9 A;  2JU5 A;  1K0C A;  4RUV A;  5IMA A;  1EV4 A;  1X9M B;  4MF6 A;  1KBN A;  2H66 A;  5AIX A;  1U3I A;  4F82 A;  4MAB A;  5B7C A;  4P3Y B;  5JCW A;  3HD5 A;  1F37 A;  1THX A;  1PX7 A;  3HDC A;  1GUL A;  4ZBB A;  4ML1 A;  1QUW A;  4XS4 B;  4V2M A;  4TVE A;  2PBJ A;  5ECL B;  2PMT A;  1MEK A;  3GL5 A;  3GUR A;  2LQQ A;  4N0Z A;  3W6G A;  1V57 A;  3E0U A;  4NXI A;  1SKR B;  2CT6 A;  5ECQ B;  4QL7 A;  1Z6M A;  2IMI A;  3RAZ A;  1GH2 A;  4ECJ A;  1K3Y A;  1HYU A;  3D22 A;  2FA8 A;  3N9J A;  4TW5 A;  2AHE A;  1GLQ A;  4ZB6 A;  2B6M A;  3LQ7 A;  3TKS C;  2GQL A;  3ZRE A;  3J7Y k;  4X43 A;  2B3S A;  1A2J A;  1EV9 A;  4HJ2 A;  4KE3 A;  2VL2 C;  22GS A;  5HFK A;  1FB6 A;  4FYU A;  1G7O A;  4DSS B;  2JAD A;  5D8I A;  5ELA A;  1DE2 A;  4AF2 A;  3IRA A;  1GL8 A;  2XPE A;  3C7M A;  2IWT A;  2FWF A;  2IY2 A;  1SL2 B;  1B4P A;  1ZMA A;  5D73 A;  4TR1 B;  2VCW A;  1H4O A;  2OAD A;  4KAE A;  4K2D A;  4K0G A;  1XW9 A;  2IN3 A;  2RLI A;  2FWG A;  1GWC A;  5IPG A;  5HFG A;  3UVH A;  2LTK A;  1DUG A;  2C0E A;  1FO5 A;  2YAN A;  4IGJ A;  16GS A;  3CSJ A;  4MZW A;  3GA4 A;  4MH2 A;  1OC9 A;  2O87 A;  2LJR A;  3UAP A;  1J08 A;  3BBY A;  4TXO B;  2NBS A;  3TJB A;  5J4U A;  3D6I A;  4K1F A;  2K6V A;  4TOP A;  3EWL A;  4K9Z A;  2LJK A;  3C73 A;  2H8L A;  3IR4 A;  4I8B A;  5GZZ B;  4PQI A;  2VLT A;  3DVW A;  3H8Q A;  4KGI A;  2JZR A;  1PRX A;  2XHF A;  5ECS A;  2R2J A;  5HQP A;  2LRC A;  3ZTL A;  7GSS A;  5CRH A;  2X8C A;  3HHV A;  3ZFB A;  3FRC A;  3PGT A;  4X0X A;  2DJ0 A;  1FHE A;  2EIO A;  3LG6 A;  3UEM A;  3LYK A;  3QAW A;  1E6B A;  3IHQ A;  1ACV A;  4KSM A;  1O8W A;  3QR6 A;  4NV5 A;  4IP6 A;  2VOC A;  3DWV A;  4LA1 A;  3F63 A;  3M0F A;  1YQ1 A;  2H6Y A;  2I3Y A;  5JWO B;  3KXO A;  2YJ7 A;  17GS A;  5IQY A;  4FYB A;  1F6M C;  2PUK C;  1Z3E A;  4I2U A;  3F6D A;  5DAK B;  1PSQ A;  4HDE A;  3TJF A;  5AGY A;  1UVZ A;  4TR3 A;  1X5C A;  3FZ4 A;  5HR3 A;  2IMF A;  4JRR A;  1XCC A;  4MK3 A;  3R2Q A;  5COH A;  1MD4 A;  3V1W A;  3KJY A;  4PQH A;  5B6M A;  3D0Z A;  3MSZ A;  3TOT A;  2K8V A;  1A0R P;  1VF2 A;  3UJ1 A;  2A2S A;  5A5K A;  3RDW A;  1XZO A;  4MDC A;  1OKD A;  5ECN B;  3MWH A;  1FOV A;  1W89 A;  2B5E A;  3RHC A;  3S9F A;  3GST A;  1B4Q A;  2C8U A;  3N5O A;  2D2Z A;  4POM A;  4WF5 A;  2RUE A;  3HY2 A;  1S3A A;  4BVY A;  1MDJ A;  3HA9 A;  4KUN A;  4RQR A;  3APS A;  4KB3 A;  2H75 A;  2GZY A;  2LRN A;  4HJM A;  5CYY A;  2N5A A;  2WUL A;  1WOU A;  1TRV A;  4LMV A;  2IYJ A;  4JBB A;  4K7N A;  2P0G A;  5JCU A;  4ID0 A;  4MJB A;  1TK0 B;  3HZ8 A;  3WGD A;  3UAR A;  2MMN A;  3TUE A;  3VFI A;  2TIR A;  2WDU A;  3C71 A;  2CVK A;  3UIW A;  2FHE A;  5DBQ A;  2CV4 A;  3L9V A;  2H74 A;  4IKH A;  4JZQ A;  1M9A A;  2V2G A;  1EP8 A;  1SEN A;  1FVJ A;  3LYP A;  3Q19 A;  2QC7 A;  1PKZ A;  3F4S A;  2H76 A;  3U5R E;  1VRS D;  1TOF A;  5D9V A;  2NTO A;  4IP1 A;  4X1U A;  4NHW A;  1EEJ A;  3IPZ A;  1R5P A;  1BED A;  3KGK A;  5KN2 A;  4Z7X A;  3MDK A;  1B48 A;  4GRF A;  2N5F A;  3ZVJ D;  4IHU A;  5CNW A;  3GTU A;  2B7K A;  3E3E A;  5D9X A;  4G19 A;  4MH3 A;  3LSZ A;  2JSZ A;  3KH7 A;  1ZCP A;  1AQW A;  4K6X A;  2HYX A;  3FYG A;  4OCE A;  2DJ2 A;  3WGX A;  2MMA A;  3US3 A;  1F3B A;  2XPD A;  1UA5 A;  4HS1 A;  3H1N A;  3HXS A;  4OMV A;  2O85 A;  1V40 A;  1XPV A;  4G2E A;  4BVX A;  1XFL A;  1XW6 A;  1I5G A;  4DEJ A;  5A4V A;  3ZZX A;  4GQF A;  3HVV A;  4EVM A;  2F51 A;  3BOA A;  3F6F A;  5A4W A;  1G0T A;  2DBC A;  2KOK A;  2C0G A;  2VL9 A;  3BD2 A;  1YJ6 A;  5ECH B;  2HZE B;  2DJ3 A;  2CVB A;  4KX4 A;  4I2T A;  3IOS A;  4WR4 A;  2CAQ A;  2OJL A;  1XW5 A;  3HJM A;  3HZ4 A;  4K8M A;  3G7J A;  2AJQ B;  3FR9 A;  4MMM A;  3UBK A;  3IAM 2;  4TN8 A;  2HZF A;  4MF7 A;  2AYT A;  5KN3 A;  1HNA A;  4E8E A;  4EDZ A;  4NAX A;  2O89 A;  2FWH A;  3A3T A;  3UL3 A;  5IMF A;  1F2E A;  1A24 A;  3QPM A;  1G7E A;  6GSU A;  4YAP A;  1JZD A;  1Y25 A;  2LJA A;  3LJR A;  2DJK A;  2GSR A;  4JR4 A;  2HSY A;  3UBL A;  4IS0 A;  4BL7 A;  6GSY A;  4TRX A;  3TRP A;  2H71 A;  4KA0 A;  5CRD A;  4PUR A;  2GLR A;  1M99 A;  3VLN A;  1USB A;  4PUA A;  1AUC A;  2VO4 A;  1U6T A;  4V2N A;  2E7P A;  2XBQ A;  3P2A A;  3KMN A;  4EXJ A;  1S3C A;  1SJZ A;  4YQV A;  2P5R A;  1XOA A;  1ZYE A;  5C00 A;  5EVO A;  2GTU A;  1G6W A;  4YQU A;  2YV7 A;  2VCX A;  3L0H A;  4AJ7 A;  1QMV A;  4WEY A;  1O81 A;  4MJA A;  5AIS A;  3VI5 A;  2VCQ A;  5HR1 A;  3GV1 A;  3LOR A;  5IMZ A;  2VM2 A;  5B6N A;  2JSY A;  4I97 A;  2IPA A;  1TRW A;  4OWY A;  1WIK A;  3TRQ A;  1TK5 B;  5FWG A;  4TR0 A;  2FUG 2;  3EU3 A;  1GSY A;  2H19 A;  1OKT A;  1R26 A;  3EMX A;  1Z7P A;  1RW1 A;  4FO5 A;  4AGS A;  2M72 A;  1ZZY A;  4NPB A;  4GCI A;  1GSE A;  4LMW A;  2RII A;  1A2L A;  2IFQ A;  4RQX A;  3NOF A;  4GQC A;  3DIE A;  2PU9 C;  1MTC A;  1K0N A;  2GST A;  4N0V A;  12GS A;  5A4U A;  2YNX A;  3G7I A;  5F07 A;  1K0A A;  3F9U A;  1YKC A;  3TKS A;  1Z7R A;  1HNC A;  3BCI A;  2BJX A;  4AJ8 A;  3QDN A;  4ZIL A;  1SU9 A;  5IIZ A;  2VL2 A;  3DRN A;  3TGZ A;  3LXT A;  3F3R A;  4ZL9 A;  3EC3 A;  4Q5Q A;  4ACS A;  3ZYW A;  2ZUP A;  3ZIT A;  1U3A A;  3C1S A;  3M3M A;  4KSO A;  3GSS A;  5ID2 A;  3KP8 A;  3IK9 A;  1YEX A;  3HVX A;  5ECK B;  3L4N A;  4L8E A;  2H0G A;  4MPF A;  3QAV A;  3OR5 A;  2WB9 A;  3IA1 A;  2FLS A;  3EYT A;  4LL4 B;  3QMX A;  1T7P B;  3HVS A;  3I9V 2;  2H6Z A;  2LNT A;  4MPG A;  1X0R A;  1MDI A;  2E2G A;  1RQM A;  3F0I A;  5AIV A;  1VF4 A;  2NVL A;  2YZU A;  1U88 A;  2YPM A;  4WF4 A;  2FNO A;  1VF1 A;  3ZL5 A;  1PA3 A;  3PR8 A;  1JHB A;  2H73 A;  2R5G A;  4ZBD A;  2DJ1 A;  3TJJ A;  5D9T A;  2ON5 A;  2H0I A;  3WT1 A;  8GSS A;  4FH8 A;  4KH7 A;  1BQ7 A;  3ZML A;  1BAY A;  3QD9 A;  2HNL A;  6GSV A;  4Q5N A;  1TI3 A;  2HSH A;  1ERW A;  5KEJ A;  2YP6 A;  1EGO A; 
#chains in the Genus database with same CATH topology
 2L57 A;  2N5B A;  4F03 A;  1UCI A;  2P38 A;  1N8J A;  2CZ2 A;  2WGQ A;  1AW9 A;  3JUP A;  3GL3 A;  1Z5Y E;  2IUK A;  3KTL A;  2K9F A;  1B2Z A;  4L5O A;  1I70 A;  3UVT A;  1MOL A;  4O02 B;  2YN1 A;  2PPT A;  3GH6 A;  1JRQ A;  4IQA A;  1ZYP A;  3D9R A;  4GSS A;  1M1X B;  1BAN A;  3APO A;  2I9H A;  5H5S A;  2GBX B;  3KII A;  1DSB A;  3IE3 A;  3UB1 A;  2R0P A;  2KF5 A;  3G6E 3;  1KTE A;  5IPH A;  2B1L A;  3ERW A;  4K2X A;  4QL9 A;  1C72 A;  4IPB A;  3QAG A;  2HRK A;  3HCZ A;  1Q82 4;  3CSH A;  1OVN A;  3TJK A;  3MPH A;  5IOX A;  1PL2 A;  4LSO A;  1GRX A;  2W2C A;  2VCV A;  1A67 A;  3NIV A;  2D42 A;  5RNT A;  3WA3 A;  2QA2 A;  3O76 A;  3GSP A;  4V2L A;  4XS4 A;  2XC2 A;  2OAC A;  5B8B A;  2I81 A;  1XWG A;  4J56 E;  4D73 A;  6GSX A;  4JF8 A;  3UOM A;  3PIN A;  2BMR B;  5ELJ A;  3S28 A;  3GTU B;  3LYG A;  1IT8 A;  1GTI A;  1GTA A;  4HOH A;  1QQ2 A;  3F40 A;  20GS A;  3GMF A;  1LOW A;  1D6U A;  1AQX A;  2LNS A;  4HZ2 A;  1S72 3;  1VQL 3;  4IVF A;  1ZOF A;  1JLW A;  4HM4 B;  2WOH A;  1N8R 4;  1J9B A;  3QCP A;  1JB4 A;  1TTO A;  4WYK A;  1QJG A;  1VQQ A;  3FGY A;  1ULJ B;  1R4Y A;  4K5R A;  1BNR A;  3L9U A;  3CTG A;  4ZB8 A;  1BSC A;  2H1G A;  4CDO A;  4EE0 A;  3F14 A;  3FG3 A;  2VD1 A;  2HE3 A;  1RKY A;  3FZ5 A;  4H3U A;  3HJP A;  1SL0 B;  3VWV A;  3FG1 A;  3DGN A;  4PTS A;  1B2U A;  5DAL B;  4BPY A;  2CAI A;  1K0B A;  11GS A;  4ICY A;  3B4O A;  3GKK A;  2GXF A;  4MJE A;  4L5L A;  4XRD A;  2BMO B;  2R4V A;  1YHQ 3;  2I1U A;  4BU4 A;  1SD8 A;  2XGL A;  4DSS A;  4G0K A;  1YDK A;  3MNG A;  2M46 A;  4F2I A;  1OH0 A;  2H6X A;  3Q6O A;  2C3N A;  1UUW B;  3J7Y d;  3J7Y b;  1T4Y A;  4GTU A;  1A2P A;  4POL A;  2ML5 A;  2TRX A;  1DYU A;  3H51 A;  1GNW A;  3ME7 A;  4GF0 A;  1TU5 A;  1UCK A;  3VWU A;  4OVM A;  5AEW B;  1JLV A;  3A2X A;  5IMD A;  2EIQ A;  2F3M A;  3SX1 A;  4TR1 A;  1GSS A;  5CAX A;  5AII A;  3NV0 B;  5KN0 A;  3B7C A;  3FZA A;  3DD3 A;  3QFA C;  4PEJ A;  2X8H A;  4KCA A;  3FSD A;  3EHC A;  1GY6 A;  3PGB A;  2GT6 A;  2CQ9 A;  5F8B A;  3KD0 A;  1W7C A;  1EP7 A;  4R4K A;  2B7J A;  1OAZ A;  4XBY A;  3S5C A;  1TP9 A;  3CMI A;  2X8G A;  2OTL 3;  1ML6 A;  1WE0 A;  1X1X A;  3IK7 A;  3EUR A;  3F8X A;  4STD A;  1JKG B;  5AIH A;  1EA2 A;  4RZM A;  1SK2 A;  2V1L A;  1M2A A;  5INY A;  5DCG A;  3RPP A;  3ISO A;  3IMA B;  1VQP 3;  1QMA A;  3KM6 A;  2IMK A;  5JWQ B;  1I8V A;  3CCU 3;  1VQ4 3;  4TXO A;  4LL1 B;  2Z9S A;  2LEG A;  1WRY A;  2CC3 A;  1SYX A;  2KHP A;  2F9S A;  4J8T A;  2SBL A;  3P7X A;  1NO3 A;  4N6N B;  1MDK A;  4PNG A;  4BL7 B;  2C3T A;  3URP A;  2ES7 A;  1BAO A;  1JV2 B;  5AYR B;  1O8X A;  1XXU A;  3KH9 A;  3FEU A;  5GSP A;  2OTJ 3;  4JED A;  2EIR A;  3M1G A;  1YGW A;  5LCZ A;  1ZYQ B;  5CF1 A;  2CZ3 A;  4G0I A;  3TKP A;  1RDS A;  1JZW A;  1IVV A;  5DRE A;  2LV3 A;  5JCG A;  4KCE A;  3UJM A;  1BUJ A;  2AAE A;  2VL3 A;  2CIU A;  4JR6 A;  3DYR A;  2OBK A;  3IC4 A;  2EC4 A;  3WOE B;  2JQ5 A;  3PS8 A;  5LNK e;  3CRT A;  3H79 A;  4KW6 A;  2QEX 3;  4EV2 A;  5DVB A;  2YWN A;  4J57 E;  2J23 A;  2WGR A;  1GSU A;  2WGO A;  3I43 A;  4IEL A;  3NQZ A;  1TXX A;  4TX4 A;  4EC0 A;  2VUP A;  4K5S A;  1CEW I;  2YFL B;  1A2V A;  2M80 A;  4HU7 A;  4R80 A;  1FGR A;  1IV9 A;  1BG5 A;  1FW7 A;  4KDY A;  3ZRD A;  4HSC X;  1IQX A;  1A8L A;  4N11 A;  3F9S A;  5ECO B;  2HML B;  4ULX A;  1K28 A;  2V6O A;  1PX6 A;  3FR3 A;  1A2M A;  3NUV A;  1BNF A;  3M8N A;  4TR4 A;  2OOV C;  3RGR A;  1AC1 A;  1VGL A;  2P05 A;  1QAF A;  4V1A p;  4XRA A;  4CY6 A;  1B21 A;  4TKY A;  4YKF A;  2W0Q A;  2WFC A;  5CK6 A;  2DMM A;  4ML6 A;  4O5R A;  1ZGN A;  3FKF A;  4HM1 B;  2OA7 A;  2DLX A;  1AQV A;  3VWW A;  3L0R A;  1W2B 2;  1RLS A;  9GSS A;  4HQZ A;  2C0F A;  1KWI A;  1FGQ A;  4HBR A;  5D81 A;  1JB2 A;  1FB0 A;  1ERV A;  4ECI A;  4N10 A;  3Q74 A;  4LLR A;  1RCL A;  1O7N B;  1OPY A;  5JPU A;  3HKR A;  4DSQ A;  4X4J A;  2R37 A;  3CNM A;  2J9H A;  4KF9 A;  3HZP A;  2BTO T;  1SKS B;  1VF3 A;  2GSQ A;  1SII A;  3VK9 A;  1RGE A;  3CME 3;  4MZB A;  2K18 A;  5IMC A;  3CTF A;  3GX8 A;  5DCH A;  4RI7 A;  3CPW 2;  2LS5 A;  2YWM A;  3N9H A;  2O7K A;  3R3E A;  2GQM A;  3IDV A;  4NV2 A;  3D4M A;  3ZIV A;  3ZFL A;  1TDI A;  3GFK A;  4GST A;  2CA8 A;  3G7Y A;  3BIR A;  1R7H A;  2H70 A;  3ZG5 A;  1SK1 A;  3SVA A;  3ZG0 A;  2YJH A;  3MSO A;  5GSS A;  3TKQ A;  2DC5 A;  1NB5 I;  1I3F A;  2PZV A;  4EL1 A;  3LTC A;  2ZNM A;  4USS A;  1X9W B;  4G9H A;  3E99 A;  1YKA A;  2CWT A;  3IAS 2;  4FMB A;  3HJO A;  1R5A A;  5G1K A;  3MG1 A;  2E2V A;  3AY8 A;  4RI6 A;  2MMO A;  3IHG A;  2G2Q A;  2CFL A;  2DKI A;  2E2T A;  3ECF A;  1NM3 A;  3OWY A;  2H1A A;  2OCT A;  4XIH A;  3WT2 A;  4QWT A;  2ZCT A;  3P8W A;  1CQS A;  3Q90 A;  3H93 A;  4OO4 A;  1FGM A;  2IUJ A;  1SJI A;  1GSF A;  1SK0 A;  1Z6N A;  4MF5 A;  1YF1 A;  2C1Y A;  2PN8 A;  3D4A A;  1EZK A;  2C3Q A;  4EF0 A;  3D4T A;  1LU4 A;  1MWU A;  5F06 A;  1FAA A;  3ERF A;  3Q3F A;  4X2H A;  2V32 A;  1BSD A;  2HRN A;  1DBY A;  1LJR A;  2HLS A;  4LZI A;  4OFT A;  1YF0 A;  1TKD B;  1TFO A;  3NX0 A;  1BX9 A;  3GAX A;  1TI1 A;  4CJN A;  3KP9 A;  2MBS A;  6GST A;  1UUV B;  1ABA A;  4HKV B;  1NHO A;  1BNJ A;  1OC9 B;  4QQ7 A;  4GXZ A;  3TOU A;  5G30 A;  4MJC A;  4ZM8 A;  3EE2 A;  4IT7 A;  5A0O B;  4ZBA A;  1XBS A;  1PMT A;  3HOH A;  1PN0 A;  3M9J A;  1VQ8 3;  5D9W A;  1CQH A;  1A23 A;  1M3I A;  2AB6 A;  1XWK A;  1B9Y C;  2OE0 A;  3P90 A;  5IMV A;  2KP2 A;  1LVN A;  1TRS A;  2Y74 A;  1MWS A;  4GL6 A;  5BIR A;  4NRE A;  1ZYN A;  1SL1 B;  4HM3 B;  1OE8 A;  2AUV A;  3SOA A;  2B1K A;  4EYC A;  1GSQ A;  3KZQ A;  2VLU A;  1EOG A;  5DDL A;  5ECM B;  2IMD A;  3GH9 A;  1WP0 A;  2X49 A;  5CRW A;  3D3L A;  5BU4 A;  2WJU A;  1Q7Y 4;  5G2Z A;  5GST A;  3TKR A;  3JUM A;  1B8X A;  3SXX A;  2QKE A;  2DJJ A;  3CXG A;  3AHS A;  1F8N A;  1V98 A;  2E0Q A;  2P5Q A;  1JBR A;  1B2S A;  3O3T A;  2RNT A;  3A76 A;  4CCV A;  3ZMK A;  3G0K A;  1U87 A;  2L5L A;  4HEA 2;  1OC3 A;  1ERT A;  2DML A;  4NMU A;  14GS A;  3CC2 3;  1A8Y A;  1ZS7 A;  2OE3 A;  3EBT A;  1TK8 B;  3F4R A;  1WWJ A;  4JRF A;  3U6V A;  1PFO A;  3NZN A;  3MKI A;  2H1D A;  1BRN L;  3K5T A;  1UC7 A;  5AN1 A;  1FG4 A;  2Q07 A;  4MMY B;  2UX0 A;  1N5P A;  4XDW A;  1RNB A;  3A2W A;  1E97 A;  2JL4 A;  1HQO A;  1OC8 A;  4WWU C;  4CDL A;  4FCJ A;  4EW5 A;  1B20 A;  1JZR A;  1JN5 A;  2HI7 A;  2OKA A;  1QFN A;  5KP4 A;  1SKW B;  4HUA A;  1ZL9 A;  2P31 A;  18GS A;  1RN7 A;  2LUS A;  4D73 B;  1U8C B;  2QGU A;  1K0M A;  2WRT A;  3BJ5 A;  1OF5 A;  2VLV A;  3SWL A;  3SYU A;  3TJG A;  4OUQ A;  4XS1 A;  2XSO B;  3E9J B;  3MYT A;  1W02 A;  3N8B A;  5IG3 A;  3DGQ A;  3DXB A;  4FYC A;  2C11 A;  2VAF A;  2UUG C;  2FD3 A;  3RHB A;  1FUT A;  3QOU A;  2IJY A;  2X99 A;  2HZE A;  5JWR B;  1M2B A;  2YCD A;  3CCL 3;  2HMN B;  3D79 A;  2R0C A;  1ON4 A;  2PVQ A;  1D6Z A;  1QK8 A;  3KIJ A;  3LXU X;  1DVC A;  3MHE A;  4EDY A;  4K7I A;  5IEO A;  4MLY A;  1FW1 A;  1EQK A;  4GSP A;  2A4H A;  4CHS A;  1Q42 A;  4EO3 A;  4IBP A;  3DXO A;  5AEU B;  3GIX A;  5F05 A;  2H1B A;  4HM8 B;  1CQG A;  3CC7 3;  1BIR A;  1IVW A;  3F8U A;  3M8C A;  1K9M 4;  1WQL B;  5IOW A;  1HZ1 A;  4ECB A;  5C04 A;  4BVY B;  3LT8 A;  13GS A;  4N30 A;  2KF3 A;  2C4B A;  4WFO A;  3G71 3;  2CKF B;  1DE3 A;  1YZX A;  2CFD A;  1UCJ A;  5CRE A;  1TJD A;  4HM0 B;  4RNY A;  1Y6E A;  2GZZ A;  3CSI A;  4O7H A;  3APQ A;  4OFN A;  2L4Q A;  3STD A;  3ERG A;  1GUH A;  1TRU A;  1WJK A;  1IQ8 A;  1GMP A;  1A0F A;  4BWQ A;  1O7H B;  4MP4 A;  1BRH A;  1PGT A;  1WPI A;  1AIU A;  5G31 A;  2W04 A;  1Q4J A;  5IO2 A;  1RSN A;  3D5J A;  2XH9 A;  4PXO A;  4GHO A;  4FQU A;  3TRX A;  1J0F A;  4WBR D;  3UL6 A;  3QFB C;  1JFU A;  3HI7 A;  3H3H A;  3GRD A;  1BYE A;  3BLZ A;  2GS3 A;  3EU4 A;  2XFT A;  4CW9 A;  1M0U A;  3I6A A;  1BRK A;  2L1S A;  1U5O A;  4KFF A;  1W6Y A;  6GSS A;  2CHC A;  3EIN A;  1PYL A;  2GEY A;  1G96 A;  1T00 A;  3GHA A;  4HVN A;  4Q5F A;  2L6D A;  1URM A;  3KSE D;  3DEX A;  3GYK A;  1THO A;  1KNG A;  4IJ3 A;  2NPB A;  1UN2 A;  3NM7 A;  1IU7 A;  5FHI A;  5B8A A;  1DE1 A;  1HNB A;  4WBJ A;  4KT3 B;  5AYS C;  4K7O A;  2R6K A;  1BGS A;  2OE1 A;  3EMP A;  1ZX2 A;  4XB5 A;  1TTZ A;  2WOF A;  1ZO2 A;  3N54 B;  3ROB A;  1KEB A;  2KRT A;  3GUS A;  2VIM A;  2JAC A;  3GN3 A;  1UUG B;  3DGO A;  3CBU A;  4PX1 A;  2H72 A;  4HOJ A;  1K0O A;  2E2M A;  2QGV A;  5IEN A;  1CH0 A;  1BU4 A;  1H75 A;  3DML A;  3LH4 A;  4KFD A;  1NSW A;  4ZXG A;  1TW9 A;  1GUK A;  2YV9 A;  4TXV A;  1IQY A;  4F0B A;  1SJ6 A;  1M9B A;  5DQY A;  5TGN A;  3FZ9 A;  4OO5 A;  3BNB A;  2SAR A;  4I5Q A;  5KOW A;  4HYZ A;  2MZC A;  2RSX A;  1YNV X;  3LGC A;  2O8V B;  3IPT A;  3F8H A;  3LOY A;  2IIY A;  2GU3 A;  2GZP A;  4H61 A;  1SYR A;  3Q18 A;  5CO3 A;  4HM7 B;  4HQS A;  5G5E A;  4HZ9 B;  5D93 A;  3CCQ 3;  5L71 A;  4F0C A;  2Y73 A;  4Z2T A;  3JUN A;  2DIY A;  4GLT A;  1X9S B;  2FY6 A;  1W6C A;  1M3J A;  1IYI A;  5AI1 A;  3F4T A;  5LC6 A;  3U97 A;  2FGX A;  3S27 A;  1SD9 A;  4JE1 A;  4MZC A;  3RPN A;  3Q2P A;  4O5U A;  1XVW A;  2KP1 A;  1K3L A;  4DSR A;  1GMQ A;  4EUY A;  1N5H A;  1W4V A;  1ERU A;  1PD2 1;  2GT5 A;  1STF I;  4MA9 A;  2CWV A;  3TB2 A;  2ON7 A;  2REM A;  2RM5 A;  2QSI A;  3VPQ A;  1T1V A;  4WKW A;  2XRX B;  4N6M A;  4E8H A;  3LWA A;  3SBC A;  2W03 A;  1LNI A;  4PGT A;  2RCD A;  1I2G A;  1RRL A;  2CX0 A;  3WD6 A;  3NBJ A;  2IME A;  4L8O A;  1N9J A;  2KAA A;  2GSS A;  5F0G A;  2LYX A;  2A15 A;  4IN0 A;  5G1L A;  1AXD A;  2PVO C;  1W4N A;  1TP6 A;  1JB5 A;  2W9P A;  5CP1 A;  4IJI A;  4BVX B;  4RNZ A;  4L7K A;  4BA7 A;  3KMO A;  3X41 A;  2YWI A;  5EL8 A;  2F8A A;  2BO9 B;  2I9W A;  1OE7 A;  2WS2 A;  2MF7 A;  4N6V 0;  3HVN A;  3IBH A;  1ROA A;  2BMX A;  4ZL7 A;  2QA4 3;  3IV4 A;  1PKW A;  2TRC P;  2FA4 A;  1X1U A;  3I55 3;  5E59 A;  4K90 B;  1YIT 3;  4H86 A;  4LEH A;  5BXQ A;  3RGA A;  3CCR 3;  1RN1 A;  3EVI A;  3AMO B;  1XVQ A;  4EIQ A;  1XOB A;  4PUF C;  2W56 B;  4YH2 A;  4F9Z A;  4GSN A;  5JPP A;  4J2F A;  4EV5 A;  5HR2 A;  3KTB A;  4ISD A;  1XWA A;  2BU4 A;  1FVK A;  2B5X A;  2L4C A;  2HXK A;  4IQ1 A;  3NBB A;  4GB5 A;  3FK8 A;  4L0U A;  4G10 A;  3EE1 A;  4R1K A;  1G02 A;  4OCF A;  5DJM A;  4XM4 A;  2K8S A;  2WCI A;  1US1 A;  1EEM A;  1SQW A;  1XWC A;  1PN9 A;  2HFD A;  1W00 A;  3ZVJ A;  3AGN A;  1W6G A;  2PER A;  4U13 A;  3HIG A;  1X5D A;  1M2D A;  2MBT A;  3FW2 A;  1T8E B;  2GVP A;  3FHK A;  3LXZ A;  5J41 A;  2JZS A;  3DKS A;  5J9B A;  5STD A;  3K9M C;  2F5W A;  1E2Y A;  4XCS A;  2CFW A;  2LST A;  1DMM A;  2H30 A;  2F5M A;  3MIX A;  1BNI A;  2RGQ A;  1K0D A;  1GSD A;  4RNT A;  1I9D A;  2Z76 A;  4AKZ A;  3BCK A;  2A2R A;  4NHZ A;  2PGT A;  1OHS A;  4POB A;  1RGF A;  3WYW A;  3EF8 A;  1O7G B;  5ABR A;  5FT3 A;  3DZL A;  2I4A A;  3KN4 A;  2VM1 A;  4Z2R A;  3CRU A;  4WXT A;  4BTX A;  4WET A;  3EBY A;  4O92 A;  4KDU A;  5IER A;  3EC9 A;  1YY7 A;  3FKA A;  1RRH A;  5IF6 A;  3AGO A;  1GNE A;  4L0W A;  1UI7 A;  3WHO A;  1PL1 A;  2R3X A;  5H5R A;  4YKG A;  3WMD A;  2OWP A;  3VSY A;  3VWX A;  3WGE A;  2A4V A;  1BJX A;  1W2Z A;  2V1M A;  1PY3 A;  5J3R A;  1WMP A;  2O9U X;  19GS A;  1T2I A;  4DVC A;  3A2V A;  3HK4 A;  4N3V A;  2CG1 A;  3KCM A;  4O32 A;  1X5E A;  3LML A;  4I6X A;  5EY6 A;  3HII A;  3GNJ A;  1NDO B;  1O85 A;  3DY5 A;  5J5N A;  1K3O A;  4HU9 A;  3CCM 3;  1Q98 A;  3HX8 A;  2OOV A;  5G2G A;  4POK A;  3H4K A;  5H5Q A;  4NWY A;  2VD0 A;  4XHM A;  1YJN 3;  1YVS A;  4X2O A;  3X42 A;  3PXM A;  3ZIJ A;  1V2A A;  2AAW A;  1ILO A;  1QXH A;  3G4S 3;  4N6U A;  3UL5 A;  3O6T A;  5GAN D;  2BIR A;  3LEF A;  1RK4 A;  3C8E A;  5LD0 A;  1XWB A;  10GS A;  1MD3 A;  1M7T A;  1Q9E A;  2CW9 A;  1TU8 A;  5DAK A;  1EOH A;  2F8F A;  1S3D A;  1LBK A;  4HI7 A;  3F3Q A;  2LKU A;  1FZU A;  1AY7 A;  1SAR A;  4OD7 A;  4XS6 A;  5IM9 A;  1LQG C;  3GKM A;  4O2H A;  1V74 A;  2YZH A;  5HFI A;  1LOV A;  3V98 A;  2GGT A;  1V58 A;  3I69 A;  3IC8 A;  2BT3 A;  3LFL A;  3KSP A;  2XSH B;  2MMZ A;  3FY7 A;  1N2A A;  1T4Z A;  3GKN A;  4HZ4 A;  4GWR A;  4EKZ A;  4OFM A;  2GQK A;  2YOI A;  3OXA A;  3D21 A;  3L78 A;  5ECP B;  3VGN A;  1RGH A;  3VI7 A;  3ZLP A;  3OWU A;  1IYH A;  2ZDJ A;  3FR6 A;  1EG9 B;  3W8J A;  5FGO A;  1G6Y A;  2IFQ B;  5G5F A;  2OQE A;  5M18 A;  6STD A;  2CX3 A;  1YIJ 3;  5DQS A;  3KEB A;  4FIW A;  3VUR A;  1AAZ A;  4YQM A;  2C4J A;  3V92 A;  4PNF A;  5E4W A;  2ALB A;  1GTB A;  3CPO A;  1F3A A;  4WR5 A;  3A5E A;  3TDG A;  1HD2 A;  3TKS E;  3ED3 A;  5DJL A;  5GAP D;  3FF0 A;  3ME8 A;  3W8S A;  5D96 A;  4YAV A;  3A5W A;  2AV4 A;  4ILF A;  5DAL A;  2OQE C;  4Q5R A;  2VCZ A;  1K73 4;  4EXR A;  3L9S A;  2B5Y A;  3K8N A;  4ZL8 A;  1B9X C;  5ELG A;  5IO0 A;  4XDV A;  2FWE A;  4FMD A;  1ROV A;  2DSA A;  2DIZ A;  5ID2 B;  3I56 3;  4ECC A;  1Z9H A;  2V6K A;  2IL3 A;  2CVD A;  5EEO A;  3GX0 A;  1OYJ A;  1O73 A;  3M9K A;  4KND A;  3IXR A;  2C0D A;  1GP1 A;  2L59 A;  2H0H A;  2L6C A;  1GY5 A;  4BWS A;  2VCT A;  1VQ6 3;  1X1W A;  3NV0 A;  2Z77 A;  2C80 A;  2FCH A;  4ZB9 A;  5J9C A;  1JBS A;  3JCM L;  3G16 A;  3GZX B;  1C54 A;  4K0N A;  3TCO A;  3EJV A;  1IT7 A;  2FGT A;  3C1R A;  3UMA A;  2X64 A;  1N8Q A;  2V41 A;  3HYP A;  2NDO A;  5ECI B;  4MJD A;  4A5P A;  4MCU A;  1TU7 A;  2J8X B;  1WMJ A;  4N6T A;  1STD A;  4V1A g;  1XIY A;  1GLP A;  2MYG A;  1NW2 A;  4XTS A;  4BL3 A;  1CYV A;  4IW9 A;  4PQ1 A;  2L5O A;  5I97 A;  3GRX A;  3K63 A;  4EBG A;  1WMO A;  1LRA A;  2KUC A;  5AIG A;  1V9W A;  3PYJ A;  2YWO A;  5ENU A;  2XBI A;  5KN1 A;  2H01 A;  4AJ6 A;  1SPU A;  2JZT A;  1DMN A;  3T8U A;  4R9K A;  3DVX A;  1ST9 A;  1Q40 B;  1RJO A;  1O7U A;  5CRG A;  2PWJ A;  1QGV A;  2AAD A;  6GSW A;  2JDI H;  3RBT A;  4ZIJ A;  1NB3 I;  5HGR A;  1EWX A;  3G9B A;  5EPF A;  3GKX A;  3B8L A;  2RM6 A;  5ECR B;  1YEP A;  1PQN A;  2WZ9 A;  1Z1S A;  5CXO A;  3CQF A;  2CX4 A;  3CYN A;  2KLX A;  3PH9 A;  3BU4 A;  1EGR A;  1R4W A;  2RUF A;  3MAK A;  4O8S A;  1GUM A;  2GDR A;  2HRF A;  1GTU A;  4KDX A;  2G0F A;  4N6L A;  1NHY A;  1MWR A;  2R41 A;  3MWZ A;  6GSP A;  1F9M A;  2LRT A;  3VPT A;  2OBI A;  5HR0 A;  1T3B A;  1O6J A;  2LQO A;  4JU5 A;  4FCZ A;  3DH2 A;  3OW2 2;  1JZO A;  1WMN A;  2HT9 A;  1YGE A;  3V99 A;  2JU5 A;  1K0C A;  4K1U A;  4RUV A;  5IMA A;  3GZY B;  1EV4 A;  1BOX A;  1X9M B;  2CG0 A;  3VF1 A;  4MF6 A;  3D5I A;  1KBN A;  2H66 A;  2KXG A;  5AIX A;  2K0M A;  1U3I A;  4HM5 B;  5HOH A;  4F82 A;  4MAB A;  5B7C A;  1HKX A;  4G1M B;  4P3Y B;  5JCW A;  3HD5 A;  1F37 A;  4L8P A;  1RNT A;  1THX A;  1PX7 A;  3HDC A;  2GU1 A;  3CU3 A;  1GUL A;  1VZZ A;  2UGI A;  4ZBB A;  1GY7 A;  4ML1 A;  1QUW A;  3WR2 A;  1OGX A;  4XS4 B;  4V2M A;  4TVE A;  2PBJ A;  1RTU A;  5ECL B;  3DGY A;  4LMI A;  2PMT A;  1LOX A;  1MEK A;  3GL5 A;  3T8N A;  2GEX A;  3GUR A;  1FA3 A;  3CCJ 3;  4OK0 A;  4O5Q A;  1GOU A;  2LQQ A;  4N0Z A;  3W6G A;  1V57 A;  3E0U A;  4NXI A;  1SKR B;  1MGW A;  2CT6 A;  5ECQ B;  1KD1 4;  4QL7 A;  1Z6M A;  2IMI A;  6RNT A;  3RAZ A;  1GH2 A;  4ECJ A;  1VQ5 3;  1K3Y A;  2B24 B;  3ALA A;  1HYU A;  2LQV A;  4HJL B;  3FCS B;  1UCL A;  3D22 A;  2FA8 A;  1S3R A;  4WYK B;  2HMK B;  5IW9 A;  3N9J A;  4TW5 A;  2AHE A;  1GD3 A;  1GLQ A;  4ZB6 A;  2B6M A;  3LQ7 A;  3TKS C;  2GQL A;  3ZRE A;  3J7Y k;  3MG2 A;  4X43 A;  3PCS A;  2B3S A;  1A2J A;  1RGG A;  1EV9 A;  4HJ2 A;  4KE3 A;  2VL2 C;  22GS A;  5HFK A;  1ULI B;  3SLU A;  1I0X A;  3CCE 3;  1FB6 A;  4FYU A;  2CH9 A;  1G7O A;  4DSS B;  1QAK A;  1BRS A;  5BRT A;  2JAD A;  5D8I A;  5ELA A;  1YJW 3;  1DE2 A;  4AF2 A;  3IRA A;  1GL8 A;  2HMO B;  2XPE A;  3C7M A;  2IWT A;  2FWF A;  2IY2 A;  1SL2 B;  1B4P A;  3WDG B;  1ZMA A;  1B27 A;  2E2U A;  3CD6 3;  2FNQ A;  5D73 A;  4TR1 B;  1VQK 3;  2VCW A;  5CF2 A;  3K0Z A;  1H4O A;  1GS3 A;  2OAD A;  4KAE A;  3JVC A;  1T5Y A;  3JUO A;  4K2D A;  4K0G A;  1UW1 A;  2K54 A;  1XW9 A;  2IN3 A;  1RGA A;  2RLI A;  2FWG A;  1K8A 4;  3NQY A;  3LZA A;  1GWC A;  4BIK A;  5HFG A;  5IPG A;  1AVK A;  3UVH A;  2LTK A;  1DUG A;  2C0E A;  1FO5 A;  2YAN A;  4IGJ A;  3RDE A;  16GS A;  3CSJ A;  4MZW A;  3GA4 A;  4MH2 A;  1OC9 A;  4IIA A;  1J2B A;  3IJE B;  2O87 A;  1BSA A;  3PZW A;  2LJR A;  3UAP A;  1J08 A;  9RNT A;  3BBY A;  4TXO B;  2NBS A;  3FZW A;  3TJB A;  2P09 A;  4J5G A;  3CXC 2;  5J4U A;  3SOY A;  3QK9 A;  3D6I A;  4K1F A;  2K6V A;  4TOP A;  3EWL A;  4K9Z A;  2LJK A;  1ISK A;  3GZR A;  3C73 A;  1OCV A;  2H8L A;  3IR4 A;  4I8B A;  5GZZ B;  4PQI A;  2VLT A;  3DVW A;  1OHP A;  3H8Q A;  4KGI A;  2F99 A;  2JZR A;  1PRX A;  2XHF A;  5KP3 A;  2GBW B;  1IVU A;  2M7O A;  5ECS A;  2R2J A;  5HQP A;  2LRC A;  3ZTL A;  7GSS A;  5CRH A;  2X8C A;  1TFK A;  3HHV A;  3ZFB A;  3FRC A;  3PGT A;  4X0X A;  2DJ0 A;  1FHE A;  2EIO A;  3LG6 A;  3UEM A;  4HAA A;  2P0M A;  3LYK A;  3QAW A;  1E6B A;  3LTB A;  1HYF A;  3IHQ A;  1ACV A;  4KSM A;  1O8W A;  3QR6 A;  4MEI A;  4NV5 A;  5M19 A;  4BL2 A;  4IP6 A;  1AVL A;  2VOC A;  3DWV A;  4LA1 A;  1MGR A;  2HOH A;  1TIJ A;  3F63 A;  3M0F A;  3NBR A;  2STD A;  1YQ1 A;  2H6Y A;  2I3Y A;  1ASK A;  5JWO B;  1FOH A;  5FW5 A;  3KXO A;  2YJ7 A;  3AHW A;  2HRA A;  2WO0 A;  17GS A;  3BNE A;  5IQY A;  4FYB A;  1F6M C;  1KQS 2;  2PUK C;  1Z3E A;  4I2U A;  3F6D A;  2BHM A;  4K61 A;  1MWT A;  2ZHX B;  3PCR A;  4J5K A;  1PSQ A;  1E3R A;  1UGH I;  3WOD G;  4HDE A;  5AGY A;  5DAK B;  3TJF A;  1UVZ A;  4TR3 A;  1X5C A;  3FZ4 A;  2FXT A;  5HR3 A;  2IMF A;  4JRR A;  3CC4 3;  1XCC A;  1KSI A;  4MK3 A;  5IG0 A;  1S5A A;  2P0X A;  3F7S A;  1JNQ A;  1UGI A;  3R2Q A;  5COH A;  1FGO A;  1MD4 A;  3KZT A;  3KJY A;  3V1W A;  4PQH A;  5B6M A;  3D0Z A;  3MSZ A;  3TOT A;  3FLJ A;  2HMJ B;  1RHL A;  1Y4K A;  1O7M B;  2K8V A;  1A0R P;  1VF2 A;  3UJ1 A;  4EC6 A;  2A2S A;  5A5K A;  1UDI I;  3RDW A;  2CWU A;  1XZO A;  4MDC A;  1LOY A;  1OKD A;  3X3X A;  5ECN B;  5IG5 A;  3MWH A;  1FOV A;  1W89 A;  4MMX B;  2B5E A;  1OHO A;  1EKM A;  3RHC A;  3S9F A;  4I4K A;  3GST A;  2L4V A;  1B4Q A;  2C8U A;  3N5O A;  1BVI A;  3EN8 A;  2D2Z A;  2IA7 A;  4POM A;  4WF5 A;  1AQZ A;  2RUE A;  1RGL A;  3HY2 A;  1S3A A;  4BVY A;  3NM2 A;  1MDJ A;  3HA9 A;  3BB9 A;  4HM2 B;  4KUN A;  1GYB A;  7STD A;  4Z2U A;  4RQR A;  3APS A;  4KB3 A;  1JJ2 2;  1OGZ A;  2H75 A;  3KE7 A;  3DUK A;  2GZY A;  2LRN A;  4HJM A;  4ORL A;  5CYY A;  2N5A A;  2WUL A;  1WOU A;  1TRV A;  2CFG A;  1VQN 3;  4LMV A;  2IYJ A;  4JBB A;  4K7N A;  2P0G A;  5JCU A;  4ID0 A;  2XEP A;  4MJB A;  1TK0 B;  1VQO 3;  3NHX A;  3HZ8 A;  1GOV A;  3WGD A;  3EQQ B;  3UAR A;  2MMN A;  3TUE A;  1Q86 4;  3VFI A;  1BSE A;  2TIR A;  5D83 A;  2WDU A;  3U1W A;  1ZGX A;  2CVK A;  3C71 A;  3UIW A;  4BTY A;  3CCV 3;  3CCS 3;  2FHE A;  4MNN A;  4HZB B;  7RNT A;  5DBQ A;  2CV4 A;  3L9V A;  1I0V A;  2H74 A;  5D82 A;  4FMC A;  4IKH A;  1C7H A;  1W01 A;  5IG4 A;  4JZQ A;  1M9A A;  2MC8 A;  2V2G A;  1EP8 A;  1SEN A;  1BNE A;  3CMA 3;  1SIH A;  1FVJ A;  3FMW A;  3LYP A;  1R4C A;  3Q19 A;  1OUN A;  2QC7 A;  1PKZ A;  3F4S A;  2O3O A;  2H76 A;  1YI2 3;  2KF6 A;  3U5R E;  1VRS D;  1TOF A;  5D9V A;  1AV4 A;  1SJW A;  4LYL B;  2NTO A;  4IP1 A;  1A90 A;  1IV7 A;  3F7X A;  4X1U A;  8RNT A;  1B2M A;  4NHW A;  3KFQ C;  1EEJ A;  3IPZ A;  1R5P A;  5IEP A;  1BED A;  3WOF B;  3KGK A;  2XR8 B;  5BMU A;  5KN2 A;  4Z7X A;  3UNL A;  1NJI 4;  3MDK A;  1B48 A;  4GRF A;  1DET A;  2N5F A;  3ZVJ D;  4IHU A;  5CNW A;  3EX9 A;  3GTU A;  1BSB A;  2B7K A;  3E3E A;  5D9X A;  1FUW A;  4G19 A;  3EPT A;  1OAC A;  4MH3 A;  2ZA4 A;  3LSZ A;  2JSZ A;  3WA2 X;  2B1X B;  3KH7 A;  1ZCP A;  1AQW A;  4K6X A;  2HYX A;  3FYG A;  3OV4 A;  2ML6 A;  4OCE A;  3GWR A;  2DJ2 A;  3SED A;  3WGX A;  1UI8 A;  2MMA A;  3US3 A;  1YJ9 3;  4DKI A;  1F3B A;  2W6J H;  1T2H A;  2XPD A;  1UA5 A;  1GD4 A;  4HS1 A;  3H1N A;  2PNC A;  3HXS A;  4OMV A;  2O85 A;  1V40 A;  3D5G A;  1HU9 A;  5JBS A;  1XPV A;  1QVG 2;  1RMS A;  3MG3 A;  4G2E A;  1JN5 B;  4WHA A;  4BVX A;  1XFL A;  1XW6 A;  1I5G A;  4DEJ A;  5A4V A;  3ZZX A;  4GQF A;  4WP5 A;  4KZ1 A;  3KCH A;  3FH1 A;  3LTA A;  1OF5 B;  2GSP A;  3HVV A;  1MNL A;  4EVM A;  2F51 A;  1QAL A;  3BOA A;  3F6F A;  1BNS A;  5A4W A;  1G0T A;  1LNH A;  2DBC A;  1RGK A;  2KOK A;  3AMO A;  3Q1C A;  2W56 A;  2C0G A;  3S29 A;  2VL9 A;  1YJ6 A;  3A5I A;  3BD2 A;  1FYS A;  1BRG A;  2BMQ B;  5ECH B;  2HZE B;  3NXJ A;  4KVH A;  1O7P B;  5LC7 A;  2DJ3 A;  1RCK A;  2CVB A;  4EIP A;  4KX4 A;  4I2T A;  3MYD A;  3IOS A;  1NWW A;  4WR4 A;  3S67 A;  1BRJ A;  2CAQ A;  2OJL A;  1XW5 A;  3HJM A;  1GMR A;  1D6Y A;  2YFJ B;  4MMZ B;  3HZ4 A;  4K8M A;  3ER7 A;  4HM6 B;  3G7J A;  2AJQ B;  3FR9 A;  1BRI A;  1DMQ A;  4MMM A;  3UBK A;  4LGQ A;  3IAM 2;  4KFE A;  4TN8 A;  5ELU A;  2F86 B;  2R4I A;  2HZF A;  4MF7 A;  5M1A A;  4NHF A;  2AYT A;  5KN3 A;  5CLK A;  1HNA A;  1I3I A;  4E8E A;  4EDZ A;  4NAX A;  2O89 A;  4FR9 A;  2FWH A;  3A3T A;  4BIR A;  2YX9 A;  1JKG A;  3UL3 A;  5IMF A;  1DVD A;  1F2E A;  2INX A;  1KC8 4;  1A24 A;  3QPM A;  1G7E A;  6GSU A;  4YAP A;  1JZD A;  1Y25 A;  2LJA A;  3LJR A;  2HSM A;  2Z6B A;  2DJK A;  2GSR A;  4JR4 A;  3RNT A;  2XGN A;  3OX9 A;  2HSY A;  3UBL A;  4IS0 A;  4BL7 A;  6GSY A;  2C10 A;  1QVF 2;  2RFR A;  1VQM 3;  4TRX A;  3LTD A;  3TRP A;  2H71 A;  4KA0 A;  2D1W A;  5CRD A;  8CHO A;  1I2F A;  4PUR A;  2GLR A;  2Z7A A;  1M99 A;  3VLN A;  1USB A;  4AEQ A;  4PUA A;  1AUC A;  2VO4 A;  2XF3 A;  1U6T A;  4V2N A;  1M90 4;  1IK3 A;  2E7P A;  2XBQ A;  3P2A A;  3KMN A;  4EXJ A;  4AKY A;  1S3C A;  1SJZ A;  4YQV A;  1LQM B;  2P5R A;  1XOA A;  1EUI C;  1ZYE A;  5C00 A;  3X40 A;  3B4P A;  1B2X A;  5EVO A;  3FF2 A;  2GTU A;  1NU3 A;  1G6W A;  4YQU A;  2YV7 A;  2K3D A;  2VCX A;  5EQL A;  3K7C A;  1RGC A;  3L0H A;  4AJ7 A;  1QMV A;  1VQ9 3;  1L5G B;  4WEY A;  1O81 A;  4MJA A;  4O3V A;  1NNV A;  5AIS A;  3VI5 A;  2VCQ A;  5HR1 A;  3GV1 A;  3LOR A;  5IMZ A;  2IMJ A;  2VM2 A;  5B6N A;  2JSY A;  4I97 A;  3JUQ A;  2IPA A;  1TRW A;  3OWS A;  4OWY A;  1WIK A;  3TRQ A;  1IYY A;  1TK5 B;  5FWG A;  4N6O B;  1IDP A;  2UZ8 A;  1AR0 A;  4TR0 A;  3EN1 B;  2FUG 2;  3EU3 A;  1GSY A;  2H19 A;  1OKT A;  3G8Z A;  3BNC A;  1R26 A;  3EMX A;  1Z7P A;  1RW1 A;  1TRP A;  4FO5 A;  4J9A A;  4AGS A;  2M72 A;  1ZZY A;  4NPB A;  3DMC A;  4RBN A;  1E3V A;  4GCI A;  1GSE A;  4LMW A;  2RII A;  2XFS A;  4FMA A;  2CK3 H;  1A2L A;  2IFQ A;  4RQX A;  1RN4 A;  3NOF A;  4CPK A;  4GQC A;  3DIE A;  3LW9 A;  4XBX A;  2PU9 C;  1MTC A;  1K0N A;  2GST A;  4N0V A;  12GS A;  5A4U A;  4R9L A;  2YNX A;  2A2P A;  3G7I A;  3ZFZ A;  5BVB A;  5F07 A;  1WNH A;  1X1Y A;  1I2E A;  3LT9 A;  1K0A A;  2CFK A;  3F9U A;  1YKC A;  2F98 A;  3BND A;  3TKS A;  1Z7R A;  1HNC A;  1K41 A;  1XG8 A;  3BCI A;  2BJX A;  2F56 A;  4AJ8 A;  5DRV A;  3X3Z A;  3QDN A;  4ZIL A;  1SU9 A;  5IIZ A;  2VL2 A;  3CNX A;  3DRN A;  3TGZ A;  3LXT A;  3F3R A;  3GZB A;  3EC3 A;  4ZL9 A;  4Q5Q A;  4ACS A;  1GSP A;  3ZYW A;  2YFI B;  2QIY A;  2ZUP A;  3ZIT A;  4G0L A;  1M9G A;  3DGL A;  1U3A A;  3C1S A;  3M3M A;  4KSO A;  2KF4 A;  1LXE A;  2QA1 A;  3GSS A;  3T0U A;  5ID2 A;  3KP8 A;  1FGT A;  4BTW A;  5EVH A;  3IK9 A;  1YEX A;  3HVX A;  5ECK B;  3L4N A;  4L8E A;  7GSP A;  2H0G A;  1YVB I;  4MPF A;  3QAV A;  3OR5 A;  2WB9 A;  3IA1 A;  1N9E A;  1A2K A;  2HMM B;  3DM8 A;  3DGM A;  2KCD A;  2FLS A;  3PPU A;  3EYT A;  4LL4 B;  3QMX A;  1T7P B;  3HVS A;  3I9V 2;  2H6Z A;  2LNT A;  3FG4 A;  3QRD A;  4MPG A;  1TRQ A;  1X0R A;  3O8Y A;  1W5Z A;  3KKG A;  4Q53 A;  1MDI A;  2E2G A;  1RQM A;  2BNG A;  3F0I A;  5AIV A;  2RBI A;  1VF4 A;  4XBT A;  2NVL A;  4CY8 A;  5KOX A;  1O7W B;  2YZU A;  1CYU A;  1U88 A;  2YPM A;  4FCM A;  4WF4 A;  3EB8 A;  1GOY A;  1IVX A;  2FNO A;  1VF1 A;  3ZL5 A;  1BUQ A;  1PA3 A;  3PR8 A;  1M1K 4;  5KP1 A;  1JHB A;  1Q81 4;  2H73 A;  2R5G A;  4ZBD A;  2CX1 A;  2DJ1 A;  3TJJ A;  1PFP A;  1Q40 A;  2W9Q A;  5D9T A;  2ON5 A;  1B3S A;  3I0Y A;  2H0I A;  3WT1 A;  1TUH A;  8GSS A;  1JBT A;  4FH8 A;  4KH7 A;  1BQ7 A;  3ZML A;  2F4Y A;  1BAY A;  3QD9 A;  1BNG A;  2DKH A;  2R0G A;  2HNL A;  6GSV A;  4Q5N A;  1WTH A;  2X4A A;  1FUS A;  2ZL8 A;  1TI3 A;  1PU4 A;  5AIF A;  3X3Y A;  2HSH A;  1Q7H A;  1ERW A;  5KEJ A;  4K1V A;  2YP6 A;  1VQ7 3;  1EGO A; 
#chains in the Genus database with same CATH homology
 2L57 A;  2N5B A;  4F03 A;  1N8J A;  2CZ2 A;  1AW9 A;  3GL3 A;  1Z5Y E;  3KTL A;  2K9F A;  4L5O A;  3UVT A;  2YN1 A;  2PPT A;  3GH6 A;  4IQA A;  1ZYP A;  4GSS A;  3APO A;  2I9H A;  5H5S A;  1DSB A;  3IE3 A;  2R0P A;  1KTE A;  5IPH A;  2B1L A;  3ERW A;  4K2X A;  4QL9 A;  1C72 A;  3QAG A;  2HRK A;  3HCZ A;  3CSH A;  1OVN A;  3TJK A;  5IOX A;  1PL2 A;  1GRX A;  2VCV A;  3NIV A;  2QA2 A;  3O76 A;  4V2L A;  4XS4 A;  2XC2 A;  2OAC A;  5B8B A;  2I81 A;  1XWG A;  4J56 E;  4D73 A;  6GSX A;  3UOM A;  3PIN A;  3GTU B;  1GTI A;  1GTA A;  1QQ2 A;  20GS A;  3GMF A;  1AQX A;  2LNS A;  4HZ2 A;  4IVF A;  1ZOF A;  1JLW A;  1J9B A;  3QCP A;  4K5R A;  3L9U A;  3CTG A;  4ZB8 A;  4CDO A;  2H1G A;  4EE0 A;  2VD1 A;  2HE3 A;  3FZ5 A;  3HJP A;  1SL0 B;  3VWV A;  4BPY A;  4PTS A;  5DAL B;  2CAI A;  1K0B A;  11GS A;  4ICY A;  3GKK A;  4MJE A;  4L5L A;  4XRD A;  2R4V A;  2I1U A;  1SD8 A;  4DSS A;  4G0K A;  1YDK A;  3MNG A;  2M46 A;  4F2I A;  2H6X A;  3Q6O A;  2C3N A;  3J7Y b;  1T4Y A;  4GTU A;  4POL A;  2TRX A;  3ME7 A;  1GNW A;  4GF0 A;  3VWU A;  1JLV A;  3A2X A;  5IMD A;  2EIQ A;  2F3M A;  4TR1 A;  1GSS A;  5CAX A;  5KN0 A;  3FZA A;  3DD3 A;  3QFA C;  2X8H A;  4KCA A;  2GT6 A;  2CQ9 A;  5F8B A;  3KD0 A;  1EP7 A;  2B7J A;  1OAZ A;  1TP9 A;  3CMI A;  2X8G A;  1ML6 A;  1WE0 A;  3IK7 A;  3EUR A;  1SK2 A;  1M2A A;  5INY A;  5DCG A;  3RPP A;  3ISO A;  3KM6 A;  2IMK A;  5JWQ B;  4TXO A;  4LL1 B;  2Z9S A;  2LEG A;  1WRY A;  1SYX A;  2KHP A;  2F9S A;  3P7X A;  1MDK A;  4PNG A;  4BL7 B;  2C3T A;  2ES7 A;  1O8X A;  1XXU A;  3KH9 A;  3FEU A;  4JED A;  2EIR A;  3M1G A;  1ZYQ B;  5LCZ A;  4G0I A;  2CZ3 A;  3TKP A;  1JZW A;  2LV3 A;  5JCG A;  4KCE A;  2VL3 A;  4JR6 A;  3DYR A;  2OBK A;  3IC4 A;  2EC4 A;  5LNK e;  3CRT A;  3H79 A;  4KW6 A;  5DVB A;  2YWN A;  4J57 E;  2J23 A;  2WGR A;  1GSU A;  3I43 A;  4IEL A;  1TXX A;  4EC0 A;  2VUP A;  4K5S A;  2M80 A;  4HU7 A;  1BG5 A;  4KDY A;  3ZRD A;  1A8L A;  4N11 A;  5ECO B;  4ULX A;  2V6O A;  1PX6 A;  3FR3 A;  1A2M A;  3M8N A;  4TR4 A;  1AC1 A;  1VGL A;  4V1A p;  4XRA A;  4CY6 A;  4TKY A;  4YKF A;  2WFC A;  4ML6 A;  2DMM A;  4O5R A;  1ZGN A;  3FKF A;  2OA7 A;  2DLX A;  1AQV A;  3VWW A;  9GSS A;  4HQZ A;  2C0F A;  1FB0 A;  1ERV A;  4ECI A;  4N10 A;  3Q74 A;  4LLR A;  3HKR A;  4DSQ A;  4X4J A;  2R37 A;  2J9H A;  4KF9 A;  2BTO T;  1SKS B;  1VF3 A;  2GSQ A;  3VK9 A;  4MZB A;  5IMC A;  2K18 A;  3CTF A;  3GX8 A;  5DCH A;  4RI7 A;  2LS5 A;  2YWM A;  2O7K A;  3R3E A;  2GQM A;  3IDV A;  4NV2 A;  3D4M A;  3ZIV A;  3ZFL A;  1TDI A;  3GFK A;  4GST A;  2CA8 A;  3G7Y A;  1R7H A;  2H70 A;  1SK1 A;  2YJH A;  5GSS A;  3TKQ A;  2DC5 A;  4EL1 A;  2ZNM A;  4USS A;  1X9W B;  4G9H A;  1YKA A;  3IAS 2;  3HJO A;  1R5A A;  5G1K A;  3AY8 A;  4RI6 A;  2MMO A;  3IHG A;  2G2Q A;  2DKI A;  1NM3 A;  4XIH A;  2H1A A;  3WT2 A;  2ZCT A;  3P8W A;  3H93 A;  4OO4 A;  1SJI A;  1GSF A;  1SK0 A;  1Z6N A;  4MF5 A;  1YF1 A;  2C1Y A;  2PN8 A;  1EZK A;  2C3Q A;  4EF0 A;  3D4T A;  1LU4 A;  5F06 A;  1FAA A;  3ERF A;  2V32 A;  2HRN A;  1DBY A;  1LJR A;  2HLS A;  4OFT A;  1YF0 A;  1TKD B;  1BX9 A;  1TI1 A;  3KP9 A;  2MBS A;  6GST A;  1ABA A;  1NHO A;  1OC9 B;  4QQ7 A;  4GXZ A;  3TOU A;  5G30 A;  4MJC A;  3EE2 A;  4ZBA A;  1XBS A;  1PMT A;  1PN0 A;  3M9J A;  5D9W A;  1CQH A;  1A23 A;  2AB6 A;  1XWK A;  1B9Y C;  2OE0 A;  3P90 A;  5IMV A;  2KP2 A;  1TRS A;  1ZYN A;  1SL1 B;  1OE8 A;  2AUV A;  2B1K A;  3KZQ A;  1GSQ A;  2VLU A;  1EOG A;  5DDL A;  5ECM B;  2IMD A;  3GH9 A;  1WP0 A;  2X49 A;  5CRW A;  2WJU A;  5G2Z A;  5GST A;  3TKR A;  1B8X A;  2QKE A;  2DJJ A;  3CXG A;  1V98 A;  2E0Q A;  2P5Q A;  3O3T A;  3ZMK A;  1U87 A;  2L5L A;  4HEA 2;  1OC3 A;  1ERT A;  2DML A;  4NMU A;  14GS A;  1A8Y A;  2OE3 A;  1TK8 B;  3F4R A;  1WWJ A;  3U6V A;  3NZN A;  2H1D A;  1UC7 A;  5AN1 A;  1FG4 A;  3A2W A;  2JL4 A;  1HQO A;  1OC8 A;  1JZR A;  2HI7 A;  2OKA A;  1QFN A;  1SKW B;  4HUA A;  1ZL9 A;  2P31 A;  18GS A;  2LUS A;  4D73 B;  1K0M A;  2WRT A;  3BJ5 A;  2VLV A;  3SWL A;  3TJG A;  4XS1 A;  3E9J B;  3DGQ A;  3DXB A;  4FYC A;  2VAF A;  2FD3 A;  3RHB A;  3QOU A;  2IJY A;  2X99 A;  2HZE A;  5JWR B;  1M2B A;  2YCD A;  2R0C A;  1ON4 A;  2PVQ A;  1QK8 A;  3KIJ A;  4EDY A;  4K7I A;  4MLY A;  1FW1 A;  2A4H A;  4CHS A;  4EO3 A;  4IBP A;  3GIX A;  5F05 A;  2H1B A;  1CQG A;  3F8U A;  5IOW A;  4ECB A;  5C04 A;  4BVY B;  4N30 A;  13GS A;  1YZX A;  5CRE A;  1TJD A;  2GZZ A;  1Y6E A;  3CSI A;  4OFN A;  4O7H A;  3APQ A;  2L4Q A;  3ERG A;  1GUH A;  1TRU A;  1WJK A;  1A0F A;  4BWQ A;  4MP4 A;  1PGT A;  1WPI A;  1AIU A;  5G31 A;  1Q4J A;  5IO2 A;  3D5J A;  4PXO A;  4FQU A;  3TRX A;  1J0F A;  4WBR D;  3QFB C;  1JFU A;  1BYE A;  2GS3 A;  3EU4 A;  4CW9 A;  1M0U A;  3I6A A;  6GSS A;  3EIN A;  1T00 A;  3GHA A;  4Q5F A;  2L6D A;  1URM A;  3DEX A;  3GYK A;  1THO A;  1KNG A;  4IJ3 A;  2NPB A;  1UN2 A;  5FHI A;  5B8A A;  1DE1 A;  1HNB A;  4WBJ A;  4K7O A;  2R6K A;  2OE1 A;  3EMP A;  1TTZ A;  1KEB A;  3GUS A;  2VIM A;  2JAC A;  3GN3 A;  3CBU A;  4PX1 A;  2H72 A;  4HOJ A;  1K0O A;  2E2M A;  2QGV A;  1H75 A;  3DML A;  1NSW A;  4ZXG A;  1TW9 A;  1GUK A;  2YV9 A;  4TXV A;  4F0B A;  1SJ6 A;  1M9B A;  5DQY A;  3FZ9 A;  4OO5 A;  4I5Q A;  5KOW A;  2MZC A;  3LGC A;  2O8V B;  2IIY A;  2GZP A;  1SYR A;  3Q18 A;  5CO3 A;  5G5E A;  4HQS A;  5D93 A;  5L71 A;  4F0C A;  4Z2T A;  2DIY A;  4GLT A;  1X9S B;  2FY6 A;  1IYI A;  3F4T A;  4JE1 A;  2FGX A;  4MZC A;  1SD9 A;  3RPN A;  4O5U A;  1XVW A;  2KP1 A;  1K3L A;  4DSR A;  4EUY A;  1W4V A;  1ERU A;  1PD2 1;  2GT5 A;  4MA9 A;  3TB2 A;  2ON7 A;  2REM A;  2RM5 A;  2QSI A;  3VPQ A;  1T1V A;  4WKW A;  4E8H A;  3LWA A;  3SBC A;  4PGT A;  3WD6 A;  2IME A;  2GSS A;  5F0G A;  4IN0 A;  5G1L A;  1AXD A;  2PVO C;  5CP1 A;  4IJI A;  4BVX B;  4BA7 A;  3KMO A;  2YWI A;  5EL8 A;  2F8A A;  1OE7 A;  2WS2 A;  3IBH A;  2BMX A;  4ZL7 A;  3IV4 A;  1PKW A;  2TRC P;  2FA4 A;  5E59 A;  4H86 A;  3EVI A;  4EIQ A;  1XVQ A;  1XOB A;  4PUF C;  4YH2 A;  4F9Z A;  4GSN A;  4J2F A;  5HR2 A;  3KTB A;  4ISD A;  1XWA A;  1FVK A;  2B5X A;  2L4C A;  2HXK A;  4IQ1 A;  3FK8 A;  4L0U A;  4G10 A;  4OCF A;  5DJM A;  2K8S A;  2WCI A;  1EEM A;  1XWC A;  1PN9 A;  2HFD A;  3ZVJ A;  2PER A;  1X5D A;  1M2D A;  2MBT A;  3FW2 A;  1T8E B;  2GVP A;  3FHK A;  3LXZ A;  5J41 A;  2JZS A;  3DKS A;  5J9B A;  4XCS A;  1E2Y A;  2LST A;  2H30 A;  3MIX A;  1K0D A;  1GSD A;  1I9D A;  3BCK A;  2A2R A;  4NHZ A;  2PGT A;  4POB A;  3WYW A;  5ABR A;  5FT3 A;  2I4A A;  2VM1 A;  4Z2R A;  3CRU A;  4WXT A;  4WET A;  4O92 A;  4KDU A;  1YY7 A;  4YKG A;  1GNE A;  4L0W A;  1PL1 A;  2R3X A;  5H5R A;  3VWX A;  3WGE A;  2A4V A;  1BJX A;  2V1M A;  5J3R A;  19GS A;  4DVC A;  3A2V A;  3KCM A;  4O32 A;  1X5E A;  4I6X A;  5EY6 A;  3GNJ A;  1O85 A;  5J5N A;  1K3O A;  4HU9 A;  1Q98 A;  4POK A;  3H4K A;  5H5Q A;  4NWY A;  2VD0 A;  4XHM A;  3ZIJ A;  1V2A A;  2AAW A;  1ILO A;  1QXH A;  3O6T A;  5GAN D;  3LEF A;  1RK4 A;  3C8E A;  5LD0 A;  1XWB A;  10GS A;  1MD3 A;  1M7T A;  1TU8 A;  5DAK A;  1EOH A;  2F8F A;  1S3D A;  1LBK A;  4HI7 A;  3F3Q A;  2LKU A;  4OD7 A;  4XS6 A;  5IM9 A;  3GKM A;  2YZH A;  5HFI A;  2GGT A;  3IC8 A;  1V58 A;  3I69 A;  3LFL A;  2MMZ A;  3FY7 A;  1N2A A;  1T4Z A;  3GKN A;  4HZ4 A;  4GWR A;  4EKZ A;  4OFM A;  2GQK A;  2YOI A;  3D21 A;  3L78 A;  5ECP B;  3VI7 A;  3ZLP A;  1IYH A;  3FR6 A;  3W8J A;  1G6Y A;  2IFQ B;  5G5F A;  2CX3 A;  5DQS A;  3KEB A;  4FIW A;  3VUR A;  1AAZ A;  4YQM A;  2C4J A;  4PNF A;  5E4W A;  2ALB A;  1GTB A;  1F3A A;  4WR5 A;  3TDG A;  1HD2 A;  3TKS E;  3ED3 A;  5DJL A;  5GAP D;  3ME8 A;  3W8S A;  5D96 A;  4YAV A;  3A5W A;  2AV4 A;  4ILF A;  5DAL A;  4Q5R A;  2VCZ A;  3L9S A;  2B5Y A;  3K8N A;  4ZL8 A;  1B9X C;  5ELG A;  5IO0 A;  2FWE A;  2DSA A;  2DIZ A;  5ID2 B;  4ECC A;  1Z9H A;  2V6K A;  2IL3 A;  2CVD A;  3GX0 A;  1OYJ A;  1O73 A;  3M9K A;  4KND A;  3IXR A;  2C0D A;  1GP1 A;  2L59 A;  2H0H A;  2L6C A;  4BWS A;  2VCT A;  2FCH A;  2C80 A;  5J9C A;  4ZB9 A;  3JCM L;  4K0N A;  3TCO A;  3C1R A;  3UMA A;  2X64 A;  2V41 A;  3HYP A;  2NDO A;  5ECI B;  4A5P A;  4MCU A;  1TU7 A;  1WMJ A;  4V1A g;  4XTS A;  1XIY A;  1GLP A;  2MYG A;  1NW2 A;  4IW9 A;  4PQ1 A;  2L5O A;  3GRX A;  2KUC A;  1V9W A;  2YWO A;  5ENU A;  2XBI A;  5KN1 A;  2H01 A;  4AJ6 A;  2JZT A;  3DVX A;  1ST9 A;  1O7U A;  5CRG A;  2PWJ A;  1QGV A;  6GSW A;  3RBT A;  4ZIJ A;  1EWX A;  3G9B A;  5EPF A;  3GKX A;  2RM6 A;  5ECR B;  1YEP A;  1PQN A;  2WZ9 A;  2CX4 A;  3CYN A;  2KLX A;  3PH9 A;  1EGR A;  1R4W A;  2RUF A;  3MAK A;  2GDR A;  1GUM A;  2HRF A;  1GTU A;  4KDX A;  2G0F A;  1NHY A;  1F9M A;  2LRT A;  3VPT A;  2OBI A;  5HR0 A;  1T3B A;  1O6J A;  2LQO A;  4JU5 A;  1JZO A;  2HT9 A;  2JU5 A;  1K0C A;  4RUV A;  5IMA A;  1EV4 A;  1X9M B;  4MF6 A;  1KBN A;  2H66 A;  5AIX A;  1U3I A;  4F82 A;  4MAB A;  5B7C A;  4P3Y B;  5JCW A;  3HD5 A;  1F37 A;  1THX A;  1PX7 A;  3HDC A;  1GUL A;  4ZBB A;  4ML1 A;  1QUW A;  4XS4 B;  4V2M A;  4TVE A;  2PBJ A;  5ECL B;  2PMT A;  1MEK A;  3GL5 A;  3GUR A;  4O5Q A;  2LQQ A;  4N0Z A;  3W6G A;  1V57 A;  3E0U A;  4NXI A;  1SKR B;  2CT6 A;  5ECQ B;  4QL7 A;  1Z6M A;  2IMI A;  3RAZ A;  1GH2 A;  4ECJ A;  1K3Y A;  1HYU A;  3D22 A;  2FA8 A;  3N9J A;  4TW5 A;  2AHE A;  1GLQ A;  4ZB6 A;  2B6M A;  3LQ7 A;  3TKS C;  2GQL A;  3ZRE A;  3J7Y k;  4X43 A;  2B3S A;  1A2J A;  1EV9 A;  4HJ2 A;  4KE3 A;  2VL2 C;  22GS A;  5HFK A;  1FB6 A;  4FYU A;  1G7O A;  4DSS B;  5BRT A;  2JAD A;  5D8I A;  5ELA A;  1DE2 A;  4AF2 A;  3IRA A;  1GL8 A;  2XPE A;  3C7M A;  2IWT A;  2FWF A;  2IY2 A;  1SL2 B;  1B4P A;  1ZMA A;  5D73 A;  4TR1 B;  2VCW A;  1H4O A;  2OAD A;  4KAE A;  4K2D A;  4K0G A;  1XW9 A;  2IN3 A;  2RLI A;  2FWG A;  1GWC A;  5IPG A;  5HFG A;  3UVH A;  2LTK A;  1DUG A;  2C0E A;  1FO5 A;  2YAN A;  4IGJ A;  16GS A;  3CSJ A;  4MZW A;  3GA4 A;  4MH2 A;  1OC9 A;  2O87 A;  2LJR A;  3UAP A;  1J08 A;  3BBY A;  4TXO B;  2NBS A;  3TJB A;  5J4U A;  3D6I A;  4K1F A;  2K6V A;  4TOP A;  3EWL A;  4K9Z A;  2LJK A;  3C73 A;  2H8L A;  3IR4 A;  4I8B A;  5GZZ B;  4PQI A;  2VLT A;  3DVW A;  3H8Q A;  4KGI A;  2JZR A;  1PRX A;  2XHF A;  5ECS A;  2R2J A;  5HQP A;  2LRC A;  3ZTL A;  7GSS A;  5CRH A;  2X8C A;  3HHV A;  3ZFB A;  3FRC A;  3PGT A;  4X0X A;  2DJ0 A;  1FHE A;  2EIO A;  3LG6 A;  3UEM A;  3LYK A;  3QAW A;  1E6B A;  3IHQ A;  1ACV A;  4KSM A;  1O8W A;  3QR6 A;  4NV5 A;  4IP6 A;  2VOC A;  3DWV A;  4LA1 A;  3F63 A;  3M0F A;  1YQ1 A;  2H6Y A;  2I3Y A;  5JWO B;  1FOH A;  3KXO A;  2YJ7 A;  2HRA A;  17GS A;  5IQY A;  4FYB A;  1F6M C;  2PUK C;  1Z3E A;  4I2U A;  3F6D A;  5DAK B;  1PSQ A;  4HDE A;  3TJF A;  5AGY A;  1UVZ A;  4TR3 A;  1X5C A;  3FZ4 A;  5HR3 A;  2IMF A;  4JRR A;  1XCC A;  4MK3 A;  3R2Q A;  5COH A;  1MD4 A;  3V1W A;  3KJY A;  4PQH A;  5B6M A;  3D0Z A;  3MSZ A;  3TOT A;  2K8V A;  1A0R P;  1VF2 A;  3UJ1 A;  2A2S A;  5A5K A;  3RDW A;  1XZO A;  4MDC A;  1OKD A;  5ECN B;  3MWH A;  1FOV A;  1W89 A;  2B5E A;  3RHC A;  3S9F A;  3GST A;  1B4Q A;  2C8U A;  3N5O A;  2D2Z A;  4POM A;  4WF5 A;  2RUE A;  3HY2 A;  1S3A A;  4BVY A;  1MDJ A;  3HA9 A;  4KUN A;  4Z2U A;  4RQR A;  3APS A;  4KB3 A;  2H75 A;  2GZY A;  2LRN A;  4HJM A;  5CYY A;  2N5A A;  2WUL A;  1WOU A;  1TRV A;  4LMV A;  2IYJ A;  4JBB A;  4K7N A;  2P0G A;  5JCU A;  4ID0 A;  4MJB A;  1TK0 B;  3HZ8 A;  3WGD A;  3UAR A;  2MMN A;  3TUE A;  3VFI A;  2TIR A;  2WDU A;  3C71 A;  2CVK A;  3UIW A;  2FHE A;  4MNN A;  5DBQ A;  2CV4 A;  3L9V A;  2H74 A;  4IKH A;  4JZQ A;  1M9A A;  2V2G A;  1EP8 A;  1SEN A;  1FVJ A;  3FMW A;  3LYP A;  3Q19 A;  2QC7 A;  1PKZ A;  3F4S A;  2H76 A;  3U5R E;  1VRS D;  1TOF A;  5D9V A;  2NTO A;  4IP1 A;  4X1U A;  4NHW A;  1EEJ A;  3IPZ A;  1R5P A;  1BED A;  3KGK A;  5BMU A;  5KN2 A;  4Z7X A;  3MDK A;  1B48 A;  4GRF A;  2N5F A;  3ZVJ D;  4IHU A;  5CNW A;  3GTU A;  2B7K A;  3E3E A;  5D9X A;  4G19 A;  3EPT A;  4MH3 A;  3LSZ A;  2JSZ A;  3KH7 A;  1ZCP A;  1AQW A;  4K6X A;  2HYX A;  3FYG A;  4OCE A;  2DJ2 A;  3WGX A;  2MMA A;  3US3 A;  1F3B A;  2XPD A;  1UA5 A;  4HS1 A;  3H1N A;  3HXS A;  4OMV A;  2O85 A;  1V40 A;  1XPV A;  4G2E A;  4BVX A;  1XFL A;  1XW6 A;  1I5G A;  4DEJ A;  5A4V A;  3ZZX A;  4GQF A;  3HVV A;  4EVM A;  2F51 A;  3BOA A;  3F6F A;  5A4W A;  1G0T A;  2DBC A;  2KOK A;  2C0G A;  2VL9 A;  3A5I A;  1YJ6 A;  3BD2 A;  5ECH B;  2HZE B;  2DJ3 A;  4EIP A;  2CVB A;  4KX4 A;  4I2T A;  3MYD A;  3IOS A;  4WR4 A;  2CAQ A;  2OJL A;  1XW5 A;  3HJM A;  3HZ4 A;  4K8M A;  3G7J A;  2AJQ B;  3FR9 A;  4MMM A;  3UBK A;  3IAM 2;  4TN8 A;  2HZF A;  4MF7 A;  2AYT A;  5KN3 A;  1HNA A;  4E8E A;  4EDZ A;  4NAX A;  2O89 A;  2FWH A;  3A3T A;  3UL3 A;  5IMF A;  1F2E A;  1A24 A;  3QPM A;  1G7E A;  6GSU A;  4YAP A;  1JZD A;  1Y25 A;  2LJA A;  3LJR A;  2HSM A;  2DJK A;  2GSR A;  4JR4 A;  2HSY A;  3UBL A;  4IS0 A;  4BL7 A;  6GSY A;  4TRX A;  3TRP A;  2H71 A;  4KA0 A;  5CRD A;  4PUR A;  2GLR A;  1M99 A;  3VLN A;  1USB A;  4PUA A;  1AUC A;  2VO4 A;  1U6T A;  4V2N A;  2E7P A;  2XBQ A;  3P2A A;  3KMN A;  4EXJ A;  1S3C A;  1SJZ A;  4YQV A;  2P5R A;  1XOA A;  1ZYE A;  5C00 A;  5EVO A;  2GTU A;  1G6W A;  4YQU A;  2YV7 A;  2VCX A;  3L0H A;  4AJ7 A;  1QMV A;  4WEY A;  1O81 A;  4MJA A;  5AIS A;  3VI5 A;  2VCQ A;  5HR1 A;  3GV1 A;  3LOR A;  5IMZ A;  2VM2 A;  5B6N A;  2JSY A;  4I97 A;  2IPA A;  1TRW A;  4OWY A;  1WIK A;  3TRQ A;  1TK5 B;  5FWG A;  2UZ8 A;  4TR0 A;  2FUG 2;  3EU3 A;  1GSY A;  2H19 A;  1OKT A;  1R26 A;  3EMX A;  1Z7P A;  1RW1 A;  4FO5 A;  4AGS A;  2M72 A;  1ZZY A;  4NPB A;  4GCI A;  1GSE A;  4LMW A;  2RII A;  1A2L A;  2IFQ A;  4RQX A;  3NOF A;  4GQC A;  3DIE A;  3LW9 A;  2PU9 C;  1MTC A;  1K0N A;  2GST A;  4N0V A;  12GS A;  5A4U A;  2YNX A;  2A2P A;  3G7I A;  5F07 A;  1K0A A;  3F9U A;  1YKC A;  3TKS A;  1Z7R A;  1HNC A;  3BCI A;  2BJX A;  4AJ8 A;  3QDN A;  4ZIL A;  1SU9 A;  5IIZ A;  2VL2 A;  3DRN A;  3TGZ A;  3LXT A;  3F3R A;  4ZL9 A;  3EC3 A;  4Q5Q A;  4ACS A;  3ZYW A;  2ZUP A;  3ZIT A;  4G0L A;  1U3A A;  3C1S A;  3M3M A;  4KSO A;  2QA1 A;  3GSS A;  5ID2 A;  3KP8 A;  3IK9 A;  1YEX A;  3HVX A;  5ECK B;  3L4N A;  4L8E A;  2H0G A;  4MPF A;  3QAV A;  3OR5 A;  2WB9 A;  3IA1 A;  3PPU A;  2FLS A;  3EYT A;  4LL4 B;  3QMX A;  1T7P B;  3HVS A;  3I9V 2;  2H6Z A;  2LNT A;  4MPG A;  1X0R A;  1MDI A;  2E2G A;  1RQM A;  3F0I A;  5AIV A;  1VF4 A;  2NVL A;  4CY8 A;  5KOX A;  2YZU A;  1U88 A;  2YPM A;  4WF4 A;  2FNO A;  1VF1 A;  3ZL5 A;  1PA3 A;  3PR8 A;  1JHB A;  2H73 A;  2R5G A;  4ZBD A;  2DJ1 A;  3TJJ A;  5D9T A;  2ON5 A;  2H0I A;  3WT1 A;  8GSS A;  4FH8 A;  4KH7 A;  1BQ7 A;  3ZML A;  1BAY A;  3QD9 A;  2DKH A;  2R0G A;  2HNL A;  6GSV A;  4Q5N A;  2X4A A;  1TI3 A;  2HSH A;  1ERW A;  5KEJ A;  2YP6 A;  1EGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...